1K96A

Crystal structure of calcium bound human s100a6
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
89
structure length
89
Chain Sequence
ACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords S100A6
publication title Crystal structures of S100A6 in the Ca(2+)-free and Ca(2+)-bound states: the calcium sensor mechanism of S100 proteins revealed at atomic resolution.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2001-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1k96A00
2KI6D 1L2OB 3SIAA 5JOLA 1UP5A 1ALWA 3NSKA 2KFFA 2L2EA 3FIAA 1DF0A 4GGNA 1IKUA 2KAVA 1DJIA 2KNEA 3PLFB 2F33A 1CM4A 1BG1A 3EKHA 1K94A 3WXAA 1W7IB 4NDCA 1H4BA 1OZSA 1KQVA 3SG3A 2KGRA 2VRGA 3M0WA 2L98A 2Y4QA 1LA3A 1TCFA 2GGMA 3GOFA 3A8RA 2LVJA 1S6IA 3C1VA 1CMGA 2LV7A 1NX1A 4ORAB 3PN7B 2BE6A 4DS7A 3RLZA 2JU0A 3CWGA 3KPXA 5F6TA 4WQ2A 1JFJA 1PRWA 2EC6C 4MBEA 3TS5C 4MZKA 3IQQA 3KF9A 3SG5A 1IWQA 1YVHA 3WNXB 3BOWB 1B1GA 3HCMA 1U5IA 3JVTC 2KQ6A 1QV0A 1Y1UA 2JQ6A 4ICBA 4PHJA 3TUYB 1DJZA 2K7BA 2M1KB 1TCOB 4P2YB 5PALA 1CFDA 1CDPA 1M46A 1NWDA 2BCBA 4P5OE 3OX5A 1IG5A 1QVIY 1WLZA 2LMUA 2KFHA 2KGBC 3GK4X 1A2XA 3ICBA 5AANA 3AAJA 4AQIA 1KFXS 3JTDB 2BL0B 3F45A 1QATA 1JC2A 3DF0B 1F70A 1A4PA 1QLKA 2I2RE 3BUXB 5KTYA 3CR4X 2L5XB 2AAOA 3SIBA 3CS1A 3KO0A 1JFKA 2KAYA 3HX4A 1YUTA 3LK0A 2K7CA 1NPQA 4PHKA 3BXKA 1IJ5A 1MXEA 4ZCUA 1RWYA 2F3ZA 4NDBA 1BJFA 3BUNB 2O5GA 1C07A 1Y1AA 1IJ6A 2H61C 1SKTA 3OB2B 2LCPA 1ALVA 3SJSA 1FPWA 1BOCA 1UHHA 4WRIA 4PCWA 1WRLA 1S1EA 1TOPA 4XJKB 4DUQA 3EKJA 5HYDA 2E30A 3VRQA 5DKQA 1DJWA 2CCMA 2GV5A 4HRGA 2BBNA 4JQ0D 4E68A 2KI4B 2WOSA 1CDMA 2HQ8A 1B9AA 1F54A 4I5KA 1Y0VH 4ORCB 3GK2A 1XO5A 1N2DA 2LVKA 5CSFA 1WDCC 2HQWA 4DRWA 5KSZA 3CZTX 1DGUA 1EL4A 1SW8A 4YGBB 5I2LA 4PE7A 2FJUB 3GK1A 3I5IB 2M97A 2MRDA 1B7TZ 1XFUO 2JZIA 1OQPA 1NX0A 1S3PA 3EVUA 1ZUZA 3KHEA 5ER4X 2GGZA 2MAZA 1MHOA 2NCOA 2KFGA 3LL8B 1KK8C 3BUOB 2BBMA 4YRUA 1MUXA 1QX2A 2WCEA 1XK4A 3O78A 5HKYA 1TRFA 1NCZA 2AUCA 1TNQA 2LLTA 5FYXA 1CB1A 4HREE 4TNCA 2JOJA 2MLFC 2ZNDA 1RECA 5K89A 1J7RA 3MSEB 1PSRA 4YI9A 2K8MB 1TNPA 4MRYA 1TIZA 2LLUA 1CDLA 4BY5A 4CIDA 1B8RA 1MF8B 2JTTA 2K61A 1DJHA 1JF0A 1DMOA 1J7OA 1XFYO 3JVTB 3VRNA 1BLQA 1BR1B 1CFFA 1F4OA 1YUUA 1CKKA 3I5FB 3AKBA 3D10A 1R2UA 3D0YB 3FWCA 1B8LA 1QTXA 3VRRA 2M7NA 1AK8A 2F2OA 1OSAA 3LCPC 4MZLA 4NQGA 5CSJA 4MSPA 2AMIA 4A4BA 2Q91A 3EVRA 1A29A 2ZRTA 1YX7A 2QACA 1E8AA 2EHBA 3CTNA 3H4SE 5AFPA 5IBWA 1XVJA 3BOWA 3OP0A 2KSPA 1UHIA 1K8UA 3NXAA 1AUIB 1KSOA 4U8DA 5CSIA 1QX7A 1NIWA 3AAKA 3DVJA 2BCAA 1LXFC 5B8IB 1XFWO 2K7DA 2KBMA 5AXIA 3WHUB 5ER5A 1KQMC 4N1FA 1F71A 1CDNA 2IS9A 2COLB 1NSHA 1QVIZ 1KWOB 2PMYA 1AHRA 4DCKA 3DF0A 1BR4B 3VGOA 1UWOA 1SK6D 4PALA 1N0YA 3DVKA 1EG3A 2OS8C 1IGVA 5AEQA 5HLOA 1JBAA 4MEWA 1WDCB 1XYDA 2L4IA 2PSRA 1XA5A 3CR2A 1Y6WA 1ZOTB 2F2PA 2O60A 4F0ZB 2LMVA 4XYNA 1OMVA 1SY9A 1XK4C 2JT8A 1QIVA 2LM5A 1NCYA 5HKZA 1TNXA 1V1GA 1EJ3A 1K2HA 4XJKA 3SG6A 1XFZO 2LUCA 1QV1A 1L7ZA 1BU3A 2JXLA 2JPTA 4MN0A 2EGDA 1SL9A 1SCVA 3VRPA 5KU1A 3WHTB 2KI6C 1C7VA 2WCFA 1NX3A 3NSIA 1PVAA 1JSAA 3O4YA 1DJGA 2WCBA 2ZN8A 2H2KA 2ZKMX 5CPVA 2NCPA 3SG2A 2KBIA 2MA2A 1ZFSA 3NSLA 1S6JA 1A75A 1LKJA 2KYCA 2PALA 1S6CA 3A4UB 1QS7A 2LVIA 1MWNA 2LUXA 2OTGB 5CSNA 3BUMB 2JULA 1SCMB 1KFUS 1SL7A 2Q4UA 3DVMA 1S26D 3PN7C 1UHNA 4OKHA 5HKWA 2MJWB 3BUWB 3TZ1A 1MQ1A 3LK1A 1CM1A 1NCXA 2I7AA 2KDHA 2P6BB 5I8NA 1J7PA 1BF5A 1HQVA 2LAPA 2MHHA 1SBJA 4CLNA 1FBVA 2V53A 4GUKA 1JF2A 4M2QA 4ORBB 4JPZB 3SG4A 5DKRA 3TUYC 1SPYA 3DVEA 1RK9A 4MLWA 4IL1A 1Q80A 3EK7A 4YBHB 1KFXL 2L4HA 1YURA 1EXRA 1M31A 2FOTA 1OE9B 4AQJA 1QX5B 2L51A 4N5XA 2L0PA 2BL0C 2NZ0A 1N65A 2F3YA 1J1EA 3D0YA 4OVNF 1CMFA 1C7WA 1UHJA 1J7QA 1YUSA 2LVVA 3IQOA 3LLEA 1F4QA 4I5JA 2Y1MA 4FQOA 2EC6B 1TN4A 3TS5B 1LVCD 2CXJA 1TNWA 2KHNA 2WC8A 1CFCA 2WNDA 4I5LB 1YVLA 1K96A 3BYAA 2ZFDA 5JJGA 1NYAA 1QASA 2LC5A 4MZJA 1CFPA 1G4YR 3DD4A 4UPGA 4MRXA 1ZMZA 2RGIA 1PSBA 5I2QA 1IH0A 3OHMB 2PASA 2LMTA 1BT6A 1SYMA 1OZOA 2M3WA 4D1EA 3AKAA 2M0RA 1KCYA 1YR5A 2KI4C 4PHNA 1AJ5A 1QIWA 2JWWA 2H61A 1FI5A 1UURA 4YI8A 4QJ5B 3FS7A 1NP8A 4CFRA 2M8UA 4YGEB 1GGZA 1WRKA 2SCPA 1QXPA 1B47A 4C0KA 5GQQC 2KOTA 2OPOA 3RM1A 3OB1B 1SR6C 1WY9A 1QJTA 3I5IC 3SG7A 1X02A 2FCDA 1CLBA 1IRJA 3EK4A 2M29A 1ODBA 1B4CA 2M49B 3I5HC 3OX6A 1H8BA 2CNPA 1MXLC 1OMDA 4MVFA 4YGAA 1WRZA 1V1FA 1F55A 3VROA 1YX8A 2HPSA 1JUOA 2R2IA 2BKHB 2KQYA 4GGFA 5I2OA 1DF0B 1NUBA 3I5GC 1ZACA 1SRAA 2A4JA 2CTNA 5TNCA 1DJYA 3CLNA 4BY4A 1JWDA 1D1OA 1MR8A 3O2PA 4JWQA 4GNKB 1K90D 1PVBA 3K21A 5G08A 3PFVA 2I18A 4WQ3A 1IQ3A 2B1UA 4M2PA 2ZNEA 4PE4A 4N1GA 2NLNA 3TDIA 2BECA 3CR5X 4YGDB 1FF1A 1W7JB 1NX2A 5D69A 4GBAA 3BQ3A 1L2OC 4QJ3B 1KSMA 1FW4A 1DT7B 2SASA 3I5FC 2I94A 1KK8B 1PALA 1TTXA 4AOMA 3PALA 4CPVA 2MLEC 2JXCA 3PSRA 3ZNIA 3ZWHA 3E3RA 4DIRA 3FWBA 2JC2A 1DJXA 2L50A 5BPJA 1XFVO 1Y1XA 2FCEA 1K9UA 1U5IB 2DOQA 2PVBA 1LA0A 2LHLA 1M39A 5J3XA 4C0LA 1CTRA 2CT9A 1HT9A 1YRUB 1G8IA 2ISDA 2ZRSA 2LP2A 2KYFA 2Y1NA 2ZN9A 4L9MA 1BODA 1J1DA 1CLLA 1RTP1 2JRFA 3NSOA 2M1UA 1OOJA 1LINA 2LANA 2LHIA 1AJ4A 1M45A 2CBLA 2E6WA 4OR9B 1F8HA 2KAXA 3O6BA 1UUSA 1SL8A 1SMGA 1YRTB 1R6PA 4PE1A 1KWOC 4GFTA 1PULA 4OV2A 2MBXA 1CLMA 1DGVA 1GGWA 2K2FA 4OCIA 3KEVA 3IF7A 1XFXO 2G2BA 4GAOA 1FI6A 4NDDA 2JTZA 1A03A 1VRKA 4C0JA 2K2AA 1OMRA 4FTGA 3PM8A 1IQ5A 4PE0A 2JT0A 2LLSA 2PRUA 1DVIA 1WLMA 4USLA 1RROA 4R1EA 2BCXA 2D8NA 2M9GA 2WORA 1CNPA 3EVVA 1GQMA 1SR6B 2LNKA 2JNFA 1A75B 3JTDC 1SNLA 2NXQA 2K7OA 1UHKA 4I5NB 4GGFC 4CFQA 1QLSA 1S36A 2JT3A 4QJ4B 1M63B 4ETOA 2LP3A 1KQMB 1K9PA 4PDZA 2JNXA 1BMOA 3I5HB 1EG4A 1AVSA 4GPLB 5AERA 1S5GZ 3CGAA 1B7TY 1DTLA 4Q04A 2HETA 4M2OA 3I5GB 1RFJA 5D7FA 4HRHA 1KK7Z 1K9KA 2LE9B 3QRXA 3EK8A 4HSZA 1G33A 2OS8B 4PHMA 1S5GY 2BKIB 1GJYA 2QPTA 1B8CA 2K0JA 2G9BA 3PATA 3TDUA 1AP4A 1RJVA 1J55A 2TN4A 1YTZC 5HLVA 1K95A 4YGCB 1KFUL 1K93D 1PK0D 2M7LA 2BE4A 2Y5IA 4ZCVA 1KK7Y 2OTGC 3TDZA 5DKNA 2HF5A 2F8PA 4A4CA 1SCMC 1EH2A
chains in the Genus database with same CATH superfamily
2KI6D 3CZ2A 1L2OB 3SIAA 5JOLA 1UP5A 1ALWA 3CDNA 3NSKA 1IIOA 1C3YA 2KFFA 2L2EA 3FIAA 1DF0A 4GGNA 1IKUA 2KAVA 1DJIA 2KNEA 3PLFB 2F33A 1CM4A 1BG1A 1DEKA 3EKHA 1K94A 3WXAA 1W7IB 3D78A 4NDCA 1H4BA 1OZSA 1KQVA 3SG3A 2KGRA 2VRGA 3M0WA 2L98A 3D75A 2Y4QA 1LA3A 1TCFA 2GGMA 3GOFA 3A8RA 2LVJA 1S6IA 3C1VA 1CMGA 2LV7A 1NX1A 4ORAB 3PN7B 2BE6A 4DS7A 3RLZA 2JU0A 3CWGA 3KPXA 1OOFA 1TUZA 5F6TA 4WQ2A 1JFJA 1PRWA 3BFAA 2EC6C 4MBEA 5FI7A 4MZKA 3TS5C 3IQQA 3KF9A 3SG5A 1IWQA 1YVHA 3WNXB 3BOWB 1B1GA 3HCMA 1U5IA 3JVTC 2KQ6A 1QV0A 1Y1UA 2QEOA 2JQ6A 3CABA 4ICBA 4PHJA 3TUYB 1DJZA 2K7BA 2M1KB 1TCOB 4P2YB 5DICA 5PALA 1CFDA 1CDPA 1M46A 1NWDA 2BCBA 4P5OE 3OX5A 1IG5A 1QVIY 1WLZA 2LMUA 2BAPA 2QEBA 2KFHA 2KGBC 3GK4X 1A2XA 3ICBA 5AANA 3AAJA 4AQIA 1KFXS 3JTDB 2BL0B 4OZDA 3F45A 1QATA 1JC2A 3DF0B 4INWA 1A4PA 1F70A 1QLKA 2I2RE 3BUXB 5KTYA 3CR4X 2L5XB 2AAOA 3SIBA 1DELA 2PYQA 3CS1A 3KO0A 3BJHA 1JFKA 2KAYA 3HX4A 1YUTA 3LK0A 2K7CA 1NPQA 4PHKA 3B88A 3BXKA 1IJ5A 1MXEA 4ZCUA 1RWYA 2F3ZA 4NDBA 1BJFA 2KLDA 3BFBA 2O5GA 3BUNB 3S0FA 1Y1AA 1C07A 1IJ6A 2H61C 1SKTA 3OB2B 2LCPA 1ALVA 3O4XA 3SJSA 1FPWA 1BOCA 1UHHA 4WRIA 4PCWA 1WRLA 1S1EA 1TOPA 2GTEA 4XJKB 4DUQA 3EKJA 5HYDA 1W9ZA 2E30A 3VRQA 5DKQA 1DJWA 4YBHB 2CCMA 2GV5A 4HRGA 2BBNA 4JQ0D 4E68A 2KI4B 2WOSA 1CDMA 2HQ8A 1B9AA 1F54A 4I5KA 1Y0VH 4ORCB 3GK2A 1XO5A 1N2DA 1Z2CB 2LVKA 5CSFA 1WDCC 2HQWA 4DRWA 5KSZA 3CZTX 1DGUA 5HL1A 1EL4A 1SW8A 4YGBB 5I2LA 3CZ0A 4PE7A 2FJUB 3GK1A 3I5IB 2WCJA 2M97A 2MRDA 1B7TZ 1XFUO 2JZIA 1OQPA 3R1OA 1GM0A 1NX0A 1S3PA 1DC1A 3EVUA 1ZUZA 3KHEA 5ER4X 2GGZA 2MAZA 1MHOA 2NCOA 2KFGA 3LL8B 1KK8C 3BUOB 2BBMA 4YRUA 1OOIX 3DY9A 3SS3A 1MUXA 3NHTA 1QX2A 2WCEA 1XK4A 2L2CA 3O78A 5HKYA 1TRFA 1NCZA 2AUCA 1TNQA 2LLTA 5FYXA 1CB1A 4HREE 4TNCA 2JOJA 2MLFC 2ZNDA 1RECA 5K89A 1J7RA 3MSEB 1PSRA 4YI9A 2K8MB 1TNPA 3S0GA 4MRYA 1TIZA 2LLUA 1XFRA 1CDLA 4BY5A 4CIDA 1B8RA 1MF8B 2JTTA 2K61A 1DJHA 1JF0A 3L4AA 1DMOA 1J7OA 1XFYO 3JVTB 3VRNA 1BLQA 1BR1B 3B7AA 1CFFA 1F4OA 1YUUA 1CKKA 3I5FB 3AKBA 3D10A 1R2UA 3D0YB 3FWCA 1B8LA 1QTXA 2ERBA 2M7NA 3NHIA 3VRRA 1AK8A 2F2OA 1OSAA 3LCPC 4MZLA 1Z4HA 4NQGA 5CSJA 4MSPA 2AMIA 4A4BA 2Q91A 2WCMA 1C3ZA 2BNXA 3EVRA 1A29A 2ZRTA 1OW4A 1YX7A 3QMEA 2QACA 1E8AA 4KYNA 2EHBA 3CTNA 3H4SE 5AFPA 3OGNA 5IBWA 1XVJA 3BOWA 3OP0A 2KSPA 1UHIA 3PJIA 1K8UA 3NXAA 1AUIB 1KSOA 4U8DA 5CSIA 1QX7A 1NIWA 3AAKA 3DVJA 2BCAA 1LXFC 5B8IB 1XFWO 2K7DA 2KBMA 5AXIA 3WHUB 5ER5A 1KQMC 4N1FA 1F71A 1T14A 1CDNA 2IS9A 1NSHA 2COLB 1QVIZ 1KWOB 2PMYA 1AHRA 4DCKA 3DF0A 1BR4B 3VGOA 3CYZA 1UWOA 1SK6D 4PALA 1N0YA 3DVKA 1EG3A 1SSEB 2OS8C 1IGVA 5AEQA 5HLOA 3RZSA 4MEWA 1WDCB 1JBAA 1XYDA 3FE8A 2L4IA 2PSRA 1XA5A 3CR2A 3CZ1A 1Y6WA 1ZOTB 2F2PA 2O60A 4F0ZB 2L5YA 2LMVA 4XYNA 1OMVA 1SY9A 1XK4C 2KPHA 3VB1A 2JT8A 1QIVA 2LM5A 1NCYA 5HKZA 2WC5A 1TNXA 1V1GA 1EJ3A 3D76A 1K2HA 4XJKA 3SG6A 1XFZO 2LUCA 4IJ7A 1QV1A 1L7ZA 1BU3A 2JXLA 2JPTA 4MN0A 2EGDA 1SL9A 1SCVA 3VRPA 5KU1A 3WHTB 2KI6C 1C7VA 2WCFA 1NX3A 3NSIA 1PVAA 1JSAA 3O4YA 1DJGA 3S0DA 2WCBA 2ZN8A 2H2KA 2ZKMX 5CPVA 3PM2A 1TWOA 2NCPA 3SG2A 3S0EA 2KBIA 2MA2A 1ZFSA 3NSLA 1S6JA 2QDIA 1A75A 1LKJA 2KYCA 2PALA 1S6CA 3A4UB 3B6XA 1QS7A 2LVIA 1MWNA 2LUXA 2OTGB 5CSNA 3BUMB 2JULA 4FQTA 1SCMB 1KFUS 1SL7A 2Q4UA 3DVMA 3FE9A 3N7HA 1S26D 3PN7C 1UHNA 4OKHA 5HKWA 2MJWB 3BUWB 3TZ1A 1QWVA 4F7FA 1MQ1A 3LK1A 5FI6A 1CM1A 1NCXA 2I7AA 2KDHA 2P6BB 5I8NA 1J7PA 1BF5A 1HQVA 2LAPA 2MHHA 1SBJA 4CLNA 1FBVA 2V53A 2YGUA 1JF2A 4GUKA 4M2QA 4ORBB 4JPZB 3SG4A 2JPOA 2QEVA 5DKRA 1SPYA 3DVEA 3TUYC 1RK9A 4MLWA 4IL1A 1Q80A 5D3OA 2WCHA 3EK7A 1KFXL 2L4HA 1YURA 3L4LA 1EXRA 1M31A 2FOTA 3B86A 3R1PA 1OE9B 4AQJA 1QX5B 2L51A 4N5XA 2L0PA 3EG5B 3Q8IA 2BL0C 2NZ0A 1N65A 2F3YA 1J1EA 3D0YA 3FE6A 4OVNF 1CMFA 1C7WA 1UHJA 1J7QA 1YUSA 2LVVA 3IQOA 3LLEA 1F4QA 4I5JA 2Y1MA 4FQOA 2EC6B 1TN4A 3TS5B 1LVCD 2WC6A 2CXJA 1TNWA 2KHNA 2WC8A 1CFCA 2WNDA 4I5LB 1YVLA 1K96A 3BYAA 2ZFDA 5JJGA 1NYAA 1QASA 2LC5A 4MZJA 1CFPA 2KLEA 1G4YR 3D74A 3DD4A 4UPGA 4MRXA 1ZMZA 2RGIA 1PSBA 5I2QA 1IH0A 3OHMB 2PASA 2LMTA 1BT6A 3D77A 1SYMA 1OZOA 4PT1A 2M3WA 4D1EA 3AKAA 2M0RA 1KCYA 1YR5A 2KI4C 4PHNA 1AJ5A 1QIWA 2JWWA 2FJYA 2H61A 1FI5A 1UURA 4YI8A 4QJ5B 3DZTA 1NP8A 3FS7A 4CFRA 2M8UA 4YGEB 1GGZA 1WRKA 2SCPA 1QXPA 1B47A 4C0KA 5GQQC 2KOTA 2OPOA 3RM1A 3OB1B 1SR6C 1WY9A 1QJTA 3I5IC 3SG7A 1X02A 2FCDA 1CLBA 1IRJA 2PQLA 3EK4A 2M29A 1ODBA 4INXA 2M49B 1B4CA 3I5HC 3OX6A 1H8BA 2CNPA 1MXLC 1P28A 1OMDA 4MVFA 4YGAA 1WRZA 1V1FA 2K60A 1F55A 3VROA 1YX8A 2HPSA 1JUOA 3R1VA 2R2IA 2BKHB 2KQYA 4GGFA 3S0BA 5I2OA 1DF0B 1NUBA 3I5GC 1ZACA 1SRAA 2A4JA 2CTNA 5TNCA 1DJYA 3CLNA 4BY4A 1JWDA 3UO9A 1D1OA 1MR8A 3O2PA 4JWQA 4GNKB 1K90D 1PVBA 3K21A 5G08A 3PFVA 2I18A 4WQ3A 1IQ3A 2B1UA 4M2PA 2ZNEA 4PE4A 3NGVA 3S0AA 4N1GA 2NLNA 3TDIA 2BECA 5I94A 3CR5X 4YGDB 1FF1A 1W7JB 3R72A 1NX2A 5D69A 4GBAA 3BQ3A 1L2OC 4QJ3B 1KSMA 1FW4A 1DT7B 2SASA 3I5FC 2I94A 1KK8B 1PALA 1TTXA 4AOMA 3PALA 4CPVA 2MLEC 2JXCA 3PSRA 3ZNIA 3ZWHA 1ORGA 3E3RA 4DIRA 3FWBA 2JC2A 1DJXA 1LS8A 2L50A 5BPJA 1XFVO 1Y1XA 2FCEA 1K9UA 1U5IB 2DOQA 1DQEA 2PVBA 1LA0A 2LHLA 1M39A 5J3XA 4C0LA 1CTRA 2CT9A 1HT9A 1YRUB 1G8IA 2ISDA 2ZRSA 2LP2A 2KYFA 2Y1NA 2ZN9A 4L9MA 1BODA 3BFHA 1J1DA 1CLLA 1RTP1 2JRFA 2WCKA 3NSOA 2M1UA 1OOJA 1LINA 2LANA 2LHIA 1AJ4A 5FI2A 1M45A 2CBLA 2E6WA 4OR9B 1F8HA 3D73A 2KAXA 3O6BA 1UUSA 1SL8A 1SMGA 1YRTB 2WCLA 4JKTA 1R6PA 1TUJA 4PE1A 1KWOC 4GFTA 1PULA 4OV2A 2MBXA 3SS5A 1CLMA 3V2LA 1DGVA 1GGWA 2K2FA 4OCIA 3KEVA 3IF7A 1XFXO 2G2BA 4GAOA 2H8VA 4NDDA 1FI6A 2JTZA 1A03A 1VRKA 4C0JA 2K2AA 1OMRA 4FTGA 3PM8A 1IQ5A 4PE0A 2JT0A 2LLSA 2PRUA 1DVIA 1WLMA 4USLA 1RROA 4R1EA 2BCXA 2D8NA 2M9GA 2WORA 1CNPA 3OBVA 3EVVA 1GQMA 1OOHA 1SR6B 3B87A 2LNKA 2JNFA 1A75B 3JTDC 1SNLA 2NXQA 2K7OA 1UHKA 4I5NB 4GGFC 4CFQA 1QLSA 1S36A 2JT3A 3UNWA 4QJ4B 1M63B 4ETOA 2LP3A 2P70A 1KQMB 1K9PA 4PDZA 2JNXA 1BMOA 3DYEA 3I5HB 1EG4A 1AVSA 1OOGA 4GPLB 3SS4A 5AERA 2P71A 1S5GZ 3CGAA 1B7TY 4JD9A 5DKNA 1DTLA 2QEHA 4Q04A 2HETA 4M2OA 3I5GB 1RFJA 5D7FA 4HRHA 1KK7Z 1K9KA 2LE9B 3QRXA 3EK8A 4HSZA 1G33A 2OS8B 3L47A 4PHMA 1S5GY 2BKIB 1GJYA 2QPTA 1B8CA 2K0JA 2G9BA 3PATA 3TDUA 1AP4A 1RJVA 1J55A 2TN4A 1YTZC 5HLVA 1K95A 4YGCB 1KFUL 1K93D 1PK0D 5EL2A 2M7LA 2BE4A 2Y5IA 4ZCVA 1KK7Y 2OTGC 3DXLA 3TDZA 3IVTA 2HF5A 2F8PA 3K1EA 4A4CA 1SCMC 1EH2A
chains in the Genus database with same CATH topology
2KI6D 1L2OB 3SIAA 5JOLA 1UP5A 1ALWA 3NSKA 2KFFA 2L2EA 3FIAA 1DF0A 4GGNA 1IKUA 2KAVA 1DJIA 2KNEA 3PLFB 2F33A 1CM4A 1BG1A 3EKHA 1K94A 3WXAA 1W7IB 4NDCA 1H4BA 1OZSA 1KQVA 3SG3A 2KGRA 2VRGA 3M0WA 2L98A 2Y4QA 1LA3A 1TCFA 2GGMA 3GOFA 3A8RA 2LVJA 1S6IA 3C1VA 1CMGA 2LV7A 1NX1A 4ORAB 3PN7B 2BE6A 4DS7A 3RLZA 2JU0A 3CWGA 3KPXA 5F6TA 4WQ2A 1JFJA 1PRWA 2EC6C 4MBEA 3TS5C 4MZKA 3IQQA 3KF9A 3SG5A 1IWQA 1YVHA 3WNXB 3BOWB 1B1GA 3HCMA 1U5IA 3JVTC 2KQ6A 1QV0A 1Y1UA 2JQ6A 4ICBA 4PHJA 3TUYB 1DJZA 2K7BA 2M1KB 1TCOB 4P2YB 5PALA 1CFDA 1CDPA 1M46A 1NWDA 2BCBA 4P5OE 3OX5A 1IG5A 1QVIY 1WLZA 2LMUA 2KFHA 2KGBC 3GK4X 1A2XA 3ICBA 5AANA 3AAJA 4AQIA 1KFXS 3JTDB 2BL0B 3F45A 1QATA 1JC2A 3DF0B 1F70A 1A4PA 1QLKA 2I2RE 3BUXB 5KTYA 3CR4X 2L5XB 2AAOA 3SIBA 3CS1A 3KO0A 1JFKA 2KAYA 3HX4A 1YUTA 3LK0A 2K7CA 1NPQA 4PHKA 3BXKA 1IJ5A 1MXEA 4ZCUA 1RWYA 2F3ZA 4NDBA 1BJFA 3BUNB 2O5GA 1C07A 1Y1AA 1IJ6A 2H61C 1SKTA 3OB2B 2LCPA 1ALVA 3SJSA 1FPWA 1BOCA 1UHHA 4WRIA 4PCWA 1WRLA 1S1EA 1TOPA 4XJKB 4DUQA 3EKJA 5HYDA 2E30A 3VRQA 5DKQA 1DJWA 2CCMA 2GV5A 4HRGA 2BBNA 4JQ0D 4E68A 2KI4B 2WOSA 1CDMA 2HQ8A 1B9AA 1F54A 4I5KA 1Y0VH 4ORCB 3GK2A 1XO5A 1N2DA 2LVKA 5CSFA 1WDCC 2HQWA 4DRWA 5KSZA 3CZTX 1DGUA 1EL4A 1SW8A 4YGBB 5I2LA 4PE7A 2FJUB 3GK1A 3I5IB 2M97A 2MRDA 1B7TZ 1XFUO 2JZIA 1OQPA 1NX0A 1S3PA 3EVUA 1ZUZA 3KHEA 5ER4X 2GGZA 2MAZA 1MHOA 2NCOA 2KFGA 3LL8B 1KK8C 3BUOB 2BBMA 4YRUA 1MUXA 1QX2A 2WCEA 1XK4A 3O78A 5HKYA 1TRFA 1NCZA 2AUCA 1TNQA 2LLTA 5FYXA 1CB1A 4HREE 4TNCA 2JOJA 2MLFC 2ZNDA 1RECA 5K89A 1J7RA 3MSEB 1PSRA 4YI9A 2K8MB 1TNPA 4MRYA 1TIZA 2LLUA 1CDLA 4BY5A 4CIDA 1B8RA 1MF8B 2JTTA 2K61A 1DJHA 1JF0A 1DMOA 1J7OA 1XFYO 3JVTB 3VRNA 1BLQA 1BR1B 1CFFA 1F4OA 1YUUA 1CKKA 3I5FB 3AKBA 3D10A 1R2UA 3D0YB 3FWCA 1B8LA 1QTXA 3VRRA 2M7NA 1AK8A 2F2OA 1OSAA 3LCPC 4MZLA 4NQGA 5CSJA 4MSPA 2AMIA 4A4BA 2Q91A 3EVRA 1A29A 2ZRTA 1YX7A 2QACA 1E8AA 2EHBA 3CTNA 3H4SE 5AFPA 5IBWA 1XVJA 3BOWA 3OP0A 2KSPA 1UHIA 1K8UA 3NXAA 1AUIB 1KSOA 4U8DA 5CSIA 1QX7A 1NIWA 3AAKA 3DVJA 2BCAA 1LXFC 5B8IB 1XFWO 2K7DA 2KBMA 5AXIA 3WHUB 5ER5A 1KQMC 4N1FA 1F71A 1CDNA 2IS9A 2COLB 1NSHA 1QVIZ 1KWOB 2PMYA 1AHRA 4DCKA 3DF0A 1BR4B 3VGOA 1UWOA 1SK6D 4PALA 1N0YA 3DVKA 1EG3A 2OS8C 1IGVA 5AEQA 5HLOA 1JBAA 4MEWA 1WDCB 1XYDA 2L4IA 2PSRA 1XA5A 3CR2A 1Y6WA 1ZOTB 2F2PA 2O60A 4F0ZB 2LMVA 4XYNA 1OMVA 1SY9A 1XK4C 2JT8A 1QIVA 2LM5A 1NCYA 5HKZA 1TNXA 1V1GA 1EJ3A 1K2HA 4XJKA 3SG6A 1XFZO 2LUCA 1QV1A 1L7ZA 1BU3A 2JXLA 2JPTA 4MN0A 2EGDA 1SL9A 1SCVA 3VRPA 5KU1A 3WHTB 2KI6C 1C7VA 2WCFA 1NX3A 3NSIA 1PVAA 1JSAA 3O4YA 1DJGA 2WCBA 2ZN8A 2H2KA 2ZKMX 5CPVA 2NCPA 3SG2A 2KBIA 2MA2A 1ZFSA 3NSLA 1S6JA 1A75A 1LKJA 2KYCA 2PALA 1S6CA 3A4UB 1QS7A 2LVIA 1MWNA 2LUXA 2OTGB 5CSNA 3BUMB 2JULA 1SCMB 1KFUS 1SL7A 2Q4UA 3DVMA 1S26D 3PN7C 1UHNA 4OKHA 5HKWA 2MJWB 3BUWB 3TZ1A 1MQ1A 3LK1A 1CM1A 1NCXA 2I7AA 2KDHA 2P6BB 5I8NA 1J7PA 1BF5A 1HQVA 2LAPA 2MHHA 1SBJA 4CLNA 1FBVA 2V53A 4GUKA 1JF2A 4M2QA 4ORBB 4JPZB 3SG4A 5DKRA 3TUYC 1SPYA 3DVEA 1RK9A 4MLWA 4IL1A 1Q80A 3EK7A 4YBHB 1KFXL 2L4HA 1YURA 1EXRA 1M31A 2FOTA 1OE9B 4AQJA 1QX5B 2L51A 4N5XA 2L0PA 2BL0C 2NZ0A 1N65A 2F3YA 1J1EA 3D0YA 4OVNF 1CMFA 1C7WA 1UHJA 1J7QA 1YUSA 2LVVA 3IQOA 3LLEA 1F4QA 4I5JA 2Y1MA 4FQOA 2EC6B 1TN4A 3TS5B 1LVCD 2CXJA 1TNWA 2KHNA 2WC8A 1CFCA 2WNDA 4I5LB 1YVLA 1K96A 3BYAA 2ZFDA 5JJGA 1NYAA 1QASA 2LC5A 4MZJA 1CFPA 1G4YR 3DD4A 4UPGA 4MRXA 1ZMZA 2RGIA 1PSBA 5I2QA 1IH0A 3OHMB 2PASA 2LMTA 1BT6A 1SYMA 1OZOA 2M3WA 4D1EA 3AKAA 2M0RA 1KCYA 1YR5A 2KI4C 4PHNA 1AJ5A 1QIWA 2JWWA 2H61A 1FI5A 1UURA 4YI8A 4QJ5B 3FS7A 1NP8A 4CFRA 2M8UA 4YGEB 1GGZA 1WRKA 2SCPA 1QXPA 1B47A 4C0KA 5GQQC 2KOTA 2OPOA 3RM1A 3OB1B 1SR6C 1WY9A 1QJTA 3I5IC 3SG7A 1X02A 2FCDA 1CLBA 1IRJA 3EK4A 2M29A 1ODBA 1B4CA 2M49B 3I5HC 3OX6A 1H8BA 2CNPA 1MXLC 1OMDA 4MVFA 4YGAA 1WRZA 1V1FA 1F55A 3VROA 1YX8A 2HPSA 1JUOA 2R2IA 2BKHB 2KQYA 4GGFA 5I2OA 1DF0B 1NUBA 3I5GC 1ZACA 1SRAA 2A4JA 2CTNA 5TNCA 1DJYA 3CLNA 4BY4A 1JWDA 1D1OA 1MR8A 3O2PA 4JWQA 4GNKB 1K90D 1PVBA 3K21A 5G08A 3PFVA 2I18A 4WQ3A 1IQ3A 2B1UA 4M2PA 2ZNEA 4PE4A 4N1GA 2NLNA 3TDIA 2BECA 3CR5X 4YGDB 1FF1A 1W7JB 1NX2A 5D69A 4GBAA 3BQ3A 1L2OC 4QJ3B 1KSMA 1FW4A 1DT7B 2SASA 3I5FC 2I94A 1KK8B 1PALA 1TTXA 4AOMA 3PALA 4CPVA 2MLEC 2JXCA 3PSRA 3ZNIA 3ZWHA 3E3RA 4DIRA 3FWBA 2JC2A 1DJXA 2L50A 5BPJA 1XFVO 1Y1XA 2FCEA 1K9UA 1U5IB 2DOQA 2PVBA 1LA0A 2LHLA 1M39A 5J3XA 4C0LA 1CTRA 2CT9A 1HT9A 1YRUB 1G8IA 2ISDA 2ZRSA 2LP2A 2KYFA 2Y1NA 2ZN9A 4L9MA 1BODA 1J1DA 1CLLA 1RTP1 2JRFA 3NSOA 2M1UA 1OOJA 1LINA 2LANA 2LHIA 1AJ4A 1M45A 2CBLA 2E6WA 4OR9B 1F8HA 2KAXA 3O6BA 1UUSA 1SL8A 1SMGA 1YRTB 1R6PA 4PE1A 1KWOC 4GFTA 1PULA 4OV2A 2MBXA 1CLMA 1DGVA 1GGWA 2K2FA 4OCIA 3KEVA 3IF7A 1XFXO 2G2BA 4GAOA 1FI6A 4NDDA 2JTZA 1A03A 1VRKA 4C0JA 2K2AA 1OMRA 4FTGA 3PM8A 1IQ5A 4PE0A 2JT0A 2LLSA 2PRUA 1DVIA 1WLMA 4USLA 1RROA 4R1EA 2BCXA 2D8NA 2M9GA 2WORA 1CNPA 3EVVA 1GQMA 1SR6B 2LNKA 2JNFA 1A75B 3JTDC 1SNLA 2NXQA 2K7OA 1UHKA 4I5NB 4GGFC 4CFQA 1QLSA 1S36A 2JT3A 4QJ4B 1M63B 4ETOA 2LP3A 1KQMB 1K9PA 4PDZA 2JNXA 1BMOA 3I5HB 1EG4A 1AVSA 4GPLB 5AERA 1S5GZ 3CGAA 1B7TY 1DTLA 4Q04A 2HETA 4M2OA 3I5GB 1RFJA 5D7FA 4HRHA 1KK7Z 1K9KA 2LE9B 3QRXA 3EK8A 4HSZA 1G33A 2OS8B 4PHMA 1S5GY 2BKIB 1GJYA 2QPTA 1B8CA 2K0JA 2G9BA 3PATA 3TDUA 1AP4A 1RJVA 1J55A 2TN4A 1YTZC 5HLVA 1K95A 4YGCB 1KFUL 1K93D 1PK0D 2M7LA 2BE4A 2Y5IA 4ZCVA 1KK7Y 2OTGC 3TDZA 5DKNA 2HF5A 2F8PA 4A4CA 1SCMC 1EH2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KI6 D;  1L2O B;  3SIA A;  5JOL A;  1UP5 A;  1ALW A;  3NSK A;  2KFF A;  2L2E A;  3FIA A;  1DF0 A;  4GGN A;  1IKU A;  2KAV A;  1DJI A;  2KNE A;  3PLF B;  2F33 A;  1CM4 A;  1BG1 A;  3EKH A;  1K94 A;  3WXA A;  1W7I B;  4NDC A;  1H4B A;  1OZS A;  1KQV A;  3SG3 A;  2KGR A;  2VRG A;  3M0W A;  2L98 A;  2Y4Q A;  1LA3 A;  1TCF A;  2GGM A;  3GOF A;  3A8R A;  2LVJ A;  1S6I A;  3C1V A;  1CMG A;  2LV7 A;  1NX1 A;  4ORA B;  3PN7 B;  2BE6 A;  4DS7 A;  3RLZ A;  2JU0 A;  3CWG A;  3KPX A;  5F6T A;  4WQ2 A;  1JFJ A;  1PRW A;  2EC6 C;  4MBE A;  3TS5 C;  4MZK A;  3IQQ A;  3KF9 A;  3SG5 A;  1IWQ A;  1YVH A;  3WNX B;  3BOW B;  1B1G A;  3HCM A;  1U5I A;  3JVT C;  2KQ6 A;  1QV0 A;  1Y1U A;  2JQ6 A;  4ICB A;  4PHJ A;  3TUY B;  1DJZ A;  2K7B A;  2M1K B;  1TCO B;  4P2Y B;  5PAL A;  1CFD A;  1CDP A;  1M46 A;  1NWD A;  2BCB A;  4P5O E;  3OX5 A;  1IG5 A;  1QVI Y;  1WLZ A;  2LMU A;  2KFH A;  2KGB C;  3GK4 X;  1A2X A;  3ICB A;  5AAN A;  3AAJ A;  4AQI A;  1KFX S;  3JTD B;  2BL0 B;  3F45 A;  1QAT A;  1JC2 A;  3DF0 B;  1F70 A;  1A4P A;  1QLK A;  2I2R E;  3BUX B;  5KTY A;  3CR4 X;  2L5X B;  2AAO A;  3SIB A;  3CS1 A;  3KO0 A;  1JFK A;  2KAY A;  3HX4 A;  1YUT A;  3LK0 A;  2K7C A;  1NPQ A;  4PHK A;  3BXK A;  1IJ5 A;  1MXE A;  4ZCU A;  1RWY A;  2F3Z A;  4NDB A;  1BJF A;  3BUN B;  2O5G A;  1C07 A;  1Y1A A;  1IJ6 A;  2H61 C;  1SKT A;  3OB2 B;  2LCP A;  1ALV A;  3SJS A;  1FPW A;  1BOC A;  1UHH A;  4WRI A;  4PCW A;  1WRL A;  1S1E A;  1TOP A;  4XJK B;  4DUQ A;  3EKJ A;  5HYD A;  2E30 A;  3VRQ A;  5DKQ A;  1DJW A;  2CCM A;  2GV5 A;  4HRG A;  2BBN A;  4JQ0 D;  4E68 A;  2KI4 B;  2WOS A;  1CDM A;  2HQ8 A;  1B9A A;  1F54 A;  4I5K A;  1Y0V H;  4ORC B;  3GK2 A;  1XO5 A;  1N2D A;  2LVK A;  5CSF A;  1WDC C;  2HQW A;  4DRW A;  5KSZ A;  3CZT X;  1DGU A;  1EL4 A;  1SW8 A;  4YGB B;  5I2L A;  4PE7 A;  2FJU B;  3GK1 A;  3I5I B;  2M97 A;  2MRD A;  1B7T Z;  1XFU O;  2JZI A;  1OQP A;  1NX0 A;  1S3P A;  3EVU A;  1ZUZ A;  3KHE A;  5ER4 X;  2GGZ A;  2MAZ A;  1MHO A;  2NCO A;  2KFG A;  3LL8 B;  1KK8 C;  3BUO B;  2BBM A;  4YRU A;  1MUX A;  1QX2 A;  2WCE A;  1XK4 A;  3O78 A;  5HKY A;  1TRF A;  1NCZ A;  2AUC A;  1TNQ A;  2LLT A;  5FYX A;  1CB1 A;  4HRE E;  4TNC A;  2JOJ A;  2MLF C;  2ZND A;  1REC A;  5K89 A;  1J7R A;  3MSE B;  1PSR A;  4YI9 A;  2K8M B;  1TNP A;  4MRY A;  1TIZ A;  2LLU A;  1CDL A;  4BY5 A;  4CID A;  1B8R A;  1MF8 B;  2JTT A;  2K61 A;  1DJH A;  1JF0 A;  1DMO A;  1J7O A;  1XFY O;  3JVT B;  3VRN A;  1BLQ A;  1BR1 B;  1CFF A;  1F4O A;  1YUU A;  1CKK A;  3I5F B;  3AKB A;  3D10 A;  1R2U A;  3D0Y B;  3FWC A;  1B8L A;  1QTX A;  3VRR A;  2M7N A;  1AK8 A;  2F2O A;  1OSA A;  3LCP C;  4MZL A;  4NQG A;  5CSJ A;  4MSP A;  2AMI A;  4A4B A;  2Q91 A;  3EVR A;  1A29 A;  2ZRT A;  1YX7 A;  2QAC A;  1E8A A;  2EHB A;  3CTN A;  3H4S E;  5AFP A;  5IBW A;  1XVJ A;  3BOW A;  3OP0 A;  2KSP A;  1UHI A;  1K8U A;  3NXA A;  1AUI B;  1KSO A;  4U8D A;  5CSI A;  1QX7 A;  1NIW A;  3AAK A;  3DVJ A;  2BCA A;  1LXF C;  5B8I B;  1XFW O;  2K7D A;  2KBM A;  5AXI A;  3WHU B;  5ER5 A;  1KQM C;  4N1F A;  1F71 A;  1CDN A;  2IS9 A;  2COL B;  1NSH A;  1QVI Z;  1KWO B;  2PMY A;  1AHR A;  4DCK A;  3DF0 A;  1BR4 B;  3VGO A;  1UWO A;  1SK6 D;  4PAL A;  1N0Y A;  3DVK A;  1EG3 A;  2OS8 C;  1IGV A;  5AEQ A;  5HLO A;  1JBA A;  4MEW A;  1WDC B;  1XYD A;  2L4I A;  2PSR A;  1XA5 A;  3CR2 A;  1Y6W A;  1ZOT B;  2F2P A;  2O60 A;  4F0Z B;  2LMV A;  4XYN A;  1OMV A;  1SY9 A;  1XK4 C;  2JT8 A;  1QIV A;  2LM5 A;  1NCY A;  5HKZ A;  1TNX A;  1V1G A;  1EJ3 A;  1K2H A;  4XJK A;  3SG6 A;  1XFZ O;  2LUC A;  1QV1 A;  1L7Z A;  1BU3 A;  2JXL A;  2JPT A;  4MN0 A;  2EGD A;  1SL9 A;  1SCV A;  3VRP A;  5KU1 A;  3WHT B;  2KI6 C;  1C7V A;  2WCF A;  1NX3 A;  3NSI A;  1PVA A;  1JSA A;  3O4Y A;  1DJG A;  2WCB A;  2ZN8 A;  2H2K A;  2ZKM X;  5CPV A;  2NCP A;  3SG2 A;  2KBI A;  2MA2 A;  1ZFS A;  3NSL A;  1S6J A;  1A75 A;  1LKJ A;  2KYC A;  2PAL A;  1S6C A;  3A4U B;  1QS7 A;  2LVI A;  1MWN A;  2LUX A;  2OTG B;  5CSN A;  3BUM B;  2JUL A;  1SCM B;  1KFU S;  1SL7 A;  2Q4U A;  3DVM A;  1S26 D;  3PN7 C;  1UHN A;  4OKH A;  5HKW A;  2MJW B;  3BUW B;  3TZ1 A;  1MQ1 A;  3LK1 A;  1CM1 A;  1NCX A;  2I7A A;  2KDH A;  2P6B B;  5I8N A;  1J7P A;  1BF5 A;  1HQV A;  2LAP A;  2MHH A;  1SBJ A;  4CLN A;  1FBV A;  2V53 A;  4GUK A;  1JF2 A;  4M2Q A;  4ORB B;  4JPZ B;  3SG4 A;  5DKR A;  3TUY C;  1SPY A;  3DVE A;  1RK9 A;  4MLW A;  4IL1 A;  1Q80 A;  3EK7 A;  4YBH B;  1KFX L;  2L4H A;  1YUR A;  1EXR A;  1M31 A;  2FOT A;  1OE9 B;  4AQJ A;  1QX5 B;  2L51 A;  4N5X A;  2L0P A;  2BL0 C;  2NZ0 A;  1N65 A;  2F3Y A;  1J1E A;  3D0Y A;  4OVN F;  1CMF A;  1C7W A;  1UHJ A;  1J7Q A;  1YUS A;  2LVV A;  3IQO A;  3LLE A;  1F4Q A;  4I5J A;  2Y1M A;  4FQO A;  2EC6 B;  1TN4 A;  3TS5 B;  1LVC D;  2CXJ A;  1TNW A;  2KHN A;  2WC8 A;  1CFC A;  2WND A;  4I5L B;  1YVL A;  1K96 A;  3BYA A;  2ZFD A;  5JJG A;  1NYA A;  1QAS A;  2LC5 A;  4MZJ A;  1CFP A;  1G4Y R;  3DD4 A;  4UPG A;  4MRX A;  1ZMZ A;  2RGI A;  1PSB A;  5I2Q A;  1IH0 A;  3OHM B;  2PAS A;  2LMT A;  1BT6 A;  1SYM A;  1OZO A;  2M3W A;  4D1E A;  3AKA A;  2M0R A;  1KCY A;  1YR5 A;  2KI4 C;  4PHN A;  1AJ5 A;  1QIW A;  2JWW A;  2H61 A;  1FI5 A;  1UUR A;  4YI8 A;  4QJ5 B;  3FS7 A;  1NP8 A;  4CFR A;  2M8U A;  4YGE B;  1GGZ A;  1WRK A;  2SCP A;  1QXP A;  1B47 A;  4C0K A;  5GQQ C;  2KOT A;  2OPO A;  3RM1 A;  3OB1 B;  1SR6 C;  1WY9 A;  1QJT A;  3I5I C;  3SG7 A;  1X02 A;  2FCD A;  1CLB A;  1IRJ A;  3EK4 A;  2M29 A;  1ODB A;  1B4C A;  2M49 B;  3I5H C;  3OX6 A;  1H8B A;  2CNP A;  1MXL C;  1OMD A;  4MVF A;  4YGA A;  1WRZ A;  1V1F A;  1F55 A;  3VRO A;  1YX8 A;  2HPS A;  1JUO A;  2R2I A;  2BKH B;  2KQY A;  4GGF A;  5I2O A;  1DF0 B;  1NUB A;  3I5G C;  1ZAC A;  1SRA A;  2A4J A;  2CTN A;  5TNC A;  1DJY A;  3CLN A;  4BY4 A;  1JWD A;  1D1O A;  1MR8 A;  3O2P A;  4JWQ A;  4GNK B;  1K90 D;  1PVB A;  3K21 A;  5G08 A;  3PFV A;  2I18 A;  4WQ3 A;  1IQ3 A;  2B1U A;  4M2P A;  2ZNE A;  4PE4 A;  4N1G A;  2NLN A;  3TDI A;  2BEC A;  3CR5 X;  4YGD B;  1FF1 A;  1W7J B;  1NX2 A;  5D69 A;  4GBA A;  3BQ3 A;  1L2O C;  4QJ3 B;  1KSM A;  1FW4 A;  1DT7 B;  2SAS A;  3I5F C;  2I94 A;  1KK8 B;  1PAL A;  1TTX A;  4AOM A;  3PAL A;  4CPV A;  2MLE C;  2JXC A;  3PSR A;  3ZNI A;  3ZWH A;  3E3R A;  4DIR A;  3FWB A;  2JC2 A;  1DJX A;  2L50 A;  5BPJ A;  1XFV O;  1Y1X A;  2FCE A;  1K9U A;  1U5I B;  2DOQ A;  2PVB A;  1LA0 A;  2LHL A;  1M39 A;  5J3X A;  4C0L A;  1CTR A;  2CT9 A;  1HT9 A;  1YRU B;  1G8I A;  2ISD A;  2ZRS A;  2LP2 A;  2KYF A;  2Y1N A;  2ZN9 A;  4L9M A;  1BOD A;  1J1D A;  1CLL A;  1RTP 1;  2JRF A;  3NSO A;  2M1U A;  1OOJ A;  1LIN A;  2LAN A;  2LHI A;  1AJ4 A;  1M45 A;  2CBL A;  2E6W A;  4OR9 B;  1F8H A;  2KAX A;  3O6B A;  1UUS A;  1SL8 A;  1SMG A;  1YRT B;  1R6P A;  4PE1 A;  1KWO C;  4GFT A;  1PUL A;  4OV2 A;  2MBX A;  1CLM A;  1DGV A;  1GGW A;  2K2F A;  4OCI A;  3KEV A;  3IF7 A;  1XFX O;  2G2B A;  4GAO A;  1FI6 A;  4NDD A;  2JTZ A;  1A03 A;  1VRK A;  4C0J A;  2K2A A;  1OMR A;  4FTG A;  3PM8 A;  1IQ5 A;  4PE0 A;  2JT0 A;  2LLS A;  2PRU A;  1DVI A;  1WLM A;  4USL A;  1RRO A;  4R1E A;  2BCX A;  2D8N A;  2M9G A;  2WOR A;  1CNP A;  3EVV A;  1GQM A;  1SR6 B;  2LNK A;  2JNF A;  1A75 B;  3JTD C;  1SNL A;  2NXQ A;  2K7O A;  1UHK A;  4I5N B;  4GGF C;  4CFQ A;  1QLS A;  1S36 A;  2JT3 A;  4QJ4 B;  1M63 B;  4ETO A;  2LP3 A;  1KQM B;  1K9P A;  4PDZ A;  2JNX A;  1BMO A;  3I5H B;  1EG4 A;  1AVS A;  4GPL B;  5AER A;  1S5G Z;  3CGA A;  1B7T Y;  1DTL A;  4Q04 A;  2HET A;  4M2O A;  3I5G B;  1RFJ A;  5D7F A;  4HRH A;  1KK7 Z;  1K9K A;  2LE9 B;  3QRX A;  3EK8 A;  4HSZ A;  1G33 A;  2OS8 B;  4PHM A;  1S5G Y;  2BKI B;  1GJY A;  2QPT A;  1B8C A;  2K0J A;  2G9B A;  3PAT A;  3TDU A;  1AP4 A;  1RJV A;  1J55 A;  2TN4 A;  1YTZ C;  5HLV A;  1K95 A;  4YGC B;  1KFU L;  1K93 D;  1PK0 D;  2M7L A;  2BE4 A;  2Y5I A;  4ZCV A;  1KK7 Y;  2OTG C;  3TDZ A;  5DKN A;  2HF5 A;  2F8P A;  4A4C A;  1SCM C;  1EH2 A; 
#chains in the Genus database with same CATH topology
 2KI6 D;  3CZ2 A;  1L2O B;  3SIA A;  5JOL A;  1UP5 A;  1ALW A;  3CDN A;  3NSK A;  1IIO A;  1C3Y A;  2KFF A;  2L2E A;  3FIA A;  1DF0 A;  4GGN A;  1IKU A;  2KAV A;  1DJI A;  2KNE A;  3PLF B;  2F33 A;  1CM4 A;  1BG1 A;  1DEK A;  3EKH A;  1K94 A;  3WXA A;  1W7I B;  3D78 A;  4NDC A;  1H4B A;  1OZS A;  1KQV A;  3SG3 A;  2KGR A;  2VRG A;  3M0W A;  2L98 A;  3D75 A;  2Y4Q A;  1LA3 A;  1TCF A;  2GGM A;  3GOF A;  3A8R A;  2LVJ A;  1S6I A;  3C1V A;  1CMG A;  2LV7 A;  1NX1 A;  4ORA B;  3PN7 B;  2BE6 A;  4DS7 A;  3RLZ A;  2JU0 A;  3CWG A;  3KPX A;  1OOF A;  1TUZ A;  5F6T A;  4WQ2 A;  1JFJ A;  1PRW A;  3BFA A;  2EC6 C;  4MBE A;  5FI7 A;  4MZK A;  3TS5 C;  3IQQ A;  3KF9 A;  3SG5 A;  1IWQ A;  1YVH A;  3WNX B;  3BOW B;  1B1G A;  3HCM A;  1U5I A;  3JVT C;  2KQ6 A;  1QV0 A;  1Y1U A;  2QEO A;  2JQ6 A;  3CAB A;  4ICB A;  4PHJ A;  3TUY B;  1DJZ A;  2K7B A;  2M1K B;  1TCO B;  4P2Y B;  5DIC A;  5PAL A;  1CFD A;  1CDP A;  1M46 A;  1NWD A;  2BCB A;  4P5O E;  3OX5 A;  1IG5 A;  1QVI Y;  1WLZ A;  2LMU A;  2BAP A;  2QEB A;  2KFH A;  2KGB C;  3GK4 X;  1A2X A;  3ICB A;  5AAN A;  3AAJ A;  4AQI A;  1KFX S;  3JTD B;  2BL0 B;  4OZD A;  3F45 A;  1QAT A;  1JC2 A;  3DF0 B;  4INW A;  1A4P A;  1F70 A;  1QLK A;  2I2R E;  3BUX B;  5KTY A;  3CR4 X;  2L5X B;  2AAO A;  3SIB A;  1DEL A;  2PYQ A;  3CS1 A;  3KO0 A;  3BJH A;  1JFK A;  2KAY A;  3HX4 A;  1YUT A;  3LK0 A;  2K7C A;  1NPQ A;  4PHK A;  3B88 A;  3BXK A;  1IJ5 A;  1MXE A;  4ZCU A;  1RWY A;  2F3Z A;  4NDB A;  1BJF A;  2KLD A;  3BFB A;  2O5G A;  3BUN B;  3S0F A;  1Y1A A;  1C07 A;  1IJ6 A;  2H61 C;  1SKT A;  3OB2 B;  2LCP A;  1ALV A;  3O4X A;  3SJS A;  1FPW A;  1BOC A;  1UHH A;  4WRI A;  4PCW A;  1WRL A;  1S1E A;  1TOP A;  2GTE A;  4XJK B;  4DUQ A;  3EKJ A;  5HYD A;  1W9Z A;  2E30 A;  3VRQ A;  5DKQ A;  1DJW A;  4YBH B;  2CCM A;  2GV5 A;  4HRG A;  2BBN A;  4JQ0 D;  4E68 A;  2KI4 B;  2WOS A;  1CDM A;  2HQ8 A;  1B9A A;  1F54 A;  4I5K A;  1Y0V H;  4ORC B;  3GK2 A;  1XO5 A;  1N2D A;  1Z2C B;  2LVK A;  5CSF A;  1WDC C;  2HQW A;  4DRW A;  5KSZ A;  3CZT X;  1DGU A;  5HL1 A;  1EL4 A;  1SW8 A;  4YGB B;  5I2L A;  3CZ0 A;  4PE7 A;  2FJU B;  3GK1 A;  3I5I B;  2WCJ A;  2M97 A;  2MRD A;  1B7T Z;  1XFU O;  2JZI A;  1OQP A;  3R1O A;  1GM0 A;  1NX0 A;  1S3P A;  1DC1 A;  3EVU A;  1ZUZ A;  3KHE A;  5ER4 X;  2GGZ A;  2MAZ A;  1MHO A;  2NCO A;  2KFG A;  3LL8 B;  1KK8 C;  3BUO B;  2BBM A;  4YRU A;  1OOI X;  3DY9 A;  3SS3 A;  1MUX A;  3NHT A;  1QX2 A;  2WCE A;  1XK4 A;  2L2C A;  3O78 A;  5HKY A;  1TRF A;  1NCZ A;  2AUC A;  1TNQ A;  2LLT A;  5FYX A;  1CB1 A;  4HRE E;  4TNC A;  2JOJ A;  2MLF C;  2ZND A;  1REC A;  5K89 A;  1J7R A;  3MSE B;  1PSR A;  4YI9 A;  2K8M B;  1TNP A;  3S0G A;  4MRY A;  1TIZ A;  2LLU A;  1XFR A;  1CDL A;  4BY5 A;  4CID A;  1B8R A;  1MF8 B;  2JTT A;  2K61 A;  1DJH A;  1JF0 A;  3L4A A;  1DMO A;  1J7O A;  1XFY O;  3JVT B;  3VRN A;  1BLQ A;  1BR1 B;  3B7A A;  1CFF A;  1F4O A;  1YUU A;  1CKK A;  3I5F B;  3AKB A;  3D10 A;  1R2U A;  3D0Y B;  3FWC A;  1B8L A;  1QTX A;  2ERB A;  2M7N A;  3NHI A;  3VRR A;  1AK8 A;  2F2O A;  1OSA A;  3LCP C;  4MZL A;  1Z4H A;  4NQG A;  5CSJ A;  4MSP A;  2AMI A;  4A4B A;  2Q91 A;  2WCM A;  1C3Z A;  2BNX A;  3EVR A;  1A29 A;  2ZRT A;  1OW4 A;  1YX7 A;  3QME A;  2QAC A;  1E8A A;  4KYN A;  2EHB A;  3CTN A;  3H4S E;  5AFP A;  3OGN A;  5IBW A;  1XVJ A;  3BOW A;  3OP0 A;  2KSP A;  1UHI A;  3PJI A;  1K8U A;  3NXA A;  1AUI B;  1KSO A;  4U8D A;  5CSI A;  1QX7 A;  1NIW A;  3AAK A;  3DVJ A;  2BCA A;  1LXF C;  5B8I B;  1XFW O;  2K7D A;  2KBM A;  5AXI A;  3WHU B;  5ER5 A;  1KQM C;  4N1F A;  1F71 A;  1T14 A;  1CDN A;  2IS9 A;  1NSH A;  2COL B;  1QVI Z;  1KWO B;  2PMY A;  1AHR A;  4DCK A;  3DF0 A;  1BR4 B;  3VGO A;  3CYZ A;  1UWO A;  1SK6 D;  4PAL A;  1N0Y A;  3DVK A;  1EG3 A;  1SSE B;  2OS8 C;  1IGV A;  5AEQ A;  5HLO A;  3RZS A;  4MEW A;  1WDC B;  1JBA A;  1XYD A;  3FE8 A;  2L4I A;  2PSR A;  1XA5 A;  3CR2 A;  3CZ1 A;  1Y6W A;  1ZOT B;  2F2P A;  2O60 A;  4F0Z B;  2L5Y A;  2LMV A;  4XYN A;  1OMV A;  1SY9 A;  1XK4 C;  2KPH A;  3VB1 A;  2JT8 A;  1QIV A;  2LM5 A;  1NCY A;  5HKZ A;  2WC5 A;  1TNX A;  1V1G A;  1EJ3 A;  3D76 A;  1K2H A;  4XJK A;  3SG6 A;  1XFZ O;  2LUC A;  4IJ7 A;  1QV1 A;  1L7Z A;  1BU3 A;  2JXL A;  2JPT A;  4MN0 A;  2EGD A;  1SL9 A;  1SCV A;  3VRP A;  5KU1 A;  3WHT B;  2KI6 C;  1C7V A;  2WCF A;  1NX3 A;  3NSI A;  1PVA A;  1JSA A;  3O4Y A;  1DJG A;  3S0D A;  2WCB A;  2ZN8 A;  2H2K A;  2ZKM X;  5CPV A;  3PM2 A;  1TWO A;  2NCP A;  3SG2 A;  3S0E A;  2KBI A;  2MA2 A;  1ZFS A;  3NSL A;  1S6J A;  2QDI A;  1A75 A;  1LKJ A;  2KYC A;  2PAL A;  1S6C A;  3A4U B;  3B6X A;  1QS7 A;  2LVI A;  1MWN A;  2LUX A;  2OTG B;  5CSN A;  3BUM B;  2JUL A;  4FQT A;  1SCM B;  1KFU S;  1SL7 A;  2Q4U A;  3DVM A;  3FE9 A;  3N7H A;  1S26 D;  3PN7 C;  1UHN A;  4OKH A;  5HKW A;  2MJW B;  3BUW B;  3TZ1 A;  1QWV A;  4F7F A;  1MQ1 A;  3LK1 A;  5FI6 A;  1CM1 A;  1NCX A;  2I7A A;  2KDH A;  2P6B B;  5I8N A;  1J7P A;  1BF5 A;  1HQV A;  2LAP A;  2MHH A;  1SBJ A;  4CLN A;  1FBV A;  2V53 A;  2YGU A;  1JF2 A;  4GUK A;  4M2Q A;  4ORB B;  4JPZ B;  3SG4 A;  2JPO A;  2QEV A;  5DKR A;  1SPY A;  3DVE A;  3TUY C;  1RK9 A;  4MLW A;  4IL1 A;  1Q80 A;  5D3O A;  2WCH A;  3EK7 A;  1KFX L;  2L4H A;  1YUR A;  3L4L A;  1EXR A;  1M31 A;  2FOT A;  3B86 A;  3R1P A;  1OE9 B;  4AQJ A;  1QX5 B;  2L51 A;  4N5X A;  2L0P A;  3EG5 B;  3Q8I A;  2BL0 C;  2NZ0 A;  1N65 A;  2F3Y A;  1J1E A;  3D0Y A;  3FE6 A;  4OVN F;  1CMF A;  1C7W A;  1UHJ A;  1J7Q A;  1YUS A;  2LVV A;  3IQO A;  3LLE A;  1F4Q A;  4I5J A;  2Y1M A;  4FQO A;  2EC6 B;  1TN4 A;  3TS5 B;  1LVC D;  2WC6 A;  2CXJ A;  1TNW A;  2KHN A;  2WC8 A;  1CFC A;  2WND A;  4I5L B;  1YVL A;  1K96 A;  3BYA A;  2ZFD A;  5JJG A;  1NYA A;  1QAS A;  2LC5 A;  4MZJ A;  1CFP A;  2KLE A;  1G4Y R;  3D74 A;  3DD4 A;  4UPG A;  4MRX A;  1ZMZ A;  2RGI A;  1PSB A;  5I2Q A;  1IH0 A;  3OHM B;  2PAS A;  2LMT A;  1BT6 A;  3D77 A;  1SYM A;  1OZO A;  4PT1 A;  2M3W A;  4D1E A;  3AKA A;  2M0R A;  1KCY A;  1YR5 A;  2KI4 C;  4PHN A;  1AJ5 A;  1QIW A;  2JWW A;  2FJY A;  2H61 A;  1FI5 A;  1UUR A;  4YI8 A;  4QJ5 B;  3DZT A;  1NP8 A;  3FS7 A;  4CFR A;  2M8U A;  4YGE B;  1GGZ A;  1WRK A;  2SCP A;  1QXP A;  1B47 A;  4C0K A;  5GQQ C;  2KOT A;  2OPO A;  3RM1 A;  3OB1 B;  1SR6 C;  1WY9 A;  1QJT A;  3I5I C;  3SG7 A;  1X02 A;  2FCD A;  1CLB A;  1IRJ A;  2PQL A;  3EK4 A;  2M29 A;  1ODB A;  4INX A;  2M49 B;  1B4C A;  3I5H C;  3OX6 A;  1H8B A;  2CNP A;  1MXL C;  1P28 A;  1OMD A;  4MVF A;  4YGA A;  1WRZ A;  1V1F A;  2K60 A;  1F55 A;  3VRO A;  1YX8 A;  2HPS A;  1JUO A;  3R1V A;  2R2I A;  2BKH B;  2KQY A;  4GGF A;  3S0B A;  5I2O A;  1DF0 B;  1NUB A;  3I5G C;  1ZAC A;  1SRA A;  2A4J A;  2CTN A;  5TNC A;  1DJY A;  3CLN A;  4BY4 A;  1JWD A;  3UO9 A;  1D1O A;  1MR8 A;  3O2P A;  4JWQ A;  4GNK B;  1K90 D;  1PVB A;  3K21 A;  5G08 A;  3PFV A;  2I18 A;  4WQ3 A;  1IQ3 A;  2B1U A;  4M2P A;  2ZNE A;  4PE4 A;  3NGV A;  3S0A A;  4N1G A;  2NLN A;  3TDI A;  2BEC A;  5I94 A;  3CR5 X;  4YGD B;  1FF1 A;  1W7J B;  3R72 A;  1NX2 A;  5D69 A;  4GBA A;  3BQ3 A;  1L2O C;  4QJ3 B;  1KSM A;  1FW4 A;  1DT7 B;  2SAS A;  3I5F C;  2I94 A;  1KK8 B;  1PAL A;  1TTX A;  4AOM A;  3PAL A;  4CPV A;  2MLE C;  2JXC A;  3PSR A;  3ZNI A;  3ZWH A;  1ORG A;  3E3R A;  4DIR A;  3FWB A;  2JC2 A;  1DJX A;  1LS8 A;  2L50 A;  5BPJ A;  1XFV O;  1Y1X A;  2FCE A;  1K9U A;  1U5I B;  2DOQ A;  1DQE A;  2PVB A;  1LA0 A;  2LHL A;  1M39 A;  5J3X A;  4C0L A;  1CTR A;  2CT9 A;  1HT9 A;  1YRU B;  1G8I A;  2ISD A;  2ZRS A;  2LP2 A;  2KYF A;  2Y1N A;  2ZN9 A;  4L9M A;  1BOD A;  3BFH A;  1J1D A;  1CLL A;  1RTP 1;  2JRF A;  2WCK A;  3NSO A;  2M1U A;  1OOJ A;  1LIN A;  2LAN A;  2LHI A;  1AJ4 A;  5FI2 A;  1M45 A;  2CBL A;  2E6W A;  4OR9 B;  1F8H A;  3D73 A;  2KAX A;  3O6B A;  1UUS A;  1SL8 A;  1SMG A;  1YRT B;  2WCL A;  4JKT A;  1R6P A;  1TUJ A;  4PE1 A;  1KWO C;  4GFT A;  1PUL A;  4OV2 A;  2MBX A;  3SS5 A;  1CLM A;  3V2L A;  1DGV A;  1GGW A;  2K2F A;  4OCI A;  3KEV A;  3IF7 A;  1XFX O;  2G2B A;  4GAO A;  2H8V A;  4NDD A;  1FI6 A;  2JTZ A;  1A03 A;  1VRK A;  4C0J A;  2K2A A;  1OMR A;  4FTG A;  3PM8 A;  1IQ5 A;  4PE0 A;  2JT0 A;  2LLS A;  2PRU A;  1DVI A;  1WLM A;  4USL A;  1RRO A;  4R1E A;  2BCX A;  2D8N A;  2M9G A;  2WOR A;  1CNP A;  3OBV A;  3EVV A;  1GQM A;  1OOH A;  1SR6 B;  3B87 A;  2LNK A;  2JNF A;  1A75 B;  3JTD C;  1SNL A;  2NXQ A;  2K7O A;  1UHK A;  4I5N B;  4GGF C;  4CFQ A;  1QLS A;  1S36 A;  2JT3 A;  3UNW A;  4QJ4 B;  1M63 B;  4ETO A;  2LP3 A;  2P70 A;  1KQM B;  1K9P A;  4PDZ A;  2JNX A;  1BMO A;  3DYE A;  3I5H B;  1EG4 A;  1AVS A;  1OOG A;  4GPL B;  3SS4 A;  5AER A;  2P71 A;  1S5G Z;  3CGA A;  1B7T Y;  4JD9 A;  5DKN A;  1DTL A;  2QEH A;  4Q04 A;  2HET A;  4M2O A;  3I5G B;  1RFJ A;  5D7F A;  4HRH A;  1KK7 Z;  1K9K A;  2LE9 B;  3QRX A;  3EK8 A;  4HSZ A;  1G33 A;  2OS8 B;  3L47 A;  4PHM A;  1S5G Y;  2BKI B;  1GJY A;  2QPT A;  1B8C A;  2K0J A;  2G9B A;  3PAT A;  3TDU A;  1AP4 A;  1RJV A;  1J55 A;  2TN4 A;  1YTZ C;  5HLV A;  1K95 A;  4YGC B;  1KFU L;  1K93 D;  1PK0 D;  5EL2 A;  2M7L A;  2BE4 A;  2Y5I A;  4ZCV A;  1KK7 Y;  2OTG C;  3DXL A;  3TDZ A;  3IVT A;  2HF5 A;  2F8P A;  3K1E A;  4A4C A;  1SCM C;  1EH2 A; 
#chains in the Genus database with same CATH homology
 2KI6 D;  1L2O B;  3SIA A;  5JOL A;  1UP5 A;  1ALW A;  3NSK A;  2KFF A;  2L2E A;  3FIA A;  1DF0 A;  4GGN A;  1IKU A;  2KAV A;  1DJI A;  2KNE A;  3PLF B;  2F33 A;  1CM4 A;  1BG1 A;  3EKH A;  1K94 A;  3WXA A;  1W7I B;  4NDC A;  1H4B A;  1OZS A;  1KQV A;  3SG3 A;  2KGR A;  2VRG A;  3M0W A;  2L98 A;  2Y4Q A;  1LA3 A;  1TCF A;  2GGM A;  3GOF A;  3A8R A;  2LVJ A;  1S6I A;  3C1V A;  1CMG A;  2LV7 A;  1NX1 A;  4ORA B;  3PN7 B;  2BE6 A;  4DS7 A;  3RLZ A;  2JU0 A;  3CWG A;  3KPX A;  5F6T A;  4WQ2 A;  1JFJ A;  1PRW A;  2EC6 C;  4MBE A;  3TS5 C;  4MZK A;  3IQQ A;  3KF9 A;  3SG5 A;  1IWQ A;  1YVH A;  3WNX B;  3BOW B;  1B1G A;  3HCM A;  1U5I A;  3JVT C;  2KQ6 A;  1QV0 A;  1Y1U A;  2JQ6 A;  4ICB A;  4PHJ A;  3TUY B;  1DJZ A;  2K7B A;  2M1K B;  1TCO B;  4P2Y B;  5PAL A;  1CFD A;  1CDP A;  1M46 A;  1NWD A;  2BCB A;  4P5O E;  3OX5 A;  1IG5 A;  1QVI Y;  1WLZ A;  2LMU A;  2KFH A;  2KGB C;  3GK4 X;  1A2X A;  3ICB A;  5AAN A;  3AAJ A;  4AQI A;  1KFX S;  3JTD B;  2BL0 B;  3F45 A;  1QAT A;  1JC2 A;  3DF0 B;  1F70 A;  1A4P A;  1QLK A;  2I2R E;  3BUX B;  5KTY A;  3CR4 X;  2L5X B;  2AAO A;  3SIB A;  3CS1 A;  3KO0 A;  1JFK A;  2KAY A;  3HX4 A;  1YUT A;  3LK0 A;  2K7C A;  1NPQ A;  4PHK A;  3BXK A;  1IJ5 A;  1MXE A;  4ZCU A;  1RWY A;  2F3Z A;  4NDB A;  1BJF A;  3BUN B;  2O5G A;  1C07 A;  1Y1A A;  1IJ6 A;  2H61 C;  1SKT A;  3OB2 B;  2LCP A;  1ALV A;  3SJS A;  1FPW A;  1BOC A;  1UHH A;  4WRI A;  4PCW A;  1WRL A;  1S1E A;  1TOP A;  4XJK B;  4DUQ A;  3EKJ A;  5HYD A;  2E30 A;  3VRQ A;  5DKQ A;  1DJW A;  2CCM A;  2GV5 A;  4HRG A;  2BBN A;  4JQ0 D;  4E68 A;  2KI4 B;  2WOS A;  1CDM A;  2HQ8 A;  1B9A A;  1F54 A;  4I5K A;  1Y0V H;  4ORC B;  3GK2 A;  1XO5 A;  1N2D A;  2LVK A;  5CSF A;  1WDC C;  2HQW A;  4DRW A;  5KSZ A;  3CZT X;  1DGU A;  1EL4 A;  1SW8 A;  4YGB B;  5I2L A;  4PE7 A;  2FJU B;  3GK1 A;  3I5I B;  2M97 A;  2MRD A;  1B7T Z;  1XFU O;  2JZI A;  1OQP A;  1NX0 A;  1S3P A;  3EVU A;  1ZUZ A;  3KHE A;  5ER4 X;  2GGZ A;  2MAZ A;  1MHO A;  2NCO A;  2KFG A;  3LL8 B;  1KK8 C;  3BUO B;  2BBM A;  4YRU A;  1MUX A;  1QX2 A;  2WCE A;  1XK4 A;  3O78 A;  5HKY A;  1TRF A;  1NCZ A;  2AUC A;  1TNQ A;  2LLT A;  5FYX A;  1CB1 A;  4HRE E;  4TNC A;  2JOJ A;  2MLF C;  2ZND A;  1REC A;  5K89 A;  1J7R A;  3MSE B;  1PSR A;  4YI9 A;  2K8M B;  1TNP A;  4MRY A;  1TIZ A;  2LLU A;  1CDL A;  4BY5 A;  4CID A;  1B8R A;  1MF8 B;  2JTT A;  2K61 A;  1DJH A;  1JF0 A;  1DMO A;  1J7O A;  1XFY O;  3JVT B;  3VRN A;  1BLQ A;  1BR1 B;  1CFF A;  1F4O A;  1YUU A;  1CKK A;  3I5F B;  3AKB A;  3D10 A;  1R2U A;  3D0Y B;  3FWC A;  1B8L A;  1QTX A;  3VRR A;  2M7N A;  1AK8 A;  2F2O A;  1OSA A;  3LCP C;  4MZL A;  4NQG A;  5CSJ A;  4MSP A;  2AMI A;  4A4B A;  2Q91 A;  3EVR A;  1A29 A;  2ZRT A;  1YX7 A;  2QAC A;  1E8A A;  2EHB A;  3CTN A;  3H4S E;  5AFP A;  5IBW A;  1XVJ A;  3BOW A;  3OP0 A;  2KSP A;  1UHI A;  1K8U A;  3NXA A;  1AUI B;  1KSO A;  4U8D A;  5CSI A;  1QX7 A;  1NIW A;  3AAK A;  3DVJ A;  2BCA A;  1LXF C;  5B8I B;  1XFW O;  2K7D A;  2KBM A;  5AXI A;  3WHU B;  5ER5 A;  1KQM C;  4N1F A;  1F71 A;  1CDN A;  2IS9 A;  2COL B;  1NSH A;  1QVI Z;  1KWO B;  2PMY A;  1AHR A;  4DCK A;  3DF0 A;  1BR4 B;  3VGO A;  1UWO A;  1SK6 D;  4PAL A;  1N0Y A;  3DVK A;  1EG3 A;  2OS8 C;  1IGV A;  5AEQ A;  5HLO A;  1JBA A;  4MEW A;  1WDC B;  1XYD A;  2L4I A;  2PSR A;  1XA5 A;  3CR2 A;  1Y6W A;  1ZOT B;  2F2P A;  2O60 A;  4F0Z B;  2LMV A;  4XYN A;  1OMV A;  1SY9 A;  1XK4 C;  2JT8 A;  1QIV A;  2LM5 A;  1NCY A;  5HKZ A;  1TNX A;  1V1G A;  1EJ3 A;  1K2H A;  4XJK A;  3SG6 A;  1XFZ O;  2LUC A;  1QV1 A;  1L7Z A;  1BU3 A;  2JXL A;  2JPT A;  4MN0 A;  2EGD A;  1SL9 A;  1SCV A;  3VRP A;  5KU1 A;  3WHT B;  2KI6 C;  1C7V A;  2WCF A;  1NX3 A;  3NSI A;  1PVA A;  1JSA A;  3O4Y A;  1DJG A;  2WCB A;  2ZN8 A;  2H2K A;  2ZKM X;  5CPV A;  2NCP A;  3SG2 A;  2KBI A;  2MA2 A;  1ZFS A;  3NSL A;  1S6J A;  1A75 A;  1LKJ A;  2KYC A;  2PAL A;  1S6C A;  3A4U B;  1QS7 A;  2LVI A;  1MWN A;  2LUX A;  2OTG B;  5CSN A;  3BUM B;  2JUL A;  1SCM B;  1KFU S;  1SL7 A;  2Q4U A;  3DVM A;  1S26 D;  3PN7 C;  1UHN A;  4OKH A;  5HKW A;  2MJW B;  3BUW B;  3TZ1 A;  1MQ1 A;  3LK1 A;  1CM1 A;  1NCX A;  2I7A A;  2KDH A;  2P6B B;  5I8N A;  1J7P A;  1BF5 A;  1HQV A;  2LAP A;  2MHH A;  1SBJ A;  4CLN A;  1FBV A;  2V53 A;  4GUK A;  1JF2 A;  4M2Q A;  4ORB B;  4JPZ B;  3SG4 A;  5DKR A;  3TUY C;  1SPY A;  3DVE A;  1RK9 A;  4MLW A;  4IL1 A;  1Q80 A;  3EK7 A;  4YBH B;  1KFX L;  2L4H A;  1YUR A;  1EXR A;  1M31 A;  2FOT A;  1OE9 B;  4AQJ A;  1QX5 B;  2L51 A;  4N5X A;  2L0P A;  2BL0 C;  2NZ0 A;  1N65 A;  2F3Y A;  1J1E A;  3D0Y A;  4OVN F;  1CMF A;  1C7W A;  1UHJ A;  1J7Q A;  1YUS A;  2LVV A;  3IQO A;  3LLE A;  1F4Q A;  4I5J A;  2Y1M A;  4FQO A;  2EC6 B;  1TN4 A;  3TS5 B;  1LVC D;  2CXJ A;  1TNW A;  2KHN A;  2WC8 A;  1CFC A;  2WND A;  4I5L B;  1YVL A;  1K96 A;  3BYA A;  2ZFD A;  5JJG A;  1NYA A;  1QAS A;  2LC5 A;  4MZJ A;  1CFP A;  1G4Y R;  3DD4 A;  4UPG A;  4MRX A;  1ZMZ A;  2RGI A;  1PSB A;  5I2Q A;  1IH0 A;  3OHM B;  2PAS A;  2LMT A;  1BT6 A;  1SYM A;  1OZO A;  2M3W A;  4D1E A;  3AKA A;  2M0R A;  1KCY A;  1YR5 A;  2KI4 C;  4PHN A;  1AJ5 A;  1QIW A;  2JWW A;  2H61 A;  1FI5 A;  1UUR A;  4YI8 A;  4QJ5 B;  3FS7 A;  1NP8 A;  4CFR A;  2M8U A;  4YGE B;  1GGZ A;  1WRK A;  2SCP A;  1QXP A;  1B47 A;  4C0K A;  5GQQ C;  2KOT A;  2OPO A;  3RM1 A;  3OB1 B;  1SR6 C;  1WY9 A;  1QJT A;  3I5I C;  3SG7 A;  1X02 A;  2FCD A;  1CLB A;  1IRJ A;  3EK4 A;  2M29 A;  1ODB A;  1B4C A;  2M49 B;  3I5H C;  3OX6 A;  1H8B A;  2CNP A;  1MXL C;  1OMD A;  4MVF A;  4YGA A;  1WRZ A;  1V1F A;  1F55 A;  3VRO A;  1YX8 A;  2HPS A;  1JUO A;  2R2I A;  2BKH B;  2KQY A;  4GGF A;  5I2O A;  1DF0 B;  1NUB A;  3I5G C;  1ZAC A;  1SRA A;  2A4J A;  2CTN A;  5TNC A;  1DJY A;  3CLN A;  4BY4 A;  1JWD A;  1D1O A;  1MR8 A;  3O2P A;  4JWQ A;  4GNK B;  1K90 D;  1PVB A;  3K21 A;  5G08 A;  3PFV A;  2I18 A;  4WQ3 A;  1IQ3 A;  2B1U A;  4M2P A;  2ZNE A;  4PE4 A;  4N1G A;  2NLN A;  3TDI A;  2BEC A;  3CR5 X;  4YGD B;  1FF1 A;  1W7J B;  1NX2 A;  5D69 A;  4GBA A;  3BQ3 A;  1L2O C;  4QJ3 B;  1KSM A;  1FW4 A;  1DT7 B;  2SAS A;  3I5F C;  2I94 A;  1KK8 B;  1PAL A;  1TTX A;  4AOM A;  3PAL A;  4CPV A;  2MLE C;  2JXC A;  3PSR A;  3ZNI A;  3ZWH A;  3E3R A;  4DIR A;  3FWB A;  2JC2 A;  1DJX A;  2L50 A;  5BPJ A;  1XFV O;  1Y1X A;  2FCE A;  1K9U A;  1U5I B;  2DOQ A;  2PVB A;  1LA0 A;  2LHL A;  1M39 A;  5J3X A;  4C0L A;  1CTR A;  2CT9 A;  1HT9 A;  1YRU B;  1G8I A;  2ISD A;  2ZRS A;  2LP2 A;  2KYF A;  2Y1N A;  2ZN9 A;  4L9M A;  1BOD A;  1J1D A;  1CLL A;  1RTP 1;  2JRF A;  3NSO A;  2M1U A;  1OOJ A;  1LIN A;  2LAN A;  2LHI A;  1AJ4 A;  1M45 A;  2CBL A;  2E6W A;  4OR9 B;  1F8H A;  2KAX A;  3O6B A;  1UUS A;  1SL8 A;  1SMG A;  1YRT B;  1R6P A;  4PE1 A;  1KWO C;  4GFT A;  1PUL A;  4OV2 A;  2MBX A;  1CLM A;  1DGV A;  1GGW A;  2K2F A;  4OCI A;  3KEV A;  3IF7 A;  1XFX O;  2G2B A;  4GAO A;  1FI6 A;  4NDD A;  2JTZ A;  1A03 A;  1VRK A;  4C0J A;  2K2A A;  1OMR A;  4FTG A;  3PM8 A;  1IQ5 A;  4PE0 A;  2JT0 A;  2LLS A;  2PRU A;  1DVI A;  1WLM A;  4USL A;  1RRO A;  4R1E A;  2BCX A;  2D8N A;  2M9G A;  2WOR A;  1CNP A;  3EVV A;  1GQM A;  1SR6 B;  2LNK A;  2JNF A;  1A75 B;  3JTD C;  1SNL A;  2NXQ A;  2K7O A;  1UHK A;  4I5N B;  4GGF C;  4CFQ A;  1QLS A;  1S36 A;  2JT3 A;  4QJ4 B;  1M63 B;  4ETO A;  2LP3 A;  1KQM B;  1K9P A;  4PDZ A;  2JNX A;  1BMO A;  3I5H B;  1EG4 A;  1AVS A;  4GPL B;  5AER A;  1S5G Z;  3CGA A;  1B7T Y;  1DTL A;  4Q04 A;  2HET A;  4M2O A;  3I5G B;  1RFJ A;  5D7F A;  4HRH A;  1KK7 Z;  1K9K A;  2LE9 B;  3QRX A;  3EK8 A;  4HSZ A;  1G33 A;  2OS8 B;  4PHM A;  1S5G Y;  2BKI B;  1GJY A;  2QPT A;  1B8C A;  2K0J A;  2G9B A;  3PAT A;  3TDU A;  1AP4 A;  1RJV A;  1J55 A;  2TN4 A;  1YTZ C;  5HLV A;  1K95 A;  4YGC B;  1KFU L;  1K93 D;  1PK0 D;  2M7L A;  2BE4 A;  2Y5I A;  4ZCV A;  1KK7 Y;  2OTG C;  3TDZ A;  5DKN A;  2HF5 A;  2F8P A;  4A4C A;  1SCM C;  1EH2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...