2EGDA

Crystal structure of human s100a13 in the ca2+-bound state
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
86
structure length
86
Chain Sequence
PLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A13
publication title Crystal structure of human S100A13 in the Ca2+-bound state
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 28
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2egdA00
1DJWA 3LCPC 5D69A 4I5NB 5HKZA 2M7LA 1PSRA 2KYCA 3KHEA 1F8HA 1A03A 2JTZA 2I2RE 1KFUS 5HKYA 3PSRA 1RTP1 4PHMA 2KDHA 1EL4A 4PE1A 4YGAA 2CNPA 1KK8C 3OHMB 2WOSA 2BE6A 3DVEA 1N65A 3TS5C 1TNXA 5F6TA 1ZOTB 4DS7A 2LUCA 2K7BA 4GGNA 2M1KB 5HLVA 1M31A 2CXJA 2NZ0A 1AK8A 2RGIA 1QLSA 1G33A 1M45A 2EC6B 2OTGC 2BKHB 3TDZA 2L5XB 2KAVA 1F70A 4USLA 1BR1B 2R2IA 2O5GA 1XK4A 1NCZA 1AJ4A 1N2DA 2KOTA 3CR2A 1SL9A 1F71A 3DF0B 2KI6D 1KK7Y 2KI4B 1YX7A 2PSRA 3LK0A 3NSOA 1NYAA 1WRKA 4F0ZB 2BKIB 4MLWA 5AANA 3FIAA 1CLMA 2E30A 4PE4A 1H8BA 1XFYO 1D1OA 2LP3A 5GQQC 2WCEA 1ZMZA 5I8NA 4GAOA 1AVSA 4A4BA 1L7ZA 2F33A 3GK4X 4GFTA 5J3XA 2HQ8A 2JNFA 1UHNA 3OX5A 3PATA 1MUXA 1Y1XA 1SCMB 1YVHA 2DOQA 1M63B 2Y4QA 2ZNDA 2NCOA 4DIRA 2QPTA 2I94A 1PALA 2KAYA 5DKQA 1BOCA 1DJXA 1OMRA 1SMGA 3BXKA 4AQJA 1LKJA 1C7WA 5CSIA 5AERA 2FCDA 4A4CA 3OB1B 2ZRSA 3FWCA 2CBLA 1RROA 4YI8A 3SG7A 3ZNIA 1MWNA 3RM1A 3IQQA 2ZN9A 1K94A 2F3YA 2KNEA 3BYAA 1Y0VH 3F45A 1S26D 2M97A 3DVMA 4MRXA 3NSIA 3AKAA 1CNPA 3LK1A 2MBXA 2I7AA 1DGVA 4I5KA 4I5LB 2KYFA 4M2OA 1PVAA 1CMFA 2I18A 3QRXA 4I5JA 3H4SE 4NDBA 5I2LA 2PMYA 4MVFA 4NDDA 2FOTA 2JT8A 2M8UA 1CDMA 1QX5B 1UWOA 2HPSA 2CTNA 3PN7B 4XJKA 1FF1A 1JF0A 2JXLA 1UP5A 1FPWA 4PE0A 1FI5A 1NP8A 4D1EA 2MRDA 5AEQA 5I2QA 1QV1A 2K7CA 3CLNA 1NCXA 2SCPA 1QLKA 2KFFA 4MZKA 2JQ6A 1K8UA 3VRQA 1C7VA 1M39A 2L50A 2Y5IA 2JC2A 4CPVA 1NX3A 4N1GA 2MLEC 1KK7Z 1IG5A 3CGAA 3KEVA 2JT0A 2G2BA 4ICBA 5G08A 1CDPA 1CM4A 1AHRA 3NSKA 3PM8A 4ORCB 3A4UB 4U8DA 4CFRA 5KTYA 1N0YA 1EXRA 4CIDA 2KAXA 2LLUA 2L4HA 2KGBC 2HETA 2Q91A 3SIBA 1UUSA 2LMUA 4Q04A 4PCWA 2Y1MA 1EG4A 3SG6A 1F54A 2PASA 4OVNF 1GGWA 1M46A 2LVJA 3FS7A 2LLSA 3PFVA 2LVVA 2COLB 1JBAA 3IQOA 1MQ1A 4JQ0D 1K96A 4QJ4B 1RFJA 2NCPA 2EHBA 2LVKA 3BUWB 3OP0A 2K2AA 1L2OC 4JPZB 2GV5A 1WDCB 1MF8B 4MN0A 4QJ5B 1XFXO 2MA2A 1G4YR 1DT7B 1SR6C 4M2PA 2K8MB 3JVTB 1E8AA 4MZLA 1S6JA 2KQ6A 4MSPA 5HLOA 4WQ3A 2BECA 2IS9A 5BPJA 3BUNB 5JOLA 4GNKB 2E6WA 2B1UA 4YGDB 2KBMA 1J7OA 3D0YA 1QJTA 4TNCA 1YTZC 2K0JA 1S3PA 4M2QA 5KSZA 1R2UA 2F3ZA 1K95A 1EH2A 4C0LA 1J7RA 3SG3A 3C1VA 4NDCA 1F4QA 1SKTA 5AFPA 2WCFA 4UPGA 5HKWA 3AAJA 3I5HB 3CTNA 1S1EA 2PVBA 2K61A 3DVJA 1J55A 2LAPA 4DCKA 1ZFSA 2H61A 2JXCA 2MAZA 2LHIA 4PHJA 2EC6C 1IJ5A 1Y6WA 1IKUA 2K7OA 1CLBA 4GGFC 1KFXL 3BQ3A 2L0PA 5CSNA 1F4OA 3BUOB 4AOMA 2WORA 1J7QA 4ETOA 1KSOA 2KI4C 1PULA 4FQOA 2LVIA 3M0WA 4C0KA 1SNLA 1K9UA 4BY4A 4YGCB 4DUQA 2AMIA 4DRWA 2M1UA 1JWDA 1YRUB 4PE7A 1IQ3A 2OS8B 1PK0D 3EKJA 1PRWA 1TIZA 2F8PA 4YGBB 5KU1A 5I2OA 1JSAA 4E68A 3AAKA 1HQVA 5CPVA 1Q80A 1CM1A 2M7NA 1XK4C 2OS8C 2L4IA 1SCMC 2Q4UA 1B1GA 4ZCVA 2H2KA 2GGMA 1BODA 3BUMB 1KQMB 2CT9A 3EVUA 3LL8B 1CMGA 1RWYA 3BOWA 1ZUZA 5TNCA 5PALA 1LVCD 3TDIA 1CFDA 2SASA 2ZKMX 2KFGA 2LLTA 4OR9B 1KQMC 1WLMA 3EK4A 5AXIA 1CFFA 1LA0A 2JRFA 1ALVA 1QV0A 1TN4A 2BBMA 1OMDA 1A75A 1BJFA 5ER5A 4PHNA 1IJ6A 2BL0B 2VRGA 2BCBA 1QASA 3BOWB 4N5XA 4OCIA 4P5OE 1YUSA 1YUTA 3JTDB 1SRAA 1B7TZ 1UHJA 2A4JA 4QJ3B 3OB2B 2JTTA 1K93D 3PN7C 1IRJA 2LNKA 1CKKA 1OQPA 3NSLA 1B8RA 3A8RA 1OOJA 1NWDA 1FBVA 2AAOA 2AUCA 1SYMA 1NCYA 3IF7A 3I5IB 1QIVA 1MXEA 3D10A 1KWOB 3O4YA 4N1FA 1NSHA 1BG1A 1OE9B 1CB1A 4R1EA 2G9BA 1KQVA 4GBAA 2LANA 4XJKB 1S6IA 2L51A 3MSEB 4CFQA 1DJIA 2JOJA 1S36A 2F2OA 3KF9A 5IBWA 3EK8A 1B9AA 1B8CA 1J1DA 2M3WA 1VRKA 1IH0A 1BLQA 2GGZA 1U5IA 1A4PA 3EKHA 3WHUB 1CFCA 2ZRTA 3TUYB 1J7PA 2F2PA 1XYDA 1AJ5A 2LE9B 2KHNA 4JWQA 1SPYA 1DJYA 1F55A 1J1EA 1XFZO 1PVBA 1QVIZ 1BMOA 4ORBB 1RECA 2CCMA 1UHHA 3TDUA 5B8IB 3WXAA 1AP4A 1WDCC 1MR8A 1EJ3A 1DGUA 1WLZA 2K2FA 3I5GB 1GQMA 3ZWHA 1SL7A 1LXFC 3EVVA 4C0JA 4PDZA 1YURA 1DTLA 2KGRA 3JVTC 2JU0A 2QACA 1NX1A 1QX7A 1KFXS 1A29A 1OMVA 2PRUA 1X02A 3RLZA 2JPTA 2LM5A 3K21A 1YUUA 3HCMA 5CSFA 1JFKA 2LP2A 1K2HA 2LMTA 1KK8B 2BCAA 1NX2A 4GGFA 2O60A 3TS5B 1QTXA 1BF5A 1AUIB 1TOPA 1UURA 1SCVA 1NIWA 1B7TY 3PALA 5CSJA 1CTRA 3DF0A 1XFWO 1DMOA 2WCBA 2OTGB 3I5FB 2ISDA 2ZFDA 3D0YB 3I5HC 1JF2A 4PHKA 1B4CA 4AQIA 1ALWA 5FYXA 1XVJA 3SG2A 1YR5A 1EG3A 1S5GZ 1K9KA 1BU3A 1DJHA 1G8IA 4MZJA 1NUBA 3SIAA 3I5FC 1QXPA 5ER4X 2K7DA 3VRNA 1SW8A 3OX6A 4GUKA 1XFUO 1B8LA 2LUXA 1MXLC 3GK1A 1QIWA 4YBHB 1KFUL 2V53A 1W7IB 2Y1NA 3DD4A 4IL1A 1LINA 4YRUA 2EGDA 1WRLA 4ZCUA 1S6CA 1SBJA 4OKHA 4MRYA 3ICBA 2LMVA 1QVIY 1LA3A 1DF0A 1IGVA 2H61C 2BBNA 2MHHA 1MHOA 4BY5A 2KSPA 2NXQA 1IQ5A 4XYNA 2HQWA 1Y1UA 2OPOA 3O6BA 1TRFA 5HYDA 4PALA 1R6PA 1TNQA 1SK6D 4HRHA 1OSAA 4ORAB 1YX8A 1QX2A 4GPLB 1PSBA 2JZIA 3NXAA 3KPXA 3CZTX 3VRPA 3WNXB 2JWWA 3WHTB 1YRTB 1K90D 1QATA 2JT3A 1W7JB 2L2EA 5K89A 1JFJA 1DF0B 1A2XA 1CDLA 3O78A 2LV7A 4P2YB 1V1FA 4FTGA 5JJGA 5DKNA 1IWQA 2LHLA 1OZSA 1QS7A 2D8NA 5D7FA 4HRGA 2LC5A 4YGEB 3SJSA 1TNWA 4MBEA 3EK7A 3PLFB 1RJVA 2M9GA 1S5GY 1FI6A 1GGZA 2BL0C 2BCXA 1WRZA 2FJUB 2ZN8A 4CLNA 3GOFA 1SL8A 2NLNA 3VROA 4HSZA 1TCFA 2KFHA 3FWBA 3JTDC 3CR4X 1FW4A 1CDNA 1JC2A 2KBIA 1OZOA 1TTXA 1NPQA 3GK2A 1H4BA 1CLLA 1KCYA 2M0RA 2L98A 2FCEA 4L9MA 4YI9A 1A75B 3SG5A 1XFVO 2HF5A 1B47A 1K9PA 2M29A 2MLFC 4WRIA 3O2PA 2WC8A 1HT9A 3I5IC 3SG4A 1DJZA 1CFPA 1KWOC 3VRRA 4HREE 2ZNEA 1ODBA 3CR5X 1BR4B 5DKRA 2MJWB 1BT6A 2BE4A 1RK9A 4NQGA 1DJGA 1WY9A 3E3RA 4MEWA 4WQ2A 3KO0A 2P6BB 2PALA 2M49B 1JUOA 1ZACA 2TN4A 3HX4A 4OV2A 1UHKA 1TCOB 2KQYA 1L2OB 3TZ1A 2JNXA 1NX0A 3AKBA 2WNDA 3TUYC 1SY9A 1GJYA 3DVKA 3BUXB 3VGOA 1YVLA 1UHIA 3LLEA 3CS1A 1KSMA 2KI6C 1SR6B 3EVRA 2LCPA 1V1GA 1DVIA 1U5IB 1XO5A 1Y1AA 2JULA 1C07A 3CWGA 3I5GC 1TNPA 1XA5A
chains in the Genus database with same CATH superfamily
1DJWA 3LCPC 5D69A 4I5NB 5HKZA 4KYNA 1PSRA 2KYCA 2M7LA 3KHEA 1F8HA 1A03A 2JTZA 2I2RE 1KFUS 5HKYA 3PSRA 1RTP1 4PHMA 2KDHA 1EL4A 4PE1A 4YGAA 1OW4A 2CNPA 1KK8C 3OHMB 2WOSA 2BE6A 3DVEA 3S0FA 1N65A 3TS5C 1TNXA 3D78A 5F6TA 1OOFA 1ZOTB 4DS7A 2LUCA 2K7BA 4GGNA 2M1KB 3DYEA 2ERBA 1M31A 2CXJA 2NZ0A 5HLVA 1AK8A 2RGIA 1QLSA 1G33A 1M45A 2EC6B 2OTGC 3R1OA 2BKHB 3TDZA 2L5XB 2KAVA 1F70A 4USLA 1BR1B 5D3OA 2R2IA 2O5GA 1XK4A 1NCZA 1AJ4A 1N2DA 3DXLA 2KOTA 3CR2A 1SL9A 3B88A 1F71A 3DF0B 2KI6D 1KK7Y 2KI4B 1YX7A 2PSRA 3LK0A 3NSOA 1NYAA 1WRKA 4F0ZB 2BKIB 3CZ1A 4MLWA 5AANA 3FIAA 1CLMA 2E30A 4PE4A 1H8BA 1XFYO 1D1OA 1Z2CB 2LP3A 5GQQC 2WCEA 1ZMZA 5I8NA 4GAOA 1AVSA 4A4BA 1L7ZA 3UO9A 2F33A 3GK4X 3FE6A 4GFTA 5J3XA 2HQ8A 2JNFA 1TWOA 1UHNA 3OX5A 1MUXA 3PATA 1DC1A 1Y1XA 1SCMB 1YVHA 2DOQA 1M63B 2Y4QA 2ZNDA 2NCOA 4DIRA 2QPTA 2I94A 1PALA 2KAYA 5DKQA 1BOCA 1DJXA 1OMRA 1SMGA 3BXKA 4AQJA 3FE8A 1LKJA 3OGNA 1C7WA 2KLEA 5CSIA 1GM0A 5AERA 2H8VA 2FCDA 4A4CA 3OB1B 5FI6A 2ZRSA 3FWCA 2CBLA 2WCMA 1RROA 4YI8A 3Q8IA 3SG7A 3ZNIA 2L5YA 1C3YA 1MWNA 3RM1A 3IQQA 2ZN9A 1K94A 2F3YA 2KNEA 3BYAA 1Y0VH 3F45A 3N7HA 1S26D 2M97A 3DZTA 3DVMA 4MRXA 3S0AA 3NSIA 3AKAA 1CNPA 3LK1A 2MBXA 2I7AA 1DQEA 1DGVA 4I5KA 4I5LB 2KYFA 4M2OA 1PVAA 4INXA 1ORGA 1CMFA 2I18A 4PT1A 3QRXA 4I5JA 1LS8A 3H4SE 4NDBA 5I2LA 2PMYA 4MVFA 4NDDA 2FOTA 2JT8A 3V2LA 2M8UA 1CDMA 1QX5B 1UWOA 2HPSA 2CTNA 3PN7B 4XJKA 1FF1A 1JF0A 2JXLA 1UP5A 1FPWA 4PE0A 1FI5A 1NP8A 4D1EA 2MRDA 5AEQA 5I2QA 1QV1A 2K7CA 3CLNA 3CABA 1NCXA 3CDNA 2SCPA 1QLKA 2KFFA 4MZKA 2JQ6A 1K8UA 3VRQA 1C7VA 1M39A 2L50A 2Y5IA 1W9ZA 2JC2A 4CPVA 4JKTA 1NX3A 3L4LA 4N1GA 2MLEC 1KK7Z 1IG5A 2QDIA 3CGAA 2JT0A 3KEVA 2G2BA 3PJIA 4ICBA 5G08A 1CDPA 1CM4A 1AHRA 3NSKA 3PM8A 4ORCB 3A4UB 4U8DA 1OOHA 4CFRA 5KTYA 1N0YA 1EXRA 3D76A 4CIDA 2KAXA 2LLUA 2L4HA 2KGBC 2HETA 2Q91A 3SIBA 1UUSA 2L2CA 2LMUA 4Q04A 4PCWA 2Y1MA 1EG4A 3SG6A 3VB1A 1F54A 2PASA 4OVNF 1GGWA 1M46A 2LVJA 3FS7A 2LLSA 3PFVA 2LVVA 2COLB 1JBAA 3IQOA 1MQ1A 4JQ0D 1K96A 4QJ4B 3CZ2A 1RFJA 2NCPA 2EHBA 2LVKA 3BUWB 3OP0A 2K2AA 1L2OC 4JPZB 2GV5A 1WDCB 1MF8B 1C3ZA 4MN0A 4QJ5B 1XFXO 2MA2A 1G4YR 1DT7B 1SR6C 4M2PA 2K8MB 3JVTB 3SS3A 1E8AA 2YGUA 4MZLA 1S6JA 2KQ6A 3NHIA 4MSPA 5HLOA 2QEVA 4WQ3A 2BECA 2IS9A 3S0EA 3BUNB 5JOLA 5BPJA 3B86A 4GNKB 2E6WA 2B1UA 4YGDB 2KBMA 3K1EA 1J7OA 3SS4A 3D0YA 1QJTA 4TNCA 1YTZC 2K0JA 1S3PA 2PQLA 4M2QA 5KSZA 1R2UA 2F3ZA 1K95A 1EH2A 4C0LA 1J7RA 3SG3A 3RZSA 3C1VA 4NDCA 1F4QA 1SKTA 5AFPA 2QEOA 2WCFA 2WCHA 4UPGA 5HKWA 3AAJA 3I5HB 3CTNA 1S1EA 2PVBA 2K61A 3DVJA 1J55A 2LAPA 4DCKA 1ZFSA 2H61A 2JXCA 2MAZA 2LHIA 4PHJA 2EC6C 1IJ5A 5FI2A 1Y6WA 4FQTA 3D74A 1IKUA 2K7OA 1CLBA 4GGFC 1KFXL 3BQ3A 2L0PA 5CSNA 1F4OA 3BUOB 4AOMA 2WORA 1J7QA 4ETOA 1KSOA 2KI4C 1PULA 4FQOA 2LVIA 3M0WA 4C0KA 1SNLA 1K9UA 4BY4A 4YGCB 4DUQA 3CYZA 2AMIA 4DRWA 2M1UA 1JWDA 1YRUB 4PE7A 1IQ3A 2OS8B 1PK0D 3EKJA 1PRWA 1TIZA 2F8PA 4YGBB 3QMEA 5KU1A 5I2OA 4N1FA 1JSAA 4E68A 3AAKA 1HQVA 5CPVA 1Q80A 1CM1A 2WC6A 2M7NA 1XK4C 2OS8C 2K60A 2L4IA 1SCMC 2Q4UA 1B1GA 4ZCVA 3UNWA 2H2KA 1P28A 2GGMA 1BODA 3BUMB 1KQMB 2CT9A 2KLDA 3EVUA 3LL8B 1CMGA 1RWYA 3BOWA 1ZUZA 5TNCA 5PALA 1LVCD 3BFHA 3B6XA 3TDIA 1CFDA 2SASA 2ZKMX 2KFGA 2LLTA 2QEBA 4OR9B 1KQMC 1WLMA 3EK4A 5AXIA 1CFFA 1LA0A 2JRFA 1ALVA 1QV0A 1TN4A 2BBMA 2WCJA 1OMDA 1A75A 1BJFA 5ER5A 4PHNA 1IJ6A 2BL0B 5FI7A 2VRGA 2BCBA 1QASA 3BOWB 4N5XA 4OZDA 4OCIA 4P5OE 1YUSA 1YUTA 3JTDB 1SRAA 1B7TZ 1UHJA 2A4JA 4QJ3B 3OB2B 2JTTA 1DELA 1K93D 3PN7C 1IRJA 2LNKA 1CKKA 1OQPA 3NSLA 1B8RA 3A8RA 1OOJA 3FE9A 1NWDA 2WCLA 3R72A 1FBVA 2AAOA 2AUCA 1SYMA 1NCYA 3IF7A 3I5IB 1QIVA 1MXEA 3D10A 1KWOB 3O4YA 3R1PA 1NSHA 2P70A 1OE9B 1BG1A 4R1EA 2G9BA 1KQVA 4GBAA 2LANA 4XJKB 1S6IA 2L51A 4INWA 3MSEB 1TUJA 4CFQA 1DJIA 1XFRA 2JOJA 1S36A 2F2OA 3KF9A 3NGVA 5IBWA 3EK8A 1B9AA 1B8CA 1J1DA 2M3WA 3CZ0A 1VRKA 1IH0A 1BLQA 2GGZA 1U5IA 1A4PA 3EKHA 3WHUB 1CB1A 1CFCA 2ZRTA 3TUYB 1J7PA 2F2PA 1XYDA 1AJ5A 2LE9B 2KHNA 4JWQA 1SPYA 1DJYA 1F55A 1J1EA 1XFZO 1PVBA 1QVIZ 1BMOA 4ORBB 1RECA 2CCMA 1UHHA 3TDUA 5B8IB 3WXAA 5HL1A 1AP4A 1WDCC 1MR8A 1EJ3A 1DGUA 1WLZA 2K2FA 3I5GB 1GQMA 3IVTA 1SL7A 1LXFC 3EVVA 3ZWHA 4PDZA 4C0JA 1YURA 1DTLA 2KGRA 3JVTC 2JU0A 2QACA 1OOIX 2QEHA 1NX1A 1QX7A 1T14A 1KFXS 1A29A 1OMVA 2PRUA 1X02A 3RLZA 2JPTA 2LM5A 3K21A 1YUUA 3HCMA 3S0BA 5CSFA 1JFKA 1Z4HA 2LP2A 2LMTA 1K2HA 5DICA 1KK8B 2BCAA 1NX2A 4GGFA 2O60A 3TS5B 1QTXA 1BF5A 1AUIB 1TOPA 1UURA 3OBVA 1SCVA 1NIWA 1B7TY 3PALA 5CSJA 1CTRA 3DF0A 2P71A 1XFWO 1DMOA 2WCBA 2OTGB 3I5FB 2ISDA 2ZFDA 2FJYA 3D0YB 3I5HC 1JF2A 4PHKA 1B4CA 4AQIA 1ALWA 5FYXA 1XVJA 3SG2A 1YR5A 1EG3A 1S5GZ 1K9KA 1BU3A 1DJHA 1G8IA 4MZJA 1NUBA 3SIAA 3I5FC 1QXPA 5ER4X 1DEKA 2K7DA 3VRNA 1OOGA 1SW8A 3OX6A 4GUKA 1XFUO 1B8LA 2LUXA 1MXLC 3GK1A 1QIWA 4YBHB 1KFUL 2PYQA 2V53A 3BFAA 1W7IB 2Y1NA 3DD4A 4IL1A 1LINA 4YRUA 1SSEB 2EGDA 1WRLA 4ZCUA 1S6CA 1SBJA 4OKHA 4MRYA 3ICBA 2LMVA 3BFBA 1QVIY 1LA3A 1DF0A 1IGVA 2H61C 2BBNA 2MHHA 3D73A 1MHOA 4BY5A 2KSPA 2NXQA 1IQ5A 4XYNA 2HQWA 1Y1UA 2OPOA 3O6BA 1TRFA 5HYDA 1IIOA 4PALA 1R6PA 1TNQA 3L47A 1SK6D 4HRHA 1OSAA 4F7FA 3BJHA 4ORAB 1YX8A 1QX2A 2KPHA 4GPLB 1PSBA 3D77A 2JZIA 3DY9A 3NXAA 2JPOA 3KPXA 3CZTX 2BAPA 3VRPA 3L4AA 3PM2A 2JWWA 3WHTB 1YRTB 3WNXB 1K90D 5EL2A 1QATA 2JT3A 1W7JB 2L2EA 2WCKA 5K89A 1JFJA 1DF0B 1A2XA 1CDLA 3O78A 2LV7A 4P2YB 3EG5B 1V1FA 4FTGA 5JJGA 5DKNA 3R1VA 1IWQA 2LHLA 3B87A 1OZSA 1QS7A 2D8NA 4JD9A 1TUZA 5D7FA 4HRGA 2LC5A 4YGEB 3SJSA 1TNWA 4MBEA 3EK7A 3PLFB 1RJVA 2M9GA 1S5GY 1FI6A 3O4XA 1GGZA 2BL0C 2BCXA 1WRZA 2FJUB 2ZN8A 4CLNA 3GOFA 1SL8A 2NLNA 3VROA 4HSZA 1TCFA 2KFHA 3FWBA 3JTDC 3CR4X 1FW4A 1CDNA 1JC2A 2KBIA 1OZOA 1TTXA 1NPQA 3GK2A 4IJ7A 1CLLA 1H4BA 1KCYA 2M0RA 2L98A 2FCEA 4L9MA 4YI9A 1A75B 3SG5A 1QWVA 1XFVO 2HF5A 1B47A 1K9PA 2M29A 2MLFC 4WRIA 3D75A 3O2PA 2WC8A 1HT9A 3I5IC 3SG4A 1DJZA 1CFPA 1KWOC 2WC5A 3VRRA 3S0GA 4HREE 2ZNEA 1ODBA 3CR5X 1BR4B 2GTEA 2MJWB 5DKRA 1BT6A 2BE4A 1RK9A 4NQGA 1DJGA 1WY9A 3E3RA 4MEWA 4WQ2A 3KO0A 2P6BB 2PALA 2M49B 1JUOA 1ZACA 2TN4A 3HX4A 4OV2A 1UHKA 1TCOB 2KQYA 1L2OB 3TZ1A 2BNXA 2JNXA 3NHTA 1NX0A 3AKBA 2WNDA 3TUYC 1SY9A 1GJYA 3DVKA 3BUXB 3SS5A 3VGOA 1YVLA 1UHIA 3B7AA 3LLEA 3CS1A 3S0DA 1KSMA 2KI6C 1SR6B 3EVRA 2LCPA 1V1GA 1DVIA 1U5IB 5I94A 1XO5A 1Y1AA 2JULA 1C07A 3CWGA 3I5GC 1TNPA 1XA5A
chains in the Genus database with same CATH topology
1DJWA 3LCPC 5D69A 4I5NB 5HKZA 2M7LA 1PSRA 2KYCA 3KHEA 1F8HA 1A03A 2JTZA 2I2RE 1KFUS 5HKYA 3PSRA 1RTP1 4PHMA 2KDHA 1EL4A 4PE1A 4YGAA 2CNPA 1KK8C 3OHMB 2WOSA 2BE6A 3DVEA 1N65A 3TS5C 1TNXA 5F6TA 1ZOTB 4DS7A 2LUCA 2K7BA 4GGNA 2M1KB 5HLVA 1M31A 2CXJA 2NZ0A 1AK8A 2RGIA 1QLSA 1G33A 1M45A 2EC6B 2OTGC 2BKHB 3TDZA 2L5XB 2KAVA 1F70A 4USLA 1BR1B 2R2IA 2O5GA 1XK4A 1NCZA 1AJ4A 1N2DA 2KOTA 3CR2A 1SL9A 1F71A 3DF0B 2KI6D 1KK7Y 2KI4B 1YX7A 2PSRA 3LK0A 3NSOA 1NYAA 1WRKA 4F0ZB 2BKIB 4MLWA 5AANA 3FIAA 1CLMA 2E30A 4PE4A 1H8BA 1XFYO 1D1OA 2LP3A 5GQQC 2WCEA 1ZMZA 5I8NA 4GAOA 1AVSA 4A4BA 1L7ZA 2F33A 3GK4X 4GFTA 5J3XA 2HQ8A 2JNFA 1UHNA 3OX5A 3PATA 1MUXA 1Y1XA 1SCMB 1YVHA 2DOQA 1M63B 2Y4QA 2ZNDA 2NCOA 4DIRA 2QPTA 2I94A 1PALA 2KAYA 5DKQA 1BOCA 1DJXA 1OMRA 1SMGA 3BXKA 4AQJA 1LKJA 1C7WA 5CSIA 5AERA 2FCDA 4A4CA 3OB1B 2ZRSA 3FWCA 2CBLA 1RROA 4YI8A 3SG7A 3ZNIA 1MWNA 3RM1A 3IQQA 2ZN9A 1K94A 2F3YA 2KNEA 3BYAA 1Y0VH 3F45A 1S26D 2M97A 3DVMA 4MRXA 3NSIA 3AKAA 1CNPA 3LK1A 2MBXA 2I7AA 1DGVA 4I5KA 4I5LB 2KYFA 4M2OA 1PVAA 1CMFA 2I18A 3QRXA 4I5JA 3H4SE 4NDBA 5I2LA 2PMYA 4MVFA 4NDDA 2FOTA 2JT8A 2M8UA 1CDMA 1QX5B 1UWOA 2HPSA 2CTNA 3PN7B 4XJKA 1FF1A 1JF0A 2JXLA 1UP5A 1FPWA 4PE0A 1FI5A 1NP8A 4D1EA 2MRDA 5AEQA 5I2QA 1QV1A 2K7CA 3CLNA 1NCXA 2SCPA 1QLKA 2KFFA 4MZKA 2JQ6A 1K8UA 3VRQA 1C7VA 1M39A 2L50A 2Y5IA 2JC2A 4CPVA 1NX3A 4N1GA 2MLEC 1KK7Z 1IG5A 3CGAA 3KEVA 2JT0A 2G2BA 4ICBA 5G08A 1CDPA 1CM4A 1AHRA 3NSKA 3PM8A 4ORCB 3A4UB 4U8DA 4CFRA 5KTYA 1N0YA 1EXRA 4CIDA 2KAXA 2LLUA 2L4HA 2KGBC 2HETA 2Q91A 3SIBA 1UUSA 2LMUA 4Q04A 4PCWA 2Y1MA 1EG4A 3SG6A 1F54A 2PASA 4OVNF 1GGWA 1M46A 2LVJA 3FS7A 2LLSA 3PFVA 2LVVA 2COLB 1JBAA 3IQOA 1MQ1A 4JQ0D 1K96A 4QJ4B 1RFJA 2NCPA 2EHBA 2LVKA 3BUWB 3OP0A 2K2AA 1L2OC 4JPZB 2GV5A 1WDCB 1MF8B 4MN0A 4QJ5B 1XFXO 2MA2A 1G4YR 1DT7B 1SR6C 4M2PA 2K8MB 3JVTB 1E8AA 4MZLA 1S6JA 2KQ6A 4MSPA 5HLOA 4WQ3A 2BECA 2IS9A 5BPJA 3BUNB 5JOLA 4GNKB 2E6WA 2B1UA 4YGDB 2KBMA 1J7OA 3D0YA 1QJTA 4TNCA 1YTZC 2K0JA 1S3PA 4M2QA 5KSZA 1R2UA 2F3ZA 1K95A 1EH2A 4C0LA 1J7RA 3SG3A 3C1VA 4NDCA 1F4QA 1SKTA 5AFPA 2WCFA 4UPGA 5HKWA 3AAJA 3I5HB 3CTNA 1S1EA 2PVBA 2K61A 3DVJA 1J55A 2LAPA 4DCKA 1ZFSA 2H61A 2JXCA 2MAZA 2LHIA 4PHJA 2EC6C 1IJ5A 1Y6WA 1IKUA 2K7OA 1CLBA 4GGFC 1KFXL 3BQ3A 2L0PA 5CSNA 1F4OA 3BUOB 4AOMA 2WORA 1J7QA 4ETOA 1KSOA 2KI4C 1PULA 4FQOA 2LVIA 3M0WA 4C0KA 1SNLA 1K9UA 4BY4A 4YGCB 4DUQA 2AMIA 4DRWA 2M1UA 1JWDA 1YRUB 4PE7A 1IQ3A 2OS8B 1PK0D 3EKJA 1PRWA 1TIZA 2F8PA 4YGBB 5KU1A 5I2OA 1JSAA 4E68A 3AAKA 1HQVA 5CPVA 1Q80A 1CM1A 2M7NA 1XK4C 2OS8C 2L4IA 1SCMC 2Q4UA 1B1GA 4ZCVA 2H2KA 2GGMA 1BODA 3BUMB 1KQMB 2CT9A 3EVUA 3LL8B 1CMGA 1RWYA 3BOWA 1ZUZA 5TNCA 5PALA 1LVCD 3TDIA 1CFDA 2SASA 2ZKMX 2KFGA 2LLTA 4OR9B 1KQMC 1WLMA 3EK4A 5AXIA 1CFFA 1LA0A 2JRFA 1ALVA 1QV0A 1TN4A 2BBMA 1OMDA 1A75A 1BJFA 5ER5A 4PHNA 1IJ6A 2BL0B 2VRGA 2BCBA 1QASA 3BOWB 4N5XA 4OCIA 4P5OE 1YUSA 1YUTA 3JTDB 1SRAA 1B7TZ 1UHJA 2A4JA 4QJ3B 3OB2B 2JTTA 1K93D 3PN7C 1IRJA 2LNKA 1CKKA 1OQPA 3NSLA 1B8RA 3A8RA 1OOJA 1NWDA 1FBVA 2AAOA 2AUCA 1SYMA 1NCYA 3IF7A 3I5IB 1QIVA 1MXEA 3D10A 1KWOB 3O4YA 4N1FA 1NSHA 1BG1A 1OE9B 1CB1A 4R1EA 2G9BA 1KQVA 4GBAA 2LANA 4XJKB 1S6IA 2L51A 3MSEB 4CFQA 1DJIA 2JOJA 1S36A 2F2OA 3KF9A 5IBWA 3EK8A 1B9AA 1B8CA 1J1DA 2M3WA 1VRKA 1IH0A 1BLQA 2GGZA 1U5IA 1A4PA 3EKHA 3WHUB 1CFCA 2ZRTA 3TUYB 1J7PA 2F2PA 1XYDA 1AJ5A 2LE9B 2KHNA 4JWQA 1SPYA 1DJYA 1F55A 1J1EA 1XFZO 1PVBA 1QVIZ 1BMOA 4ORBB 1RECA 2CCMA 1UHHA 3TDUA 5B8IB 3WXAA 1AP4A 1WDCC 1MR8A 1EJ3A 1DGUA 1WLZA 2K2FA 3I5GB 1GQMA 3ZWHA 1SL7A 1LXFC 3EVVA 4C0JA 4PDZA 1YURA 1DTLA 2KGRA 3JVTC 2JU0A 2QACA 1NX1A 1QX7A 1KFXS 1A29A 1OMVA 2PRUA 1X02A 3RLZA 2JPTA 2LM5A 3K21A 1YUUA 3HCMA 5CSFA 1JFKA 2LP2A 1K2HA 2LMTA 1KK8B 2BCAA 1NX2A 4GGFA 2O60A 3TS5B 1QTXA 1BF5A 1AUIB 1TOPA 1UURA 1SCVA 1NIWA 1B7TY 3PALA 5CSJA 1CTRA 3DF0A 1XFWO 1DMOA 2WCBA 2OTGB 3I5FB 2ISDA 2ZFDA 3D0YB 3I5HC 1JF2A 4PHKA 1B4CA 4AQIA 1ALWA 5FYXA 1XVJA 3SG2A 1YR5A 1EG3A 1S5GZ 1K9KA 1BU3A 1DJHA 1G8IA 4MZJA 1NUBA 3SIAA 3I5FC 1QXPA 5ER4X 2K7DA 3VRNA 1SW8A 3OX6A 4GUKA 1XFUO 1B8LA 2LUXA 1MXLC 3GK1A 1QIWA 4YBHB 1KFUL 2V53A 1W7IB 2Y1NA 3DD4A 4IL1A 1LINA 4YRUA 2EGDA 1WRLA 4ZCUA 1S6CA 1SBJA 4OKHA 4MRYA 3ICBA 2LMVA 1QVIY 1LA3A 1DF0A 1IGVA 2H61C 2BBNA 2MHHA 1MHOA 4BY5A 2KSPA 2NXQA 1IQ5A 4XYNA 2HQWA 1Y1UA 2OPOA 3O6BA 1TRFA 5HYDA 4PALA 1R6PA 1TNQA 1SK6D 4HRHA 1OSAA 4ORAB 1YX8A 1QX2A 4GPLB 1PSBA 2JZIA 3NXAA 3KPXA 3CZTX 3VRPA 3WNXB 2JWWA 3WHTB 1YRTB 1K90D 1QATA 2JT3A 1W7JB 2L2EA 5K89A 1JFJA 1DF0B 1A2XA 1CDLA 3O78A 2LV7A 4P2YB 1V1FA 4FTGA 5JJGA 5DKNA 1IWQA 2LHLA 1OZSA 1QS7A 2D8NA 5D7FA 4HRGA 2LC5A 4YGEB 3SJSA 1TNWA 4MBEA 3EK7A 3PLFB 1RJVA 2M9GA 1S5GY 1FI6A 1GGZA 2BL0C 2BCXA 1WRZA 2FJUB 2ZN8A 4CLNA 3GOFA 1SL8A 2NLNA 3VROA 4HSZA 1TCFA 2KFHA 3FWBA 3JTDC 3CR4X 1FW4A 1CDNA 1JC2A 2KBIA 1OZOA 1TTXA 1NPQA 3GK2A 1H4BA 1CLLA 1KCYA 2M0RA 2L98A 2FCEA 4L9MA 4YI9A 1A75B 3SG5A 1XFVO 2HF5A 1B47A 1K9PA 2M29A 2MLFC 4WRIA 3O2PA 2WC8A 1HT9A 3I5IC 3SG4A 1DJZA 1CFPA 1KWOC 3VRRA 4HREE 2ZNEA 1ODBA 3CR5X 1BR4B 5DKRA 2MJWB 1BT6A 2BE4A 1RK9A 4NQGA 1DJGA 1WY9A 3E3RA 4MEWA 4WQ2A 3KO0A 2P6BB 2PALA 2M49B 1JUOA 1ZACA 2TN4A 3HX4A 4OV2A 1UHKA 1TCOB 2KQYA 1L2OB 3TZ1A 2JNXA 1NX0A 3AKBA 2WNDA 3TUYC 1SY9A 1GJYA 3DVKA 3BUXB 3VGOA 1YVLA 1UHIA 3LLEA 3CS1A 1KSMA 2KI6C 1SR6B 3EVRA 2LCPA 1V1GA 1DVIA 1U5IB 1XO5A 1Y1AA 2JULA 1C07A 3CWGA 3I5GC 1TNPA 1XA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DJW A;  3LCP C;  5D69 A;  4I5N B;  5HKZ A;  2M7L A;  1PSR A;  2KYC A;  3KHE A;  1F8H A;  1A03 A;  2JTZ A;  2I2R E;  1KFU S;  5HKY A;  3PSR A;  1RTP 1;  4PHM A;  2KDH A;  1EL4 A;  4PE1 A;  4YGA A;  2CNP A;  1KK8 C;  3OHM B;  2WOS A;  2BE6 A;  3DVE A;  1N65 A;  3TS5 C;  1TNX A;  5F6T A;  1ZOT B;  4DS7 A;  2LUC A;  2K7B A;  4GGN A;  2M1K B;  5HLV A;  1M31 A;  2CXJ A;  2NZ0 A;  1AK8 A;  2RGI A;  1QLS A;  1G33 A;  1M45 A;  2EC6 B;  2OTG C;  2BKH B;  3TDZ A;  2L5X B;  2KAV A;  1F70 A;  4USL A;  1BR1 B;  2R2I A;  2O5G A;  1XK4 A;  1NCZ A;  1AJ4 A;  1N2D A;  2KOT A;  3CR2 A;  1SL9 A;  1F71 A;  3DF0 B;  2KI6 D;  1KK7 Y;  2KI4 B;  1YX7 A;  2PSR A;  3LK0 A;  3NSO A;  1NYA A;  1WRK A;  4F0Z B;  2BKI B;  4MLW A;  5AAN A;  3FIA A;  1CLM A;  2E30 A;  4PE4 A;  1H8B A;  1XFY O;  1D1O A;  2LP3 A;  5GQQ C;  2WCE A;  1ZMZ A;  5I8N A;  4GAO A;  1AVS A;  4A4B A;  1L7Z A;  2F33 A;  3GK4 X;  4GFT A;  5J3X A;  2HQ8 A;  2JNF A;  1UHN A;  3OX5 A;  3PAT A;  1MUX A;  1Y1X A;  1SCM B;  1YVH A;  2DOQ A;  1M63 B;  2Y4Q A;  2ZND A;  2NCO A;  4DIR A;  2QPT A;  2I94 A;  1PAL A;  2KAY A;  5DKQ A;  1BOC A;  1DJX A;  1OMR A;  1SMG A;  3BXK A;  4AQJ A;  1LKJ A;  1C7W A;  5CSI A;  5AER A;  2FCD A;  4A4C A;  3OB1 B;  2ZRS A;  3FWC A;  2CBL A;  1RRO A;  4YI8 A;  3SG7 A;  3ZNI A;  1MWN A;  3RM1 A;  3IQQ A;  2ZN9 A;  1K94 A;  2F3Y A;  2KNE A;  3BYA A;  1Y0V H;  3F45 A;  1S26 D;  2M97 A;  3DVM A;  4MRX A;  3NSI A;  3AKA A;  1CNP A;  3LK1 A;  2MBX A;  2I7A A;  1DGV A;  4I5K A;  4I5L B;  2KYF A;  4M2O A;  1PVA A;  1CMF A;  2I18 A;  3QRX A;  4I5J A;  3H4S E;  4NDB A;  5I2L A;  2PMY A;  4MVF A;  4NDD A;  2FOT A;  2JT8 A;  2M8U A;  1CDM A;  1QX5 B;  1UWO A;  2HPS A;  2CTN A;  3PN7 B;  4XJK A;  1FF1 A;  1JF0 A;  2JXL A;  1UP5 A;  1FPW A;  4PE0 A;  1FI5 A;  1NP8 A;  4D1E A;  2MRD A;  5AEQ A;  5I2Q A;  1QV1 A;  2K7C A;  3CLN A;  1NCX A;  2SCP A;  1QLK A;  2KFF A;  4MZK A;  2JQ6 A;  1K8U A;  3VRQ A;  1C7V A;  1M39 A;  2L50 A;  2Y5I A;  2JC2 A;  4CPV A;  1NX3 A;  4N1G A;  2MLE C;  1KK7 Z;  1IG5 A;  3CGA A;  3KEV A;  2JT0 A;  2G2B A;  4ICB A;  5G08 A;  1CDP A;  1CM4 A;  1AHR A;  3NSK A;  3PM8 A;  4ORC B;  3A4U B;  4U8D A;  4CFR A;  5KTY A;  1N0Y A;  1EXR A;  4CID A;  2KAX A;  2LLU A;  2L4H A;  2KGB C;  2HET A;  2Q91 A;  3SIB A;  1UUS A;  2LMU A;  4Q04 A;  4PCW A;  2Y1M A;  1EG4 A;  3SG6 A;  1F54 A;  2PAS A;  4OVN F;  1GGW A;  1M46 A;  2LVJ A;  3FS7 A;  2LLS A;  3PFV A;  2LVV A;  2COL B;  1JBA A;  3IQO A;  1MQ1 A;  4JQ0 D;  1K96 A;  4QJ4 B;  1RFJ A;  2NCP A;  2EHB A;  2LVK A;  3BUW B;  3OP0 A;  2K2A A;  1L2O C;  4JPZ B;  2GV5 A;  1WDC B;  1MF8 B;  4MN0 A;  4QJ5 B;  1XFX O;  2MA2 A;  1G4Y R;  1DT7 B;  1SR6 C;  4M2P A;  2K8M B;  3JVT B;  1E8A A;  4MZL A;  1S6J A;  2KQ6 A;  4MSP A;  5HLO A;  4WQ3 A;  2BEC A;  2IS9 A;  5BPJ A;  3BUN B;  5JOL A;  4GNK B;  2E6W A;  2B1U A;  4YGD B;  2KBM A;  1J7O A;  3D0Y A;  1QJT A;  4TNC A;  1YTZ C;  2K0J A;  1S3P A;  4M2Q A;  5KSZ A;  1R2U A;  2F3Z A;  1K95 A;  1EH2 A;  4C0L A;  1J7R A;  3SG3 A;  3C1V A;  4NDC A;  1F4Q A;  1SKT A;  5AFP A;  2WCF A;  4UPG A;  5HKW A;  3AAJ A;  3I5H B;  3CTN A;  1S1E A;  2PVB A;  2K61 A;  3DVJ A;  1J55 A;  2LAP A;  4DCK A;  1ZFS A;  2H61 A;  2JXC A;  2MAZ A;  2LHI A;  4PHJ A;  2EC6 C;  1IJ5 A;  1Y6W A;  1IKU A;  2K7O A;  1CLB A;  4GGF C;  1KFX L;  3BQ3 A;  2L0P A;  5CSN A;  1F4O A;  3BUO B;  4AOM A;  2WOR A;  1J7Q A;  4ETO A;  1KSO A;  2KI4 C;  1PUL A;  4FQO A;  2LVI A;  3M0W A;  4C0K A;  1SNL A;  1K9U A;  4BY4 A;  4YGC B;  4DUQ A;  2AMI A;  4DRW A;  2M1U A;  1JWD A;  1YRU B;  4PE7 A;  1IQ3 A;  2OS8 B;  1PK0 D;  3EKJ A;  1PRW A;  1TIZ A;  2F8P A;  4YGB B;  5KU1 A;  5I2O A;  1JSA A;  4E68 A;  3AAK A;  1HQV A;  5CPV A;  1Q80 A;  1CM1 A;  2M7N A;  1XK4 C;  2OS8 C;  2L4I A;  1SCM C;  2Q4U A;  1B1G A;  4ZCV A;  2H2K A;  2GGM A;  1BOD A;  3BUM B;  1KQM B;  2CT9 A;  3EVU A;  3LL8 B;  1CMG A;  1RWY A;  3BOW A;  1ZUZ A;  5TNC A;  5PAL A;  1LVC D;  3TDI A;  1CFD A;  2SAS A;  2ZKM X;  2KFG A;  2LLT A;  4OR9 B;  1KQM C;  1WLM A;  3EK4 A;  5AXI A;  1CFF A;  1LA0 A;  2JRF A;  1ALV A;  1QV0 A;  1TN4 A;  2BBM A;  1OMD A;  1A75 A;  1BJF A;  5ER5 A;  4PHN A;  1IJ6 A;  2BL0 B;  2VRG A;  2BCB A;  1QAS A;  3BOW B;  4N5X A;  4OCI A;  4P5O E;  1YUS A;  1YUT A;  3JTD B;  1SRA A;  1B7T Z;  1UHJ A;  2A4J A;  4QJ3 B;  3OB2 B;  2JTT A;  1K93 D;  3PN7 C;  1IRJ A;  2LNK A;  1CKK A;  1OQP A;  3NSL A;  1B8R A;  3A8R A;  1OOJ A;  1NWD A;  1FBV A;  2AAO A;  2AUC A;  1SYM A;  1NCY A;  3IF7 A;  3I5I B;  1QIV A;  1MXE A;  3D10 A;  1KWO B;  3O4Y A;  4N1F A;  1NSH A;  1BG1 A;  1OE9 B;  1CB1 A;  4R1E A;  2G9B A;  1KQV A;  4GBA A;  2LAN A;  4XJK B;  1S6I A;  2L51 A;  3MSE B;  4CFQ A;  1DJI A;  2JOJ A;  1S36 A;  2F2O A;  3KF9 A;  5IBW A;  3EK8 A;  1B9A A;  1B8C A;  1J1D A;  2M3W A;  1VRK A;  1IH0 A;  1BLQ A;  2GGZ A;  1U5I A;  1A4P A;  3EKH A;  3WHU B;  1CFC A;  2ZRT A;  3TUY B;  1J7P A;  2F2P A;  1XYD A;  1AJ5 A;  2LE9 B;  2KHN A;  4JWQ A;  1SPY A;  1DJY A;  1F55 A;  1J1E A;  1XFZ O;  1PVB A;  1QVI Z;  1BMO A;  4ORB B;  1REC A;  2CCM A;  1UHH A;  3TDU A;  5B8I B;  3WXA A;  1AP4 A;  1WDC C;  1MR8 A;  1EJ3 A;  1DGU A;  1WLZ A;  2K2F A;  3I5G B;  1GQM A;  3ZWH A;  1SL7 A;  1LXF C;  3EVV A;  4C0J A;  4PDZ A;  1YUR A;  1DTL A;  2KGR A;  3JVT C;  2JU0 A;  2QAC A;  1NX1 A;  1QX7 A;  1KFX S;  1A29 A;  1OMV A;  2PRU A;  1X02 A;  3RLZ A;  2JPT A;  2LM5 A;  3K21 A;  1YUU A;  3HCM A;  5CSF A;  1JFK A;  2LP2 A;  1K2H A;  2LMT A;  1KK8 B;  2BCA A;  1NX2 A;  4GGF A;  2O60 A;  3TS5 B;  1QTX A;  1BF5 A;  1AUI B;  1TOP A;  1UUR A;  1SCV A;  1NIW A;  1B7T Y;  3PAL A;  5CSJ A;  1CTR A;  3DF0 A;  1XFW O;  1DMO A;  2WCB A;  2OTG B;  3I5F B;  2ISD A;  2ZFD A;  3D0Y B;  3I5H C;  1JF2 A;  4PHK A;  1B4C A;  4AQI A;  1ALW A;  5FYX A;  1XVJ A;  3SG2 A;  1YR5 A;  1EG3 A;  1S5G Z;  1K9K A;  1BU3 A;  1DJH A;  1G8I A;  4MZJ A;  1NUB A;  3SIA A;  3I5F C;  1QXP A;  5ER4 X;  2K7D A;  3VRN A;  1SW8 A;  3OX6 A;  4GUK A;  1XFU O;  1B8L A;  2LUX A;  1MXL C;  3GK1 A;  1QIW A;  4YBH B;  1KFU L;  2V53 A;  1W7I B;  2Y1N A;  3DD4 A;  4IL1 A;  1LIN A;  4YRU A;  2EGD A;  1WRL A;  4ZCU A;  1S6C A;  1SBJ A;  4OKH A;  4MRY A;  3ICB A;  2LMV A;  1QVI Y;  1LA3 A;  1DF0 A;  1IGV A;  2H61 C;  2BBN A;  2MHH A;  1MHO A;  4BY5 A;  2KSP A;  2NXQ A;  1IQ5 A;  4XYN A;  2HQW A;  1Y1U A;  2OPO A;  3O6B A;  1TRF A;  5HYD A;  4PAL A;  1R6P A;  1TNQ A;  1SK6 D;  4HRH A;  1OSA A;  4ORA B;  1YX8 A;  1QX2 A;  4GPL B;  1PSB A;  2JZI A;  3NXA A;  3KPX A;  3CZT X;  3VRP A;  3WNX B;  2JWW A;  3WHT B;  1YRT B;  1K90 D;  1QAT A;  2JT3 A;  1W7J B;  2L2E A;  5K89 A;  1JFJ A;  1DF0 B;  1A2X A;  1CDL A;  3O78 A;  2LV7 A;  4P2Y B;  1V1F A;  4FTG A;  5JJG A;  5DKN A;  1IWQ A;  2LHL A;  1OZS A;  1QS7 A;  2D8N A;  5D7F A;  4HRG A;  2LC5 A;  4YGE B;  3SJS A;  1TNW A;  4MBE A;  3EK7 A;  3PLF B;  1RJV A;  2M9G A;  1S5G Y;  1FI6 A;  1GGZ A;  2BL0 C;  2BCX A;  1WRZ A;  2FJU B;  2ZN8 A;  4CLN A;  3GOF A;  1SL8 A;  2NLN A;  3VRO A;  4HSZ A;  1TCF A;  2KFH A;  3FWB A;  3JTD C;  3CR4 X;  1FW4 A;  1CDN A;  1JC2 A;  2KBI A;  1OZO A;  1TTX A;  1NPQ A;  3GK2 A;  1H4B A;  1CLL A;  1KCY A;  2M0R A;  2L98 A;  2FCE A;  4L9M A;  4YI9 A;  1A75 B;  3SG5 A;  1XFV O;  2HF5 A;  1B47 A;  1K9P A;  2M29 A;  2MLF C;  4WRI A;  3O2P A;  2WC8 A;  1HT9 A;  3I5I C;  3SG4 A;  1DJZ A;  1CFP A;  1KWO C;  3VRR A;  4HRE E;  2ZNE A;  1ODB A;  3CR5 X;  1BR4 B;  5DKR A;  2MJW B;  1BT6 A;  2BE4 A;  1RK9 A;  4NQG A;  1DJG A;  1WY9 A;  3E3R A;  4MEW A;  4WQ2 A;  3KO0 A;  2P6B B;  2PAL A;  2M49 B;  1JUO A;  1ZAC A;  2TN4 A;  3HX4 A;  4OV2 A;  1UHK A;  1TCO B;  2KQY A;  1L2O B;  3TZ1 A;  2JNX A;  1NX0 A;  3AKB A;  2WND A;  3TUY C;  1SY9 A;  1GJY A;  3DVK A;  3BUX B;  3VGO A;  1YVL A;  1UHI A;  3LLE A;  3CS1 A;  1KSM A;  2KI6 C;  1SR6 B;  3EVR A;  2LCP A;  1V1G A;  1DVI A;  1U5I B;  1XO5 A;  1Y1A A;  2JUL A;  1C07 A;  3CWG A;  3I5G C;  1TNP A;  1XA5 A; 
#chains in the Genus database with same CATH topology
 1DJW A;  3LCP C;  5D69 A;  4I5N B;  5HKZ A;  4KYN A;  1PSR A;  2KYC A;  2M7L A;  3KHE A;  1F8H A;  1A03 A;  2JTZ A;  2I2R E;  1KFU S;  5HKY A;  3PSR A;  1RTP 1;  4PHM A;  2KDH A;  1EL4 A;  4PE1 A;  4YGA A;  1OW4 A;  2CNP A;  1KK8 C;  3OHM B;  2WOS A;  2BE6 A;  3DVE A;  3S0F A;  1N65 A;  3TS5 C;  1TNX A;  3D78 A;  5F6T A;  1OOF A;  1ZOT B;  4DS7 A;  2LUC A;  2K7B A;  4GGN A;  2M1K B;  3DYE A;  2ERB A;  1M31 A;  2CXJ A;  2NZ0 A;  5HLV A;  1AK8 A;  2RGI A;  1QLS A;  1G33 A;  1M45 A;  2EC6 B;  2OTG C;  3R1O A;  2BKH B;  3TDZ A;  2L5X B;  2KAV A;  1F70 A;  4USL A;  1BR1 B;  5D3O A;  2R2I A;  2O5G A;  1XK4 A;  1NCZ A;  1AJ4 A;  1N2D A;  3DXL A;  2KOT A;  3CR2 A;  1SL9 A;  3B88 A;  1F71 A;  3DF0 B;  2KI6 D;  1KK7 Y;  2KI4 B;  1YX7 A;  2PSR A;  3LK0 A;  3NSO A;  1NYA A;  1WRK A;  4F0Z B;  2BKI B;  3CZ1 A;  4MLW A;  5AAN A;  3FIA A;  1CLM A;  2E30 A;  4PE4 A;  1H8B A;  1XFY O;  1D1O A;  1Z2C B;  2LP3 A;  5GQQ C;  2WCE A;  1ZMZ A;  5I8N A;  4GAO A;  1AVS A;  4A4B A;  1L7Z A;  3UO9 A;  2F33 A;  3GK4 X;  3FE6 A;  4GFT A;  5J3X A;  2HQ8 A;  2JNF A;  1TWO A;  1UHN A;  3OX5 A;  1MUX A;  3PAT A;  1DC1 A;  1Y1X A;  1SCM B;  1YVH A;  2DOQ A;  1M63 B;  2Y4Q A;  2ZND A;  2NCO A;  4DIR A;  2QPT A;  2I94 A;  1PAL A;  2KAY A;  5DKQ A;  1BOC A;  1DJX A;  1OMR A;  1SMG A;  3BXK A;  4AQJ A;  3FE8 A;  1LKJ A;  3OGN A;  1C7W A;  2KLE A;  5CSI A;  1GM0 A;  5AER A;  2H8V A;  2FCD A;  4A4C A;  3OB1 B;  5FI6 A;  2ZRS A;  3FWC A;  2CBL A;  2WCM A;  1RRO A;  4YI8 A;  3Q8I A;  3SG7 A;  3ZNI A;  2L5Y A;  1C3Y A;  1MWN A;  3RM1 A;  3IQQ A;  2ZN9 A;  1K94 A;  2F3Y A;  2KNE A;  3BYA A;  1Y0V H;  3F45 A;  3N7H A;  1S26 D;  2M97 A;  3DZT A;  3DVM A;  4MRX A;  3S0A A;  3NSI A;  3AKA A;  1CNP A;  3LK1 A;  2MBX A;  2I7A A;  1DQE A;  1DGV A;  4I5K A;  4I5L B;  2KYF A;  4M2O A;  1PVA A;  4INX A;  1ORG A;  1CMF A;  2I18 A;  4PT1 A;  3QRX A;  4I5J A;  1LS8 A;  3H4S E;  4NDB A;  5I2L A;  2PMY A;  4MVF A;  4NDD A;  2FOT A;  2JT8 A;  3V2L A;  2M8U A;  1CDM A;  1QX5 B;  1UWO A;  2HPS A;  2CTN A;  3PN7 B;  4XJK A;  1FF1 A;  1JF0 A;  2JXL A;  1UP5 A;  1FPW A;  4PE0 A;  1FI5 A;  1NP8 A;  4D1E A;  2MRD A;  5AEQ A;  5I2Q A;  1QV1 A;  2K7C A;  3CLN A;  3CAB A;  1NCX A;  3CDN A;  2SCP A;  1QLK A;  2KFF A;  4MZK A;  2JQ6 A;  1K8U A;  3VRQ A;  1C7V A;  1M39 A;  2L50 A;  2Y5I A;  1W9Z A;  2JC2 A;  4CPV A;  4JKT A;  1NX3 A;  3L4L A;  4N1G A;  2MLE C;  1KK7 Z;  1IG5 A;  2QDI A;  3CGA A;  2JT0 A;  3KEV A;  2G2B A;  3PJI A;  4ICB A;  5G08 A;  1CDP A;  1CM4 A;  1AHR A;  3NSK A;  3PM8 A;  4ORC B;  3A4U B;  4U8D A;  1OOH A;  4CFR A;  5KTY A;  1N0Y A;  1EXR A;  3D76 A;  4CID A;  2KAX A;  2LLU A;  2L4H A;  2KGB C;  2HET A;  2Q91 A;  3SIB A;  1UUS A;  2L2C A;  2LMU A;  4Q04 A;  4PCW A;  2Y1M A;  1EG4 A;  3SG6 A;  3VB1 A;  1F54 A;  2PAS A;  4OVN F;  1GGW A;  1M46 A;  2LVJ A;  3FS7 A;  2LLS A;  3PFV A;  2LVV A;  2COL B;  1JBA A;  3IQO A;  1MQ1 A;  4JQ0 D;  1K96 A;  4QJ4 B;  3CZ2 A;  1RFJ A;  2NCP A;  2EHB A;  2LVK A;  3BUW B;  3OP0 A;  2K2A A;  1L2O C;  4JPZ B;  2GV5 A;  1WDC B;  1MF8 B;  1C3Z A;  4MN0 A;  4QJ5 B;  1XFX O;  2MA2 A;  1G4Y R;  1DT7 B;  1SR6 C;  4M2P A;  2K8M B;  3JVT B;  3SS3 A;  1E8A A;  2YGU A;  4MZL A;  1S6J A;  2KQ6 A;  3NHI A;  4MSP A;  5HLO A;  2QEV A;  4WQ3 A;  2BEC A;  2IS9 A;  3S0E A;  3BUN B;  5JOL A;  5BPJ A;  3B86 A;  4GNK B;  2E6W A;  2B1U A;  4YGD B;  2KBM A;  3K1E A;  1J7O A;  3SS4 A;  3D0Y A;  1QJT A;  4TNC A;  1YTZ C;  2K0J A;  1S3P A;  2PQL A;  4M2Q A;  5KSZ A;  1R2U A;  2F3Z A;  1K95 A;  1EH2 A;  4C0L A;  1J7R A;  3SG3 A;  3RZS A;  3C1V A;  4NDC A;  1F4Q A;  1SKT A;  5AFP A;  2QEO A;  2WCF A;  2WCH A;  4UPG A;  5HKW A;  3AAJ A;  3I5H B;  3CTN A;  1S1E A;  2PVB A;  2K61 A;  3DVJ A;  1J55 A;  2LAP A;  4DCK A;  1ZFS A;  2H61 A;  2JXC A;  2MAZ A;  2LHI A;  4PHJ A;  2EC6 C;  1IJ5 A;  5FI2 A;  1Y6W A;  4FQT A;  3D74 A;  1IKU A;  2K7O A;  1CLB A;  4GGF C;  1KFX L;  3BQ3 A;  2L0P A;  5CSN A;  1F4O A;  3BUO B;  4AOM A;  2WOR A;  1J7Q A;  4ETO A;  1KSO A;  2KI4 C;  1PUL A;  4FQO A;  2LVI A;  3M0W A;  4C0K A;  1SNL A;  1K9U A;  4BY4 A;  4YGC B;  4DUQ A;  3CYZ A;  2AMI A;  4DRW A;  2M1U A;  1JWD A;  1YRU B;  4PE7 A;  1IQ3 A;  2OS8 B;  1PK0 D;  3EKJ A;  1PRW A;  1TIZ A;  2F8P A;  4YGB B;  3QME A;  5KU1 A;  5I2O A;  4N1F A;  1JSA A;  4E68 A;  3AAK A;  1HQV A;  5CPV A;  1Q80 A;  1CM1 A;  2WC6 A;  2M7N A;  1XK4 C;  2OS8 C;  2K60 A;  2L4I A;  1SCM C;  2Q4U A;  1B1G A;  4ZCV A;  3UNW A;  2H2K A;  1P28 A;  2GGM A;  1BOD A;  3BUM B;  1KQM B;  2CT9 A;  2KLD A;  3EVU A;  3LL8 B;  1CMG A;  1RWY A;  3BOW A;  1ZUZ A;  5TNC A;  5PAL A;  1LVC D;  3BFH A;  3B6X A;  3TDI A;  1CFD A;  2SAS A;  2ZKM X;  2KFG A;  2LLT A;  2QEB A;  4OR9 B;  1KQM C;  1WLM A;  3EK4 A;  5AXI A;  1CFF A;  1LA0 A;  2JRF A;  1ALV A;  1QV0 A;  1TN4 A;  2BBM A;  2WCJ A;  1OMD A;  1A75 A;  1BJF A;  5ER5 A;  4PHN A;  1IJ6 A;  2BL0 B;  5FI7 A;  2VRG A;  2BCB A;  1QAS A;  3BOW B;  4N5X A;  4OZD A;  4OCI A;  4P5O E;  1YUS A;  1YUT A;  3JTD B;  1SRA A;  1B7T Z;  1UHJ A;  2A4J A;  4QJ3 B;  3OB2 B;  2JTT A;  1DEL A;  1K93 D;  3PN7 C;  1IRJ A;  2LNK A;  1CKK A;  1OQP A;  3NSL A;  1B8R A;  3A8R A;  1OOJ A;  3FE9 A;  1NWD A;  2WCL A;  3R72 A;  1FBV A;  2AAO A;  2AUC A;  1SYM A;  1NCY A;  3IF7 A;  3I5I B;  1QIV A;  1MXE A;  3D10 A;  1KWO B;  3O4Y A;  3R1P A;  1NSH A;  2P70 A;  1OE9 B;  1BG1 A;  4R1E A;  2G9B A;  1KQV A;  4GBA A;  2LAN A;  4XJK B;  1S6I A;  2L51 A;  4INW A;  3MSE B;  1TUJ A;  4CFQ A;  1DJI A;  1XFR A;  2JOJ A;  1S36 A;  2F2O A;  3KF9 A;  3NGV A;  5IBW A;  3EK8 A;  1B9A A;  1B8C A;  1J1D A;  2M3W A;  3CZ0 A;  1VRK A;  1IH0 A;  1BLQ A;  2GGZ A;  1U5I A;  1A4P A;  3EKH A;  3WHU B;  1CB1 A;  1CFC A;  2ZRT A;  3TUY B;  1J7P A;  2F2P A;  1XYD A;  1AJ5 A;  2LE9 B;  2KHN A;  4JWQ A;  1SPY A;  1DJY A;  1F55 A;  1J1E A;  1XFZ O;  1PVB A;  1QVI Z;  1BMO A;  4ORB B;  1REC A;  2CCM A;  1UHH A;  3TDU A;  5B8I B;  3WXA A;  5HL1 A;  1AP4 A;  1WDC C;  1MR8 A;  1EJ3 A;  1DGU A;  1WLZ A;  2K2F A;  3I5G B;  1GQM A;  3IVT A;  1SL7 A;  1LXF C;  3EVV A;  3ZWH A;  4PDZ A;  4C0J A;  1YUR A;  1DTL A;  2KGR A;  3JVT C;  2JU0 A;  2QAC A;  1OOI X;  2QEH A;  1NX1 A;  1QX7 A;  1T14 A;  1KFX S;  1A29 A;  1OMV A;  2PRU A;  1X02 A;  3RLZ A;  2JPT A;  2LM5 A;  3K21 A;  1YUU A;  3HCM A;  3S0B A;  5CSF A;  1JFK A;  1Z4H A;  2LP2 A;  2LMT A;  1K2H A;  5DIC A;  1KK8 B;  2BCA A;  1NX2 A;  4GGF A;  2O60 A;  3TS5 B;  1QTX A;  1BF5 A;  1AUI B;  1TOP A;  1UUR A;  3OBV A;  1SCV A;  1NIW A;  1B7T Y;  3PAL A;  5CSJ A;  1CTR A;  3DF0 A;  2P71 A;  1XFW O;  1DMO A;  2WCB A;  2OTG B;  3I5F B;  2ISD A;  2ZFD A;  2FJY A;  3D0Y B;  3I5H C;  1JF2 A;  4PHK A;  1B4C A;  4AQI A;  1ALW A;  5FYX A;  1XVJ A;  3SG2 A;  1YR5 A;  1EG3 A;  1S5G Z;  1K9K A;  1BU3 A;  1DJH A;  1G8I A;  4MZJ A;  1NUB A;  3SIA A;  3I5F C;  1QXP A;  5ER4 X;  1DEK A;  2K7D A;  3VRN A;  1OOG A;  1SW8 A;  3OX6 A;  4GUK A;  1XFU O;  1B8L A;  2LUX A;  1MXL C;  3GK1 A;  1QIW A;  4YBH B;  1KFU L;  2PYQ A;  2V53 A;  3BFA A;  1W7I B;  2Y1N A;  3DD4 A;  4IL1 A;  1LIN A;  4YRU A;  1SSE B;  2EGD A;  1WRL A;  4ZCU A;  1S6C A;  1SBJ A;  4OKH A;  4MRY A;  3ICB A;  2LMV A;  3BFB A;  1QVI Y;  1LA3 A;  1DF0 A;  1IGV A;  2H61 C;  2BBN A;  2MHH A;  3D73 A;  1MHO A;  4BY5 A;  2KSP A;  2NXQ A;  1IQ5 A;  4XYN A;  2HQW A;  1Y1U A;  2OPO A;  3O6B A;  1TRF A;  5HYD A;  1IIO A;  4PAL A;  1R6P A;  1TNQ A;  3L47 A;  1SK6 D;  4HRH A;  1OSA A;  4F7F A;  3BJH A;  4ORA B;  1YX8 A;  1QX2 A;  2KPH A;  4GPL B;  1PSB A;  3D77 A;  2JZI A;  3DY9 A;  3NXA A;  2JPO A;  3KPX A;  3CZT X;  2BAP A;  3VRP A;  3L4A A;  3PM2 A;  2JWW A;  3WHT B;  1YRT B;  3WNX B;  1K90 D;  5EL2 A;  1QAT A;  2JT3 A;  1W7J B;  2L2E A;  2WCK A;  5K89 A;  1JFJ A;  1DF0 B;  1A2X A;  1CDL A;  3O78 A;  2LV7 A;  4P2Y B;  3EG5 B;  1V1F A;  4FTG A;  5JJG A;  5DKN A;  3R1V A;  1IWQ A;  2LHL A;  3B87 A;  1OZS A;  1QS7 A;  2D8N A;  4JD9 A;  1TUZ A;  5D7F A;  4HRG A;  2LC5 A;  4YGE B;  3SJS A;  1TNW A;  4MBE A;  3EK7 A;  3PLF B;  1RJV A;  2M9G A;  1S5G Y;  1FI6 A;  3O4X A;  1GGZ A;  2BL0 C;  2BCX A;  1WRZ A;  2FJU B;  2ZN8 A;  4CLN A;  3GOF A;  1SL8 A;  2NLN A;  3VRO A;  4HSZ A;  1TCF A;  2KFH A;  3FWB A;  3JTD C;  3CR4 X;  1FW4 A;  1CDN A;  1JC2 A;  2KBI A;  1OZO A;  1TTX A;  1NPQ A;  3GK2 A;  4IJ7 A;  1CLL A;  1H4B A;  1KCY A;  2M0R A;  2L98 A;  2FCE A;  4L9M A;  4YI9 A;  1A75 B;  3SG5 A;  1QWV A;  1XFV O;  2HF5 A;  1B47 A;  1K9P A;  2M29 A;  2MLF C;  4WRI A;  3D75 A;  3O2P A;  2WC8 A;  1HT9 A;  3I5I C;  3SG4 A;  1DJZ A;  1CFP A;  1KWO C;  2WC5 A;  3VRR A;  3S0G A;  4HRE E;  2ZNE A;  1ODB A;  3CR5 X;  1BR4 B;  2GTE A;  2MJW B;  5DKR A;  1BT6 A;  2BE4 A;  1RK9 A;  4NQG A;  1DJG A;  1WY9 A;  3E3R A;  4MEW A;  4WQ2 A;  3KO0 A;  2P6B B;  2PAL A;  2M49 B;  1JUO A;  1ZAC A;  2TN4 A;  3HX4 A;  4OV2 A;  1UHK A;  1TCO B;  2KQY A;  1L2O B;  3TZ1 A;  2BNX A;  2JNX A;  3NHT A;  1NX0 A;  3AKB A;  2WND A;  3TUY C;  1SY9 A;  1GJY A;  3DVK A;  3BUX B;  3SS5 A;  3VGO A;  1YVL A;  1UHI A;  3B7A A;  3LLE A;  3CS1 A;  3S0D A;  1KSM A;  2KI6 C;  1SR6 B;  3EVR A;  2LCP A;  1V1G A;  1DVI A;  1U5I B;  5I94 A;  1XO5 A;  1Y1A A;  2JUL A;  1C07 A;  3CWG A;  3I5G C;  1TNP A;  1XA5 A; 
#chains in the Genus database with same CATH homology
 1DJW A;  3LCP C;  5D69 A;  4I5N B;  5HKZ A;  2M7L A;  1PSR A;  2KYC A;  3KHE A;  1F8H A;  1A03 A;  2JTZ A;  2I2R E;  1KFU S;  5HKY A;  3PSR A;  1RTP 1;  4PHM A;  2KDH A;  1EL4 A;  4PE1 A;  4YGA A;  2CNP A;  1KK8 C;  3OHM B;  2WOS A;  2BE6 A;  3DVE A;  1N65 A;  3TS5 C;  1TNX A;  5F6T A;  1ZOT B;  4DS7 A;  2LUC A;  2K7B A;  4GGN A;  2M1K B;  5HLV A;  1M31 A;  2CXJ A;  2NZ0 A;  1AK8 A;  2RGI A;  1QLS A;  1G33 A;  1M45 A;  2EC6 B;  2OTG C;  2BKH B;  3TDZ A;  2L5X B;  2KAV A;  1F70 A;  4USL A;  1BR1 B;  2R2I A;  2O5G A;  1XK4 A;  1NCZ A;  1AJ4 A;  1N2D A;  2KOT A;  3CR2 A;  1SL9 A;  1F71 A;  3DF0 B;  2KI6 D;  1KK7 Y;  2KI4 B;  1YX7 A;  2PSR A;  3LK0 A;  3NSO A;  1NYA A;  1WRK A;  4F0Z B;  2BKI B;  4MLW A;  5AAN A;  3FIA A;  1CLM A;  2E30 A;  4PE4 A;  1H8B A;  1XFY O;  1D1O A;  2LP3 A;  5GQQ C;  2WCE A;  1ZMZ A;  5I8N A;  4GAO A;  1AVS A;  4A4B A;  1L7Z A;  2F33 A;  3GK4 X;  4GFT A;  5J3X A;  2HQ8 A;  2JNF A;  1UHN A;  3OX5 A;  3PAT A;  1MUX A;  1Y1X A;  1SCM B;  1YVH A;  2DOQ A;  1M63 B;  2Y4Q A;  2ZND A;  2NCO A;  4DIR A;  2QPT A;  2I94 A;  1PAL A;  2KAY A;  5DKQ A;  1BOC A;  1DJX A;  1OMR A;  1SMG A;  3BXK A;  4AQJ A;  1LKJ A;  1C7W A;  5CSI A;  5AER A;  2FCD A;  4A4C A;  3OB1 B;  2ZRS A;  3FWC A;  2CBL A;  1RRO A;  4YI8 A;  3SG7 A;  3ZNI A;  1MWN A;  3RM1 A;  3IQQ A;  2ZN9 A;  1K94 A;  2F3Y A;  2KNE A;  3BYA A;  1Y0V H;  3F45 A;  1S26 D;  2M97 A;  3DVM A;  4MRX A;  3NSI A;  3AKA A;  1CNP A;  3LK1 A;  2MBX A;  2I7A A;  1DGV A;  4I5K A;  4I5L B;  2KYF A;  4M2O A;  1PVA A;  1CMF A;  2I18 A;  3QRX A;  4I5J A;  3H4S E;  4NDB A;  5I2L A;  2PMY A;  4MVF A;  4NDD A;  2FOT A;  2JT8 A;  2M8U A;  1CDM A;  1QX5 B;  1UWO A;  2HPS A;  2CTN A;  3PN7 B;  4XJK A;  1FF1 A;  1JF0 A;  2JXL A;  1UP5 A;  1FPW A;  4PE0 A;  1FI5 A;  1NP8 A;  4D1E A;  2MRD A;  5AEQ A;  5I2Q A;  1QV1 A;  2K7C A;  3CLN A;  1NCX A;  2SCP A;  1QLK A;  2KFF A;  4MZK A;  2JQ6 A;  1K8U A;  3VRQ A;  1C7V A;  1M39 A;  2L50 A;  2Y5I A;  2JC2 A;  4CPV A;  1NX3 A;  4N1G A;  2MLE C;  1KK7 Z;  1IG5 A;  3CGA A;  3KEV A;  2JT0 A;  2G2B A;  4ICB A;  5G08 A;  1CDP A;  1CM4 A;  1AHR A;  3NSK A;  3PM8 A;  4ORC B;  3A4U B;  4U8D A;  4CFR A;  5KTY A;  1N0Y A;  1EXR A;  4CID A;  2KAX A;  2LLU A;  2L4H A;  2KGB C;  2HET A;  2Q91 A;  3SIB A;  1UUS A;  2LMU A;  4Q04 A;  4PCW A;  2Y1M A;  1EG4 A;  3SG6 A;  1F54 A;  2PAS A;  4OVN F;  1GGW A;  1M46 A;  2LVJ A;  3FS7 A;  2LLS A;  3PFV A;  2LVV A;  2COL B;  1JBA A;  3IQO A;  1MQ1 A;  4JQ0 D;  1K96 A;  4QJ4 B;  1RFJ A;  2NCP A;  2EHB A;  2LVK A;  3BUW B;  3OP0 A;  2K2A A;  1L2O C;  4JPZ B;  2GV5 A;  1WDC B;  1MF8 B;  4MN0 A;  4QJ5 B;  1XFX O;  2MA2 A;  1G4Y R;  1DT7 B;  1SR6 C;  4M2P A;  2K8M B;  3JVT B;  1E8A A;  4MZL A;  1S6J A;  2KQ6 A;  4MSP A;  5HLO A;  4WQ3 A;  2BEC A;  2IS9 A;  5BPJ A;  3BUN B;  5JOL A;  4GNK B;  2E6W A;  2B1U A;  4YGD B;  2KBM A;  1J7O A;  3D0Y A;  1QJT A;  4TNC A;  1YTZ C;  2K0J A;  1S3P A;  4M2Q A;  5KSZ A;  1R2U A;  2F3Z A;  1K95 A;  1EH2 A;  4C0L A;  1J7R A;  3SG3 A;  3C1V A;  4NDC A;  1F4Q A;  1SKT A;  5AFP A;  2WCF A;  4UPG A;  5HKW A;  3AAJ A;  3I5H B;  3CTN A;  1S1E A;  2PVB A;  2K61 A;  3DVJ A;  1J55 A;  2LAP A;  4DCK A;  1ZFS A;  2H61 A;  2JXC A;  2MAZ A;  2LHI A;  4PHJ A;  2EC6 C;  1IJ5 A;  1Y6W A;  1IKU A;  2K7O A;  1CLB A;  4GGF C;  1KFX L;  3BQ3 A;  2L0P A;  5CSN A;  1F4O A;  3BUO B;  4AOM A;  2WOR A;  1J7Q A;  4ETO A;  1KSO A;  2KI4 C;  1PUL A;  4FQO A;  2LVI A;  3M0W A;  4C0K A;  1SNL A;  1K9U A;  4BY4 A;  4YGC B;  4DUQ A;  2AMI A;  4DRW A;  2M1U A;  1JWD A;  1YRU B;  4PE7 A;  1IQ3 A;  2OS8 B;  1PK0 D;  3EKJ A;  1PRW A;  1TIZ A;  2F8P A;  4YGB B;  5KU1 A;  5I2O A;  1JSA A;  4E68 A;  3AAK A;  1HQV A;  5CPV A;  1Q80 A;  1CM1 A;  2M7N A;  1XK4 C;  2OS8 C;  2L4I A;  1SCM C;  2Q4U A;  1B1G A;  4ZCV A;  2H2K A;  2GGM A;  1BOD A;  3BUM B;  1KQM B;  2CT9 A;  3EVU A;  3LL8 B;  1CMG A;  1RWY A;  3BOW A;  1ZUZ A;  5TNC A;  5PAL A;  1LVC D;  3TDI A;  1CFD A;  2SAS A;  2ZKM X;  2KFG A;  2LLT A;  4OR9 B;  1KQM C;  1WLM A;  3EK4 A;  5AXI A;  1CFF A;  1LA0 A;  2JRF A;  1ALV A;  1QV0 A;  1TN4 A;  2BBM A;  1OMD A;  1A75 A;  1BJF A;  5ER5 A;  4PHN A;  1IJ6 A;  2BL0 B;  2VRG A;  2BCB A;  1QAS A;  3BOW B;  4N5X A;  4OCI A;  4P5O E;  1YUS A;  1YUT A;  3JTD B;  1SRA A;  1B7T Z;  1UHJ A;  2A4J A;  4QJ3 B;  3OB2 B;  2JTT A;  1K93 D;  3PN7 C;  1IRJ A;  2LNK A;  1CKK A;  1OQP A;  3NSL A;  1B8R A;  3A8R A;  1OOJ A;  1NWD A;  1FBV A;  2AAO A;  2AUC A;  1SYM A;  1NCY A;  3IF7 A;  3I5I B;  1QIV A;  1MXE A;  3D10 A;  1KWO B;  3O4Y A;  4N1F A;  1NSH A;  1BG1 A;  1OE9 B;  1CB1 A;  4R1E A;  2G9B A;  1KQV A;  4GBA A;  2LAN A;  4XJK B;  1S6I A;  2L51 A;  3MSE B;  4CFQ A;  1DJI A;  2JOJ A;  1S36 A;  2F2O A;  3KF9 A;  5IBW A;  3EK8 A;  1B9A A;  1B8C A;  1J1D A;  2M3W A;  1VRK A;  1IH0 A;  1BLQ A;  2GGZ A;  1U5I A;  1A4P A;  3EKH A;  3WHU B;  1CFC A;  2ZRT A;  3TUY B;  1J7P A;  2F2P A;  1XYD A;  1AJ5 A;  2LE9 B;  2KHN A;  4JWQ A;  1SPY A;  1DJY A;  1F55 A;  1J1E A;  1XFZ O;  1PVB A;  1QVI Z;  1BMO A;  4ORB B;  1REC A;  2CCM A;  1UHH A;  3TDU A;  5B8I B;  3WXA A;  1AP4 A;  1WDC C;  1MR8 A;  1EJ3 A;  1DGU A;  1WLZ A;  2K2F A;  3I5G B;  1GQM A;  3ZWH A;  1SL7 A;  1LXF C;  3EVV A;  4C0J A;  4PDZ A;  1YUR A;  1DTL A;  2KGR A;  3JVT C;  2JU0 A;  2QAC A;  1NX1 A;  1QX7 A;  1KFX S;  1A29 A;  1OMV A;  2PRU A;  1X02 A;  3RLZ A;  2JPT A;  2LM5 A;  3K21 A;  1YUU A;  3HCM A;  5CSF A;  1JFK A;  2LP2 A;  1K2H A;  2LMT A;  1KK8 B;  2BCA A;  1NX2 A;  4GGF A;  2O60 A;  3TS5 B;  1QTX A;  1BF5 A;  1AUI B;  1TOP A;  1UUR A;  1SCV A;  1NIW A;  1B7T Y;  3PAL A;  5CSJ A;  1CTR A;  3DF0 A;  1XFW O;  1DMO A;  2WCB A;  2OTG B;  3I5F B;  2ISD A;  2ZFD A;  3D0Y B;  3I5H C;  1JF2 A;  4PHK A;  1B4C A;  4AQI A;  1ALW A;  5FYX A;  1XVJ A;  3SG2 A;  1YR5 A;  1EG3 A;  1S5G Z;  1K9K A;  1BU3 A;  1DJH A;  1G8I A;  4MZJ A;  1NUB A;  3SIA A;  3I5F C;  1QXP A;  5ER4 X;  2K7D A;  3VRN A;  1SW8 A;  3OX6 A;  4GUK A;  1XFU O;  1B8L A;  2LUX A;  1MXL C;  3GK1 A;  1QIW A;  4YBH B;  1KFU L;  2V53 A;  1W7I B;  2Y1N A;  3DD4 A;  4IL1 A;  1LIN A;  4YRU A;  2EGD A;  1WRL A;  4ZCU A;  1S6C A;  1SBJ A;  4OKH A;  4MRY A;  3ICB A;  2LMV A;  1QVI Y;  1LA3 A;  1DF0 A;  1IGV A;  2H61 C;  2BBN A;  2MHH A;  1MHO A;  4BY5 A;  2KSP A;  2NXQ A;  1IQ5 A;  4XYN A;  2HQW A;  1Y1U A;  2OPO A;  3O6B A;  1TRF A;  5HYD A;  4PAL A;  1R6P A;  1TNQ A;  1SK6 D;  4HRH A;  1OSA A;  4ORA B;  1YX8 A;  1QX2 A;  4GPL B;  1PSB A;  2JZI A;  3NXA A;  3KPX A;  3CZT X;  3VRP A;  3WNX B;  2JWW A;  3WHT B;  1YRT B;  1K90 D;  1QAT A;  2JT3 A;  1W7J B;  2L2E A;  5K89 A;  1JFJ A;  1DF0 B;  1A2X A;  1CDL A;  3O78 A;  2LV7 A;  4P2Y B;  1V1F A;  4FTG A;  5JJG A;  5DKN A;  1IWQ A;  2LHL A;  1OZS A;  1QS7 A;  2D8N A;  5D7F A;  4HRG A;  2LC5 A;  4YGE B;  3SJS A;  1TNW A;  4MBE A;  3EK7 A;  3PLF B;  1RJV A;  2M9G A;  1S5G Y;  1FI6 A;  1GGZ A;  2BL0 C;  2BCX A;  1WRZ A;  2FJU B;  2ZN8 A;  4CLN A;  3GOF A;  1SL8 A;  2NLN A;  3VRO A;  4HSZ A;  1TCF A;  2KFH A;  3FWB A;  3JTD C;  3CR4 X;  1FW4 A;  1CDN A;  1JC2 A;  2KBI A;  1OZO A;  1TTX A;  1NPQ A;  3GK2 A;  1H4B A;  1CLL A;  1KCY A;  2M0R A;  2L98 A;  2FCE A;  4L9M A;  4YI9 A;  1A75 B;  3SG5 A;  1XFV O;  2HF5 A;  1B47 A;  1K9P A;  2M29 A;  2MLF C;  4WRI A;  3O2P A;  2WC8 A;  1HT9 A;  3I5I C;  3SG4 A;  1DJZ A;  1CFP A;  1KWO C;  3VRR A;  4HRE E;  2ZNE A;  1ODB A;  3CR5 X;  1BR4 B;  5DKR A;  2MJW B;  1BT6 A;  2BE4 A;  1RK9 A;  4NQG A;  1DJG A;  1WY9 A;  3E3R A;  4MEW A;  4WQ2 A;  3KO0 A;  2P6B B;  2PAL A;  2M49 B;  1JUO A;  1ZAC A;  2TN4 A;  3HX4 A;  4OV2 A;  1UHK A;  1TCO B;  2KQY A;  1L2O B;  3TZ1 A;  2JNX A;  1NX0 A;  3AKB A;  2WND A;  3TUY C;  1SY9 A;  1GJY A;  3DVK A;  3BUX B;  3VGO A;  1YVL A;  1UHI A;  3LLE A;  3CS1 A;  1KSM A;  2KI6 C;  1SR6 B;  3EVR A;  2LCP A;  1V1G A;  1DVI A;  1U5I B;  1XO5 A;  1Y1A A;  2JUL A;  1C07 A;  3CWG A;  3I5G C;  1TNP A;  1XA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...