2EGDA

Crystal structure of human s100a13 in the ca2+-bound state
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
86
structure length
86
Chain Sequence
b'PLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A13
publication title Crystal structure of human S100A13 in the Ca2+-bound state
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 28
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2egdA00
1EL4A 3QRXA 2M1UA 4FQOA 1YRTB 1IJ6A 4N1GA 1IRJA 2BKHB 1SCMC 3VRPA 2BCXA 2MJWB 2LVJA 2GGZA 3OP0A 4MEWA 3NSLA 2BKIB 1TCOB 1B8CA 2K7DA 4MLWA 3TZ1A 1YUTA 1IWQA 1YURA 4Q04A 1G8IA 4DS7A 3I5IC 3CR4X 2LM5A 1S3PA 1ALWA 1DGUA 4DCKA 1XA5A 3WHTB 2BBNA 2AUCA 1DJYA 1F4QA 1SRAA 2LUXA 3OX6A 2K2FA 4ICBA 1KFUS 4NDBA 1ZMZA 1GGZA 2LHIA 1CDNA 2K7OA 2WOSA 2L50A 2KDHA 1DF0A 1JUOA 1S6IA 2L4IA 1EXRA 5KSZA 1H4BA 2F8PA 1RECA 2MHHA 3VRRA 3SIBA 2I94A 5CPVA 1DJHA 1MWNA 5B8IB 1KK7Z 2BCBA 4PDZA 3OB1B 2K2AA 1A29A 2L2EA 2ZFDA 1TTXA 2CNPA 2RGIA 3A4UB 1ALVA 3O78A 4GUKA 4P5OE 1QTXA 1RFJA 2JC2A 1C7VA 2F33A 4GBAA 1BJFA 2NLNA 1RTP1 2KHNA 1OZOA 2VRGA 1A75A 4N5XA 1EH2A 2BE6A 4QJ3B 2Y5IA 3EK4A 1SR6C 2O60A 4GPLB 5D7FA 5KTYA 2MA2A 2JT0A 3TDIA 2M3WA 4C0JA 1LA3A 1OMDA 2AMIA 1XVJA 2JT3A 5IBWA 1EJ3A 3KHEA 1YVHA 1B47A 2JNXA 2MLEC 2KAVA 2LLUA 2Q4UA 3SG7A 1DVIA 1CDPA 3PN7B 1LXFC 1AJ5A 1TCFA 3JTDC 1CDLA 1DJZA 2LMTA 3RM1A 2HF5A 4PALA 3CTNA 2E6WA 4XYNA 1KFXS 1JFJA 2H2KA 5TNCA 2JULA 2ZN8A 1KK8B 4HREE 4CPVA 1KQVA 2HQ8A 4U8DA 5I8NA 1NCZA 4PHNA 1GGWA 3HCMA 4JQ0D 4IL1A 2P6BB 3F45A 3CZTX 4E68A 5PALA 1F71A 2ZNDA 5AEQA 2NXQA 2QPTA 2JPTA 2LNKA 4P2YB 3CR5X 4TNCA 1L7ZA 1XFVO 1C07A 5GQQC 4DIRA 3EVRA 5FYXA 1DJGA 1CLLA 3KPXA 2ZKMX 4YGBB 4JWQA 1UURA 2KYFA 2EC6C 4WQ2A 5CSFA 3BOWB 3IQOA 3I5FB 2BBMA 3I5HB 1IG5A 4GAOA 4ETOA 5HLVA 1CFCA 1J55A 4PHJA 1CM4A 1B8LA 1XFXO 2KI4C 2KI6D 4FTGA 2K8MB 3AAJA 4MVFA 2EHBA 2JTTA 3PLFB 1IQ3A 1D1OA 1EG3A 1NPQA 1L2OC 1NX2A 4JPZB 2LAPA 1B9AA 2CXJA 1SCVA 1WLZA 3SG6A 1ODBA 1QX7A 2D8NA 3OB2B 1KQMC 3CS1A 2LHLA 1KFXL 1FF1A 2E30A 4CLNA 1V1GA 1PULA 2LMUA 4MZLA 1DJIA 3CLNA 2LP2A 4YBHB 5ER5A 1CLMA 3SG5A 1PSBA 1YX8A 4UPGA 2KFHA 1U5IA 3KEVA 3M0WA 3PATA 3PM8A 4I5JA 1AJ4A 4D1EA 5HKYA 1GQMA 1SY9A 2BE4A 1TNXA 1MF8B 1SL8A 2F3YA 2AAOA 1NX1A 1MXEA 1SMGA 2KQYA 4ORBB 1YTZC 4A4CA 3NSIA 1FI5A 4MRXA 1CDMA 3BUMB 3GK1A 4DUQA 1J1DA 3BXKA 3FWBA 3I5IB 1WRZA 2R2IA 1K9KA 2M49B 4AOMA 1E8AA 3SG3A 1JF2A 1OQPA 2MLFC 1IQ5A 1FI6A 2KGBC 1SK6D 1SBJA 2KYCA 1WY9A 1XYDA 1QLKA 2M97A 3OHMB 1QVIY 1OZSA 1N65A 2OTGC 1K94A 1CNPA 2JQ6A 3NSKA 1K9UA 1S26D 1CFFA 3IF7A 3LCPC 1A4PA 3FS7A 1YVLA 2HQWA 3HX4A 4MZKA 1MUXA 2KFGA 4WQ3A 2JU0A 1WDCC 1QASA 1SW8A 2I2RE 2LV7A 1J7PA 4ZCUA 1CB1A 1R6PA 4BY4A 3GK2A 1NP8A 2MBXA 4YGAA 1BR4B 2PALA 2ZRSA 3D0YA 1UUSA 1WRKA 1FBVA 2L5XB 2K61A 1QLSA 2DOQA 1PK0D 1SR6B 1OE9B 1UHHA 3EKJA 1CLBA 2JRFA 2KFFA 1F4OA 2JOJA 1K96A 5AERA 2SASA 3CR2A 4YI9A 1MQ1A 1DTLA 1QJTA 1A03A 4OKHA 4AQIA 1NYAA 3BQ3A 1SNLA 2F2OA 1B7TY 2F2PA 4ORCB 2COLB 2WNDA 4WRIA 1M63B 2KNEA 2JXLA 1YRUB 1OSAA 3JTDB 1A75B 2KQ6A 2FCEA 3I5GB 2QACA 4ORAB 3SG4A 1CM1A 1YR5A 2IS9A 2M7NA 4MN0A 1CFPA 4MBEA 2LMVA 4XJKA 1BT6A 2CTNA 2WCFA 1TIZA 3SJSA 4GGFA 3PFVA 3O4YA 1MHOA 1M39A 2FCDA 2Q91A 1KWOC 3TUYC 1Y1XA 3PSRA 3VGOA 4A4BA 4I5NB 5HLOA 4HSZA 4MSPA 4PHMA 2CT9A 1IGVA 1AHRA 1MXLC 2GGMA 2L98A 2M29A 2OS8C 2B1UA 3WHUB 1B8RA 1KSMA 1SYMA 1BG1A 4CFQA 1V1FA 1QV0A 4OV2A 2EC6B 1UHJA 2LLSA 3FIAA 1J7RA 1UHKA 2JXCA 3BOWA 5BPJA 1BOCA 4GGFC 2LP3A 1XFUO 2WC8A 1HQVA 3ZNIA 4BY5A 1JFKA 1N2DA 1IH0A 1QS7A 4HRGA 1QV1A 1J1EA 4GFTA 2KI4B 1UHIA 2ISDA 1PVBA 1S5GY 1TNPA 1RJVA 1YX7A 1WLMA 1CMGA 3E3RA 3OX5A 1XFZO 1L2OB 3SG2A 4GNKB 3VRQA 3WXAA 4PCWA 2BCAA 2NZ0A 2WORA 1JWDA 2M9GA 5DKNA 2M8UA 1RWYA 1IKUA 1LINA 1X02A 1KQMB 4N1FA 4ZCVA 5I2OA 1UP5A 1BR1B 3LL8B 1S6JA 1NCYA 5CSNA 1G4YR 1VRKA 1QIVA 4NDCA 1NX3A 2EGDA 1MR8A 1F55A 3DF0B 1HT9A 3TDUA 3KF9A 3TDZA 4C0LA 1OOJA 1S1EA 2G9BA 5AXIA 2FJUB 3TS5C 1BF5A 4R1EA 1QATA 1SCMB 2JT8A 4CFRA 1XK4A 1JC2A 1UWOA 1QXPA 3EVVA 4M2OA 1S36A 2I18A 3IQQA 2BL0C 2Y1NA 2FOTA 1Y6WA 1M45A 1ZOTB 2KI6C 1NIWA 3JVTC 3A8RA 3LK0A 2PVBA 3GK4X 1JF0A 1CTRA 4MRYA 2TN4A 2LE9B 2LVKA 1K95A 3ICBA 2LC5A 2M1KB 2Y1MA 1R2UA 5CSIA 1XK4C 2OTGB 2K7BA 2WCEA 2L51A 3EK7A 5HKWA 4PE1A 1IJ5A 3EKHA 5I2QA 2BECA 1NSHA 2JZIA 1K93D 1TNQA 2V53A 5KU1A 2CCMA 1AVSA 2OPOA 1WDCB 1JSAA 3AAKA 4YGEB 1K9PA 1QVIZ 2CBLA 3K21A 4DRWA 1KK7Y 3CWGA 1K8UA 2JWWA 1TN4A 2MAZA 2ZNEA 3PALA 2G2BA 4YGDB 2LVVA 1DMOA 1DF0B 2GV5A 1B1GA 2K7CA 4QJ4B 1Y0VH 1DJXA 1RK9A 2JTZA 2ZRTA 1PSRA 3DVMA 3NXAA 1BU3A 5CSJA 3LK1A 1XO5A 1F70A 1Y1UA 2LVIA 3SIAA 4OVNF 3LLEA 4CIDA 1DGVA 2M0RA 1N0YA 2M7LA 3MSEB 3O2PA 1GJYA 2HPSA 4F0ZB 5G08A 1J7OA 1XFYO 5DKRA 5I2LA 4QJ5B 1BMOA 5K89A 5JOLA 1FW4A 3D0YB 1YUSA 4M2PA 4GGNA 1SPYA 1KCYA 1M31A 4M2QA 4PE0A 5JJGA 1UHNA 2LUCA 5AANA 1K90D 3VRNA 1QX2A 3KO0A 1LKJA 1QX5B 1Q80A 1JBAA 1TRFA 3DVEA 1G33A 2H61A 1B7TZ 3H4SE 3BYAA 2WCBA 2PASA 1CMFA 3GOFA 4I5KA 5DKQA 4YRUA 1KWOB 3TUYB 1LA0A 3BUOB 1J7QA 1KFUL 1NWDA 2NCPA 3EVUA 4PHKA 2ZN9A 3PN7C 1BODA 2SCPA 4NDDA 2OS8B 2LCPA 5D69A 4NQGA 3I5GC 1H8BA 1DJWA 1TOPA 1PVAA 1KK8C 1AK8A 4XJKB 3AKAA 2H61C 4L9MA 2L4HA 1Y1AA 1A2XA 3CGAA 1KSOA 2KBIA 4YGCB 2LANA 1LVCD 4I5LB 5AFPA 1AP4A 4OCIA 1TNWA 2KGRA 4HRHA 4AQJA 3NSOA 3BUWB 3FWCA 2LLTA 3C1VA 1CFDA 1F8HA 1SL9A 2I7AA 1OMRA 2MRDA 2L0PA 1SKTA 2KAXA 2KOTA 3DD4A 3EK8A 5ER4X 5J3XA 2PMYA 1YUUA 1NCXA 2F3ZA 4YI8A 3BUXB 1PRWA 2HETA 3I5FC 1W7IB 1S5GZ 1W7JB 2JNFA 3I5HC 1OMVA 3O6BA 1S6CA 3DF0A 1FPWA 1K2HA 2PSRA 2PRUA 3DVKA 1QIWA 3DVJA 1WRLA 4PE4A 1F54A 5F6TA 2KSPA 1CKKA 3TS5B 4USLA 1M46A 1ZACA 2O5GA 1SL7A 5HKZA 3ZWHA 5HYDA 1BLQA 2KAYA 2K0JA 2A4JA 2NCOA 1C7WA 2Y4QA 2KBMA 4PE7A 1EG4A 2BL0B 3D10A 1NUBA 1B4CA 3WNXB 1ZFSA 1RROA 1DT7B 4OR9B 3RLZA 3AKBA 4MZJA 4C0KA 3JVTB 1NX0A 1XFWO 1ZUZA 1PALA 3BUNB 1AUIB 1U5IB 3VROA
chains in the Genus database with same CATH superfamily
1EL4A 3QRXA 4PT1A 2M1UA 4FQOA 5HL1A 1YRTB 1IJ6A 4N1GA 1IRJA 2BKHB 1SCMC 3VRPA 2BCXA 2MJWB 2LVJA 2GGZA 2WCKA 3OP0A 4MEWA 3NSLA 2BKIB 3L47A 1TCOB 1B8CA 2K7DA 4MLWA 3TZ1A 1YUTA 1IWQA 1YURA 4Q04A 1G8IA 4DS7A 3I5IC 3CR4X 2LM5A 1S3PA 1ALWA 1DGUA 4DCKA 1XA5A 1W9ZA 3WHTB 2BBNA 2AUCA 1DJYA 1F4QA 1SRAA 2LUXA 3OX6A 5FI7A 2K2FA 4ICBA 1KFUS 1GM0A 3BFAA 1ZMZA 1GGZA 4NDBA 2WCHA 2LHIA 3CZ1A 1CDNA 2K7OA 2WOSA 2L50A 2KDHA 1DF0A 1JUOA 1S6IA 2L4IA 1EXRA 5KSZA 1H4BA 2F8PA 1RECA 3SS3A 2MHHA 3VRRA 3SIBA 2L5YA 2I94A 5CPVA 1DJHA 1MWNA 5B8IB 1KK7Z 2BCBA 4PDZA 3OB1B 2K2AA 1A29A 2L2EA 2ZFDA 1TTXA 2CNPA 2RGIA 3A4UB 1ALVA 3O78A 4GUKA 2QDIA 4P5OE 1QTXA 1RFJA 3R1VA 2JC2A 1C7VA 2F33A 4GBAA 1BJFA 2NLNA 1RTP1 2KHNA 1OZOA 2VRGA 1A75A 4N5XA 1EH2A 2BE6A 4QJ3B 2JPOA 2Y5IA 3EK4A 1SR6C 2O60A 4GPLB 5D7FA 3CZ2A 5KTYA 2MA2A 3NHIA 2JT0A 3TDIA 3VB1A 2M3WA 3D74A 4C0JA 1LA3A 1OMDA 3B6XA 2AMIA 1XVJA 2JT3A 5IBWA 1SSEB 1EJ3A 3KHEA 1YVHA 1B47A 2JNXA 2MLEC 3OGNA 2KAVA 2LLUA 2Q4UA 3SG7A 3PJIA 1DVIA 1CDPA 3PN7B 1LXFC 2H8VA 1AJ5A 1TCFA 3JTDC 1CDLA 1DJZA 2LMTA 3RM1A 2HF5A 4PALA 3CTNA 2E6WA 4XYNA 1KFXS 1JFJA 2H2KA 5TNCA 2JULA 2ZN8A 1KK8B 4INWA 2P71A 4HREE 4CPVA 1KQVA 2HQ8A 4U8DA 5I8NA 1NCZA 4PHNA 1GGWA 3HCMA 4JQ0D 4IL1A 2P6BB 3F45A 3CZTX 4E68A 1Z2CB 3NGVA 5PALA 1F71A 2ZNDA 1IIOA 5AEQA 2NXQA 2QPTA 2JPTA 2KLEA 2LNKA 4P2YB 2FJYA 3CR5X 4TNCA 1L7ZA 1XFVO 1C07A 5GQQC 4DIRA 3EVRA 5FYXA 1DJGA 1CLLA 3B86A 2ZKMX 3KPXA 4YGBB 4JWQA 1UURA 2KYFA 2EC6C 4WQ2A 5CSFA 3BOWB 3IQOA 3I5FB 1TWOA 2BBMA 3I5HB 1IG5A 4GAOA 4ETOA 5HLVA 1CFCA 1J55A 4PHJA 1CM4A 1B8LA 1XFXO 2KI4C 2KI6D 2WCJA 4FTGA 3SS4A 2K8MB 3AAJA 4MVFA 2EHBA 2JTTA 1OOGA 3PLFB 1IQ3A 3S0GA 1EG3A 1NPQA 1L2OC 1NX2A 4JPZB 2LAPA 3B7AA 1D1OA 3S0FA 1B9AA 2CXJA 1SCVA 1WLZA 3SG6A 1ODBA 1QX7A 2D8NA 3OB2B 1KQMC 3CS1A 2LHLA 1KFXL 1FF1A 2E30A 4CLNA 1V1GA 1PULA 2LMUA 3UO9A 4MZLA 1DJIA 1OOHA 3CLNA 2LP2A 4YBHB 5ER5A 1CLMA 3SG5A 1PSBA 1YX8A 3D77A 2KFHA 1U5IA 3KEVA 3M0WA 3PATA 3PM8A 4I5JA 4UPGA 1AJ4A 4D1EA 5HKYA 1GQMA 1SY9A 1TNXA 2BE4A 1MF8B 1SL8A 2F3YA 2AAOA 1NX1A 3DZTA 1MXEA 1SMGA 2KQYA 4ORBB 1YTZC 4A4CA 1XFRA 2WC5A 3NSIA 4MRXA 1CDMA 1FI5A 3BUMB 3GK1A 4DUQA 1J1DA 3BXKA 3NHTA 3FWBA 3I5IB 1WRZA 3R1PA 2R2IA 3BFHA 3S0DA 1K9KA 2M49B 3UNWA 2WCLA 4AOMA 1E8AA 3SG3A 1JF2A 1OQPA 2MLFC 3L4AA 1IQ5A 1FI6A 2KGBC 1SK6D 1SBJA 2KYCA 1WY9A 1XYDA 1QLKA 3S0EA 2M97A 3OHMB 1QVIY 1OZSA 1N65A 2OTGC 1K94A 1CNPA 2JQ6A 3NSKA 1K9UA 1S26D 3N7HA 1CFFA 3IF7A 3LCPC 1A4PA 3FS7A 1YVLA 5I94A 2HQWA 2KPHA 3HX4A 4MZKA 3FE8A 1MUXA 2KFGA 4WQ3A 2JU0A 1WDCC 1QASA 3K1EA 1DELA 1SW8A 1DEKA 2WCMA 2I2RE 2LV7A 2QEHA 1J7PA 4ZCUA 1CB1A 5FI2A 1R6PA 3CZ0A 4BY4A 2P70A 3GK2A 3R72A 1NP8A 2MBXA 4YGAA 1BR4B 2PALA 2ZRSA 3D0YA 1UUSA 1WRKA 1FBVA 2L5XB 2K61A 1QLSA 2DOQA 1PK0D 1SR6B 1OE9B 1UHHA 3EKJA 1CLBA 2JRFA 2KFFA 1F4OA 2JOJA 1K96A 3R1OA 5AERA 2SASA 3CR2A 4YI9A 1MQ1A 1DTLA 1QJTA 1A03A 4OKHA 4AQIA 2BAPA 1NYAA 3BQ3A 1SNLA 2F2OA 1B7TY 2F2PA 4ORCB 2COLB 2WNDA 4WRIA 1M63B 2KNEA 2JXLA 1YRUB 1OSAA 3JTDB 1A75B 2KQ6A 2FCEA 3I5GB 2QACA 4ORAB 3SG4A 1CM1A 1YR5A 2IS9A 2M7NA 4MN0A 3V2LA 1CFPA 4MBEA 2LMVA 1QWVA 4XJKA 1BT6A 4OZDA 2CTNA 2WCFA 1TIZA 3SJSA 4GGFA 3PFVA 3O4YA 1MHOA 1M39A 2FCDA 2Q91A 1KWOC 3TUYC 1Y1XA 3PSRA 3VGOA 4A4BA 4I5NB 5HLOA 4HSZA 3O4XA 4MSPA 4PHMA 1DC1A 2CT9A 1IGVA 1AHRA 1MXLC 2GGMA 2L98A 2M29A 2OS8C 2B1UA 3WHUB 1B8RA 1KSMA 1SYMA 1BG1A 1T14A 1V1FA 4CFQA 1QV0A 4OV2A 2EC6B 1UHJA 2LLSA 3FIAA 1J7RA 1UHKA 2JXCA 3BOWA 5BPJA 1BOCA 4GGFC 2LP3A 1XFUO 1DQEA 2WC8A 1HQVA 3ZNIA 4BY5A 1JFKA 1N2DA 1IH0A 1QS7A 4HRGA 1QV1A 1J1EA 4GFTA 1OOIX 2KI4B 4FQTA 1UHIA 2QEVA 2ISDA 1PVBA 3D76A 1S5GY 1TNPA 1RJVA 1YX7A 1WLMA 1CMGA 3E3RA 3OX5A 1XFZO 1L2OB 1Z4HA 3SG2A 4GNKB 3VRQA 3WXAA 4PCWA 2BCAA 2NZ0A 2WORA 1JWDA 2M9GA 5DKNA 2M8UA 1RWYA 1IKUA 1LINA 1X02A 1KQMB 4N1FA 4ZCVA 5I2OA 1UP5A 1BR1B 3LL8B 1S6JA 1NCYA 5CSNA 1G4YR 1VRKA 1QIVA 3B87A 4NDCA 1NX3A 2EGDA 1MR8A 1F55A 3DF0B 1HT9A 3TDUA 3KF9A 3QMEA 3TDZA 4C0LA 1OOJA 1S1EA 3D73A 2G9BA 1TUZA 5AXIA 2FJUB 3DYEA 3TS5C 1BF5A 4R1EA 1QATA 1SCMB 2JT8A 4CFRA 1XK4A 1JC2A 1UWOA 1QXPA 3EVVA 4M2OA 1S36A 2I18A 3IQQA 2BL0C 3FE9A 2Y1NA 2FOTA 1Y6WA 1M45A 1ZOTB 3S0AA 2KI6C 1NIWA 3JVTC 3A8RA 2QEBA 3LK0A 2PVBA 3GK4X 1JF0A 3D75A 1CTRA 4MRYA 2TN4A 2LE9B 2LVKA 1K95A 1OW4A 3ICBA 2LC5A 2M1KB 2Y1MA 1R2UA 5CSIA 1XK4C 3CABA 2OTGB 2K7BA 1C3YA 2BNXA 2WCEA 2L51A 3EK7A 5HKWA 4PE1A 1IJ5A 3EKHA 5I2QA 2BECA 1NSHA 2JZIA 1K93D 1TNQA 1OOFA 2V53A 5KU1A 2CCMA 1AVSA 2OPOA 1WDCB 1JSAA 3AAKA 4YGEB 1K9PA 3BFBA 1C3ZA 1QVIZ 5DICA 2CBLA 3K21A 4DRWA 1KK7Y 3CWGA 1K8UA 2JWWA 1TN4A 2MAZA 2ZNEA 3PALA 2G2BA 3Q8IA 2LVVA 4YGDB 1DMOA 1DF0B 2GV5A 1B1GA 2K7CA 4QJ4B 1Y0VH 3DY9A 3S0BA 1DJXA 1RK9A 2GTEA 2JTZA 2ZRTA 1PSRA 3DVMA 3L4LA 3NXAA 5FI6A 1BU3A 3IVTA 2L2CA 5CSJA 3LK1A 1TUJA 1XO5A 1F70A 3CYZA 1Y1UA 2LVIA 3SIAA 2WC6A 4OVNF 3LLEA 4CIDA 1DGVA 2M0RA 1N0YA 3FE6A 2M7LA 3MSEB 3O2PA 1GJYA 2HPSA 4F0ZB 5G08A 1J7OA 1XFYO 5DKRA 5I2LA 4QJ5B 1BMOA 5K89A 4JD9A 5JOLA 1FW4A 3D0YB 1YUSA 4M2PA 4GGNA 1SPYA 2PQLA 1KCYA 1M31A 4M2QA 4PE0A 5JJGA 1UHNA 2LUCA 5AANA 1K90D 3VRNA 1QX2A 3KO0A 3PM2A 1LKJA 1QX5B 1Q80A 1JBAA 1TRFA 3DVEA 1G33A 2H61A 1B7TZ 3BJHA 3H4SE 3BYAA 2WCBA 2PASA 1CMFA 3GOFA 4I5KA 5DKQA 4YRUA 1KWOB 3TUYB 1LA0A 3BUOB 4KYNA 1KFUL 1J7QA 1NWDA 2K60A 2NCPA 3EVUA 4PHKA 2ZN9A 3PN7C 1BODA 2SCPA 4NDDA 2OS8B 2LCPA 5D69A 4NQGA 3I5GC 1H8BA 1DJWA 1TOPA 1PVAA 2QEOA 1KK8C 1AK8A 4XJKB 3AKAA 2H61C 4L9MA 2L4HA 1Y1AA 1A2XA 3CGAA 1KSOA 1ORGA 2KBIA 4YGCB 2LANA 1LVCD 4I5LB 5AFPA 1AP4A 4OCIA 1TNWA 2KGRA 3D78A 4HRHA 3NSOA 2ERBA 3BUWB 3FWCA 2LLTA 3C1VA 4AQJA 1CFDA 3RZSA 1F8HA 1SL9A 2I7AA 1OMRA 2MRDA 2L0PA 4INXA 1SKTA 2KAXA 2KOTA 3DD4A 3B88A 3SS5A 3EK8A 5ER4X 5J3XA 2PMYA 1YUUA 1NCXA 2F3ZA 4IJ7A 4YI8A 3BUXB 1PRWA 2HETA 3I5FC 1W7IB 1S5GZ 1W7JB 2JNFA 3I5HC 1OMVA 3O6BA 1S6CA 1LS8A 3DF0A 1FPWA 1K2HA 2PSRA 2PRUA 3DVKA 4JKTA 1QIWA 3DVJA 1WRLA 4PE4A 5EL2A 1F54A 3EG5B 2KSPA 5F6TA 1CKKA 3TS5B 3OBVA 4USLA 1M46A 1ZACA 2O5GA 1SL7A 2YGUA 5HKZA 3ZWHA 1P28A 5HYDA 1BLQA 2KAYA 2K0JA 2A4JA 2NCOA 5D3OA 1C7WA 2PYQA 2Y4QA 2KBMA 2KLDA 4PE7A 1EG4A 2BL0B 3D10A 1NUBA 3DXLA 4F7FA 3CDNA 1B4CA 3WNXB 1ZFSA 1RROA 1DT7B 4OR9B 3RLZA 3AKBA 4MZJA 4C0KA 3JVTB 1NX0A 1XFWO 1ZUZA 1PALA 3BUNB 1AUIB 1U5IB 3VROA
chains in the Genus database with same CATH topology
1EL4A 3QRXA 2M1UA 4FQOA 1YRTB 1IJ6A 4N1GA 1IRJA 2BKHB 1SCMC 3VRPA 2BCXA 2MJWB 2LVJA 2GGZA 3OP0A 4MEWA 3NSLA 2BKIB 1TCOB 1B8CA 2K7DA 4MLWA 3TZ1A 1YUTA 1IWQA 1YURA 4Q04A 1G8IA 4DS7A 3I5IC 3CR4X 2LM5A 1S3PA 1ALWA 1DGUA 4DCKA 1XA5A 3WHTB 2BBNA 2AUCA 1DJYA 1F4QA 1SRAA 2LUXA 3OX6A 2K2FA 4ICBA 1KFUS 4NDBA 1ZMZA 1GGZA 2LHIA 1CDNA 2K7OA 2WOSA 2L50A 2KDHA 1DF0A 1JUOA 1S6IA 2L4IA 1EXRA 5KSZA 1H4BA 2F8PA 1RECA 2MHHA 3VRRA 3SIBA 2I94A 5CPVA 1DJHA 1MWNA 5B8IB 1KK7Z 2BCBA 4PDZA 3OB1B 2K2AA 1A29A 2L2EA 2ZFDA 1TTXA 2CNPA 2RGIA 3A4UB 1ALVA 3O78A 4GUKA 4P5OE 1QTXA 1RFJA 2JC2A 1C7VA 2F33A 4GBAA 1BJFA 2NLNA 1RTP1 2KHNA 1OZOA 2VRGA 1A75A 4N5XA 1EH2A 2BE6A 4QJ3B 2Y5IA 3EK4A 1SR6C 2O60A 4GPLB 5D7FA 5KTYA 2MA2A 2JT0A 3TDIA 2M3WA 4C0JA 1LA3A 1OMDA 2AMIA 1XVJA 2JT3A 5IBWA 1EJ3A 3KHEA 1YVHA 1B47A 2JNXA 2MLEC 2KAVA 2LLUA 2Q4UA 3SG7A 1DVIA 1CDPA 3PN7B 1LXFC 1AJ5A 1TCFA 3JTDC 1CDLA 1DJZA 2LMTA 3RM1A 2HF5A 4PALA 3CTNA 2E6WA 4XYNA 1KFXS 1JFJA 2H2KA 5TNCA 2JULA 2ZN8A 1KK8B 4HREE 4CPVA 1KQVA 2HQ8A 4U8DA 5I8NA 1NCZA 4PHNA 1GGWA 3HCMA 4JQ0D 4IL1A 2P6BB 3F45A 3CZTX 4E68A 5PALA 1F71A 2ZNDA 5AEQA 2NXQA 2QPTA 2JPTA 2LNKA 4P2YB 3CR5X 4TNCA 1L7ZA 1XFVO 1C07A 5GQQC 4DIRA 3EVRA 5FYXA 1DJGA 1CLLA 3KPXA 2ZKMX 4YGBB 4JWQA 1UURA 2KYFA 2EC6C 4WQ2A 5CSFA 3BOWB 3IQOA 3I5FB 2BBMA 3I5HB 1IG5A 4GAOA 4ETOA 5HLVA 1CFCA 1J55A 4PHJA 1CM4A 1B8LA 1XFXO 2KI4C 2KI6D 4FTGA 2K8MB 3AAJA 4MVFA 2EHBA 2JTTA 3PLFB 1IQ3A 1D1OA 1EG3A 1NPQA 1L2OC 1NX2A 4JPZB 2LAPA 1B9AA 2CXJA 1SCVA 1WLZA 3SG6A 1ODBA 1QX7A 2D8NA 3OB2B 1KQMC 3CS1A 2LHLA 1KFXL 1FF1A 2E30A 4CLNA 1V1GA 1PULA 2LMUA 4MZLA 1DJIA 3CLNA 2LP2A 4YBHB 5ER5A 1CLMA 3SG5A 1PSBA 1YX8A 4UPGA 2KFHA 1U5IA 3KEVA 3M0WA 3PATA 3PM8A 4I5JA 1AJ4A 4D1EA 5HKYA 1GQMA 1SY9A 2BE4A 1TNXA 1MF8B 1SL8A 2F3YA 2AAOA 1NX1A 1MXEA 1SMGA 2KQYA 4ORBB 1YTZC 4A4CA 3NSIA 1FI5A 4MRXA 1CDMA 3BUMB 3GK1A 4DUQA 1J1DA 3BXKA 3FWBA 3I5IB 1WRZA 2R2IA 1K9KA 2M49B 4AOMA 1E8AA 3SG3A 1JF2A 1OQPA 2MLFC 1IQ5A 1FI6A 2KGBC 1SK6D 1SBJA 2KYCA 1WY9A 1XYDA 1QLKA 2M97A 3OHMB 1QVIY 1OZSA 1N65A 2OTGC 1K94A 1CNPA 2JQ6A 3NSKA 1K9UA 1S26D 1CFFA 3IF7A 3LCPC 1A4PA 3FS7A 1YVLA 2HQWA 3HX4A 4MZKA 1MUXA 2KFGA 4WQ3A 2JU0A 1WDCC 1QASA 1SW8A 2I2RE 2LV7A 1J7PA 4ZCUA 1CB1A 1R6PA 4BY4A 3GK2A 1NP8A 2MBXA 4YGAA 1BR4B 2PALA 2ZRSA 3D0YA 1UUSA 1WRKA 1FBVA 2L5XB 2K61A 1QLSA 2DOQA 1PK0D 1SR6B 1OE9B 1UHHA 3EKJA 1CLBA 2JRFA 2KFFA 1F4OA 2JOJA 1K96A 5AERA 2SASA 3CR2A 4YI9A 1MQ1A 1DTLA 1QJTA 1A03A 4OKHA 4AQIA 1NYAA 3BQ3A 1SNLA 2F2OA 1B7TY 2F2PA 4ORCB 2COLB 2WNDA 4WRIA 1M63B 2KNEA 2JXLA 1YRUB 1OSAA 3JTDB 1A75B 2KQ6A 2FCEA 3I5GB 2QACA 4ORAB 3SG4A 1CM1A 1YR5A 2IS9A 2M7NA 4MN0A 1CFPA 4MBEA 2LMVA 4XJKA 1BT6A 2CTNA 2WCFA 1TIZA 3SJSA 4GGFA 3PFVA 3O4YA 1MHOA 1M39A 2FCDA 2Q91A 1KWOC 3TUYC 1Y1XA 3PSRA 3VGOA 4A4BA 4I5NB 5HLOA 4HSZA 4MSPA 4PHMA 2CT9A 1IGVA 1AHRA 1MXLC 2GGMA 2L98A 2M29A 2OS8C 2B1UA 3WHUB 1B8RA 1KSMA 1SYMA 1BG1A 4CFQA 1V1FA 1QV0A 4OV2A 2EC6B 1UHJA 2LLSA 3FIAA 1J7RA 1UHKA 2JXCA 3BOWA 5BPJA 1BOCA 4GGFC 2LP3A 1XFUO 2WC8A 1HQVA 3ZNIA 4BY5A 1JFKA 1N2DA 1IH0A 1QS7A 4HRGA 1QV1A 1J1EA 4GFTA 2KI4B 1UHIA 2ISDA 1PVBA 1S5GY 1TNPA 1RJVA 1YX7A 1WLMA 1CMGA 3E3RA 3OX5A 1XFZO 1L2OB 3SG2A 4GNKB 3VRQA 3WXAA 4PCWA 2BCAA 2NZ0A 2WORA 1JWDA 2M9GA 5DKNA 2M8UA 1RWYA 1IKUA 1LINA 1X02A 1KQMB 4N1FA 4ZCVA 5I2OA 1UP5A 1BR1B 3LL8B 1S6JA 1NCYA 5CSNA 1G4YR 1VRKA 1QIVA 4NDCA 1NX3A 2EGDA 1MR8A 1F55A 3DF0B 1HT9A 3TDUA 3KF9A 3TDZA 4C0LA 1OOJA 1S1EA 2G9BA 5AXIA 2FJUB 3TS5C 1BF5A 4R1EA 1QATA 1SCMB 2JT8A 4CFRA 1XK4A 1JC2A 1UWOA 1QXPA 3EVVA 4M2OA 1S36A 2I18A 3IQQA 2BL0C 2Y1NA 2FOTA 1Y6WA 1M45A 1ZOTB 2KI6C 1NIWA 3JVTC 3A8RA 3LK0A 2PVBA 3GK4X 1JF0A 1CTRA 4MRYA 2TN4A 2LE9B 2LVKA 1K95A 3ICBA 2LC5A 2M1KB 2Y1MA 1R2UA 5CSIA 1XK4C 2OTGB 2K7BA 2WCEA 2L51A 3EK7A 5HKWA 4PE1A 1IJ5A 3EKHA 5I2QA 2BECA 1NSHA 2JZIA 1K93D 1TNQA 2V53A 5KU1A 2CCMA 1AVSA 2OPOA 1WDCB 1JSAA 3AAKA 4YGEB 1K9PA 1QVIZ 2CBLA 3K21A 4DRWA 1KK7Y 3CWGA 1K8UA 2JWWA 1TN4A 2MAZA 2ZNEA 3PALA 2G2BA 4YGDB 2LVVA 1DMOA 1DF0B 2GV5A 1B1GA 2K7CA 4QJ4B 1Y0VH 1DJXA 1RK9A 2JTZA 2ZRTA 1PSRA 3DVMA 3NXAA 1BU3A 5CSJA 3LK1A 1XO5A 1F70A 1Y1UA 2LVIA 3SIAA 4OVNF 3LLEA 4CIDA 1DGVA 2M0RA 1N0YA 2M7LA 3MSEB 3O2PA 1GJYA 2HPSA 4F0ZB 5G08A 1J7OA 1XFYO 5DKRA 5I2LA 4QJ5B 1BMOA 5K89A 5JOLA 1FW4A 3D0YB 1YUSA 4M2PA 4GGNA 1SPYA 1KCYA 1M31A 4M2QA 4PE0A 5JJGA 1UHNA 2LUCA 5AANA 1K90D 3VRNA 1QX2A 3KO0A 1LKJA 1QX5B 1Q80A 1JBAA 1TRFA 3DVEA 1G33A 2H61A 1B7TZ 3H4SE 3BYAA 2WCBA 2PASA 1CMFA 3GOFA 4I5KA 5DKQA 4YRUA 1KWOB 3TUYB 1LA0A 3BUOB 1J7QA 1KFUL 1NWDA 2NCPA 3EVUA 4PHKA 2ZN9A 3PN7C 1BODA 2SCPA 4NDDA 2OS8B 2LCPA 5D69A 4NQGA 3I5GC 1H8BA 1DJWA 1TOPA 1PVAA 1KK8C 1AK8A 4XJKB 3AKAA 2H61C 4L9MA 2L4HA 1Y1AA 1A2XA 3CGAA 1KSOA 2KBIA 4YGCB 2LANA 1LVCD 4I5LB 5AFPA 1AP4A 4OCIA 1TNWA 2KGRA 4HRHA 4AQJA 3NSOA 3BUWB 3FWCA 2LLTA 3C1VA 1CFDA 1F8HA 1SL9A 2I7AA 1OMRA 2MRDA 2L0PA 1SKTA 2KAXA 2KOTA 3DD4A 3EK8A 5ER4X 5J3XA 2PMYA 1YUUA 1NCXA 2F3ZA 4YI8A 3BUXB 1PRWA 2HETA 3I5FC 1W7IB 1S5GZ 1W7JB 2JNFA 3I5HC 1OMVA 3O6BA 1S6CA 3DF0A 1FPWA 1K2HA 2PSRA 2PRUA 3DVKA 1QIWA 3DVJA 1WRLA 4PE4A 1F54A 5F6TA 2KSPA 1CKKA 3TS5B 4USLA 1M46A 1ZACA 2O5GA 1SL7A 5HKZA 3ZWHA 5HYDA 1BLQA 2KAYA 2K0JA 2A4JA 2NCOA 1C7WA 2Y4QA 2KBMA 4PE7A 1EG4A 2BL0B 3D10A 1NUBA 1B4CA 3WNXB 1ZFSA 1RROA 1DT7B 4OR9B 3RLZA 3AKBA 4MZJA 4C0KA 3JVTB 1NX0A 1XFWO 1ZUZA 1PALA 3BUNB 1AUIB 1U5IB 3VROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EL4 A;  3QRX A;  2M1U A;  4FQO A;  1YRT B;  1IJ6 A;  4N1G A;  1IRJ A;  2BKH B;  1SCM C;  3VRP A;  2BCX A;  2MJW B;  2LVJ A;  2GGZ A;  3OP0 A;  4MEW A;  3NSL A;  2BKI B;  1TCO B;  1B8C A;  2K7D A;  4MLW A;  3TZ1 A;  1YUT A;  1IWQ A;  1YUR A;  4Q04 A;  1G8I A;  4DS7 A;  3I5I C;  3CR4 X;  2LM5 A;  1S3P A;  1ALW A;  1DGU A;  4DCK A;  1XA5 A;  3WHT B;  2BBN A;  2AUC A;  1DJY A;  1F4Q A;  1SRA A;  2LUX A;  3OX6 A;  2K2F A;  4ICB A;  1KFU S;  4NDB A;  1ZMZ A;  1GGZ A;  2LHI A;  1CDN A;  2K7O A;  2WOS A;  2L50 A;  2KDH A;  1DF0 A;  1JUO A;  1S6I A;  2L4I A;  1EXR A;  5KSZ A;  1H4B A;  2F8P A;  1REC A;  2MHH A;  3VRR A;  3SIB A;  2I94 A;  5CPV A;  1DJH A;  1MWN A;  5B8I B;  1KK7 Z;  2BCB A;  4PDZ A;  3OB1 B;  2K2A A;  1A29 A;  2L2E A;  2ZFD A;  1TTX A;  2CNP A;  2RGI A;  3A4U B;  1ALV A;  3O78 A;  4GUK A;  4P5O E;  1QTX A;  1RFJ A;  2JC2 A;  1C7V A;  2F33 A;  4GBA A;  1BJF A;  2NLN A;  1RTP 1;  2KHN A;  1OZO A;  2VRG A;  1A75 A;  4N5X A;  1EH2 A;  2BE6 A;  4QJ3 B;  2Y5I A;  3EK4 A;  1SR6 C;  2O60 A;  4GPL B;  5D7F A;  5KTY A;  2MA2 A;  2JT0 A;  3TDI A;  2M3W A;  4C0J A;  1LA3 A;  1OMD A;  2AMI A;  1XVJ A;  2JT3 A;  5IBW A;  1EJ3 A;  3KHE A;  1YVH A;  1B47 A;  2JNX A;  2MLE C;  2KAV A;  2LLU A;  2Q4U A;  3SG7 A;  1DVI A;  1CDP A;  3PN7 B;  1LXF C;  1AJ5 A;  1TCF A;  3JTD C;  1CDL A;  1DJZ A;  2LMT A;  3RM1 A;  2HF5 A;  4PAL A;  3CTN A;  2E6W A;  4XYN A;  1KFX S;  1JFJ A;  2H2K A;  5TNC A;  2JUL A;  2ZN8 A;  1KK8 B;  4HRE E;  4CPV A;  1KQV A;  2HQ8 A;  4U8D A;  5I8N A;  1NCZ A;  4PHN A;  1GGW A;  3HCM A;  4JQ0 D;  4IL1 A;  2P6B B;  3F45 A;  3CZT X;  4E68 A;  5PAL A;  1F71 A;  2ZND A;  5AEQ A;  2NXQ A;  2QPT A;  2JPT A;  2LNK A;  4P2Y B;  3CR5 X;  4TNC A;  1L7Z A;  1XFV O;  1C07 A;  5GQQ C;  4DIR A;  3EVR A;  5FYX A;  1DJG A;  1CLL A;  3KPX A;  2ZKM X;  4YGB B;  4JWQ A;  1UUR A;  2KYF A;  2EC6 C;  4WQ2 A;  5CSF A;  3BOW B;  3IQO A;  3I5F B;  2BBM A;  3I5H B;  1IG5 A;  4GAO A;  4ETO A;  5HLV A;  1CFC A;  1J55 A;  4PHJ A;  1CM4 A;  1B8L A;  1XFX O;  2KI4 C;  2KI6 D;  4FTG A;  2K8M B;  3AAJ A;  4MVF A;  2EHB A;  2JTT A;  3PLF B;  1IQ3 A;  1D1O A;  1EG3 A;  1NPQ A;  1L2O C;  1NX2 A;  4JPZ B;  2LAP A;  1B9A A;  2CXJ A;  1SCV A;  1WLZ A;  3SG6 A;  1ODB A;  1QX7 A;  2D8N A;  3OB2 B;  1KQM C;  3CS1 A;  2LHL A;  1KFX L;  1FF1 A;  2E30 A;  4CLN A;  1V1G A;  1PUL A;  2LMU A;  4MZL A;  1DJI A;  3CLN A;  2LP2 A;  4YBH B;  5ER5 A;  1CLM A;  3SG5 A;  1PSB A;  1YX8 A;  4UPG A;  2KFH A;  1U5I A;  3KEV A;  3M0W A;  3PAT A;  3PM8 A;  4I5J A;  1AJ4 A;  4D1E A;  5HKY A;  1GQM A;  1SY9 A;  2BE4 A;  1TNX A;  1MF8 B;  1SL8 A;  2F3Y A;  2AAO A;  1NX1 A;  1MXE A;  1SMG A;  2KQY A;  4ORB B;  1YTZ C;  4A4C A;  3NSI A;  1FI5 A;  4MRX A;  1CDM A;  3BUM B;  3GK1 A;  4DUQ A;  1J1D A;  3BXK A;  3FWB A;  3I5I B;  1WRZ A;  2R2I A;  1K9K A;  2M49 B;  4AOM A;  1E8A A;  3SG3 A;  1JF2 A;  1OQP A;  2MLF C;  1IQ5 A;  1FI6 A;  2KGB C;  1SK6 D;  1SBJ A;  2KYC A;  1WY9 A;  1XYD A;  1QLK A;  2M97 A;  3OHM B;  1QVI Y;  1OZS A;  1N65 A;  2OTG C;  1K94 A;  1CNP A;  2JQ6 A;  3NSK A;  1K9U A;  1S26 D;  1CFF A;  3IF7 A;  3LCP C;  1A4P A;  3FS7 A;  1YVL A;  2HQW A;  3HX4 A;  4MZK A;  1MUX A;  2KFG A;  4WQ3 A;  2JU0 A;  1WDC C;  1QAS A;  1SW8 A;  2I2R E;  2LV7 A;  1J7P A;  4ZCU A;  1CB1 A;  1R6P A;  4BY4 A;  3GK2 A;  1NP8 A;  2MBX A;  4YGA A;  1BR4 B;  2PAL A;  2ZRS A;  3D0Y A;  1UUS A;  1WRK A;  1FBV A;  2L5X B;  2K61 A;  1QLS A;  2DOQ A;  1PK0 D;  1SR6 B;  1OE9 B;  1UHH A;  3EKJ A;  1CLB A;  2JRF A;  2KFF A;  1F4O A;  2JOJ A;  1K96 A;  5AER A;  2SAS A;  3CR2 A;  4YI9 A;  1MQ1 A;  1DTL A;  1QJT A;  1A03 A;  4OKH A;  4AQI A;  1NYA A;  3BQ3 A;  1SNL A;  2F2O A;  1B7T Y;  2F2P A;  4ORC B;  2COL B;  2WND A;  4WRI A;  1M63 B;  2KNE A;  2JXL A;  1YRU B;  1OSA A;  3JTD B;  1A75 B;  2KQ6 A;  2FCE A;  3I5G B;  2QAC A;  4ORA B;  3SG4 A;  1CM1 A;  1YR5 A;  2IS9 A;  2M7N A;  4MN0 A;  1CFP A;  4MBE A;  2LMV A;  4XJK A;  1BT6 A;  2CTN A;  2WCF A;  1TIZ A;  3SJS A;  4GGF A;  3PFV A;  3O4Y A;  1MHO A;  1M39 A;  2FCD A;  2Q91 A;  1KWO C;  3TUY C;  1Y1X A;  3PSR A;  3VGO A;  4A4B A;  4I5N B;  5HLO A;  4HSZ A;  4MSP A;  4PHM A;  2CT9 A;  1IGV A;  1AHR A;  1MXL C;  2GGM A;  2L98 A;  2M29 A;  2OS8 C;  2B1U A;  3WHU B;  1B8R A;  1KSM A;  1SYM A;  1BG1 A;  4CFQ A;  1V1F A;  1QV0 A;  4OV2 A;  2EC6 B;  1UHJ A;  2LLS A;  3FIA A;  1J7R A;  1UHK A;  2JXC A;  3BOW A;  5BPJ A;  1BOC A;  4GGF C;  2LP3 A;  1XFU O;  2WC8 A;  1HQV A;  3ZNI A;  4BY5 A;  1JFK A;  1N2D A;  1IH0 A;  1QS7 A;  4HRG A;  1QV1 A;  1J1E A;  4GFT A;  2KI4 B;  1UHI A;  2ISD A;  1PVB A;  1S5G Y;  1TNP A;  1RJV A;  1YX7 A;  1WLM A;  1CMG A;  3E3R A;  3OX5 A;  1XFZ O;  1L2O B;  3SG2 A;  4GNK B;  3VRQ A;  3WXA A;  4PCW A;  2BCA A;  2NZ0 A;  2WOR A;  1JWD A;  2M9G A;  5DKN A;  2M8U A;  1RWY A;  1IKU A;  1LIN A;  1X02 A;  1KQM B;  4N1F A;  4ZCV A;  5I2O A;  1UP5 A;  1BR1 B;  3LL8 B;  1S6J A;  1NCY A;  5CSN A;  1G4Y R;  1VRK A;  1QIV A;  4NDC A;  1NX3 A;  2EGD A;  1MR8 A;  1F55 A;  3DF0 B;  1HT9 A;  3TDU A;  3KF9 A;  3TDZ A;  4C0L A;  1OOJ A;  1S1E A;  2G9B A;  5AXI A;  2FJU B;  3TS5 C;  1BF5 A;  4R1E A;  1QAT A;  1SCM B;  2JT8 A;  4CFR A;  1XK4 A;  1JC2 A;  1UWO A;  1QXP A;  3EVV A;  4M2O A;  1S36 A;  2I18 A;  3IQQ A;  2BL0 C;  2Y1N A;  2FOT A;  1Y6W A;  1M45 A;  1ZOT B;  2KI6 C;  1NIW A;  3JVT C;  3A8R A;  3LK0 A;  2PVB A;  3GK4 X;  1JF0 A;  1CTR A;  4MRY A;  2TN4 A;  2LE9 B;  2LVK A;  1K95 A;  3ICB A;  2LC5 A;  2M1K B;  2Y1M A;  1R2U A;  5CSI A;  1XK4 C;  2OTG B;  2K7B A;  2WCE A;  2L51 A;  3EK7 A;  5HKW A;  4PE1 A;  1IJ5 A;  3EKH A;  5I2Q A;  2BEC A;  1NSH A;  2JZI A;  1K93 D;  1TNQ A;  2V53 A;  5KU1 A;  2CCM A;  1AVS A;  2OPO A;  1WDC B;  1JSA A;  3AAK A;  4YGE B;  1K9P A;  1QVI Z;  2CBL A;  3K21 A;  4DRW A;  1KK7 Y;  3CWG A;  1K8U A;  2JWW A;  1TN4 A;  2MAZ A;  2ZNE A;  3PAL A;  2G2B A;  4YGD B;  2LVV A;  1DMO A;  1DF0 B;  2GV5 A;  1B1G A;  2K7C A;  4QJ4 B;  1Y0V H;  1DJX A;  1RK9 A;  2JTZ A;  2ZRT A;  1PSR A;  3DVM A;  3NXA A;  1BU3 A;  5CSJ A;  3LK1 A;  1XO5 A;  1F70 A;  1Y1U A;  2LVI A;  3SIA A;  4OVN F;  3LLE A;  4CID A;  1DGV A;  2M0R A;  1N0Y A;  2M7L A;  3MSE B;  3O2P A;  1GJY A;  2HPS A;  4F0Z B;  5G08 A;  1J7O A;  1XFY O;  5DKR A;  5I2L A;  4QJ5 B;  1BMO A;  5K89 A;  5JOL A;  1FW4 A;  3D0Y B;  1YUS A;  4M2P A;  4GGN A;  1SPY A;  1KCY A;  1M31 A;  4M2Q A;  4PE0 A;  5JJG A;  1UHN A;  2LUC A;  5AAN A;  1K90 D;  3VRN A;  1QX2 A;  3KO0 A;  1LKJ A;  1QX5 B;  1Q80 A;  1JBA A;  1TRF A;  3DVE A;  1G33 A;  2H61 A;  1B7T Z;  3H4S E;  3BYA A;  2WCB A;  2PAS A;  1CMF A;  3GOF A;  4I5K A;  5DKQ A;  4YRU A;  1KWO B;  3TUY B;  1LA0 A;  3BUO B;  1J7Q A;  1KFU L;  1NWD A;  2NCP A;  3EVU A;  4PHK A;  2ZN9 A;  3PN7 C;  1BOD A;  2SCP A;  4NDD A;  2OS8 B;  2LCP A;  5D69 A;  4NQG A;  3I5G C;  1H8B A;  1DJW A;  1TOP A;  1PVA A;  1KK8 C;  1AK8 A;  4XJK B;  3AKA A;  2H61 C;  4L9M A;  2L4H A;  1Y1A A;  1A2X A;  3CGA A;  1KSO A;  2KBI A;  4YGC B;  2LAN A;  1LVC D;  4I5L B;  5AFP A;  1AP4 A;  4OCI A;  1TNW A;  2KGR A;  4HRH A;  4AQJ A;  3NSO A;  3BUW B;  3FWC A;  2LLT A;  3C1V A;  1CFD A;  1F8H A;  1SL9 A;  2I7A A;  1OMR A;  2MRD A;  2L0P A;  1SKT A;  2KAX A;  2KOT A;  3DD4 A;  3EK8 A;  5ER4 X;  5J3X A;  2PMY A;  1YUU A;  1NCX A;  2F3Z A;  4YI8 A;  3BUX B;  1PRW A;  2HET A;  3I5F C;  1W7I B;  1S5G Z;  1W7J B;  2JNF A;  3I5H C;  1OMV A;  3O6B A;  1S6C A;  3DF0 A;  1FPW A;  1K2H A;  2PSR A;  2PRU A;  3DVK A;  1QIW A;  3DVJ A;  1WRL A;  4PE4 A;  1F54 A;  5F6T A;  2KSP A;  1CKK A;  3TS5 B;  4USL A;  1M46 A;  1ZAC A;  2O5G A;  1SL7 A;  5HKZ A;  3ZWH A;  5HYD A;  1BLQ A;  2KAY A;  2K0J A;  2A4J A;  2NCO A;  1C7W A;  2Y4Q A;  2KBM A;  4PE7 A;  1EG4 A;  2BL0 B;  3D10 A;  1NUB A;  1B4C A;  3WNX B;  1ZFS A;  1RRO A;  1DT7 B;  4OR9 B;  3RLZ A;  3AKB A;  4MZJ A;  4C0K A;  3JVT B;  1NX0 A;  1XFW O;  1ZUZ A;  1PAL A;  3BUN B;  1AUI B;  1U5I B;  3VRO A; 
#chains in the Genus database with same CATH topology
 1EL4 A;  3QRX A;  4PT1 A;  2M1U A;  4FQO A;  5HL1 A;  1YRT B;  1IJ6 A;  4N1G A;  1IRJ A;  2BKH B;  1SCM C;  3VRP A;  2BCX A;  2MJW B;  2LVJ A;  2GGZ A;  2WCK A;  3OP0 A;  4MEW A;  3NSL A;  2BKI B;  3L47 A;  1TCO B;  1B8C A;  2K7D A;  4MLW A;  3TZ1 A;  1YUT A;  1IWQ A;  1YUR A;  4Q04 A;  1G8I A;  4DS7 A;  3I5I C;  3CR4 X;  2LM5 A;  1S3P A;  1ALW A;  1DGU A;  4DCK A;  1XA5 A;  1W9Z A;  3WHT B;  2BBN A;  2AUC A;  1DJY A;  1F4Q A;  1SRA A;  2LUX A;  3OX6 A;  5FI7 A;  2K2F A;  4ICB A;  1KFU S;  1GM0 A;  3BFA A;  1ZMZ A;  1GGZ A;  4NDB A;  2WCH A;  2LHI A;  3CZ1 A;  1CDN A;  2K7O A;  2WOS A;  2L50 A;  2KDH A;  1DF0 A;  1JUO A;  1S6I A;  2L4I A;  1EXR A;  5KSZ A;  1H4B A;  2F8P A;  1REC A;  3SS3 A;  2MHH A;  3VRR A;  3SIB A;  2L5Y A;  2I94 A;  5CPV A;  1DJH A;  1MWN A;  5B8I B;  1KK7 Z;  2BCB A;  4PDZ A;  3OB1 B;  2K2A A;  1A29 A;  2L2E A;  2ZFD A;  1TTX A;  2CNP A;  2RGI A;  3A4U B;  1ALV A;  3O78 A;  4GUK A;  2QDI A;  4P5O E;  1QTX A;  1RFJ A;  3R1V A;  2JC2 A;  1C7V A;  2F33 A;  4GBA A;  1BJF A;  2NLN A;  1RTP 1;  2KHN A;  1OZO A;  2VRG A;  1A75 A;  4N5X A;  1EH2 A;  2BE6 A;  4QJ3 B;  2JPO A;  2Y5I A;  3EK4 A;  1SR6 C;  2O60 A;  4GPL B;  5D7F A;  3CZ2 A;  5KTY A;  2MA2 A;  3NHI A;  2JT0 A;  3TDI A;  3VB1 A;  2M3W A;  3D74 A;  4C0J A;  1LA3 A;  1OMD A;  3B6X A;  2AMI A;  1XVJ A;  2JT3 A;  5IBW A;  1SSE B;  1EJ3 A;  3KHE A;  1YVH A;  1B47 A;  2JNX A;  2MLE C;  3OGN A;  2KAV A;  2LLU A;  2Q4U A;  3SG7 A;  3PJI A;  1DVI A;  1CDP A;  3PN7 B;  1LXF C;  2H8V A;  1AJ5 A;  1TCF A;  3JTD C;  1CDL A;  1DJZ A;  2LMT A;  3RM1 A;  2HF5 A;  4PAL A;  3CTN A;  2E6W A;  4XYN A;  1KFX S;  1JFJ A;  2H2K A;  5TNC A;  2JUL A;  2ZN8 A;  1KK8 B;  4INW A;  2P71 A;  4HRE E;  4CPV A;  1KQV A;  2HQ8 A;  4U8D A;  5I8N A;  1NCZ A;  4PHN A;  1GGW A;  3HCM A;  4JQ0 D;  4IL1 A;  2P6B B;  3F45 A;  3CZT X;  4E68 A;  1Z2C B;  3NGV A;  5PAL A;  1F71 A;  2ZND A;  1IIO A;  5AEQ A;  2NXQ A;  2QPT A;  2JPT A;  2KLE A;  2LNK A;  4P2Y B;  2FJY A;  3CR5 X;  4TNC A;  1L7Z A;  1XFV O;  1C07 A;  5GQQ C;  4DIR A;  3EVR A;  5FYX A;  1DJG A;  1CLL A;  3B86 A;  2ZKM X;  3KPX A;  4YGB B;  4JWQ A;  1UUR A;  2KYF A;  2EC6 C;  4WQ2 A;  5CSF A;  3BOW B;  3IQO A;  3I5F B;  1TWO A;  2BBM A;  3I5H B;  1IG5 A;  4GAO A;  4ETO A;  5HLV A;  1CFC A;  1J55 A;  4PHJ A;  1CM4 A;  1B8L A;  1XFX O;  2KI4 C;  2KI6 D;  2WCJ A;  4FTG A;  3SS4 A;  2K8M B;  3AAJ A;  4MVF A;  2EHB A;  2JTT A;  1OOG A;  3PLF B;  1IQ3 A;  3S0G A;  1EG3 A;  1NPQ A;  1L2O C;  1NX2 A;  4JPZ B;  2LAP A;  3B7A A;  1D1O A;  3S0F A;  1B9A A;  2CXJ A;  1SCV A;  1WLZ A;  3SG6 A;  1ODB A;  1QX7 A;  2D8N A;  3OB2 B;  1KQM C;  3CS1 A;  2LHL A;  1KFX L;  1FF1 A;  2E30 A;  4CLN A;  1V1G A;  1PUL A;  2LMU A;  3UO9 A;  4MZL A;  1DJI A;  1OOH A;  3CLN A;  2LP2 A;  4YBH B;  5ER5 A;  1CLM A;  3SG5 A;  1PSB A;  1YX8 A;  3D77 A;  2KFH A;  1U5I A;  3KEV A;  3M0W A;  3PAT A;  3PM8 A;  4I5J A;  4UPG A;  1AJ4 A;  4D1E A;  5HKY A;  1GQM A;  1SY9 A;  1TNX A;  2BE4 A;  1MF8 B;  1SL8 A;  2F3Y A;  2AAO A;  1NX1 A;  3DZT A;  1MXE A;  1SMG A;  2KQY A;  4ORB B;  1YTZ C;  4A4C A;  1XFR A;  2WC5 A;  3NSI A;  4MRX A;  1CDM A;  1FI5 A;  3BUM B;  3GK1 A;  4DUQ A;  1J1D A;  3BXK A;  3NHT A;  3FWB A;  3I5I B;  1WRZ A;  3R1P A;  2R2I A;  3BFH A;  3S0D A;  1K9K A;  2M49 B;  3UNW A;  2WCL A;  4AOM A;  1E8A A;  3SG3 A;  1JF2 A;  1OQP A;  2MLF C;  3L4A A;  1IQ5 A;  1FI6 A;  2KGB C;  1SK6 D;  1SBJ A;  2KYC A;  1WY9 A;  1XYD A;  1QLK A;  3S0E A;  2M97 A;  3OHM B;  1QVI Y;  1OZS A;  1N65 A;  2OTG C;  1K94 A;  1CNP A;  2JQ6 A;  3NSK A;  1K9U A;  1S26 D;  3N7H A;  1CFF A;  3IF7 A;  3LCP C;  1A4P A;  3FS7 A;  1YVL A;  5I94 A;  2HQW A;  2KPH A;  3HX4 A;  4MZK A;  3FE8 A;  1MUX A;  2KFG A;  4WQ3 A;  2JU0 A;  1WDC C;  1QAS A;  3K1E A;  1DEL A;  1SW8 A;  1DEK A;  2WCM A;  2I2R E;  2LV7 A;  2QEH A;  1J7P A;  4ZCU A;  1CB1 A;  5FI2 A;  1R6P A;  3CZ0 A;  4BY4 A;  2P70 A;  3GK2 A;  3R72 A;  1NP8 A;  2MBX A;  4YGA A;  1BR4 B;  2PAL A;  2ZRS A;  3D0Y A;  1UUS A;  1WRK A;  1FBV A;  2L5X B;  2K61 A;  1QLS A;  2DOQ A;  1PK0 D;  1SR6 B;  1OE9 B;  1UHH A;  3EKJ A;  1CLB A;  2JRF A;  2KFF A;  1F4O A;  2JOJ A;  1K96 A;  3R1O A;  5AER A;  2SAS A;  3CR2 A;  4YI9 A;  1MQ1 A;  1DTL A;  1QJT A;  1A03 A;  4OKH A;  4AQI A;  2BAP A;  1NYA A;  3BQ3 A;  1SNL A;  2F2O A;  1B7T Y;  2F2P A;  4ORC B;  2COL B;  2WND A;  4WRI A;  1M63 B;  2KNE A;  2JXL A;  1YRU B;  1OSA A;  3JTD B;  1A75 B;  2KQ6 A;  2FCE A;  3I5G B;  2QAC A;  4ORA B;  3SG4 A;  1CM1 A;  1YR5 A;  2IS9 A;  2M7N A;  4MN0 A;  3V2L A;  1CFP A;  4MBE A;  2LMV A;  1QWV A;  4XJK A;  1BT6 A;  4OZD A;  2CTN A;  2WCF A;  1TIZ A;  3SJS A;  4GGF A;  3PFV A;  3O4Y A;  1MHO A;  1M39 A;  2FCD A;  2Q91 A;  1KWO C;  3TUY C;  1Y1X A;  3PSR A;  3VGO A;  4A4B A;  4I5N B;  5HLO A;  4HSZ A;  3O4X A;  4MSP A;  4PHM A;  1DC1 A;  2CT9 A;  1IGV A;  1AHR A;  1MXL C;  2GGM A;  2L98 A;  2M29 A;  2OS8 C;  2B1U A;  3WHU B;  1B8R A;  1KSM A;  1SYM A;  1BG1 A;  1T14 A;  1V1F A;  4CFQ A;  1QV0 A;  4OV2 A;  2EC6 B;  1UHJ A;  2LLS A;  3FIA A;  1J7R A;  1UHK A;  2JXC A;  3BOW A;  5BPJ A;  1BOC A;  4GGF C;  2LP3 A;  1XFU O;  1DQE A;  2WC8 A;  1HQV A;  3ZNI A;  4BY5 A;  1JFK A;  1N2D A;  1IH0 A;  1QS7 A;  4HRG A;  1QV1 A;  1J1E A;  4GFT A;  1OOI X;  2KI4 B;  4FQT A;  1UHI A;  2QEV A;  2ISD A;  1PVB A;  3D76 A;  1S5G Y;  1TNP A;  1RJV A;  1YX7 A;  1WLM A;  1CMG A;  3E3R A;  3OX5 A;  1XFZ O;  1L2O B;  1Z4H A;  3SG2 A;  4GNK B;  3VRQ A;  3WXA A;  4PCW A;  2BCA A;  2NZ0 A;  2WOR A;  1JWD A;  2M9G A;  5DKN A;  2M8U A;  1RWY A;  1IKU A;  1LIN A;  1X02 A;  1KQM B;  4N1F A;  4ZCV A;  5I2O A;  1UP5 A;  1BR1 B;  3LL8 B;  1S6J A;  1NCY A;  5CSN A;  1G4Y R;  1VRK A;  1QIV A;  3B87 A;  4NDC A;  1NX3 A;  2EGD A;  1MR8 A;  1F55 A;  3DF0 B;  1HT9 A;  3TDU A;  3KF9 A;  3QME A;  3TDZ A;  4C0L A;  1OOJ A;  1S1E A;  3D73 A;  2G9B A;  1TUZ A;  5AXI A;  2FJU B;  3DYE A;  3TS5 C;  1BF5 A;  4R1E A;  1QAT A;  1SCM B;  2JT8 A;  4CFR A;  1XK4 A;  1JC2 A;  1UWO A;  1QXP A;  3EVV A;  4M2O A;  1S36 A;  2I18 A;  3IQQ A;  2BL0 C;  3FE9 A;  2Y1N A;  2FOT A;  1Y6W A;  1M45 A;  1ZOT B;  3S0A A;  2KI6 C;  1NIW A;  3JVT C;  3A8R A;  2QEB A;  3LK0 A;  2PVB A;  3GK4 X;  1JF0 A;  3D75 A;  1CTR A;  4MRY A;  2TN4 A;  2LE9 B;  2LVK A;  1K95 A;  1OW4 A;  3ICB A;  2LC5 A;  2M1K B;  2Y1M A;  1R2U A;  5CSI A;  1XK4 C;  3CAB A;  2OTG B;  2K7B A;  1C3Y A;  2BNX A;  2WCE A;  2L51 A;  3EK7 A;  5HKW A;  4PE1 A;  1IJ5 A;  3EKH A;  5I2Q A;  2BEC A;  1NSH A;  2JZI A;  1K93 D;  1TNQ A;  1OOF A;  2V53 A;  5KU1 A;  2CCM A;  1AVS A;  2OPO A;  1WDC B;  1JSA A;  3AAK A;  4YGE B;  1K9P A;  3BFB A;  1C3Z A;  1QVI Z;  5DIC A;  2CBL A;  3K21 A;  4DRW A;  1KK7 Y;  3CWG A;  1K8U A;  2JWW A;  1TN4 A;  2MAZ A;  2ZNE A;  3PAL A;  2G2B A;  3Q8I A;  2LVV A;  4YGD B;  1DMO A;  1DF0 B;  2GV5 A;  1B1G A;  2K7C A;  4QJ4 B;  1Y0V H;  3DY9 A;  3S0B A;  1DJX A;  1RK9 A;  2GTE A;  2JTZ A;  2ZRT A;  1PSR A;  3DVM A;  3L4L A;  3NXA A;  5FI6 A;  1BU3 A;  3IVT A;  2L2C A;  5CSJ A;  3LK1 A;  1TUJ A;  1XO5 A;  1F70 A;  3CYZ A;  1Y1U A;  2LVI A;  3SIA A;  2WC6 A;  4OVN F;  3LLE A;  4CID A;  1DGV A;  2M0R A;  1N0Y A;  3FE6 A;  2M7L A;  3MSE B;  3O2P A;  1GJY A;  2HPS A;  4F0Z B;  5G08 A;  1J7O A;  1XFY O;  5DKR A;  5I2L A;  4QJ5 B;  1BMO A;  5K89 A;  4JD9 A;  5JOL A;  1FW4 A;  3D0Y B;  1YUS A;  4M2P A;  4GGN A;  1SPY A;  2PQL A;  1KCY A;  1M31 A;  4M2Q A;  4PE0 A;  5JJG A;  1UHN A;  2LUC A;  5AAN A;  1K90 D;  3VRN A;  1QX2 A;  3KO0 A;  3PM2 A;  1LKJ A;  1QX5 B;  1Q80 A;  1JBA A;  1TRF A;  3DVE A;  1G33 A;  2H61 A;  1B7T Z;  3BJH A;  3H4S E;  3BYA A;  2WCB A;  2PAS A;  1CMF A;  3GOF A;  4I5K A;  5DKQ A;  4YRU A;  1KWO B;  3TUY B;  1LA0 A;  3BUO B;  4KYN A;  1KFU L;  1J7Q A;  1NWD A;  2K60 A;  2NCP A;  3EVU A;  4PHK A;  2ZN9 A;  3PN7 C;  1BOD A;  2SCP A;  4NDD A;  2OS8 B;  2LCP A;  5D69 A;  4NQG A;  3I5G C;  1H8B A;  1DJW A;  1TOP A;  1PVA A;  2QEO A;  1KK8 C;  1AK8 A;  4XJK B;  3AKA A;  2H61 C;  4L9M A;  2L4H A;  1Y1A A;  1A2X A;  3CGA A;  1KSO A;  1ORG A;  2KBI A;  4YGC B;  2LAN A;  1LVC D;  4I5L B;  5AFP A;  1AP4 A;  4OCI A;  1TNW A;  2KGR A;  3D78 A;  4HRH A;  3NSO A;  2ERB A;  3BUW B;  3FWC A;  2LLT A;  3C1V A;  4AQJ A;  1CFD A;  3RZS A;  1F8H A;  1SL9 A;  2I7A A;  1OMR A;  2MRD A;  2L0P A;  4INX A;  1SKT A;  2KAX A;  2KOT A;  3DD4 A;  3B88 A;  3SS5 A;  3EK8 A;  5ER4 X;  5J3X A;  2PMY A;  1YUU A;  1NCX A;  2F3Z A;  4IJ7 A;  4YI8 A;  3BUX B;  1PRW A;  2HET A;  3I5F C;  1W7I B;  1S5G Z;  1W7J B;  2JNF A;  3I5H C;  1OMV A;  3O6B A;  1S6C A;  1LS8 A;  3DF0 A;  1FPW A;  1K2H A;  2PSR A;  2PRU A;  3DVK A;  4JKT A;  1QIW A;  3DVJ A;  1WRL A;  4PE4 A;  5EL2 A;  1F54 A;  3EG5 B;  2KSP A;  5F6T A;  1CKK A;  3TS5 B;  3OBV A;  4USL A;  1M46 A;  1ZAC A;  2O5G A;  1SL7 A;  2YGU A;  5HKZ A;  3ZWH A;  1P28 A;  5HYD A;  1BLQ A;  2KAY A;  2K0J A;  2A4J A;  2NCO A;  5D3O A;  1C7W A;  2PYQ A;  2Y4Q A;  2KBM A;  2KLD A;  4PE7 A;  1EG4 A;  2BL0 B;  3D10 A;  1NUB A;  3DXL A;  4F7F A;  3CDN A;  1B4C A;  3WNX B;  1ZFS A;  1RRO A;  1DT7 B;  4OR9 B;  3RLZ A;  3AKB A;  4MZJ A;  4C0K A;  3JVT B;  1NX0 A;  1XFW O;  1ZUZ A;  1PAL A;  3BUN B;  1AUI B;  1U5I B;  3VRO A; 
#chains in the Genus database with same CATH homology
 1EL4 A;  3QRX A;  2M1U A;  4FQO A;  1YRT B;  1IJ6 A;  4N1G A;  1IRJ A;  2BKH B;  1SCM C;  3VRP A;  2BCX A;  2MJW B;  2LVJ A;  2GGZ A;  3OP0 A;  4MEW A;  3NSL A;  2BKI B;  1TCO B;  1B8C A;  2K7D A;  4MLW A;  3TZ1 A;  1YUT A;  1IWQ A;  1YUR A;  4Q04 A;  1G8I A;  4DS7 A;  3I5I C;  3CR4 X;  2LM5 A;  1S3P A;  1ALW A;  1DGU A;  4DCK A;  1XA5 A;  3WHT B;  2BBN A;  2AUC A;  1DJY A;  1F4Q A;  1SRA A;  2LUX A;  3OX6 A;  2K2F A;  4ICB A;  1KFU S;  4NDB A;  1ZMZ A;  1GGZ A;  2LHI A;  1CDN A;  2K7O A;  2WOS A;  2L50 A;  2KDH A;  1DF0 A;  1JUO A;  1S6I A;  2L4I A;  1EXR A;  5KSZ A;  1H4B A;  2F8P A;  1REC A;  2MHH A;  3VRR A;  3SIB A;  2I94 A;  5CPV A;  1DJH A;  1MWN A;  5B8I B;  1KK7 Z;  2BCB A;  4PDZ A;  3OB1 B;  2K2A A;  1A29 A;  2L2E A;  2ZFD A;  1TTX A;  2CNP A;  2RGI A;  3A4U B;  1ALV A;  3O78 A;  4GUK A;  4P5O E;  1QTX A;  1RFJ A;  2JC2 A;  1C7V A;  2F33 A;  4GBA A;  1BJF A;  2NLN A;  1RTP 1;  2KHN A;  1OZO A;  2VRG A;  1A75 A;  4N5X A;  1EH2 A;  2BE6 A;  4QJ3 B;  2Y5I A;  3EK4 A;  1SR6 C;  2O60 A;  4GPL B;  5D7F A;  5KTY A;  2MA2 A;  2JT0 A;  3TDI A;  2M3W A;  4C0J A;  1LA3 A;  1OMD A;  2AMI A;  1XVJ A;  2JT3 A;  5IBW A;  1EJ3 A;  3KHE A;  1YVH A;  1B47 A;  2JNX A;  2MLE C;  2KAV A;  2LLU A;  2Q4U A;  3SG7 A;  1DVI A;  1CDP A;  3PN7 B;  1LXF C;  1AJ5 A;  1TCF A;  3JTD C;  1CDL A;  1DJZ A;  2LMT A;  3RM1 A;  2HF5 A;  4PAL A;  3CTN A;  2E6W A;  4XYN A;  1KFX S;  1JFJ A;  2H2K A;  5TNC A;  2JUL A;  2ZN8 A;  1KK8 B;  4HRE E;  4CPV A;  1KQV A;  2HQ8 A;  4U8D A;  5I8N A;  1NCZ A;  4PHN A;  1GGW A;  3HCM A;  4JQ0 D;  4IL1 A;  2P6B B;  3F45 A;  3CZT X;  4E68 A;  5PAL A;  1F71 A;  2ZND A;  5AEQ A;  2NXQ A;  2QPT A;  2JPT A;  2LNK A;  4P2Y B;  3CR5 X;  4TNC A;  1L7Z A;  1XFV O;  1C07 A;  5GQQ C;  4DIR A;  3EVR A;  5FYX A;  1DJG A;  1CLL A;  3KPX A;  2ZKM X;  4YGB B;  4JWQ A;  1UUR A;  2KYF A;  2EC6 C;  4WQ2 A;  5CSF A;  3BOW B;  3IQO A;  3I5F B;  2BBM A;  3I5H B;  1IG5 A;  4GAO A;  4ETO A;  5HLV A;  1CFC A;  1J55 A;  4PHJ A;  1CM4 A;  1B8L A;  1XFX O;  2KI4 C;  2KI6 D;  4FTG A;  2K8M B;  3AAJ A;  4MVF A;  2EHB A;  2JTT A;  3PLF B;  1IQ3 A;  1D1O A;  1EG3 A;  1NPQ A;  1L2O C;  1NX2 A;  4JPZ B;  2LAP A;  1B9A A;  2CXJ A;  1SCV A;  1WLZ A;  3SG6 A;  1ODB A;  1QX7 A;  2D8N A;  3OB2 B;  1KQM C;  3CS1 A;  2LHL A;  1KFX L;  1FF1 A;  2E30 A;  4CLN A;  1V1G A;  1PUL A;  2LMU A;  4MZL A;  1DJI A;  3CLN A;  2LP2 A;  4YBH B;  5ER5 A;  1CLM A;  3SG5 A;  1PSB A;  1YX8 A;  4UPG A;  2KFH A;  1U5I A;  3KEV A;  3M0W A;  3PAT A;  3PM8 A;  4I5J A;  1AJ4 A;  4D1E A;  5HKY A;  1GQM A;  1SY9 A;  2BE4 A;  1TNX A;  1MF8 B;  1SL8 A;  2F3Y A;  2AAO A;  1NX1 A;  1MXE A;  1SMG A;  2KQY A;  4ORB B;  1YTZ C;  4A4C A;  3NSI A;  1FI5 A;  4MRX A;  1CDM A;  3BUM B;  3GK1 A;  4DUQ A;  1J1D A;  3BXK A;  3FWB A;  3I5I B;  1WRZ A;  2R2I A;  1K9K A;  2M49 B;  4AOM A;  1E8A A;  3SG3 A;  1JF2 A;  1OQP A;  2MLF C;  1IQ5 A;  1FI6 A;  2KGB C;  1SK6 D;  1SBJ A;  2KYC A;  1WY9 A;  1XYD A;  1QLK A;  2M97 A;  3OHM B;  1QVI Y;  1OZS A;  1N65 A;  2OTG C;  1K94 A;  1CNP A;  2JQ6 A;  3NSK A;  1K9U A;  1S26 D;  1CFF A;  3IF7 A;  3LCP C;  1A4P A;  3FS7 A;  1YVL A;  2HQW A;  3HX4 A;  4MZK A;  1MUX A;  2KFG A;  4WQ3 A;  2JU0 A;  1WDC C;  1QAS A;  1SW8 A;  2I2R E;  2LV7 A;  1J7P A;  4ZCU A;  1CB1 A;  1R6P A;  4BY4 A;  3GK2 A;  1NP8 A;  2MBX A;  4YGA A;  1BR4 B;  2PAL A;  2ZRS A;  3D0Y A;  1UUS A;  1WRK A;  1FBV A;  2L5X B;  2K61 A;  1QLS A;  2DOQ A;  1PK0 D;  1SR6 B;  1OE9 B;  1UHH A;  3EKJ A;  1CLB A;  2JRF A;  2KFF A;  1F4O A;  2JOJ A;  1K96 A;  5AER A;  2SAS A;  3CR2 A;  4YI9 A;  1MQ1 A;  1DTL A;  1QJT A;  1A03 A;  4OKH A;  4AQI A;  1NYA A;  3BQ3 A;  1SNL A;  2F2O A;  1B7T Y;  2F2P A;  4ORC B;  2COL B;  2WND A;  4WRI A;  1M63 B;  2KNE A;  2JXL A;  1YRU B;  1OSA A;  3JTD B;  1A75 B;  2KQ6 A;  2FCE A;  3I5G B;  2QAC A;  4ORA B;  3SG4 A;  1CM1 A;  1YR5 A;  2IS9 A;  2M7N A;  4MN0 A;  1CFP A;  4MBE A;  2LMV A;  4XJK A;  1BT6 A;  2CTN A;  2WCF A;  1TIZ A;  3SJS A;  4GGF A;  3PFV A;  3O4Y A;  1MHO A;  1M39 A;  2FCD A;  2Q91 A;  1KWO C;  3TUY C;  1Y1X A;  3PSR A;  3VGO A;  4A4B A;  4I5N B;  5HLO A;  4HSZ A;  4MSP A;  4PHM A;  2CT9 A;  1IGV A;  1AHR A;  1MXL C;  2GGM A;  2L98 A;  2M29 A;  2OS8 C;  2B1U A;  3WHU B;  1B8R A;  1KSM A;  1SYM A;  1BG1 A;  4CFQ A;  1V1F A;  1QV0 A;  4OV2 A;  2EC6 B;  1UHJ A;  2LLS A;  3FIA A;  1J7R A;  1UHK A;  2JXC A;  3BOW A;  5BPJ A;  1BOC A;  4GGF C;  2LP3 A;  1XFU O;  2WC8 A;  1HQV A;  3ZNI A;  4BY5 A;  1JFK A;  1N2D A;  1IH0 A;  1QS7 A;  4HRG A;  1QV1 A;  1J1E A;  4GFT A;  2KI4 B;  1UHI A;  2ISD A;  1PVB A;  1S5G Y;  1TNP A;  1RJV A;  1YX7 A;  1WLM A;  1CMG A;  3E3R A;  3OX5 A;  1XFZ O;  1L2O B;  3SG2 A;  4GNK B;  3VRQ A;  3WXA A;  4PCW A;  2BCA A;  2NZ0 A;  2WOR A;  1JWD A;  2M9G A;  5DKN A;  2M8U A;  1RWY A;  1IKU A;  1LIN A;  1X02 A;  1KQM B;  4N1F A;  4ZCV A;  5I2O A;  1UP5 A;  1BR1 B;  3LL8 B;  1S6J A;  1NCY A;  5CSN A;  1G4Y R;  1VRK A;  1QIV A;  4NDC A;  1NX3 A;  2EGD A;  1MR8 A;  1F55 A;  3DF0 B;  1HT9 A;  3TDU A;  3KF9 A;  3TDZ A;  4C0L A;  1OOJ A;  1S1E A;  2G9B A;  5AXI A;  2FJU B;  3TS5 C;  1BF5 A;  4R1E A;  1QAT A;  1SCM B;  2JT8 A;  4CFR A;  1XK4 A;  1JC2 A;  1UWO A;  1QXP A;  3EVV A;  4M2O A;  1S36 A;  2I18 A;  3IQQ A;  2BL0 C;  2Y1N A;  2FOT A;  1Y6W A;  1M45 A;  1ZOT B;  2KI6 C;  1NIW A;  3JVT C;  3A8R A;  3LK0 A;  2PVB A;  3GK4 X;  1JF0 A;  1CTR A;  4MRY A;  2TN4 A;  2LE9 B;  2LVK A;  1K95 A;  3ICB A;  2LC5 A;  2M1K B;  2Y1M A;  1R2U A;  5CSI A;  1XK4 C;  2OTG B;  2K7B A;  2WCE A;  2L51 A;  3EK7 A;  5HKW A;  4PE1 A;  1IJ5 A;  3EKH A;  5I2Q A;  2BEC A;  1NSH A;  2JZI A;  1K93 D;  1TNQ A;  2V53 A;  5KU1 A;  2CCM A;  1AVS A;  2OPO A;  1WDC B;  1JSA A;  3AAK A;  4YGE B;  1K9P A;  1QVI Z;  2CBL A;  3K21 A;  4DRW A;  1KK7 Y;  3CWG A;  1K8U A;  2JWW A;  1TN4 A;  2MAZ A;  2ZNE A;  3PAL A;  2G2B A;  4YGD B;  2LVV A;  1DMO A;  1DF0 B;  2GV5 A;  1B1G A;  2K7C A;  4QJ4 B;  1Y0V H;  1DJX A;  1RK9 A;  2JTZ A;  2ZRT A;  1PSR A;  3DVM A;  3NXA A;  1BU3 A;  5CSJ A;  3LK1 A;  1XO5 A;  1F70 A;  1Y1U A;  2LVI A;  3SIA A;  4OVN F;  3LLE A;  4CID A;  1DGV A;  2M0R A;  1N0Y A;  2M7L A;  3MSE B;  3O2P A;  1GJY A;  2HPS A;  4F0Z B;  5G08 A;  1J7O A;  1XFY O;  5DKR A;  5I2L A;  4QJ5 B;  1BMO A;  5K89 A;  5JOL A;  1FW4 A;  3D0Y B;  1YUS A;  4M2P A;  4GGN A;  1SPY A;  1KCY A;  1M31 A;  4M2Q A;  4PE0 A;  5JJG A;  1UHN A;  2LUC A;  5AAN A;  1K90 D;  3VRN A;  1QX2 A;  3KO0 A;  1LKJ A;  1QX5 B;  1Q80 A;  1JBA A;  1TRF A;  3DVE A;  1G33 A;  2H61 A;  1B7T Z;  3H4S E;  3BYA A;  2WCB A;  2PAS A;  1CMF A;  3GOF A;  4I5K A;  5DKQ A;  4YRU A;  1KWO B;  3TUY B;  1LA0 A;  3BUO B;  1J7Q A;  1KFU L;  1NWD A;  2NCP A;  3EVU A;  4PHK A;  2ZN9 A;  3PN7 C;  1BOD A;  2SCP A;  4NDD A;  2OS8 B;  2LCP A;  5D69 A;  4NQG A;  3I5G C;  1H8B A;  1DJW A;  1TOP A;  1PVA A;  1KK8 C;  1AK8 A;  4XJK B;  3AKA A;  2H61 C;  4L9M A;  2L4H A;  1Y1A A;  1A2X A;  3CGA A;  1KSO A;  2KBI A;  4YGC B;  2LAN A;  1LVC D;  4I5L B;  5AFP A;  1AP4 A;  4OCI A;  1TNW A;  2KGR A;  4HRH A;  4AQJ A;  3NSO A;  3BUW B;  3FWC A;  2LLT A;  3C1V A;  1CFD A;  1F8H A;  1SL9 A;  2I7A A;  1OMR A;  2MRD A;  2L0P A;  1SKT A;  2KAX A;  2KOT A;  3DD4 A;  3EK8 A;  5ER4 X;  5J3X A;  2PMY A;  1YUU A;  1NCX A;  2F3Z A;  4YI8 A;  3BUX B;  1PRW A;  2HET A;  3I5F C;  1W7I B;  1S5G Z;  1W7J B;  2JNF A;  3I5H C;  1OMV A;  3O6B A;  1S6C A;  3DF0 A;  1FPW A;  1K2H A;  2PSR A;  2PRU A;  3DVK A;  1QIW A;  3DVJ A;  1WRL A;  4PE4 A;  1F54 A;  5F6T A;  2KSP A;  1CKK A;  3TS5 B;  4USL A;  1M46 A;  1ZAC A;  2O5G A;  1SL7 A;  5HKZ A;  3ZWH A;  5HYD A;  1BLQ A;  2KAY A;  2K0J A;  2A4J A;  2NCO A;  1C7W A;  2Y4Q A;  2KBM A;  4PE7 A;  1EG4 A;  2BL0 B;  3D10 A;  1NUB A;  1B4C A;  3WNX B;  1ZFS A;  1RRO A;  1DT7 B;  4OR9 B;  3RLZ A;  3AKB A;  4MZJ A;  4C0K A;  3JVT B;  1NX0 A;  1XFW O;  1ZUZ A;  1PAL A;  3BUN B;  1AUI B;  1U5I B;  3VRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...