2EGDA

Crystal structure of human s100a13 in the ca2+-bound state
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
86
structure length
86
Chain Sequence
PLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A13
publication title Crystal structure of human S100A13 in the Ca2+-bound state
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 28
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2egdA00
1M31A 3CWGA 1V1FA 2KFFA 2M1KB 2FCDA 1GGZA 5JJGA 2F3YA 2JU0A 2M1UA 1WLMA 3AAJA 2KAVA 3JVTC 2JTTA 2Y5IA 3TDIA 4AQJA 1QVIZ 2PASA 4CFQA 4E68A 1G4YR 4MSPA 1DJXA 1SCMC 1QIWA 1R6PA 3GK1A 4ORCB 4N5XA 2LE9B 1JF0A 1OE9B 1CLMA 2VRGA 3TUYC 3OB2B 1S26D 4PE1A 5G08A 2FOTA 3IF7A 2SCPA 1NCXA 1IQ3A 1M39A 4C0LA 1YR5A 2M7NA 4DCKA 1KWOC 4GPLB 4MZLA 2JULA 2TN4A 1IRJA 1B47A 1L2OC 1TCOB 1FPWA 2KGRA 1AP4A 1XFYO 4IL1A 1KK8B 2Q91A 4QJ4B 4XJKB 1IWQA 1CM1A 3PSRA 3LLEA 1JUOA 1S6JA 3I5HC 1SR6C 1JBAA 3EVUA 2LC5A 1KK7Z 4L9MA 3TDUA 4PE7A 3MSEB 5TNCA 1QJTA 3BUNB 1JF2A 3OP0A 4BY4A 4N1GA 1CMFA 1SBJA 4AQIA 4DIRA 4ZCUA 4JWQA 2AMIA 1CB1A 1XK4C 3FWCA 3RLZA 1NX2A 2WCBA 2ZRSA 2I7AA 1K9KA 1SY9A 2LP3A 1TN4A 1R2UA 2GGZA 4DS7A 5CSJA 1C7WA 1RFJA 2JT3A 2EC6B 1DMOA 1Q80A 1FI5A 1F4OA 2V53A 3TUYB 3BOWA 3OX5A 2KQYA 3TS5C 1N0YA 3O2PA 1TNWA 2ZNEA 1H4BA 3IQQA 1XFWO 1KWOB 1NYAA 4NDCA 2LMTA 1S6IA 2K0JA 2SASA 2WCFA 1AUIB 2JTZA 4JPZB 3D0YB 1YUTA 3DVKA 3EVRA 4HSZA 3TZ1A 1KSOA 1KQMB 1IG5A 4YGEB 1PVBA 2DOQA 1NCYA 3FIAA 5B8IB 1M63B 1XO5A 2LUXA 1YTZC 1OZOA 1W7JB 1DJGA 1B7TY 5HLOA 4YI9A 1IQ5A 1YVLA 2BCBA 4NDBA 2BBNA 1GJYA 2JZIA 1YVHA 1J7QA 1KCYA 2MBXA 1MXEA 2KOTA 3DF0A 4D1EA 3JTDC 2M97A 1S6CA 1CLLA 3PATA 3WHUB 1JWDA 2I94A 1DT7B 2LM5A 1UP5A 2M3WA 1K96A 4PHJA 4JQ0D 2LMVA 4YRUA 2OTGC 1RECA 4MZJA 5I2LA 1MHOA 3DVJA 4R1EA 5D69A 2BBMA 2WNDA 1LA0A 2BCXA 1WRZA 4PHNA 2ZNDA 4WRIA 3AKAA 1J7OA 2LV7A 3EKJA 2H61A 5HKZA 1CFDA 1ZUZA 5ER5A 3I5GC 4YGDB 4NDDA 1SL8A 1XFVO 1SNLA 2L50A 2O5GA 4HRHA 1OZSA 2COLB 2M0RA 1G8IA 1U5IB 2CNPA 1SRAA 5AEQA 3PN7B 1J1DA 4GNKB 4GGFA 2NLNA 2LHIA 1TIZA 1QATA 3HCMA 4DUQA 3NSKA 4QJ5B 1BLQA 1B8RA 1NX1A 1YURA 2OS8B 3GK2A 5D7FA 2L4IA 2BCAA 1ZOTB 2ZN8A 5DKQA 1K9UA 2KYCA 2HF5A 1A2XA 2PSRA 1S5GY 3CGAA 3SIBA 3K21A 1CDMA 2NCPA 3CR5X 3ZNIA 2KI4C 3LK1A 1WRKA 2F2PA 1TCFA 1JFKA 4MN0A 3A4UB 4NQGA 2L4HA 1MR8A 1XA5A 4OV2A 1ODBA 1XFUO 2JC2A 4PCWA 1A75B 1Y1UA 2E6WA 2LLSA 1L7ZA 1NWDA 3E3RA 1XVJA 1TRFA 1DJWA 1K9PA 4C0KA 3I5IB 3EK8A 3EKHA 5DKRA 3FS7A 4WQ2A 2JXLA 2K61A 4PALA 5AFPA 4BY5A 2LVVA 5FYXA 1A03A 2BL0B 2JT8A 3BUWB 2HQ8A 3FWBA 1DVIA 2LANA 1YUUA 3I5FC 4C0JA 1BU3A 4P5OE 3DVMA 2QACA 3JVTB 3KEVA 1EL4A 1XFZO 1LXFC 1F70A 4M2OA 2MAZA 1LA3A 1GQMA 1SCMB 2CBLA 2KHNA 1WDCC 1CDNA 2MJWB 3LL8B 2L98A 2F33A 2G9BA 3QRXA 1OMRA 1UUSA 2I2RE 1PK0D 1PULA 1QLKA 1RROA 2KFHA 2Y1MA 2NCOA 2JXCA 1IH0A 3CTNA 1SYMA 2HETA 3BYAA 1CFPA 2B1UA 1E8AA 3VGOA 1L2OB 2ZN9A 3CZTX 1QV0A 2BECA 1NCZA 2GV5A 2KSPA 1OMDA 1BR4B 1J1EA 5AXIA 1NSHA 1TNPA 3D0YA 4ETOA 2L5XB 1UURA 5AANA 1TNQA 3I5HB 1KQVA 1SR6B 1ALWA 2AUCA 1F71A 3RM1A 5KTYA 2PALA 1EG3A 3EK7A 2AAOA 2PVBA 1GGWA 1W7IB 1SK6D 2A4JA 2GGMA 2O60A 2K2AA 2BKHB 3O4YA 1FF1A 3A8RA 1J7PA 2ZKMX 4USLA 1YUSA 1CMGA 2KDHA 1MQ1A 1QX7A 4Q04A 4OCIA 4CFRA 2H61C 1K95A 2EGDA 4A4CA 1SW8A 1F8HA 1CTRA 1QS7A 1SMGA 1C7VA 2BE6A 2NXQA 1Y0VH 3H4SE 3AKBA 3CS1A 3ZWHA 1S36A 2LVIA 2Y1NA 1EJ3A 3TS5B 1SL9A 1FI6A 3NSIA 3AAKA 1M46A 2M7LA 1TOPA 2E30A 2MHHA 1SCVA 1OOJA 5I2OA 2MA2A 4GGFC 1TTXA 5HKWA 1QTXA 3DVEA 3O78A 2H2KA 3DF0B 3PFVA 1KFUL 2M8UA 1LVCD 1PSRA 1XFXO 2KAYA 1JC2A 3CR2A 4GUKA 2F3ZA 4CLNA 5CSIA 1NUBA 2KYFA 5CPVA 1B7TZ 1D1OA 1HQVA 4PDZA 1QLSA 4ORAB 3WNXB 5IBWA 1H8BA 2RGIA 1DF0A 3SIAA 4HRGA 3BQ3A 2BE4A 1G33A 1VRKA 1YRUB 3EK4A 1OMVA 1SKTA 1U5IA 1DJZA 5JOLA 1FW4A 4TNCA 1DGVA 1PSBA 1QV1A 1QVIY 2OPOA 2L2EA 3JTDB 3VRPA 2KI6C 1JFJA 1KFUS 1RTP1 1UHNA 2JPTA 2ZFDA 4I5LB 4PE0A 5BPJA 1Y1XA 3SJSA 4MLWA 2KNEA 1RK9A 4MBEA 3KPXA 1UHHA 4U8DA 2OTGB 2KQ6A 1F54A 1CDPA 3GOFA 1KK8C 2NZ0A 1KSMA 2CT9A 3D10A 4PHMA 1BR1B 2LLUA 2Y4QA 1YRTB 2FCEA 1B8LA 4M2QA 2FJUB 3I5GB 1A75A 2WCEA 4CPVA 1IJ5A 4GFTA 1F4QA 3VRNA 3WXAA 1K90D 2CCMA 1KK7Y 3NSLA 1NX3A 1BT6A 1K94A 1WY9A 3BUMB 1J55A 4YGAA 2WC8A 5KU1A 1S5GZ 4XJKA 2L0PA 5J3XA 1CDLA 3ICBA 1MUXA 2EC6C 5CSNA 3SG5A 2CTNA 2K7BA 1RWYA 2LHLA 3SG7A 1PRWA 1KFXL 3VRQA 1CFFA 1AVSA 4GBAA 3SG3A 2KI4B 1AHRA 1CM4A 2KGBC 2KI6D 2JWWA 2L51A 3WHTB 2R2IA 1BF5A 1B9AA 4YBHB 2JOJA 1AK8A 1JSAA 1X02A 1S1EA 2M9GA 1EXRA 3GK4X 1NP8A 3IQOA 2M29A 3F45A 2IS9A 2PRUA 1F55A 1LINA 2HQWA 1KQMC 1QASA 1SPYA 4MRXA 2KFGA 4HREE 1UHIA 1Y6WA 1B1GA 1YX8A 4M2PA 1UWOA 1MXLC 2K7OA 1Y1AA 2LNKA 4OR9B 5GQQC 3DD4A 4QJ3B 1RJVA 1J7RA 4P2YB 1DJHA 1PALA 5KSZA 1KFXS 3VRRA 5HKYA 1ZACA 1PVAA 5AERA 4FQOA 3OX6A 1K2HA 1S3PA 2LVJA 5CSFA 3OHMB 1ZFSA 1DGUA 1BG1A 2JNXA 2M49B 1TNXA 3BOWB 4WQ3A 3KHEA 2QPTA 2KAXA 4N1FA 4OVNF 1NIWA 4XYNA 5DKNA 2LLTA 3I5FB 1DJIA 4MVFA 1CNPA 1WLZA 2LAPA 3LCPC 1XK4A 1BJFA 2MLFC 1WDCB 1CFCA 1A4PA 2F2OA 1DTLA 1IGVA 3PM8A 3SG4A 1K8UA 5HLVA 2I18A 4YGCB 3PLFB 2LMUA 3LK0A 4UPGA 4MEWA 5ER4X 1QX5B 1N2DA 3KO0A 4FTGA 4AOMA 1A29A 2EHBA 2JNFA 1V1GA 2CXJA 1C07A 3HX4A 1ALVA 1CLBA 3PN7C 1BODA 4I5JA 2G2BA 2KBMA 1OQPA 3VROA 2OS8C 2PMYA 2Q4UA 3OB1B 1MWNA 2K8MB 2F8PA 1N65A 4GAOA 2ISDA 1LKJA 2WORA 4ORBB 4CIDA 5HYDA 3NSOA 1BMOA 3O6BA 1YX7A 1B4CA 1EG4A 4ICBA 1DJYA 3CLNA 1CKKA 3BXKA 2K7DA 2ZRTA 2JT0A 3BUXB 1QIVA 3EVVA 3BUOB 5K89A 1OSAA 1QXPA 3PALA 3SG2A 2LUCA 4A4BA 5I2QA 2MLEC 3SG6A 1UHJA 2KBIA 2LVKA 2MRDA 4I5NB 4PHKA 4I5KA 1UHKA 1NX0A 1NPQA 2D8NA 4MRYA 5I8NA 1QX2A 1DF0B 1K93D 1EH2A 3KF9A 1IJ6A 1AJ5A 5F6TA 1HT9A 3NXAA 4YGBB 4MZKA 4YI8A 4OKHA 3C1VA 1SL7A 3CR4X 3TDZA 1IKUA 3I5IC 1M45A 1WRLA 3M0WA 4GGNA 4F0ZB 1BOCA 1MF8B 2BKIB 5PALA 1AJ4A 2LP2A 4PE4A 1FBVA 2P6BB 2BL0C 4ZCVA 2HPSA 2LCPA 1ZMZA 1B8CA 2JQ6A 1XYDA 2K7CA 2JRFA 4DRWA 2WOSA 2K2FA
chains in the Genus database with same CATH superfamily
2L2CA 1M31A 3CWGA 3D75A 1V1FA 2KFFA 2M1KB 2FCDA 1GGZA 5JJGA 2F3YA 2JU0A 4KYNA 2M1UA 1WLMA 3AAJA 2KAVA 3JVTC 2JTTA 2Y5IA 3TDIA 4AQJA 1QVIZ 2PASA 4CFQA 4E68A 1G4YR 4MSPA 1DJXA 1SCMC 1QIWA 3CABA 1R6PA 3GK1A 4ORCB 4N5XA 2LE9B 1JF0A 1OE9B 1CLMA 2VRGA 3TUYC 1IIOA 3OB2B 1S26D 4PE1A 5G08A 2FOTA 3DYEA 3IF7A 2SCPA 1NCXA 1IQ3A 1M39A 4C0LA 1YR5A 2M7NA 4DCKA 1KWOC 4GPLB 4MZLA 2JULA 2TN4A 1IRJA 1B47A 1L2OC 1TCOB 1FPWA 2KGRA 1AP4A 1P28A 1XFYO 4IL1A 1KK8B 2Q91A 4QJ4B 1OW4A 1IWQA 1CM1A 3PSRA 4XJKB 3B86A 3LLEA 1JUOA 1S6JA 3I5HC 1SR6C 1JBAA 3EVUA 2LC5A 1DC1A 1KK7Z 4L9MA 3TDUA 4PE7A 3MSEB 5TNCA 1QJTA 3BUNB 1JF2A 3OP0A 4BY4A 4N1GA 1CMFA 1SBJA 4AQIA 4DIRA 1C3YA 4ZCUA 4JWQA 2AMIA 1CB1A 1XK4C 3FWCA 3RLZA 1OOFA 1NX2A 2WCBA 2ZRSA 2I7AA 1K9KA 1SY9A 3CYZA 2LP3A 1TN4A 3BFBA 1DEKA 1R2UA 2GGZA 4DS7A 5CSJA 1C7WA 1RFJA 2JT3A 2EC6B 5I94A 1Q80A 2QEOA 1DMOA 1FI5A 1F4OA 2V53A 3TUYB 3BOWA 3OX5A 2KQYA 3TS5C 1N0YA 3O2PA 1TNWA 2ZNEA 1H4BA 3IQQA 1XFWO 1KWOB 1NYAA 4NDCA 2LMTA 1S6IA 2K0JA 2SASA 2WCFA 3SS4A 1AUIB 2JTZA 4JPZB 3D0YB 1YUTA 3DVKA 3EVRA 4HSZA 3TZ1A 1KSOA 3BJHA 3FE9A 1QWVA 1KQMB 1JSAA 3D73A 1IG5A 4YGEB 1Z4HA 2QEHA 3OBVA 1PVBA 2DOQA 1NCYA 3FIAA 5B8IB 1M63B 1XO5A 3R1PA 2LUXA 1YTZC 1OZOA 1W7JB 1DJGA 1B7TY 3O4XA 5HLOA 4YI9A 1IQ5A 4JKTA 1YVLA 2BCBA 4NDBA 2BBNA 1GJYA 2JZIA 1YVHA 1J7QA 1KCYA 2MBXA 1MXEA 2ERBA 2KOTA 3DF0A 4D1EA 2YGUA 3JTDC 3NGVA 1TWOA 2M97A 1S6CA 1CLLA 3PATA 3WHUB 1JWDA 2I94A 1DT7B 1OOGA 2LM5A 1UP5A 2M3WA 2BAPA 1K96A 4PHJA 2KLEA 3PJIA 4JQ0D 2LMVA 4YRUA 2OTGC 1RECA 4MZJA 5I2LA 1MHOA 3DVJA 4R1EA 5D69A 2BBMA 2WNDA 1LA0A 2BCXA 1WRZA 1DELA 2ZNDA 4PHNA 4WRIA 3AKAA 1J7OA 2LV7A 3EKJA 3S0BA 2H61A 5HKZA 1CFDA 3D74A 1ZUZA 3K1EA 5ER5A 3S0AA 3I5GC 4YGDB 4NDDA 1SL8A 1XFVO 3DXLA 1SNLA 2L50A 2O5GA 4HRHA 1OZSA 2COLB 2M0RA 1G8IA 1U5IB 2CNPA 1SRAA 5AEQA 3PN7B 1J1DA 4GNKB 3Q8IA 2NLNA 2LHIA 1TIZA 1QATA 3HCMA 4GGFA 3NSKA 4DUQA 4QJ5B 4IJ7A 1B8RA 1NX1A 1YURA 2OS8B 2H8VA 3GK2A 2L4IA 2BCAA 1ZOTB 2ZN8A 5D7FA 1K9UA 5DKQA 2KYCA 2HF5A 1A2XA 2PSRA 1S5GY 3CGAA 3SIBA 3K21A 1CDMA 2NCPA 3CR5X 3ZNIA 3NHTA 2KI4C 3LK1A 1TUJA 1WRKA 2F2PA 1TCFA 1JFKA 2GTEA 4MN0A 3A4UB 3D77A 4NQGA 2L4HA 1MR8A 1XA5A 3NHIA 1ODBA 4OV2A 1XFUO 5HL1A 2JC2A 4PCWA 1A75B 1Y1UA 2E6WA 2LLSA 1L7ZA 2PQLA 3DY9A 1NWDA 3E3RA 1XVJA 1TRFA 1DJWA 1K9PA 2JPOA 3R1VA 4C0KA 3I5IB 3EK8A 3EKHA 5DKRA 3FS7A 4WQ2A 2JXLA 2K61A 4PALA 1SSEB 4BY5A 2LVVA 5AFPA 5FYXA 1A03A 2BL0B 2JT8A 3BUWB 2HQ8A 3FWBA 2WCHA 1DVIA 2LANA 1YUUA 3I5FC 4C0JA 5FI7A 1BU3A 4P5OE 3FE6A 3DVMA 2QACA 3JVTB 3KEVA 1EL4A 1XFZO 1LXFC 1F70A 4M2OA 2MAZA 1LA3A 1GQMA 1SCMB 2CBLA 2KHNA 1WDCC 1CDNA 2MJWB 3LL8B 2L98A 3FE8A 2F33A 2G9BA 3QRXA 1OMRA 1UUSA 2I2RE 1PK0D 1PULA 1W9ZA 1QLKA 1RROA 2KFHA 2Y1MA 2NCOA 2JXCA 1IH0A 1ORGA 3CTNA 1SYMA 2HETA 3BYAA 1CFPA 2B1UA 3L47A 1E8AA 3VGOA 1L2OB 2ZN9A 3CZTX 1QV0A 2BECA 2WCKA 1NCZA 2GV5A 2KSPA 3D78A 1OMDA 1BR4B 1J1EA 5AXIA 1NSHA 1TNPA 3D0YA 4ETOA 2L5XB 1UURA 2QEVA 5AANA 1TNQA 3I5HB 1KQVA 1SR6B 1ALWA 2AUCA 3IVTA 1F71A 3RM1A 5KTYA 2PALA 1EG3A 3EK7A 2AAOA 2PVBA 4INXA 1W7IB 1GGWA 1SK6D 2A4JA 3B7AA 2GGMA 2O60A 3L4AA 2K2AA 2BKHB 3O4YA 3UNWA 1FF1A 3A8RA 1J7PA 2ZKMX 4USLA 1YUSA 1CMGA 2KDHA 1MQ1A 1QX7A 4Q04A 4OCIA 1DQEA 4CFRA 2H61C 5EL2A 1K95A 2EGDA 4A4CA 1SW8A 1F8HA 1CTRA 1QS7A 1SMGA 1C7VA 2BE6A 3EG5B 2NXQA 1Y0VH 3H4SE 3AKBA 3CS1A 3ZWHA 1S36A 2LVIA 2Y1NA 1EJ3A 2K60A 3TS5B 1SL9A 3CZ2A 3NSIA 3AAKA 1M46A 2M7LA 1TOPA 1FI6A 2E30A 2MHHA 1SCVA 1OOJA 5I2OA 2MA2A 4GGFC 1TTXA 5HKWA 1QTXA 3DVEA 3O78A 2H2KA 3DF0B 3PFVA 3L4LA 1KFUL 2M8UA 1LVCD 1PSRA 1XFXO 2KAYA 2WCMA 1JC2A 3CR2A 4GUKA 2F3ZA 4CLNA 5CSIA 1NUBA 2KYFA 5CPVA 1B7TZ 1D1OA 1HQVA 4PDZA 1QLSA 4ORAB 3WNXB 5IBWA 1H8BA 2RGIA 1DF0A 3SIAA 4HRGA 3BQ3A 2BE4A 1G33A 1VRKA 1YRUB 3EK4A 1OMVA 1SKTA 1C3ZA 1U5IA 1DJZA 5JOLA 1FW4A 4TNCA 1DGVA 1PSBA 1QV1A 3UO9A 3B87A 1QVIY 3R1OA 2OPOA 2L2EA 3JTDB 3VRPA 2KI6C 1JFJA 1KFUS 1RTP1 5DICA 1UHNA 2JPTA 3BFAA 2ZFDA 4I5LB 4PE0A 5BPJA 1Y1XA 3SJSA 4MLWA 2KNEA 1RK9A 4MBEA 2WC5A 3KPXA 1UHHA 4U8DA 2OTGB 4F7FA 2KQ6A 1F54A 1CDPA 3GOFA 1KK8C 4PT1A 2NZ0A 1KSMA 2CT9A 3D10A 4PHMA 1BR1B 2LLUA 2Y4QA 1YRTB 2FCEA 1B8LA 4M2QA 2FJUB 3I5GB 1A75A 2WCEA 4CPVA 1LS8A 1IJ5A 4GFTA 1F4QA 3VRNA 3WXAA 1K90D 2CCMA 1KK7Y 3NSLA 5FI6A 1NX3A 1BT6A 1K94A 1WY9A 2WCLA 1J55A 3B88A 3BUMB 2QDIA 4YGAA 3V2LA 3D76A 4FQTA 1XFRA 2WC8A 5KU1A 1S5GZ 4XJKA 2L0PA 5J3XA 1CDLA 4OZDA 3ICBA 1MUXA 2EC6C 5CSNA 3SG5A 2CTNA 2K7BA 1RWYA 2LHLA 3SG7A 1PRWA 1KFXL 3VRQA 2QEBA 3S0FA 1CFFA 1AVSA 4GBAA 5D3OA 3SG3A 2KI4B 1AHRA 1CM4A 2KGBC 2KI6D 2JWWA 2L51A 3S0EA 2R2IA 3WHTB 1B9AA 3QMEA 2JOJA 4YBHB 2P70A 1BF5A 1OOHA 1X02A 1S1EA 4JD9A 3RZSA 2M9GA 1EXRA 3GK4X 1BLQA 1NP8A 3IQOA 2M29A 3F45A 2IS9A 2PRUA 1F55A 1LINA 2HQWA 1KQMC 1QASA 1SPYA 4MRXA 2KFGA 4HREE 1UHIA 3CZ0A 1Y6WA 2BNXA 1B1GA 1YX8A 4M2PA 1UWOA 1MXLC 2K7OA 1Y1AA 2L5YA 2LNKA 2WC6A 4OR9B 5GQQC 3SS3A 3DD4A 4QJ3B 1RJVA 1J7RA 4P2YB 1DJHA 1PALA 5KSZA 1KFXS 3VRRA 5HKYA 1ZACA 1PVAA 5AERA 4FQOA 3OX6A 1K2HA 1S3PA 2LVJA 5CSFA 3OHMB 1ZFSA 1DGUA 1BG1A 2JNXA 2M49B 1TNXA 3BOWB 4WQ3A 3KHEA 2QPTA 2KAXA 1GM0A 4N1FA 2P71A 4OVNF 1NIWA 4XYNA 5DKNA 2FJYA 2LLTA 3I5FB 1DJIA 3R72A 4MVFA 3B6XA 1CNPA 1WLZA 3S0DA 4INWA 2LAPA 3LCPC 1XK4A 1BJFA 2MLFC 1WDCB 3VB1A 1CFCA 1A4PA 2F2OA 3DZTA 1DTLA 3N7HA 1IGVA 2KLDA 3PM8A 1K8UA 3SG4A 1Z2CB 5HLVA 2I18A 4YGCB 3PLFB 2LMUA 3LK0A 4UPGA 4MEWA 5ER4X 1QX5B 1N2DA 3KO0A 4FTGA 4AOMA 3OGNA 1A29A 3S0GA 2EHBA 2JNFA 1V1GA 2CXJA 1C07A 3HX4A 1ALVA 1CLBA 3PN7C 1BODA 4I5JA 3PM2A 2G2BA 2KBMA 1OQPA 3VROA 2OS8C 2PMYA 2Q4UA 3OB1B 3BFHA 1MWNA 2K8MB 2F8PA 1N65A 4GAOA 2ISDA 1LKJA 1TUZA 2WORA 4ORBB 4CIDA 5HYDA 3NSOA 1BMOA 3O6BA 1YX7A 1B4CA 1EG4A 3CZ1A 4ICBA 1DJYA 3CLNA 1CKKA 3BXKA 2K7DA 2ZRTA 3CDNA 2JT0A 3BUXB 1QIVA 2PYQA 1OOIX 3EVVA 3BUOB 5K89A 1T14A 1OSAA 1QXPA 3PALA 3SG2A 2LUCA 4A4BA 5I2QA 2MLEC 3SG6A 1UHJA 2KBIA 2LVKA 2MRDA 4I5NB 2KPHA 4PHKA 4I5KA 1UHKA 1NX0A 1NPQA 2D8NA 4MRYA 5I8NA 1QX2A 1DF0B 1K93D 1EH2A 3KF9A 1IJ6A 1AJ5A 5F6TA 1HT9A 3NXAA 4YGBB 4MZKA 2WCJA 4YI8A 4OKHA 3C1VA 5FI2A 1SL7A 3CR4X 3TDZA 1IKUA 3I5IC 1M45A 1WRLA 3M0WA 4GGNA 4F0ZB 1BOCA 1MF8B 3SS5A 1AK8A 2BKIB 5PALA 1AJ4A 2LP2A 4PE4A 1FBVA 2P6BB 2BL0C 4ZCVA 2HPSA 2LCPA 1ZMZA 1B8CA 2JQ6A 1XYDA 2K7CA 2JRFA 4DRWA 2WOSA 2K2FA
chains in the Genus database with same CATH topology
1M31A 3CWGA 1V1FA 2KFFA 2M1KB 2FCDA 1GGZA 5JJGA 2F3YA 2JU0A 2M1UA 1WLMA 3AAJA 2KAVA 3JVTC 2JTTA 2Y5IA 3TDIA 4AQJA 1QVIZ 2PASA 4CFQA 4E68A 1G4YR 4MSPA 1DJXA 1SCMC 1QIWA 1R6PA 3GK1A 4ORCB 4N5XA 2LE9B 1JF0A 1OE9B 1CLMA 2VRGA 3TUYC 3OB2B 1S26D 4PE1A 5G08A 2FOTA 3IF7A 2SCPA 1NCXA 1IQ3A 1M39A 4C0LA 1YR5A 2M7NA 4DCKA 1KWOC 4GPLB 4MZLA 2JULA 2TN4A 1IRJA 1B47A 1L2OC 1TCOB 1FPWA 2KGRA 1AP4A 1XFYO 4IL1A 1KK8B 2Q91A 4QJ4B 4XJKB 1IWQA 1CM1A 3PSRA 3LLEA 1JUOA 1S6JA 3I5HC 1SR6C 1JBAA 3EVUA 2LC5A 1KK7Z 4L9MA 3TDUA 4PE7A 3MSEB 5TNCA 1QJTA 3BUNB 1JF2A 3OP0A 4BY4A 4N1GA 1CMFA 1SBJA 4AQIA 4DIRA 4ZCUA 4JWQA 2AMIA 1CB1A 1XK4C 3FWCA 3RLZA 1NX2A 2WCBA 2ZRSA 2I7AA 1K9KA 1SY9A 2LP3A 1TN4A 1R2UA 2GGZA 4DS7A 5CSJA 1C7WA 1RFJA 2JT3A 2EC6B 1DMOA 1Q80A 1FI5A 1F4OA 2V53A 3TUYB 3BOWA 3OX5A 2KQYA 3TS5C 1N0YA 3O2PA 1TNWA 2ZNEA 1H4BA 3IQQA 1XFWO 1KWOB 1NYAA 4NDCA 2LMTA 1S6IA 2K0JA 2SASA 2WCFA 1AUIB 2JTZA 4JPZB 3D0YB 1YUTA 3DVKA 3EVRA 4HSZA 3TZ1A 1KSOA 1KQMB 1IG5A 4YGEB 1PVBA 2DOQA 1NCYA 3FIAA 5B8IB 1M63B 1XO5A 2LUXA 1YTZC 1OZOA 1W7JB 1DJGA 1B7TY 5HLOA 4YI9A 1IQ5A 1YVLA 2BCBA 4NDBA 2BBNA 1GJYA 2JZIA 1YVHA 1J7QA 1KCYA 2MBXA 1MXEA 2KOTA 3DF0A 4D1EA 3JTDC 2M97A 1S6CA 1CLLA 3PATA 3WHUB 1JWDA 2I94A 1DT7B 2LM5A 1UP5A 2M3WA 1K96A 4PHJA 4JQ0D 2LMVA 4YRUA 2OTGC 1RECA 4MZJA 5I2LA 1MHOA 3DVJA 4R1EA 5D69A 2BBMA 2WNDA 1LA0A 2BCXA 1WRZA 4PHNA 2ZNDA 4WRIA 3AKAA 1J7OA 2LV7A 3EKJA 2H61A 5HKZA 1CFDA 1ZUZA 5ER5A 3I5GC 4YGDB 4NDDA 1SL8A 1XFVO 1SNLA 2L50A 2O5GA 4HRHA 1OZSA 2COLB 2M0RA 1G8IA 1U5IB 2CNPA 1SRAA 5AEQA 3PN7B 1J1DA 4GNKB 4GGFA 2NLNA 2LHIA 1TIZA 1QATA 3HCMA 4DUQA 3NSKA 4QJ5B 1BLQA 1B8RA 1NX1A 1YURA 2OS8B 3GK2A 5D7FA 2L4IA 2BCAA 1ZOTB 2ZN8A 5DKQA 1K9UA 2KYCA 2HF5A 1A2XA 2PSRA 1S5GY 3CGAA 3SIBA 3K21A 1CDMA 2NCPA 3CR5X 3ZNIA 2KI4C 3LK1A 1WRKA 2F2PA 1TCFA 1JFKA 4MN0A 3A4UB 4NQGA 2L4HA 1MR8A 1XA5A 4OV2A 1ODBA 1XFUO 2JC2A 4PCWA 1A75B 1Y1UA 2E6WA 2LLSA 1L7ZA 1NWDA 3E3RA 1XVJA 1TRFA 1DJWA 1K9PA 4C0KA 3I5IB 3EK8A 3EKHA 5DKRA 3FS7A 4WQ2A 2JXLA 2K61A 4PALA 5AFPA 4BY5A 2LVVA 5FYXA 1A03A 2BL0B 2JT8A 3BUWB 2HQ8A 3FWBA 1DVIA 2LANA 1YUUA 3I5FC 4C0JA 1BU3A 4P5OE 3DVMA 2QACA 3JVTB 3KEVA 1EL4A 1XFZO 1LXFC 1F70A 4M2OA 2MAZA 1LA3A 1GQMA 1SCMB 2CBLA 2KHNA 1WDCC 1CDNA 2MJWB 3LL8B 2L98A 2F33A 2G9BA 3QRXA 1OMRA 1UUSA 2I2RE 1PK0D 1PULA 1QLKA 1RROA 2KFHA 2Y1MA 2NCOA 2JXCA 1IH0A 3CTNA 1SYMA 2HETA 3BYAA 1CFPA 2B1UA 1E8AA 3VGOA 1L2OB 2ZN9A 3CZTX 1QV0A 2BECA 1NCZA 2GV5A 2KSPA 1OMDA 1BR4B 1J1EA 5AXIA 1NSHA 1TNPA 3D0YA 4ETOA 2L5XB 1UURA 5AANA 1TNQA 3I5HB 1KQVA 1SR6B 1ALWA 2AUCA 1F71A 3RM1A 5KTYA 2PALA 1EG3A 3EK7A 2AAOA 2PVBA 1GGWA 1W7IB 1SK6D 2A4JA 2GGMA 2O60A 2K2AA 2BKHB 3O4YA 1FF1A 3A8RA 1J7PA 2ZKMX 4USLA 1YUSA 1CMGA 2KDHA 1MQ1A 1QX7A 4Q04A 4OCIA 4CFRA 2H61C 1K95A 2EGDA 4A4CA 1SW8A 1F8HA 1CTRA 1QS7A 1SMGA 1C7VA 2BE6A 2NXQA 1Y0VH 3H4SE 3AKBA 3CS1A 3ZWHA 1S36A 2LVIA 2Y1NA 1EJ3A 3TS5B 1SL9A 1FI6A 3NSIA 3AAKA 1M46A 2M7LA 1TOPA 2E30A 2MHHA 1SCVA 1OOJA 5I2OA 2MA2A 4GGFC 1TTXA 5HKWA 1QTXA 3DVEA 3O78A 2H2KA 3DF0B 3PFVA 1KFUL 2M8UA 1LVCD 1PSRA 1XFXO 2KAYA 1JC2A 3CR2A 4GUKA 2F3ZA 4CLNA 5CSIA 1NUBA 2KYFA 5CPVA 1B7TZ 1D1OA 1HQVA 4PDZA 1QLSA 4ORAB 3WNXB 5IBWA 1H8BA 2RGIA 1DF0A 3SIAA 4HRGA 3BQ3A 2BE4A 1G33A 1VRKA 1YRUB 3EK4A 1OMVA 1SKTA 1U5IA 1DJZA 5JOLA 1FW4A 4TNCA 1DGVA 1PSBA 1QV1A 1QVIY 2OPOA 2L2EA 3JTDB 3VRPA 2KI6C 1JFJA 1KFUS 1RTP1 1UHNA 2JPTA 2ZFDA 4I5LB 4PE0A 5BPJA 1Y1XA 3SJSA 4MLWA 2KNEA 1RK9A 4MBEA 3KPXA 1UHHA 4U8DA 2OTGB 2KQ6A 1F54A 1CDPA 3GOFA 1KK8C 2NZ0A 1KSMA 2CT9A 3D10A 4PHMA 1BR1B 2LLUA 2Y4QA 1YRTB 2FCEA 1B8LA 4M2QA 2FJUB 3I5GB 1A75A 2WCEA 4CPVA 1IJ5A 4GFTA 1F4QA 3VRNA 3WXAA 1K90D 2CCMA 1KK7Y 3NSLA 1NX3A 1BT6A 1K94A 1WY9A 3BUMB 1J55A 4YGAA 2WC8A 5KU1A 1S5GZ 4XJKA 2L0PA 5J3XA 1CDLA 3ICBA 1MUXA 2EC6C 5CSNA 3SG5A 2CTNA 2K7BA 1RWYA 2LHLA 3SG7A 1PRWA 1KFXL 3VRQA 1CFFA 1AVSA 4GBAA 3SG3A 2KI4B 1AHRA 1CM4A 2KGBC 2KI6D 2JWWA 2L51A 3WHTB 2R2IA 1BF5A 1B9AA 4YBHB 2JOJA 1AK8A 1JSAA 1X02A 1S1EA 2M9GA 1EXRA 3GK4X 1NP8A 3IQOA 2M29A 3F45A 2IS9A 2PRUA 1F55A 1LINA 2HQWA 1KQMC 1QASA 1SPYA 4MRXA 2KFGA 4HREE 1UHIA 1Y6WA 1B1GA 1YX8A 4M2PA 1UWOA 1MXLC 2K7OA 1Y1AA 2LNKA 4OR9B 5GQQC 3DD4A 4QJ3B 1RJVA 1J7RA 4P2YB 1DJHA 1PALA 5KSZA 1KFXS 3VRRA 5HKYA 1ZACA 1PVAA 5AERA 4FQOA 3OX6A 1K2HA 1S3PA 2LVJA 5CSFA 3OHMB 1ZFSA 1DGUA 1BG1A 2JNXA 2M49B 1TNXA 3BOWB 4WQ3A 3KHEA 2QPTA 2KAXA 4N1FA 4OVNF 1NIWA 4XYNA 5DKNA 2LLTA 3I5FB 1DJIA 4MVFA 1CNPA 1WLZA 2LAPA 3LCPC 1XK4A 1BJFA 2MLFC 1WDCB 1CFCA 1A4PA 2F2OA 1DTLA 1IGVA 3PM8A 3SG4A 1K8UA 5HLVA 2I18A 4YGCB 3PLFB 2LMUA 3LK0A 4UPGA 4MEWA 5ER4X 1QX5B 1N2DA 3KO0A 4FTGA 4AOMA 1A29A 2EHBA 2JNFA 1V1GA 2CXJA 1C07A 3HX4A 1ALVA 1CLBA 3PN7C 1BODA 4I5JA 2G2BA 2KBMA 1OQPA 3VROA 2OS8C 2PMYA 2Q4UA 3OB1B 1MWNA 2K8MB 2F8PA 1N65A 4GAOA 2ISDA 1LKJA 2WORA 4ORBB 4CIDA 5HYDA 3NSOA 1BMOA 3O6BA 1YX7A 1B4CA 1EG4A 4ICBA 1DJYA 3CLNA 1CKKA 3BXKA 2K7DA 2ZRTA 2JT0A 3BUXB 1QIVA 3EVVA 3BUOB 5K89A 1OSAA 1QXPA 3PALA 3SG2A 2LUCA 4A4BA 5I2QA 2MLEC 3SG6A 1UHJA 2KBIA 2LVKA 2MRDA 4I5NB 4PHKA 4I5KA 1UHKA 1NX0A 1NPQA 2D8NA 4MRYA 5I8NA 1QX2A 1DF0B 1K93D 1EH2A 3KF9A 1IJ6A 1AJ5A 5F6TA 1HT9A 3NXAA 4YGBB 4MZKA 4YI8A 4OKHA 3C1VA 1SL7A 3CR4X 3TDZA 1IKUA 3I5IC 1M45A 1WRLA 3M0WA 4GGNA 4F0ZB 1BOCA 1MF8B 2BKIB 5PALA 1AJ4A 2LP2A 4PE4A 1FBVA 2P6BB 2BL0C 4ZCVA 2HPSA 2LCPA 1ZMZA 1B8CA 2JQ6A 1XYDA 2K7CA 2JRFA 4DRWA 2WOSA 2K2FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M31 A;  3CWG A;  1V1F A;  2KFF A;  2M1K B;  2FCD A;  1GGZ A;  5JJG A;  2F3Y A;  2JU0 A;  2M1U A;  1WLM A;  3AAJ A;  2KAV A;  3JVT C;  2JTT A;  2Y5I A;  3TDI A;  4AQJ A;  1QVI Z;  2PAS A;  4CFQ A;  4E68 A;  1G4Y R;  4MSP A;  1DJX A;  1SCM C;  1QIW A;  1R6P A;  3GK1 A;  4ORC B;  4N5X A;  2LE9 B;  1JF0 A;  1OE9 B;  1CLM A;  2VRG A;  3TUY C;  3OB2 B;  1S26 D;  4PE1 A;  5G08 A;  2FOT A;  3IF7 A;  2SCP A;  1NCX A;  1IQ3 A;  1M39 A;  4C0L A;  1YR5 A;  2M7N A;  4DCK A;  1KWO C;  4GPL B;  4MZL A;  2JUL A;  2TN4 A;  1IRJ A;  1B47 A;  1L2O C;  1TCO B;  1FPW A;  2KGR A;  1AP4 A;  1XFY O;  4IL1 A;  1KK8 B;  2Q91 A;  4QJ4 B;  4XJK B;  1IWQ A;  1CM1 A;  3PSR A;  3LLE A;  1JUO A;  1S6J A;  3I5H C;  1SR6 C;  1JBA A;  3EVU A;  2LC5 A;  1KK7 Z;  4L9M A;  3TDU A;  4PE7 A;  3MSE B;  5TNC A;  1QJT A;  3BUN B;  1JF2 A;  3OP0 A;  4BY4 A;  4N1G A;  1CMF A;  1SBJ A;  4AQI A;  4DIR A;  4ZCU A;  4JWQ A;  2AMI A;  1CB1 A;  1XK4 C;  3FWC A;  3RLZ A;  1NX2 A;  2WCB A;  2ZRS A;  2I7A A;  1K9K A;  1SY9 A;  2LP3 A;  1TN4 A;  1R2U A;  2GGZ A;  4DS7 A;  5CSJ A;  1C7W A;  1RFJ A;  2JT3 A;  2EC6 B;  1DMO A;  1Q80 A;  1FI5 A;  1F4O A;  2V53 A;  3TUY B;  3BOW A;  3OX5 A;  2KQY A;  3TS5 C;  1N0Y A;  3O2P A;  1TNW A;  2ZNE A;  1H4B A;  3IQQ A;  1XFW O;  1KWO B;  1NYA A;  4NDC A;  2LMT A;  1S6I A;  2K0J A;  2SAS A;  2WCF A;  1AUI B;  2JTZ A;  4JPZ B;  3D0Y B;  1YUT A;  3DVK A;  3EVR A;  4HSZ A;  3TZ1 A;  1KSO A;  1KQM B;  1IG5 A;  4YGE B;  1PVB A;  2DOQ A;  1NCY A;  3FIA A;  5B8I B;  1M63 B;  1XO5 A;  2LUX A;  1YTZ C;  1OZO A;  1W7J B;  1DJG A;  1B7T Y;  5HLO A;  4YI9 A;  1IQ5 A;  1YVL A;  2BCB A;  4NDB A;  2BBN A;  1GJY A;  2JZI A;  1YVH A;  1J7Q A;  1KCY A;  2MBX A;  1MXE A;  2KOT A;  3DF0 A;  4D1E A;  3JTD C;  2M97 A;  1S6C A;  1CLL A;  3PAT A;  3WHU B;  1JWD A;  2I94 A;  1DT7 B;  2LM5 A;  1UP5 A;  2M3W A;  1K96 A;  4PHJ A;  4JQ0 D;  2LMV A;  4YRU A;  2OTG C;  1REC A;  4MZJ A;  5I2L A;  1MHO A;  3DVJ A;  4R1E A;  5D69 A;  2BBM A;  2WND A;  1LA0 A;  2BCX A;  1WRZ A;  4PHN A;  2ZND A;  4WRI A;  3AKA A;  1J7O A;  2LV7 A;  3EKJ A;  2H61 A;  5HKZ A;  1CFD A;  1ZUZ A;  5ER5 A;  3I5G C;  4YGD B;  4NDD A;  1SL8 A;  1XFV O;  1SNL A;  2L50 A;  2O5G A;  4HRH A;  1OZS A;  2COL B;  2M0R A;  1G8I A;  1U5I B;  2CNP A;  1SRA A;  5AEQ A;  3PN7 B;  1J1D A;  4GNK B;  4GGF A;  2NLN A;  2LHI A;  1TIZ A;  1QAT A;  3HCM A;  4DUQ A;  3NSK A;  4QJ5 B;  1BLQ A;  1B8R A;  1NX1 A;  1YUR A;  2OS8 B;  3GK2 A;  5D7F A;  2L4I A;  2BCA A;  1ZOT B;  2ZN8 A;  5DKQ A;  1K9U A;  2KYC A;  2HF5 A;  1A2X A;  2PSR A;  1S5G Y;  3CGA A;  3SIB A;  3K21 A;  1CDM A;  2NCP A;  3CR5 X;  3ZNI A;  2KI4 C;  3LK1 A;  1WRK A;  2F2P A;  1TCF A;  1JFK A;  4MN0 A;  3A4U B;  4NQG A;  2L4H A;  1MR8 A;  1XA5 A;  4OV2 A;  1ODB A;  1XFU O;  2JC2 A;  4PCW A;  1A75 B;  1Y1U A;  2E6W A;  2LLS A;  1L7Z A;  1NWD A;  3E3R A;  1XVJ A;  1TRF A;  1DJW A;  1K9P A;  4C0K A;  3I5I B;  3EK8 A;  3EKH A;  5DKR A;  3FS7 A;  4WQ2 A;  2JXL A;  2K61 A;  4PAL A;  5AFP A;  4BY5 A;  2LVV A;  5FYX A;  1A03 A;  2BL0 B;  2JT8 A;  3BUW B;  2HQ8 A;  3FWB A;  1DVI A;  2LAN A;  1YUU A;  3I5F C;  4C0J A;  1BU3 A;  4P5O E;  3DVM A;  2QAC A;  3JVT B;  3KEV A;  1EL4 A;  1XFZ O;  1LXF C;  1F70 A;  4M2O A;  2MAZ A;  1LA3 A;  1GQM A;  1SCM B;  2CBL A;  2KHN A;  1WDC C;  1CDN A;  2MJW B;  3LL8 B;  2L98 A;  2F33 A;  2G9B A;  3QRX A;  1OMR A;  1UUS A;  2I2R E;  1PK0 D;  1PUL A;  1QLK A;  1RRO A;  2KFH A;  2Y1M A;  2NCO A;  2JXC A;  1IH0 A;  3CTN A;  1SYM A;  2HET A;  3BYA A;  1CFP A;  2B1U A;  1E8A A;  3VGO A;  1L2O B;  2ZN9 A;  3CZT X;  1QV0 A;  2BEC A;  1NCZ A;  2GV5 A;  2KSP A;  1OMD A;  1BR4 B;  1J1E A;  5AXI A;  1NSH A;  1TNP A;  3D0Y A;  4ETO A;  2L5X B;  1UUR A;  5AAN A;  1TNQ A;  3I5H B;  1KQV A;  1SR6 B;  1ALW A;  2AUC A;  1F71 A;  3RM1 A;  5KTY A;  2PAL A;  1EG3 A;  3EK7 A;  2AAO A;  2PVB A;  1GGW A;  1W7I B;  1SK6 D;  2A4J A;  2GGM A;  2O60 A;  2K2A A;  2BKH B;  3O4Y A;  1FF1 A;  3A8R A;  1J7P A;  2ZKM X;  4USL A;  1YUS A;  1CMG A;  2KDH A;  1MQ1 A;  1QX7 A;  4Q04 A;  4OCI A;  4CFR A;  2H61 C;  1K95 A;  2EGD A;  4A4C A;  1SW8 A;  1F8H A;  1CTR A;  1QS7 A;  1SMG A;  1C7V A;  2BE6 A;  2NXQ A;  1Y0V H;  3H4S E;  3AKB A;  3CS1 A;  3ZWH A;  1S36 A;  2LVI A;  2Y1N A;  1EJ3 A;  3TS5 B;  1SL9 A;  1FI6 A;  3NSI A;  3AAK A;  1M46 A;  2M7L A;  1TOP A;  2E30 A;  2MHH A;  1SCV A;  1OOJ A;  5I2O A;  2MA2 A;  4GGF C;  1TTX A;  5HKW A;  1QTX A;  3DVE A;  3O78 A;  2H2K A;  3DF0 B;  3PFV A;  1KFU L;  2M8U A;  1LVC D;  1PSR A;  1XFX O;  2KAY A;  1JC2 A;  3CR2 A;  4GUK A;  2F3Z A;  4CLN A;  5CSI A;  1NUB A;  2KYF A;  5CPV A;  1B7T Z;  1D1O A;  1HQV A;  4PDZ A;  1QLS A;  4ORA B;  3WNX B;  5IBW A;  1H8B A;  2RGI A;  1DF0 A;  3SIA A;  4HRG A;  3BQ3 A;  2BE4 A;  1G33 A;  1VRK A;  1YRU B;  3EK4 A;  1OMV A;  1SKT A;  1U5I A;  1DJZ A;  5JOL A;  1FW4 A;  4TNC A;  1DGV A;  1PSB A;  1QV1 A;  1QVI Y;  2OPO A;  2L2E A;  3JTD B;  3VRP A;  2KI6 C;  1JFJ A;  1KFU S;  1RTP 1;  1UHN A;  2JPT A;  2ZFD A;  4I5L B;  4PE0 A;  5BPJ A;  1Y1X A;  3SJS A;  4MLW A;  2KNE A;  1RK9 A;  4MBE A;  3KPX A;  1UHH A;  4U8D A;  2OTG B;  2KQ6 A;  1F54 A;  1CDP A;  3GOF A;  1KK8 C;  2NZ0 A;  1KSM A;  2CT9 A;  3D10 A;  4PHM A;  1BR1 B;  2LLU A;  2Y4Q A;  1YRT B;  2FCE A;  1B8L A;  4M2Q A;  2FJU B;  3I5G B;  1A75 A;  2WCE A;  4CPV A;  1IJ5 A;  4GFT A;  1F4Q A;  3VRN A;  3WXA A;  1K90 D;  2CCM A;  1KK7 Y;  3NSL A;  1NX3 A;  1BT6 A;  1K94 A;  1WY9 A;  3BUM B;  1J55 A;  4YGA A;  2WC8 A;  5KU1 A;  1S5G Z;  4XJK A;  2L0P A;  5J3X A;  1CDL A;  3ICB A;  1MUX A;  2EC6 C;  5CSN A;  3SG5 A;  2CTN A;  2K7B A;  1RWY A;  2LHL A;  3SG7 A;  1PRW A;  1KFX L;  3VRQ A;  1CFF A;  1AVS A;  4GBA A;  3SG3 A;  2KI4 B;  1AHR A;  1CM4 A;  2KGB C;  2KI6 D;  2JWW A;  2L51 A;  3WHT B;  2R2I A;  1BF5 A;  1B9A A;  4YBH B;  2JOJ A;  1AK8 A;  1JSA A;  1X02 A;  1S1E A;  2M9G A;  1EXR A;  3GK4 X;  1NP8 A;  3IQO A;  2M29 A;  3F45 A;  2IS9 A;  2PRU A;  1F55 A;  1LIN A;  2HQW A;  1KQM C;  1QAS A;  1SPY A;  4MRX A;  2KFG A;  4HRE E;  1UHI A;  1Y6W A;  1B1G A;  1YX8 A;  4M2P A;  1UWO A;  1MXL C;  2K7O A;  1Y1A A;  2LNK A;  4OR9 B;  5GQQ C;  3DD4 A;  4QJ3 B;  1RJV A;  1J7R A;  4P2Y B;  1DJH A;  1PAL A;  5KSZ A;  1KFX S;  3VRR A;  5HKY A;  1ZAC A;  1PVA A;  5AER A;  4FQO A;  3OX6 A;  1K2H A;  1S3P A;  2LVJ A;  5CSF A;  3OHM B;  1ZFS A;  1DGU A;  1BG1 A;  2JNX A;  2M49 B;  1TNX A;  3BOW B;  4WQ3 A;  3KHE A;  2QPT A;  2KAX A;  4N1F A;  4OVN F;  1NIW A;  4XYN A;  5DKN A;  2LLT A;  3I5F B;  1DJI A;  4MVF A;  1CNP A;  1WLZ A;  2LAP A;  3LCP C;  1XK4 A;  1BJF A;  2MLF C;  1WDC B;  1CFC A;  1A4P A;  2F2O A;  1DTL A;  1IGV A;  3PM8 A;  3SG4 A;  1K8U A;  5HLV A;  2I18 A;  4YGC B;  3PLF B;  2LMU A;  3LK0 A;  4UPG A;  4MEW A;  5ER4 X;  1QX5 B;  1N2D A;  3KO0 A;  4FTG A;  4AOM A;  1A29 A;  2EHB A;  2JNF A;  1V1G A;  2CXJ A;  1C07 A;  3HX4 A;  1ALV A;  1CLB A;  3PN7 C;  1BOD A;  4I5J A;  2G2B A;  2KBM A;  1OQP A;  3VRO A;  2OS8 C;  2PMY A;  2Q4U A;  3OB1 B;  1MWN A;  2K8M B;  2F8P A;  1N65 A;  4GAO A;  2ISD A;  1LKJ A;  2WOR A;  4ORB B;  4CID A;  5HYD A;  3NSO A;  1BMO A;  3O6B A;  1YX7 A;  1B4C A;  1EG4 A;  4ICB A;  1DJY A;  3CLN A;  1CKK A;  3BXK A;  2K7D A;  2ZRT A;  2JT0 A;  3BUX B;  1QIV A;  3EVV A;  3BUO B;  5K89 A;  1OSA A;  1QXP A;  3PAL A;  3SG2 A;  2LUC A;  4A4B A;  5I2Q A;  2MLE C;  3SG6 A;  1UHJ A;  2KBI A;  2LVK A;  2MRD A;  4I5N B;  4PHK A;  4I5K A;  1UHK A;  1NX0 A;  1NPQ A;  2D8N A;  4MRY A;  5I8N A;  1QX2 A;  1DF0 B;  1K93 D;  1EH2 A;  3KF9 A;  1IJ6 A;  1AJ5 A;  5F6T A;  1HT9 A;  3NXA A;  4YGB B;  4MZK A;  4YI8 A;  4OKH A;  3C1V A;  1SL7 A;  3CR4 X;  3TDZ A;  1IKU A;  3I5I C;  1M45 A;  1WRL A;  3M0W A;  4GGN A;  4F0Z B;  1BOC A;  1MF8 B;  2BKI B;  5PAL A;  1AJ4 A;  2LP2 A;  4PE4 A;  1FBV A;  2P6B B;  2BL0 C;  4ZCV A;  2HPS A;  2LCP A;  1ZMZ A;  1B8C A;  2JQ6 A;  1XYD A;  2K7C A;  2JRF A;  4DRW A;  2WOS A;  2K2F A; 
#chains in the Genus database with same CATH topology
 2L2C A;  1M31 A;  3CWG A;  3D75 A;  1V1F A;  2KFF A;  2M1K B;  2FCD A;  1GGZ A;  5JJG A;  2F3Y A;  2JU0 A;  4KYN A;  2M1U A;  1WLM A;  3AAJ A;  2KAV A;  3JVT C;  2JTT A;  2Y5I A;  3TDI A;  4AQJ A;  1QVI Z;  2PAS A;  4CFQ A;  4E68 A;  1G4Y R;  4MSP A;  1DJX A;  1SCM C;  1QIW A;  3CAB A;  1R6P A;  3GK1 A;  4ORC B;  4N5X A;  2LE9 B;  1JF0 A;  1OE9 B;  1CLM A;  2VRG A;  3TUY C;  1IIO A;  3OB2 B;  1S26 D;  4PE1 A;  5G08 A;  2FOT A;  3DYE A;  3IF7 A;  2SCP A;  1NCX A;  1IQ3 A;  1M39 A;  4C0L A;  1YR5 A;  2M7N A;  4DCK A;  1KWO C;  4GPL B;  4MZL A;  2JUL A;  2TN4 A;  1IRJ A;  1B47 A;  1L2O C;  1TCO B;  1FPW A;  2KGR A;  1AP4 A;  1P28 A;  1XFY O;  4IL1 A;  1KK8 B;  2Q91 A;  4QJ4 B;  1OW4 A;  1IWQ A;  1CM1 A;  3PSR A;  4XJK B;  3B86 A;  3LLE A;  1JUO A;  1S6J A;  3I5H C;  1SR6 C;  1JBA A;  3EVU A;  2LC5 A;  1DC1 A;  1KK7 Z;  4L9M A;  3TDU A;  4PE7 A;  3MSE B;  5TNC A;  1QJT A;  3BUN B;  1JF2 A;  3OP0 A;  4BY4 A;  4N1G A;  1CMF A;  1SBJ A;  4AQI A;  4DIR A;  1C3Y A;  4ZCU A;  4JWQ A;  2AMI A;  1CB1 A;  1XK4 C;  3FWC A;  3RLZ A;  1OOF A;  1NX2 A;  2WCB A;  2ZRS A;  2I7A A;  1K9K A;  1SY9 A;  3CYZ A;  2LP3 A;  1TN4 A;  3BFB A;  1DEK A;  1R2U A;  2GGZ A;  4DS7 A;  5CSJ A;  1C7W A;  1RFJ A;  2JT3 A;  2EC6 B;  5I94 A;  1Q80 A;  2QEO A;  1DMO A;  1FI5 A;  1F4O A;  2V53 A;  3TUY B;  3BOW A;  3OX5 A;  2KQY A;  3TS5 C;  1N0Y A;  3O2P A;  1TNW A;  2ZNE A;  1H4B A;  3IQQ A;  1XFW O;  1KWO B;  1NYA A;  4NDC A;  2LMT A;  1S6I A;  2K0J A;  2SAS A;  2WCF A;  3SS4 A;  1AUI B;  2JTZ A;  4JPZ B;  3D0Y B;  1YUT A;  3DVK A;  3EVR A;  4HSZ A;  3TZ1 A;  1KSO A;  3BJH A;  3FE9 A;  1QWV A;  1KQM B;  1JSA A;  3D73 A;  1IG5 A;  4YGE B;  1Z4H A;  2QEH A;  3OBV A;  1PVB A;  2DOQ A;  1NCY A;  3FIA A;  5B8I B;  1M63 B;  1XO5 A;  3R1P A;  2LUX A;  1YTZ C;  1OZO A;  1W7J B;  1DJG A;  1B7T Y;  3O4X A;  5HLO A;  4YI9 A;  1IQ5 A;  4JKT A;  1YVL A;  2BCB A;  4NDB A;  2BBN A;  1GJY A;  2JZI A;  1YVH A;  1J7Q A;  1KCY A;  2MBX A;  1MXE A;  2ERB A;  2KOT A;  3DF0 A;  4D1E A;  2YGU A;  3JTD C;  3NGV A;  1TWO A;  2M97 A;  1S6C A;  1CLL A;  3PAT A;  3WHU B;  1JWD A;  2I94 A;  1DT7 B;  1OOG A;  2LM5 A;  1UP5 A;  2M3W A;  2BAP A;  1K96 A;  4PHJ A;  2KLE A;  3PJI A;  4JQ0 D;  2LMV A;  4YRU A;  2OTG C;  1REC A;  4MZJ A;  5I2L A;  1MHO A;  3DVJ A;  4R1E A;  5D69 A;  2BBM A;  2WND A;  1LA0 A;  2BCX A;  1WRZ A;  1DEL A;  2ZND A;  4PHN A;  4WRI A;  3AKA A;  1J7O A;  2LV7 A;  3EKJ A;  3S0B A;  2H61 A;  5HKZ A;  1CFD A;  3D74 A;  1ZUZ A;  3K1E A;  5ER5 A;  3S0A A;  3I5G C;  4YGD B;  4NDD A;  1SL8 A;  1XFV O;  3DXL A;  1SNL A;  2L50 A;  2O5G A;  4HRH A;  1OZS A;  2COL B;  2M0R A;  1G8I A;  1U5I B;  2CNP A;  1SRA A;  5AEQ A;  3PN7 B;  1J1D A;  4GNK B;  3Q8I A;  2NLN A;  2LHI A;  1TIZ A;  1QAT A;  3HCM A;  4GGF A;  3NSK A;  4DUQ A;  4QJ5 B;  4IJ7 A;  1B8R A;  1NX1 A;  1YUR A;  2OS8 B;  2H8V A;  3GK2 A;  2L4I A;  2BCA A;  1ZOT B;  2ZN8 A;  5D7F A;  1K9U A;  5DKQ A;  2KYC A;  2HF5 A;  1A2X A;  2PSR A;  1S5G Y;  3CGA A;  3SIB A;  3K21 A;  1CDM A;  2NCP A;  3CR5 X;  3ZNI A;  3NHT A;  2KI4 C;  3LK1 A;  1TUJ A;  1WRK A;  2F2P A;  1TCF A;  1JFK A;  2GTE A;  4MN0 A;  3A4U B;  3D77 A;  4NQG A;  2L4H A;  1MR8 A;  1XA5 A;  3NHI A;  1ODB A;  4OV2 A;  1XFU O;  5HL1 A;  2JC2 A;  4PCW A;  1A75 B;  1Y1U A;  2E6W A;  2LLS A;  1L7Z A;  2PQL A;  3DY9 A;  1NWD A;  3E3R A;  1XVJ A;  1TRF A;  1DJW A;  1K9P A;  2JPO A;  3R1V A;  4C0K A;  3I5I B;  3EK8 A;  3EKH A;  5DKR A;  3FS7 A;  4WQ2 A;  2JXL A;  2K61 A;  4PAL A;  1SSE B;  4BY5 A;  2LVV A;  5AFP A;  5FYX A;  1A03 A;  2BL0 B;  2JT8 A;  3BUW B;  2HQ8 A;  3FWB A;  2WCH A;  1DVI A;  2LAN A;  1YUU A;  3I5F C;  4C0J A;  5FI7 A;  1BU3 A;  4P5O E;  3FE6 A;  3DVM A;  2QAC A;  3JVT B;  3KEV A;  1EL4 A;  1XFZ O;  1LXF C;  1F70 A;  4M2O A;  2MAZ A;  1LA3 A;  1GQM A;  1SCM B;  2CBL A;  2KHN A;  1WDC C;  1CDN A;  2MJW B;  3LL8 B;  2L98 A;  3FE8 A;  2F33 A;  2G9B A;  3QRX A;  1OMR A;  1UUS A;  2I2R E;  1PK0 D;  1PUL A;  1W9Z A;  1QLK A;  1RRO A;  2KFH A;  2Y1M A;  2NCO A;  2JXC A;  1IH0 A;  1ORG A;  3CTN A;  1SYM A;  2HET A;  3BYA A;  1CFP A;  2B1U A;  3L47 A;  1E8A A;  3VGO A;  1L2O B;  2ZN9 A;  3CZT X;  1QV0 A;  2BEC A;  2WCK A;  1NCZ A;  2GV5 A;  2KSP A;  3D78 A;  1OMD A;  1BR4 B;  1J1E A;  5AXI A;  1NSH A;  1TNP A;  3D0Y A;  4ETO A;  2L5X B;  1UUR A;  2QEV A;  5AAN A;  1TNQ A;  3I5H B;  1KQV A;  1SR6 B;  1ALW A;  2AUC A;  3IVT A;  1F71 A;  3RM1 A;  5KTY A;  2PAL A;  1EG3 A;  3EK7 A;  2AAO A;  2PVB A;  4INX A;  1W7I B;  1GGW A;  1SK6 D;  2A4J A;  3B7A A;  2GGM A;  2O60 A;  3L4A A;  2K2A A;  2BKH B;  3O4Y A;  3UNW A;  1FF1 A;  3A8R A;  1J7P A;  2ZKM X;  4USL A;  1YUS A;  1CMG A;  2KDH A;  1MQ1 A;  1QX7 A;  4Q04 A;  4OCI A;  1DQE A;  4CFR A;  2H61 C;  5EL2 A;  1K95 A;  2EGD A;  4A4C A;  1SW8 A;  1F8H A;  1CTR A;  1QS7 A;  1SMG A;  1C7V A;  2BE6 A;  3EG5 B;  2NXQ A;  1Y0V H;  3H4S E;  3AKB A;  3CS1 A;  3ZWH A;  1S36 A;  2LVI A;  2Y1N A;  1EJ3 A;  2K60 A;  3TS5 B;  1SL9 A;  3CZ2 A;  3NSI A;  3AAK A;  1M46 A;  2M7L A;  1TOP A;  1FI6 A;  2E30 A;  2MHH A;  1SCV A;  1OOJ A;  5I2O A;  2MA2 A;  4GGF C;  1TTX A;  5HKW A;  1QTX A;  3DVE A;  3O78 A;  2H2K A;  3DF0 B;  3PFV A;  3L4L A;  1KFU L;  2M8U A;  1LVC D;  1PSR A;  1XFX O;  2KAY A;  2WCM A;  1JC2 A;  3CR2 A;  4GUK A;  2F3Z A;  4CLN A;  5CSI A;  1NUB A;  2KYF A;  5CPV A;  1B7T Z;  1D1O A;  1HQV A;  4PDZ A;  1QLS A;  4ORA B;  3WNX B;  5IBW A;  1H8B A;  2RGI A;  1DF0 A;  3SIA A;  4HRG A;  3BQ3 A;  2BE4 A;  1G33 A;  1VRK A;  1YRU B;  3EK4 A;  1OMV A;  1SKT A;  1C3Z A;  1U5I A;  1DJZ A;  5JOL A;  1FW4 A;  4TNC A;  1DGV A;  1PSB A;  1QV1 A;  3UO9 A;  3B87 A;  1QVI Y;  3R1O A;  2OPO A;  2L2E A;  3JTD B;  3VRP A;  2KI6 C;  1JFJ A;  1KFU S;  1RTP 1;  5DIC A;  1UHN A;  2JPT A;  3BFA A;  2ZFD A;  4I5L B;  4PE0 A;  5BPJ A;  1Y1X A;  3SJS A;  4MLW A;  2KNE A;  1RK9 A;  4MBE A;  2WC5 A;  3KPX A;  1UHH A;  4U8D A;  2OTG B;  4F7F A;  2KQ6 A;  1F54 A;  1CDP A;  3GOF A;  1KK8 C;  4PT1 A;  2NZ0 A;  1KSM A;  2CT9 A;  3D10 A;  4PHM A;  1BR1 B;  2LLU A;  2Y4Q A;  1YRT B;  2FCE A;  1B8L A;  4M2Q A;  2FJU B;  3I5G B;  1A75 A;  2WCE A;  4CPV A;  1LS8 A;  1IJ5 A;  4GFT A;  1F4Q A;  3VRN A;  3WXA A;  1K90 D;  2CCM A;  1KK7 Y;  3NSL A;  5FI6 A;  1NX3 A;  1BT6 A;  1K94 A;  1WY9 A;  2WCL A;  1J55 A;  3B88 A;  3BUM B;  2QDI A;  4YGA A;  3V2L A;  3D76 A;  4FQT A;  1XFR A;  2WC8 A;  5KU1 A;  1S5G Z;  4XJK A;  2L0P A;  5J3X A;  1CDL A;  4OZD A;  3ICB A;  1MUX A;  2EC6 C;  5CSN A;  3SG5 A;  2CTN A;  2K7B A;  1RWY A;  2LHL A;  3SG7 A;  1PRW A;  1KFX L;  3VRQ A;  2QEB A;  3S0F A;  1CFF A;  1AVS A;  4GBA A;  5D3O A;  3SG3 A;  2KI4 B;  1AHR A;  1CM4 A;  2KGB C;  2KI6 D;  2JWW A;  2L51 A;  3S0E A;  2R2I A;  3WHT B;  1B9A A;  3QME A;  2JOJ A;  4YBH B;  2P70 A;  1BF5 A;  1OOH A;  1X02 A;  1S1E A;  4JD9 A;  3RZS A;  2M9G A;  1EXR A;  3GK4 X;  1BLQ A;  1NP8 A;  3IQO A;  2M29 A;  3F45 A;  2IS9 A;  2PRU A;  1F55 A;  1LIN A;  2HQW A;  1KQM C;  1QAS A;  1SPY A;  4MRX A;  2KFG A;  4HRE E;  1UHI A;  3CZ0 A;  1Y6W A;  2BNX A;  1B1G A;  1YX8 A;  4M2P A;  1UWO A;  1MXL C;  2K7O A;  1Y1A A;  2L5Y A;  2LNK A;  2WC6 A;  4OR9 B;  5GQQ C;  3SS3 A;  3DD4 A;  4QJ3 B;  1RJV A;  1J7R A;  4P2Y B;  1DJH A;  1PAL A;  5KSZ A;  1KFX S;  3VRR A;  5HKY A;  1ZAC A;  1PVA A;  5AER A;  4FQO A;  3OX6 A;  1K2H A;  1S3P A;  2LVJ A;  5CSF A;  3OHM B;  1ZFS A;  1DGU A;  1BG1 A;  2JNX A;  2M49 B;  1TNX A;  3BOW B;  4WQ3 A;  3KHE A;  2QPT A;  2KAX A;  1GM0 A;  4N1F A;  2P71 A;  4OVN F;  1NIW A;  4XYN A;  5DKN A;  2FJY A;  2LLT A;  3I5F B;  1DJI A;  3R72 A;  4MVF A;  3B6X A;  1CNP A;  1WLZ A;  3S0D A;  4INW A;  2LAP A;  3LCP C;  1XK4 A;  1BJF A;  2MLF C;  1WDC B;  3VB1 A;  1CFC A;  1A4P A;  2F2O A;  3DZT A;  1DTL A;  3N7H A;  1IGV A;  2KLD A;  3PM8 A;  1K8U A;  3SG4 A;  1Z2C B;  5HLV A;  2I18 A;  4YGC B;  3PLF B;  2LMU A;  3LK0 A;  4UPG A;  4MEW A;  5ER4 X;  1QX5 B;  1N2D A;  3KO0 A;  4FTG A;  4AOM A;  3OGN A;  1A29 A;  3S0G A;  2EHB A;  2JNF A;  1V1G A;  2CXJ A;  1C07 A;  3HX4 A;  1ALV A;  1CLB A;  3PN7 C;  1BOD A;  4I5J A;  3PM2 A;  2G2B A;  2KBM A;  1OQP A;  3VRO A;  2OS8 C;  2PMY A;  2Q4U A;  3OB1 B;  3BFH A;  1MWN A;  2K8M B;  2F8P A;  1N65 A;  4GAO A;  2ISD A;  1LKJ A;  1TUZ A;  2WOR A;  4ORB B;  4CID A;  5HYD A;  3NSO A;  1BMO A;  3O6B A;  1YX7 A;  1B4C A;  1EG4 A;  3CZ1 A;  4ICB A;  1DJY A;  3CLN A;  1CKK A;  3BXK A;  2K7D A;  2ZRT A;  3CDN A;  2JT0 A;  3BUX B;  1QIV A;  2PYQ A;  1OOI X;  3EVV A;  3BUO B;  5K89 A;  1T14 A;  1OSA A;  1QXP A;  3PAL A;  3SG2 A;  2LUC A;  4A4B A;  5I2Q A;  2MLE C;  3SG6 A;  1UHJ A;  2KBI A;  2LVK A;  2MRD A;  4I5N B;  2KPH A;  4PHK A;  4I5K A;  1UHK A;  1NX0 A;  1NPQ A;  2D8N A;  4MRY A;  5I8N A;  1QX2 A;  1DF0 B;  1K93 D;  1EH2 A;  3KF9 A;  1IJ6 A;  1AJ5 A;  5F6T A;  1HT9 A;  3NXA A;  4YGB B;  4MZK A;  2WCJ A;  4YI8 A;  4OKH A;  3C1V A;  5FI2 A;  1SL7 A;  3CR4 X;  3TDZ A;  1IKU A;  3I5I C;  1M45 A;  1WRL A;  3M0W A;  4GGN A;  4F0Z B;  1BOC A;  1MF8 B;  3SS5 A;  1AK8 A;  2BKI B;  5PAL A;  1AJ4 A;  2LP2 A;  4PE4 A;  1FBV A;  2P6B B;  2BL0 C;  4ZCV A;  2HPS A;  2LCP A;  1ZMZ A;  1B8C A;  2JQ6 A;  1XYD A;  2K7C A;  2JRF A;  4DRW A;  2WOS A;  2K2F A; 
#chains in the Genus database with same CATH homology
 1M31 A;  3CWG A;  1V1F A;  2KFF A;  2M1K B;  2FCD A;  1GGZ A;  5JJG A;  2F3Y A;  2JU0 A;  2M1U A;  1WLM A;  3AAJ A;  2KAV A;  3JVT C;  2JTT A;  2Y5I A;  3TDI A;  4AQJ A;  1QVI Z;  2PAS A;  4CFQ A;  4E68 A;  1G4Y R;  4MSP A;  1DJX A;  1SCM C;  1QIW A;  1R6P A;  3GK1 A;  4ORC B;  4N5X A;  2LE9 B;  1JF0 A;  1OE9 B;  1CLM A;  2VRG A;  3TUY C;  3OB2 B;  1S26 D;  4PE1 A;  5G08 A;  2FOT A;  3IF7 A;  2SCP A;  1NCX A;  1IQ3 A;  1M39 A;  4C0L A;  1YR5 A;  2M7N A;  4DCK A;  1KWO C;  4GPL B;  4MZL A;  2JUL A;  2TN4 A;  1IRJ A;  1B47 A;  1L2O C;  1TCO B;  1FPW A;  2KGR A;  1AP4 A;  1XFY O;  4IL1 A;  1KK8 B;  2Q91 A;  4QJ4 B;  4XJK B;  1IWQ A;  1CM1 A;  3PSR A;  3LLE A;  1JUO A;  1S6J A;  3I5H C;  1SR6 C;  1JBA A;  3EVU A;  2LC5 A;  1KK7 Z;  4L9M A;  3TDU A;  4PE7 A;  3MSE B;  5TNC A;  1QJT A;  3BUN B;  1JF2 A;  3OP0 A;  4BY4 A;  4N1G A;  1CMF A;  1SBJ A;  4AQI A;  4DIR A;  4ZCU A;  4JWQ A;  2AMI A;  1CB1 A;  1XK4 C;  3FWC A;  3RLZ A;  1NX2 A;  2WCB A;  2ZRS A;  2I7A A;  1K9K A;  1SY9 A;  2LP3 A;  1TN4 A;  1R2U A;  2GGZ A;  4DS7 A;  5CSJ A;  1C7W A;  1RFJ A;  2JT3 A;  2EC6 B;  1DMO A;  1Q80 A;  1FI5 A;  1F4O A;  2V53 A;  3TUY B;  3BOW A;  3OX5 A;  2KQY A;  3TS5 C;  1N0Y A;  3O2P A;  1TNW A;  2ZNE A;  1H4B A;  3IQQ A;  1XFW O;  1KWO B;  1NYA A;  4NDC A;  2LMT A;  1S6I A;  2K0J A;  2SAS A;  2WCF A;  1AUI B;  2JTZ A;  4JPZ B;  3D0Y B;  1YUT A;  3DVK A;  3EVR A;  4HSZ A;  3TZ1 A;  1KSO A;  1KQM B;  1IG5 A;  4YGE B;  1PVB A;  2DOQ A;  1NCY A;  3FIA A;  5B8I B;  1M63 B;  1XO5 A;  2LUX A;  1YTZ C;  1OZO A;  1W7J B;  1DJG A;  1B7T Y;  5HLO A;  4YI9 A;  1IQ5 A;  1YVL A;  2BCB A;  4NDB A;  2BBN A;  1GJY A;  2JZI A;  1YVH A;  1J7Q A;  1KCY A;  2MBX A;  1MXE A;  2KOT A;  3DF0 A;  4D1E A;  3JTD C;  2M97 A;  1S6C A;  1CLL A;  3PAT A;  3WHU B;  1JWD A;  2I94 A;  1DT7 B;  2LM5 A;  1UP5 A;  2M3W A;  1K96 A;  4PHJ A;  4JQ0 D;  2LMV A;  4YRU A;  2OTG C;  1REC A;  4MZJ A;  5I2L A;  1MHO A;  3DVJ A;  4R1E A;  5D69 A;  2BBM A;  2WND A;  1LA0 A;  2BCX A;  1WRZ A;  4PHN A;  2ZND A;  4WRI A;  3AKA A;  1J7O A;  2LV7 A;  3EKJ A;  2H61 A;  5HKZ A;  1CFD A;  1ZUZ A;  5ER5 A;  3I5G C;  4YGD B;  4NDD A;  1SL8 A;  1XFV O;  1SNL A;  2L50 A;  2O5G A;  4HRH A;  1OZS A;  2COL B;  2M0R A;  1G8I A;  1U5I B;  2CNP A;  1SRA A;  5AEQ A;  3PN7 B;  1J1D A;  4GNK B;  4GGF A;  2NLN A;  2LHI A;  1TIZ A;  1QAT A;  3HCM A;  4DUQ A;  3NSK A;  4QJ5 B;  1BLQ A;  1B8R A;  1NX1 A;  1YUR A;  2OS8 B;  3GK2 A;  5D7F A;  2L4I A;  2BCA A;  1ZOT B;  2ZN8 A;  5DKQ A;  1K9U A;  2KYC A;  2HF5 A;  1A2X A;  2PSR A;  1S5G Y;  3CGA A;  3SIB A;  3K21 A;  1CDM A;  2NCP A;  3CR5 X;  3ZNI A;  2KI4 C;  3LK1 A;  1WRK A;  2F2P A;  1TCF A;  1JFK A;  4MN0 A;  3A4U B;  4NQG A;  2L4H A;  1MR8 A;  1XA5 A;  4OV2 A;  1ODB A;  1XFU O;  2JC2 A;  4PCW A;  1A75 B;  1Y1U A;  2E6W A;  2LLS A;  1L7Z A;  1NWD A;  3E3R A;  1XVJ A;  1TRF A;  1DJW A;  1K9P A;  4C0K A;  3I5I B;  3EK8 A;  3EKH A;  5DKR A;  3FS7 A;  4WQ2 A;  2JXL A;  2K61 A;  4PAL A;  5AFP A;  4BY5 A;  2LVV A;  5FYX A;  1A03 A;  2BL0 B;  2JT8 A;  3BUW B;  2HQ8 A;  3FWB A;  1DVI A;  2LAN A;  1YUU A;  3I5F C;  4C0J A;  1BU3 A;  4P5O E;  3DVM A;  2QAC A;  3JVT B;  3KEV A;  1EL4 A;  1XFZ O;  1LXF C;  1F70 A;  4M2O A;  2MAZ A;  1LA3 A;  1GQM A;  1SCM B;  2CBL A;  2KHN A;  1WDC C;  1CDN A;  2MJW B;  3LL8 B;  2L98 A;  2F33 A;  2G9B A;  3QRX A;  1OMR A;  1UUS A;  2I2R E;  1PK0 D;  1PUL A;  1QLK A;  1RRO A;  2KFH A;  2Y1M A;  2NCO A;  2JXC A;  1IH0 A;  3CTN A;  1SYM A;  2HET A;  3BYA A;  1CFP A;  2B1U A;  1E8A A;  3VGO A;  1L2O B;  2ZN9 A;  3CZT X;  1QV0 A;  2BEC A;  1NCZ A;  2GV5 A;  2KSP A;  1OMD A;  1BR4 B;  1J1E A;  5AXI A;  1NSH A;  1TNP A;  3D0Y A;  4ETO A;  2L5X B;  1UUR A;  5AAN A;  1TNQ A;  3I5H B;  1KQV A;  1SR6 B;  1ALW A;  2AUC A;  1F71 A;  3RM1 A;  5KTY A;  2PAL A;  1EG3 A;  3EK7 A;  2AAO A;  2PVB A;  1GGW A;  1W7I B;  1SK6 D;  2A4J A;  2GGM A;  2O60 A;  2K2A A;  2BKH B;  3O4Y A;  1FF1 A;  3A8R A;  1J7P A;  2ZKM X;  4USL A;  1YUS A;  1CMG A;  2KDH A;  1MQ1 A;  1QX7 A;  4Q04 A;  4OCI A;  4CFR A;  2H61 C;  1K95 A;  2EGD A;  4A4C A;  1SW8 A;  1F8H A;  1CTR A;  1QS7 A;  1SMG A;  1C7V A;  2BE6 A;  2NXQ A;  1Y0V H;  3H4S E;  3AKB A;  3CS1 A;  3ZWH A;  1S36 A;  2LVI A;  2Y1N A;  1EJ3 A;  3TS5 B;  1SL9 A;  1FI6 A;  3NSI A;  3AAK A;  1M46 A;  2M7L A;  1TOP A;  2E30 A;  2MHH A;  1SCV A;  1OOJ A;  5I2O A;  2MA2 A;  4GGF C;  1TTX A;  5HKW A;  1QTX A;  3DVE A;  3O78 A;  2H2K A;  3DF0 B;  3PFV A;  1KFU L;  2M8U A;  1LVC D;  1PSR A;  1XFX O;  2KAY A;  1JC2 A;  3CR2 A;  4GUK A;  2F3Z A;  4CLN A;  5CSI A;  1NUB A;  2KYF A;  5CPV A;  1B7T Z;  1D1O A;  1HQV A;  4PDZ A;  1QLS A;  4ORA B;  3WNX B;  5IBW A;  1H8B A;  2RGI A;  1DF0 A;  3SIA A;  4HRG A;  3BQ3 A;  2BE4 A;  1G33 A;  1VRK A;  1YRU B;  3EK4 A;  1OMV A;  1SKT A;  1U5I A;  1DJZ A;  5JOL A;  1FW4 A;  4TNC A;  1DGV A;  1PSB A;  1QV1 A;  1QVI Y;  2OPO A;  2L2E A;  3JTD B;  3VRP A;  2KI6 C;  1JFJ A;  1KFU S;  1RTP 1;  1UHN A;  2JPT A;  2ZFD A;  4I5L B;  4PE0 A;  5BPJ A;  1Y1X A;  3SJS A;  4MLW A;  2KNE A;  1RK9 A;  4MBE A;  3KPX A;  1UHH A;  4U8D A;  2OTG B;  2KQ6 A;  1F54 A;  1CDP A;  3GOF A;  1KK8 C;  2NZ0 A;  1KSM A;  2CT9 A;  3D10 A;  4PHM A;  1BR1 B;  2LLU A;  2Y4Q A;  1YRT B;  2FCE A;  1B8L A;  4M2Q A;  2FJU B;  3I5G B;  1A75 A;  2WCE A;  4CPV A;  1IJ5 A;  4GFT A;  1F4Q A;  3VRN A;  3WXA A;  1K90 D;  2CCM A;  1KK7 Y;  3NSL A;  1NX3 A;  1BT6 A;  1K94 A;  1WY9 A;  3BUM B;  1J55 A;  4YGA A;  2WC8 A;  5KU1 A;  1S5G Z;  4XJK A;  2L0P A;  5J3X A;  1CDL A;  3ICB A;  1MUX A;  2EC6 C;  5CSN A;  3SG5 A;  2CTN A;  2K7B A;  1RWY A;  2LHL A;  3SG7 A;  1PRW A;  1KFX L;  3VRQ A;  1CFF A;  1AVS A;  4GBA A;  3SG3 A;  2KI4 B;  1AHR A;  1CM4 A;  2KGB C;  2KI6 D;  2JWW A;  2L51 A;  3WHT B;  2R2I A;  1BF5 A;  1B9A A;  4YBH B;  2JOJ A;  1AK8 A;  1JSA A;  1X02 A;  1S1E A;  2M9G A;  1EXR A;  3GK4 X;  1NP8 A;  3IQO A;  2M29 A;  3F45 A;  2IS9 A;  2PRU A;  1F55 A;  1LIN A;  2HQW A;  1KQM C;  1QAS A;  1SPY A;  4MRX A;  2KFG A;  4HRE E;  1UHI A;  1Y6W A;  1B1G A;  1YX8 A;  4M2P A;  1UWO A;  1MXL C;  2K7O A;  1Y1A A;  2LNK A;  4OR9 B;  5GQQ C;  3DD4 A;  4QJ3 B;  1RJV A;  1J7R A;  4P2Y B;  1DJH A;  1PAL A;  5KSZ A;  1KFX S;  3VRR A;  5HKY A;  1ZAC A;  1PVA A;  5AER A;  4FQO A;  3OX6 A;  1K2H A;  1S3P A;  2LVJ A;  5CSF A;  3OHM B;  1ZFS A;  1DGU A;  1BG1 A;  2JNX A;  2M49 B;  1TNX A;  3BOW B;  4WQ3 A;  3KHE A;  2QPT A;  2KAX A;  4N1F A;  4OVN F;  1NIW A;  4XYN A;  5DKN A;  2LLT A;  3I5F B;  1DJI A;  4MVF A;  1CNP A;  1WLZ A;  2LAP A;  3LCP C;  1XK4 A;  1BJF A;  2MLF C;  1WDC B;  1CFC A;  1A4P A;  2F2O A;  1DTL A;  1IGV A;  3PM8 A;  3SG4 A;  1K8U A;  5HLV A;  2I18 A;  4YGC B;  3PLF B;  2LMU A;  3LK0 A;  4UPG A;  4MEW A;  5ER4 X;  1QX5 B;  1N2D A;  3KO0 A;  4FTG A;  4AOM A;  1A29 A;  2EHB A;  2JNF A;  1V1G A;  2CXJ A;  1C07 A;  3HX4 A;  1ALV A;  1CLB A;  3PN7 C;  1BOD A;  4I5J A;  2G2B A;  2KBM A;  1OQP A;  3VRO A;  2OS8 C;  2PMY A;  2Q4U A;  3OB1 B;  1MWN A;  2K8M B;  2F8P A;  1N65 A;  4GAO A;  2ISD A;  1LKJ A;  2WOR A;  4ORB B;  4CID A;  5HYD A;  3NSO A;  1BMO A;  3O6B A;  1YX7 A;  1B4C A;  1EG4 A;  4ICB A;  1DJY A;  3CLN A;  1CKK A;  3BXK A;  2K7D A;  2ZRT A;  2JT0 A;  3BUX B;  1QIV A;  3EVV A;  3BUO B;  5K89 A;  1OSA A;  1QXP A;  3PAL A;  3SG2 A;  2LUC A;  4A4B A;  5I2Q A;  2MLE C;  3SG6 A;  1UHJ A;  2KBI A;  2LVK A;  2MRD A;  4I5N B;  4PHK A;  4I5K A;  1UHK A;  1NX0 A;  1NPQ A;  2D8N A;  4MRY A;  5I8N A;  1QX2 A;  1DF0 B;  1K93 D;  1EH2 A;  3KF9 A;  1IJ6 A;  1AJ5 A;  5F6T A;  1HT9 A;  3NXA A;  4YGB B;  4MZK A;  4YI8 A;  4OKH A;  3C1V A;  1SL7 A;  3CR4 X;  3TDZ A;  1IKU A;  3I5I C;  1M45 A;  1WRL A;  3M0W A;  4GGN A;  4F0Z B;  1BOC A;  1MF8 B;  2BKI B;  5PAL A;  1AJ4 A;  2LP2 A;  4PE4 A;  1FBV A;  2P6B B;  2BL0 C;  4ZCV A;  2HPS A;  2LCP A;  1ZMZ A;  1B8C A;  2JQ6 A;  1XYD A;  2K7C A;  2JRF A;  4DRW A;  2WOS A;  2K2F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...