5PALA

Crystal structure of the unique parvalbumin component from muscle of the leopard shark (triakis semifasciata). the first x-ray study of an alpha-parvalbumin
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
109
structure length
109
Chain Sequence
b'PMTKVLKADDINKAISAFKDPGTFDYKRFFHLVGLKGKTDAQVKEVFEILDKDQSGFIEEEELKGVLKGFSAHGRDLNDTETKALLAAGDSDHDGKIGADEFAKMVAQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PARVALBUMIN
publication title Crystal structure of the unique parvalbumin component from muscle of the leopard shark (Triakis semifasciata). The first X-ray study of an alpha-parvalbumin.
pubmed doi rcsb
source organism Triakis semifasciata
molecule tags Calcium-binding protein
total genus 40
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 1991-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5palA00
3I5IB 2L4IA 4ORCB 2F3YA 1OSAA 4GPLB 2H2KA 1MWNA 4D1EA 1K2HA 1S6IA 1UWOA 2O60A 3JVTC 2MBXA 1QX7A 2LMTA 2I2RE 4I5LB 3EVRA 1K94A 3KHEA 3BUNB 4P5OE 5CSIA 1F8HA 2LMVA 2LC5A 4NDDA 3JTDC 4M2PA 1J1DA 1DTLA 3PN7C 3OHMB 1SCVA 3I5GC 5KTYA 1EXRA 4TNCA 2M29A 2BKHB 1KK8B 1SL8A 2CTNA 4QJ3B 1DJYA 2LP3A 1JSAA 2M9GA 1JWDA 2K7OA 1B8LA 2F8PA 1QIVA 2KI4B 3EVVA 1CLMA 1N0YA 5D7FA 2JNFA 4N1FA 4PDZA 2K8MB 2G2BA 1E8AA 1EG3A 1KSOA 4CLNA 5I8NA 1WY9A 1B1GA 1XYDA 3EKHA 2KYFA 2M49B 1SNLA 1DT7B 1TNPA 3GK2A 5TNCA 1ZFSA 2MRDA 3EKJA 2KAXA 1LVCD 1IRJA 1JF2A 3O78A 3SG4A 4DCKA 1DGVA 2KQ6A 2M3WA 2CNPA 4PE0A 2KBMA 1TIZA 1GQMA 4ORAB 1M39A 2D8NA 4QJ5B 5DKQA 1S3PA 1BG1A 4M2OA 2M0RA 1EH2A 1F54A 1M46A 1ALWA 5HLVA 1J55A 2B1UA 3ZNIA 1R6PA 3CR5X 5AFPA 1V1GA 2L50A 1U5IB 1IQ3A 1DJGA 1UURA 2JNXA 1XK4C 2OS8B 1CNPA 5HKYA 1AP4A 3M0WA 3VRPA 1IJ6A 1J7PA 5HLOA 1TNQA 1QS7A 1XFWO 1Y0VH 3RLZA 1CFDA 1ALVA 1N65A 2BL0C 4XJKB 1QXPA 4GAOA 1DJWA 5DKRA 1KK8C 2E6WA 3H4SE 4DIRA 1TTXA 3C1VA 4AQJA 3AAKA 1QLSA 1K9KA 3VROA 1RROA 1OQPA 1G8IA 1A2XA 2FOTA 2ZRTA 1A29A 2KI4C 3O2PA 4IL1A 3VRNA 2JT3A 2LVKA 1S5GY 1B8RA 4MRXA 1GGWA 1YVHA 2MA2A 1LXFC 1M45A 1WLZA 1KFXL 5JOLA 1JF0A 4PE4A 4ORBB 2Y1NA 3MSEB 3E3RA 4GGFA 4MZKA 1YUTA 3JTDB 1CB1A 2LV7A 2WORA 3BYAA 1V1FA 1SL7A 3AKBA 3I5GB 1W7JB 3OP0A 1QASA 1OMVA 2LLSA 2JT0A 2K2AA 2KAYA 2JQ6A 2KSPA 2TN4A 1H8BA 1SK6D 1H4BA 3DD4A 3OX5A 1SW8A 1RJVA 1K95A 2LHLA 3LK1A 2JWWA 2GV5A 1MUXA 1PVBA 1CM1A 1WRKA 1M63B 1UHKA 1UP5A 2ZNEA 3AKAA 1BMOA 4GGNA 1TNXA 1A03A 1BR1B 1YX7A 1C7VA 1K96A 1W7IB 3F45A 4JWQA 5AXIA 2HQWA 4NQGA 1KSMA 3SG6A 2AAOA 1AJ4A 3GK1A 4L9MA 3LLEA 4C0JA 2F2OA 2LNKA 1C07A 1JBAA 1TOPA 3TDZA 2MHHA 2JU0A 4MLWA 1JFJA 1L2OC 2OTGC 2G9BA 2L98A 3DF0A 1BOCA 4YGDB 4YGCB 1F4OA 4A4BA 2A4JA 2K7CA 1F70A 1XFYO 1KQMB 3WXAA 1PSRA 1LA3A 1SCMB 1CDPA 3O6BA 4M2QA 2KI6D 1SMGA 2M97A 2M1KB 1XFZO 1Y1AA 2EGDA 1S5GZ 2KGBC 4BY4A 1RECA 1KFUL 1BJFA 1MHOA 2Y5IA 2NCPA 1NX2A 1BT6A 3A4UB 2LUCA 2LM5A 1QTXA 4PALA 2BL0B 3VRRA 2ZN8A 1BR4B 1A4PA 4HRGA 2ISDA 1SKTA 4C0KA 1F55A 3TZ1A 3GOFA 4AQIA 2BE4A 1S1EA 2K0JA 4OV2A 4XYNA 3OB2B 1SPYA 3LL8B 3D0YA 4MSPA 2ZKMX 1DMOA 1NPQA 3BQ3A 2WNDA 1QIWA 2K61A 3KPXA 2BECA 2H61C 3BXKA 4CPVA 1TNWA 1OZOA 4PHJA 2KDHA 1FBVA 1AVSA 3PLFB 4PHNA 4OR9B 1FI6A 1IH0A 4YRUA 2AUCA 1JUOA 4YGAA 3CWGA 5I2QA 2PVBA 1HQVA 3D10A 3EK4A 4PCWA 5I2OA 1CDLA 3CS1A 1NCYA 2SASA 2JC2A 4U8DA 1XFXO 1A75A 4MZLA 3SG7A 1RTP1 1WRLA 1KQMC 3DVJA 4E68A 1PVAA 1QV1A 1SCMC 2HQ8A 4JPZB 1CKKA 2GGZA 5DKNA 1ODBA 1N2DA 3TDUA 4DS7A 1LKJA 3PFVA 1MF8B 2BBNA 2EHBA 3VRQA 4AOMA 5CPVA 1B7TY 5J3XA 3EK8A 3SG5A 3RM1A 2KNEA 1K90D 1GGZA 2LVIA 1SRAA 1IKUA 2R2IA 4N1GA 1QV0A 2FCDA 1CTRA 1S36A 2LUXA 2PRUA 2Q4UA 2OPOA 4HREE 1L2OB 2I18A 2OTGB 2WCEA 1SL9A 4MEWA 1PALA 4DRWA 2JOJA 4PE1A 1Y1XA 1CDNA 2L0PA 2FJUB 3BOWB 4I5NB 5G08A 4OVNF 4YI8A 1CLBA 3DVEA 3BUWB 2CBLA 4WQ2A 1UHNA 1JC2A 2DOQA 3NSOA 1QLKA 4MVFA 1KWOB 1M31A 2K2FA 1L7ZA 4YI9A 2JZIA 2RGIA 1PRWA 2AMIA 2PALA 1XFVO 2I94A 1BLQA 4F0ZB 4CFQA 1FPWA 4WRIA 1QJTA 2HF5A 1B9AA 1YRTB 1BODA 1ZACA 5I2LA 2K7DA 4MRYA 1NIWA 2ZRSA 5KU1A 3NSKA 2M1UA 4I5KA 1DF0A 1S6CA 3LCPC 5BPJA 2NCOA 2L2EA 3BUXB 3IF7A 3SIBA 2VRGA 2LCPA 1AHRA 5K89A 2FCEA 1G4YR 1GJYA 1F71A 3SJSA 2HPSA 1LINA 4JQ0D 4YGEB 1NSHA 3CR2A 1SY9A 4MN0A 5KSZA 2KAVA 3PATA 4NDBA 2Q91A 1YURA 2JRFA 2KHNA 1RK9A 2QACA 3FWBA 1ZOTB 5CSNA 1B7TZ 3KF9A 1NP8A 1YVLA 3AAJA 3FS7A 2LLTA 4ICBA 2F2PA 1EJ3A 2L51A 5JJGA 3IQQA 1UHHA 1CMGA 1RFJA 4USLA 1RWYA 2JPTA 5ER4X 3VGOA 2BCBA 2LHIA 4A4CA 1VRKA 2WC8A 2CXJA 1KWOC 2CT9A 3CTNA 1WDCB 1G33A 3DF0B 1DVIA 1EL4A 1XO5A 3PM8A 3FWCA 3NXAA 1D1OA 1OOJA 1Y1UA 1CFCA 2LVJA 2IS9A 1TCFA 2PSRA 5HKWA 4CIDA 3I5FC 1YRUB 1YX8A 4QJ4B 1B8CA 1Q80A 4GGFC 1SR6B 2KFGA 3TUYC 1WLMA 1ZUZA 4NDCA 1QX2A 1X02A 3HCMA 5IBWA 2JXLA 2M7LA 1NYAA 2WCFA 1F4QA 1DGUA 1QVIZ 1WRZA 2I7AA 5CSJA 2BKIB 4BY5A 1NX1A 1J1EA 1KK7Z 5CSFA 1MXLC 1SYMA 3I5HC 2L4HA 4WQ3A 1K93D 2JULA 4Q04A 2EC6C 1NCZA 3D0YB 1XA5A 2HETA 2BE6A 3SIAA 1R2UA 2PMYA 3QRXA 4P2YB 3BUOB 1UUSA 1OMRA 3PALA 1ZMZA 1UHIA 2KOTA 1CMFA 2ZNDA 2JXCA 2LVVA 1TRFA 1S26D 2PASA 2KFFA 1NCXA 3FIAA 4ZCUA 3A8RA 1OE9B 4PHMA 4UPGA 2WOSA 1DJXA 1WDCC 3OX6A 1BF5A 1A75B 1NX3A 1Y6WA 3TS5C 1AK8A 2MJWB 2NXQA 1C7WA 3KEVA 1YR5A 1U5IA 2Y4QA 1B4CA 4MBEA 2KI6C 2K7BA 1PK0D 3DVKA 2V53A 2M7NA 3KO0A 3CZTX 2KBIA 4HSZA 1XVJA 2M8UA 3I5IC 3O4YA 4MZJA 1K8UA 1S6JA 1SR6C 2KGRA 1KFXS 1MR8A 5AERA 1FF1A 4DUQA 1CDMA 1FW4A 1IG5A 1CFFA 4XJKA 1DJZA 1OZSA 1SBJA 1NWDA 1J7OA 2BCXA 1CM4A 2LE9B 2COLB 1EG4A 1NX0A 4PE7A 1PULA 1K9UA 2F33A 2KQYA 1CLLA 3PSRA 5GQQC 2LAPA 3BOWA 2E30A 2SCPA 4FQOA 5AEQA 2F3ZA 2Y1MA 1AUIB 3NSLA 3SG2A 1KQVA 4GBAA 4YGBB 2LANA 3I5FB 3ZWHA 2NLNA 4YBHB 1IQ5A 1QVIY 2MAZA 3TUYB 5HYDA 2LLUA 3GK4X 5HKZA 5PALA 2WCBA 5D69A 1LA0A 1NUBA 4PHKA 3OB1B 2GGMA 1KK7Y 3SG3A 3JVTB 1AJ5A 5B8IB 1IGVA 4GFTA 2P6BB 1CFPA 2QPTA 1DF0B 2O5GA 1TCOB 2KYCA 1K9PA 3WNXB 3PN7B 4C0LA 3I5HB 2JT8A 1MQ1A 2JTTA 3TDIA 2BCAA 1QX5B 2EC6B 3BUMB 3WHUB 5F6TA 4ZCVA 2ZFDA 4HRHA 1BU3A 1YTZC 1QATA 3K21A 2BBMA 2L5XB 2LP2A 3HX4A 2H61A 1OMDA 2KFHA 1YUSA 1DJHA 3DVMA 4FTGA 1DJIA 4R1EA 1KFUS 3CGAA 1UHJA 1XFUO 1J7RA 2MLFC 2OS8C 4CFRA 4OKHA 1B47A 1HT9A 1PSBA 4OCIA 2ZN9A 3LK0A 4GNKB 1JFKA 5ER5A 2CCMA 4I5JA 2LMUA 1YUUA 1MXEA 3EVUA 5AANA 2NZ0A 4GUKA 3TS5B 1IJ5A 1IWQA 2JTZA 3ICBA 5FYXA 1J7QA 3IQOA 1FI5A 4N5XA 3WHTB 1XK4A 1TN4A 3CR4X 3EK7A 1KCYA 3CLNA 2MLEC 4ETOA 3NSIA
chains in the Genus database with same CATH superfamily
3I5IB 2L4IA 4ORCB 2F3YA 1OSAA 4GPLB 2H2KA 1MWNA 4D1EA 1K2HA 1S6IA 1UWOA 2O60A 3JVTC 2MBXA 3FE9A 1QX7A 2LMTA 2I2RE 3L47A 3EVRA 4I5LB 1K94A 3KHEA 3BUNB 4P5OE 5CSIA 1F8HA 2LMVA 2LC5A 4NDDA 3JTDC 4M2PA 1J1DA 1DTLA 3PN7C 3OHMB 1SCVA 3I5GC 5KTYA 2QEBA 3CABA 1EXRA 4TNCA 2FJYA 2M29A 2BKHB 3BFAA 1KK8B 1SL8A 2CTNA 4QJ3B 1DJYA 2LP3A 1JSAA 2M9GA 3S0DA 1JWDA 1T14A 1B8LA 2K7OA 2F8PA 1QIVA 2KI4B 3EVVA 1CLMA 1N0YA 5D7FA 2JNFA 3FE6A 5EL2A 1IIOA 4N1FA 4PDZA 2K8MB 2G2BA 1E8AA 1EG3A 1KSOA 4CLNA 5I8NA 1WY9A 1B1GA 1XYDA 3EKHA 2KYFA 2M49B 1SNLA 1DT7B 1TNPA 3GK2A 5TNCA 3S0EA 1ZFSA 2MRDA 2WCKA 3EKJA 2KAXA 1LVCD 3NHTA 4PT1A 1IRJA 1JF2A 3O78A 3SG4A 4DCKA 1DGVA 2KQ6A 2M3WA 2CNPA 2QEHA 4PE0A 2KBMA 4KYNA 1TIZA 1GQMA 4IJ7A 3DYEA 4ORAB 1M39A 2D8NA 4QJ5B 5DKQA 1S3PA 1BG1A 3IVTA 3CDNA 4M2OA 4OZDA 2M0RA 2QEOA 1EH2A 1F54A 2K60A 1M46A 1ALWA 5HLVA 1J55A 2B1UA 3ZNIA 1R6PA 3CR5X 5AFPA 1V1GA 2L50A 1U5IB 1IQ3A 1DJGA 1UURA 2JNXA 1XK4C 2OS8B 1CNPA 5HKYA 1AP4A 3M0WA 3VRPA 2P70A 1IJ6A 1J7PA 5HLOA 1TNQA 1QS7A 1XFWO 1Y0VH 3RLZA 1CFDA 1ALVA 5D3OA 1N65A 2BL0C 4XJKB 5DICA 5I94A 1QXPA 4GAOA 1DJWA 5DKRA 1KK8C 2E6WA 3H4SE 4DIRA 1TTXA 3C1VA 4AQJA 3AAKA 1QLSA 1K9KA 3VROA 1RROA 1OQPA 1G8IA 1A2XA 2FOTA 2ZRTA 1A29A 1QWVA 2KI4C 3O2PA 4IL1A 3VRNA 2JT3A 2LVKA 1S5GY 1B8RA 5HL1A 1Z2CB 3OGNA 4MRXA 1GGWA 1YVHA 2MA2A 1LXFC 1M45A 1WLZA 1KFXL 5JOLA 1JF0A 4PE4A 4ORBB 3SS4A 2Y1NA 3MSEB 3E3RA 4GGFA 4MZKA 1YUTA 3JTDB 1CB1A 2LV7A 2WORA 3BYAA 3NHIA 1V1FA 1SL7A 3AKBA 3I5GB 1W7JB 3OP0A 3BJHA 1QASA 1OMVA 2LLSA 2JT0A 2K2AA 2KAYA 2JQ6A 2KSPA 2TN4A 1H8BA 1SK6D 1H4BA 3DD4A 3OX5A 1SW8A 1RJVA 1K95A 2LHLA 3LK1A 2JWWA 2GV5A 1MUXA 1PVBA 1CM1A 1WRKA 1DC1A 2JPOA 1M63B 1UHKA 1UP5A 2ZNEA 3AKAA 1BMOA 1DQEA 3R1OA 4GGNA 1TNXA 1A03A 1BR1B 1YX7A 1C7VA 1K96A 1W7IB 3F45A 4JWQA 5AXIA 2HQWA 4NQGA 1KSMA 3SG6A 2AAOA 1AJ4A 3GK1A 4L9MA 3LLEA 4C0JA 2F2OA 2LNKA 2KLDA 1C07A 1JBAA 1TOPA 3TDZA 2MHHA 2JU0A 4MLWA 1JFJA 1L2OC 3UNWA 2OTGC 2G9BA 2L98A 3DF0A 1BOCA 4YGDB 4YGCB 1F4OA 4A4BA 2A4JA 2K7CA 1F70A 1XFYO 1KQMB 3WXAA 1PSRA 3N7HA 1LA3A 1SCMB 1CDPA 3O6BA 4M2QA 2KI6D 1SMGA 2M97A 2M1KB 1XFZO 1Y1AA 2EGDA 1S5GZ 2KGBC 4BY4A 1RECA 1KFUL 1BJFA 1MHOA 2Y5IA 2NCPA 1NX2A 1BT6A 3A4UB 2LUCA 2P71A 2LM5A 1QTXA 4PALA 2BL0B 3VRRA 1C3ZA 2ZN8A 3R1PA 1BR4B 1A4PA 4HRGA 2ISDA 2WCJA 1SKTA 4C0KA 1F55A 3TZ1A 3GOFA 4AQIA 2BE4A 1S1EA 2K0JA 3FE8A 3DZTA 3R1VA 3OB2B 4OV2A 1SPYA 3LL8B 4XYNA 3R72A 3D0YA 4MSPA 2ZKMX 1DMOA 1NPQA 3BQ3A 2WNDA 1QIWA 2K61A 3KPXA 2BECA 2H61C 3BXKA 4CPVA 1TNWA 1OZOA 1OOFA 4PHJA 2KDHA 1FBVA 1AVSA 3PLFB 4PHNA 4OR9B 1FI6A 3V2LA 1IH0A 1TUZA 4YRUA 2AUCA 1JUOA 4YGAA 3CWGA 5I2QA 2PVBA 1HQVA 3D10A 3EK4A 4PCWA 5I2OA 1CDLA 3CS1A 1NCYA 2SASA 2JC2A 4U8DA 1XFXO 1A75A 4MZLA 3SG7A 1RTP1 1WRLA 1KQMC 3DVJA 4E68A 1PVAA 1QV1A 3S0FA 1SCMC 2HQ8A 3K1EA 4JPZB 2GGZA 5DKNA 1CKKA 3B88A 1C3YA 1ODBA 1LS8A 1N2DA 3TDUA 4DS7A 1LKJA 3PFVA 1MF8B 2BBNA 2EHBA 3S0AA 3VRQA 4AOMA 5CPVA 1B7TY 5J3XA 3EK8A 3SG5A 3RM1A 2KNEA 1K90D 1GGZA 2LVIA 1SRAA 2QDIA 1IKUA 2R2IA 4N1GA 1QV0A 2FCDA 1CTRA 1S36A 2LUXA 2PRUA 2Q4UA 2OPOA 2WCMA 4HREE 1L2OB 2I18A 2OTGB 2WCEA 3S0GA 1SL9A 4MEWA 1PALA 4DRWA 2JOJA 3EG5B 4PE1A 1Y1XA 1CDNA 2L0PA 2FJUB 3BOWB 4I5NB 5G08A 4OVNF 4YI8A 1CLBA 1P28A 3DVEA 3BUWB 2CBLA 3D75A 4WQ2A 1UHNA 1JC2A 2DOQA 3NSOA 1QLKA 2QEVA 1KWOB 1M31A 4MVFA 2K2FA 1L7ZA 4YI9A 2JZIA 2RGIA 3NGVA 1PRWA 2AMIA 2PALA 1XFVO 2I94A 1BLQA 4F0ZB 4CFQA 1FPWA 4WRIA 1QJTA 2HF5A 1B9AA 1YRTB 1BODA 1ZACA 5I2LA 2K7DA 4FQTA 2YGUA 4MRYA 1NIWA 2ZRSA 5KU1A 3NSKA 2M1UA 4I5KA 1DF0A 1S6CA 3LCPC 3OBVA 3B86A 5BPJA 2NCOA 2L2EA 3BUXB 3IF7A 3QMEA 3SIBA 2VRGA 2LCPA 1AHRA 5K89A 3D77A 2FCEA 1G4YR 1GJYA 1F71A 3SJSA 2HPSA 1LINA 4JQ0D 4YGEB 1NSHA 3CR2A 3L4AA 1SY9A 1OOHA 4MN0A 5KSZA 2KAVA 3PATA 4NDBA 4F7FA 2Q91A 3O4XA 1YURA 2KLEA 2JRFA 2KHNA 3BFBA 3D73A 1RK9A 2QACA 3FWBA 1ZOTB 5CSNA 1B7TZ 4INXA 3DY9A 3KF9A 1NP8A 1YVLA 3AAJA 3FS7A 2KPHA 2LLTA 4ICBA 2F2PA 1GM0A 1EJ3A 2PQLA 2L51A 5JJGA 3IQQA 1UHHA 1CMGA 1RFJA 4USLA 3RZSA 1RWYA 2JPTA 5ER4X 3VGOA 2BCBA 2LHIA 1OOGA 4A4CA 1VRKA 2WC8A 2CXJA 1KWOC 2CT9A 3CTNA 1WDCB 1G33A 3DF0B 1DVIA 1EL4A 1XO5A 3PM8A 3FWCA 3NXAA 1D1OA 1OOJA 2PYQA 1Y1UA 1CFCA 2LVJA 3CZ1A 2IS9A 1TCFA 2PSRA 5HKWA 4CIDA 2L5YA 5FI6A 1OW4A 3I5FC 1YRUB 1YX8A 4QJ4B 1B8CA 1Q80A 4GGFC 1SR6B 2KFGA 3TUYC 1WLMA 1ZUZA 4NDCA 1QX2A 1X02A 3HCMA 3VB1A 3UO9A 5IBWA 2JXLA 2M7LA 1NYAA 2WCFA 1F4QA 1DGUA 1QVIZ 1WRZA 2I7AA 5CSJA 2BKIB 4BY5A 1NX1A 1TWOA 1OOIX 1J1EA 1KK7Z 5CSFA 1MXLC 3CYZA 1SYMA 3I5HC 2L4HA 4WQ3A 1K93D 2JULA 4Q04A 2EC6C 1NCZA 3D0YB 1XA5A 2HETA 2BE6A 3SS5A 3B87A 1R2UA 3SIAA 2PMYA 3QRXA 4P2YB 1ORGA 3BFHA 3BUOB 1UUSA 1OMRA 3PALA 1ZMZA 1UHIA 2KOTA 3D76A 1CMFA 2ZNDA 5FI2A 2GTEA 2JXCA 2LVVA 1TRFA 1S26D 2PASA 2KFFA 1NCXA 3FIAA 4ZCUA 3A8RA 3SS3A 1OE9B 4PHMA 4UPGA 3B7AA 5FI7A 2WOSA 1DJXA 1WDCC 3OX6A 1BF5A 3CZ2A 1A75B 1NX3A 2BAPA 1Y6WA 3TS5C 1AK8A 2MJWB 3D74A 2NXQA 1C7WA 3KEVA 1YR5A 1U5IA 2Y4QA 1B4CA 4MBEA 3B6XA 2KI6C 2K7BA 1PK0D 3DVKA 2V53A 2M7NA 3KO0A 3CZTX 2KBIA 3D78A 4HSZA 1XVJA 2M8UA 3I5IC 3O4YA 4MZJA 1K8UA 1S6JA 1SR6C 2KGRA 1KFXS 1MR8A 5AERA 1FF1A 4DUQA 1CDMA 1FW4A 1IG5A 1CFFA 4XJKA 3L4LA 1DJZA 1OZSA 1SBJA 1NWDA 1J7OA 2BCXA 1CM4A 2LE9B 2COLB 1TUJA 1EG4A 1NX0A 4PE7A 3S0BA 1PULA 1K9UA 3PJIA 2F33A 2KQYA 4JD9A 1CLLA 3PSRA 5GQQC 2LAPA 3BOWA 2E30A 2SCPA 2WCHA 4FQOA 5AEQA 2F3ZA 2Y1MA 1AUIB 3NSLA 3SG2A 1KQVA 4GBAA 4YGBB 1XFRA 2LANA 3I5FB 2WC6A 3ZWHA 2NLNA 4YBHB 1IQ5A 1QVIY 2MAZA 3DXLA 3TUYB 5HYDA 2LLUA 3GK4X 5HKZA 5PALA 2WCBA 5D69A 1LA0A 1NUBA 4PHKA 3OB1B 2GGMA 1KK7Y 2L2CA 3JVTB 1AJ5A 3SG3A 2WC5A 1IGVA 5B8IB 1SSEB 4GFTA 2P6BB 1CFPA 2QPTA 3Q8IA 1DF0B 2O5GA 1TCOB 2KYCA 1K9PA 3WNXB 3PN7B 4C0LA 3I5HB 2JT8A 1MQ1A 2JTTA 3TDIA 2BCAA 3CZ0A 1QX5B 2EC6B 3BUMB 3WHUB 5F6TA 4ZCVA 2ZFDA 4HRHA 1BU3A 1Z4HA 1YTZC 1QATA 3K21A 2BBMA 2L5XB 2LP2A 3HX4A 2H61A 1OMDA 2BNXA 2KFHA 1YUSA 1DJHA 3DVMA 4FTGA 1DJIA 4R1EA 1KFUS 3CGAA 1UHJA 1XFUO 1J7RA 2MLFC 2OS8C 4CFRA 4OKHA 1DEKA 1B47A 1HT9A 1PSBA 4INWA 4OCIA 2ZN9A 3LK0A 3PM2A 4GNKB 1JFKA 5ER5A 2CCMA 4I5JA 2ERBA 1DELA 2LMUA 1YUUA 1MXEA 3EVUA 5AANA 2NZ0A 4GUKA 3TS5B 1IJ5A 4JKTA 2WCLA 1IWQA 2JTZA 3ICBA 5FYXA 1J7QA 3IQOA 1FI5A 4N5XA 3WHTB 1XK4A 1TN4A 1W9ZA 3CR4X 3EK7A 1KCYA 2H8VA 2MLEC 3CLNA 4ETOA 3NSIA
chains in the Genus database with same CATH topology
3I5IB 2L4IA 4ORCB 2F3YA 1OSAA 4GPLB 2H2KA 1MWNA 4D1EA 1K2HA 1S6IA 1UWOA 2O60A 3JVTC 2MBXA 1QX7A 2LMTA 2I2RE 4I5LB 3EVRA 1K94A 3KHEA 3BUNB 4P5OE 5CSIA 1F8HA 2LMVA 2LC5A 4NDDA 3JTDC 4M2PA 1J1DA 1DTLA 3PN7C 3OHMB 1SCVA 3I5GC 5KTYA 1EXRA 4TNCA 2M29A 2BKHB 1KK8B 1SL8A 2CTNA 4QJ3B 1DJYA 2LP3A 1JSAA 2M9GA 1JWDA 2K7OA 1B8LA 2F8PA 1QIVA 2KI4B 3EVVA 1CLMA 1N0YA 5D7FA 2JNFA 4N1FA 4PDZA 2K8MB 2G2BA 1E8AA 1EG3A 1KSOA 4CLNA 5I8NA 1WY9A 1B1GA 1XYDA 3EKHA 2KYFA 2M49B 1SNLA 1DT7B 1TNPA 3GK2A 5TNCA 1ZFSA 2MRDA 3EKJA 2KAXA 1LVCD 1IRJA 1JF2A 3O78A 3SG4A 4DCKA 1DGVA 2KQ6A 2M3WA 2CNPA 4PE0A 2KBMA 1TIZA 1GQMA 4ORAB 1M39A 2D8NA 4QJ5B 5DKQA 1S3PA 1BG1A 4M2OA 2M0RA 1EH2A 1F54A 1M46A 1ALWA 5HLVA 1J55A 2B1UA 3ZNIA 1R6PA 3CR5X 5AFPA 1V1GA 2L50A 1U5IB 1IQ3A 1DJGA 1UURA 2JNXA 1XK4C 2OS8B 1CNPA 5HKYA 1AP4A 3M0WA 3VRPA 1IJ6A 1J7PA 5HLOA 1TNQA 1QS7A 1XFWO 1Y0VH 3RLZA 1CFDA 1ALVA 1N65A 2BL0C 4XJKB 1QXPA 4GAOA 1DJWA 5DKRA 1KK8C 2E6WA 3H4SE 4DIRA 1TTXA 3C1VA 4AQJA 3AAKA 1QLSA 1K9KA 3VROA 1RROA 1OQPA 1G8IA 1A2XA 2FOTA 2ZRTA 1A29A 2KI4C 3O2PA 4IL1A 3VRNA 2JT3A 2LVKA 1S5GY 1B8RA 4MRXA 1GGWA 1YVHA 2MA2A 1LXFC 1M45A 1WLZA 1KFXL 5JOLA 1JF0A 4PE4A 4ORBB 2Y1NA 3MSEB 3E3RA 4GGFA 4MZKA 1YUTA 3JTDB 1CB1A 2LV7A 2WORA 3BYAA 1V1FA 1SL7A 3AKBA 3I5GB 1W7JB 3OP0A 1QASA 1OMVA 2LLSA 2JT0A 2K2AA 2KAYA 2JQ6A 2KSPA 2TN4A 1H8BA 1SK6D 1H4BA 3DD4A 3OX5A 1SW8A 1RJVA 1K95A 2LHLA 3LK1A 2JWWA 2GV5A 1MUXA 1PVBA 1CM1A 1WRKA 1M63B 1UHKA 1UP5A 2ZNEA 3AKAA 1BMOA 4GGNA 1TNXA 1A03A 1BR1B 1YX7A 1C7VA 1K96A 1W7IB 3F45A 4JWQA 5AXIA 2HQWA 4NQGA 1KSMA 3SG6A 2AAOA 1AJ4A 3GK1A 4L9MA 3LLEA 4C0JA 2F2OA 2LNKA 1C07A 1JBAA 1TOPA 3TDZA 2MHHA 2JU0A 4MLWA 1JFJA 1L2OC 2OTGC 2G9BA 2L98A 3DF0A 1BOCA 4YGDB 4YGCB 1F4OA 4A4BA 2A4JA 2K7CA 1F70A 1XFYO 1KQMB 3WXAA 1PSRA 1LA3A 1SCMB 1CDPA 3O6BA 4M2QA 2KI6D 1SMGA 2M97A 2M1KB 1XFZO 1Y1AA 2EGDA 1S5GZ 2KGBC 4BY4A 1RECA 1KFUL 1BJFA 1MHOA 2Y5IA 2NCPA 1NX2A 1BT6A 3A4UB 2LUCA 2LM5A 1QTXA 4PALA 2BL0B 3VRRA 2ZN8A 1BR4B 1A4PA 4HRGA 2ISDA 1SKTA 4C0KA 1F55A 3TZ1A 3GOFA 4AQIA 2BE4A 1S1EA 2K0JA 4OV2A 4XYNA 3OB2B 1SPYA 3LL8B 3D0YA 4MSPA 2ZKMX 1DMOA 1NPQA 3BQ3A 2WNDA 1QIWA 2K61A 3KPXA 2BECA 2H61C 3BXKA 4CPVA 1TNWA 1OZOA 4PHJA 2KDHA 1FBVA 1AVSA 3PLFB 4PHNA 4OR9B 1FI6A 1IH0A 4YRUA 2AUCA 1JUOA 4YGAA 3CWGA 5I2QA 2PVBA 1HQVA 3D10A 3EK4A 4PCWA 5I2OA 1CDLA 3CS1A 1NCYA 2SASA 2JC2A 4U8DA 1XFXO 1A75A 4MZLA 3SG7A 1RTP1 1WRLA 1KQMC 3DVJA 4E68A 1PVAA 1QV1A 1SCMC 2HQ8A 4JPZB 1CKKA 2GGZA 5DKNA 1ODBA 1N2DA 3TDUA 4DS7A 1LKJA 3PFVA 1MF8B 2BBNA 2EHBA 3VRQA 4AOMA 5CPVA 1B7TY 5J3XA 3EK8A 3SG5A 3RM1A 2KNEA 1K90D 1GGZA 2LVIA 1SRAA 1IKUA 2R2IA 4N1GA 1QV0A 2FCDA 1CTRA 1S36A 2LUXA 2PRUA 2Q4UA 2OPOA 4HREE 1L2OB 2I18A 2OTGB 2WCEA 1SL9A 4MEWA 1PALA 4DRWA 2JOJA 4PE1A 1Y1XA 1CDNA 2L0PA 2FJUB 3BOWB 4I5NB 5G08A 4OVNF 4YI8A 1CLBA 3DVEA 3BUWB 2CBLA 4WQ2A 1UHNA 1JC2A 2DOQA 3NSOA 1QLKA 4MVFA 1KWOB 1M31A 2K2FA 1L7ZA 4YI9A 2JZIA 2RGIA 1PRWA 2AMIA 2PALA 1XFVO 2I94A 1BLQA 4F0ZB 4CFQA 1FPWA 4WRIA 1QJTA 2HF5A 1B9AA 1YRTB 1BODA 1ZACA 5I2LA 2K7DA 4MRYA 1NIWA 2ZRSA 5KU1A 3NSKA 2M1UA 4I5KA 1DF0A 1S6CA 3LCPC 5BPJA 2NCOA 2L2EA 3BUXB 3IF7A 3SIBA 2VRGA 2LCPA 1AHRA 5K89A 2FCEA 1G4YR 1GJYA 1F71A 3SJSA 2HPSA 1LINA 4JQ0D 4YGEB 1NSHA 3CR2A 1SY9A 4MN0A 5KSZA 2KAVA 3PATA 4NDBA 2Q91A 1YURA 2JRFA 2KHNA 1RK9A 2QACA 3FWBA 1ZOTB 5CSNA 1B7TZ 3KF9A 1NP8A 1YVLA 3AAJA 3FS7A 2LLTA 4ICBA 2F2PA 1EJ3A 2L51A 5JJGA 3IQQA 1UHHA 1CMGA 1RFJA 4USLA 1RWYA 2JPTA 5ER4X 3VGOA 2BCBA 2LHIA 4A4CA 1VRKA 2WC8A 2CXJA 1KWOC 2CT9A 3CTNA 1WDCB 1G33A 3DF0B 1DVIA 1EL4A 1XO5A 3PM8A 3FWCA 3NXAA 1D1OA 1OOJA 1Y1UA 1CFCA 2LVJA 2IS9A 1TCFA 2PSRA 5HKWA 4CIDA 3I5FC 1YRUB 1YX8A 4QJ4B 1B8CA 1Q80A 4GGFC 1SR6B 2KFGA 3TUYC 1WLMA 1ZUZA 4NDCA 1QX2A 1X02A 3HCMA 5IBWA 2JXLA 2M7LA 1NYAA 2WCFA 1F4QA 1DGUA 1QVIZ 1WRZA 2I7AA 5CSJA 2BKIB 4BY5A 1NX1A 1J1EA 1KK7Z 5CSFA 1MXLC 1SYMA 3I5HC 2L4HA 4WQ3A 1K93D 2JULA 4Q04A 2EC6C 1NCZA 3D0YB 1XA5A 2HETA 2BE6A 3SIAA 1R2UA 2PMYA 3QRXA 4P2YB 3BUOB 1UUSA 1OMRA 3PALA 1ZMZA 1UHIA 2KOTA 1CMFA 2ZNDA 2JXCA 2LVVA 1TRFA 1S26D 2PASA 2KFFA 1NCXA 3FIAA 4ZCUA 3A8RA 1OE9B 4PHMA 4UPGA 2WOSA 1DJXA 1WDCC 3OX6A 1BF5A 1A75B 1NX3A 1Y6WA 3TS5C 1AK8A 2MJWB 2NXQA 1C7WA 3KEVA 1YR5A 1U5IA 2Y4QA 1B4CA 4MBEA 2KI6C 2K7BA 1PK0D 3DVKA 2V53A 2M7NA 3KO0A 3CZTX 2KBIA 4HSZA 1XVJA 2M8UA 3I5IC 3O4YA 4MZJA 1K8UA 1S6JA 1SR6C 2KGRA 1KFXS 1MR8A 5AERA 1FF1A 4DUQA 1CDMA 1FW4A 1IG5A 1CFFA 4XJKA 1DJZA 1OZSA 1SBJA 1NWDA 1J7OA 2BCXA 1CM4A 2LE9B 2COLB 1EG4A 1NX0A 4PE7A 1PULA 1K9UA 2F33A 2KQYA 1CLLA 3PSRA 5GQQC 2LAPA 3BOWA 2E30A 2SCPA 4FQOA 5AEQA 2F3ZA 2Y1MA 1AUIB 3NSLA 3SG2A 1KQVA 4GBAA 4YGBB 2LANA 3I5FB 3ZWHA 2NLNA 4YBHB 1IQ5A 1QVIY 2MAZA 3TUYB 5HYDA 2LLUA 3GK4X 5HKZA 5PALA 2WCBA 5D69A 1LA0A 1NUBA 4PHKA 3OB1B 2GGMA 1KK7Y 3SG3A 3JVTB 1AJ5A 5B8IB 1IGVA 4GFTA 2P6BB 1CFPA 2QPTA 1DF0B 2O5GA 1TCOB 2KYCA 1K9PA 3WNXB 3PN7B 4C0LA 3I5HB 2JT8A 1MQ1A 2JTTA 3TDIA 2BCAA 1QX5B 2EC6B 3BUMB 3WHUB 5F6TA 4ZCVA 2ZFDA 4HRHA 1BU3A 1YTZC 1QATA 3K21A 2BBMA 2L5XB 2LP2A 3HX4A 2H61A 1OMDA 2KFHA 1YUSA 1DJHA 3DVMA 4FTGA 1DJIA 4R1EA 1KFUS 3CGAA 1UHJA 1XFUO 1J7RA 2MLFC 2OS8C 4CFRA 4OKHA 1B47A 1HT9A 1PSBA 4OCIA 2ZN9A 3LK0A 4GNKB 1JFKA 5ER5A 2CCMA 4I5JA 2LMUA 1YUUA 1MXEA 3EVUA 5AANA 2NZ0A 4GUKA 3TS5B 1IJ5A 1IWQA 2JTZA 3ICBA 5FYXA 1J7QA 3IQOA 1FI5A 4N5XA 3WHTB 1XK4A 1TN4A 3CR4X 3EK7A 1KCYA 3CLNA 2MLEC 4ETOA 3NSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I5I B;  2L4I A;  4ORC B;  2F3Y A;  1OSA A;  4GPL B;  2H2K A;  1MWN A;  4D1E A;  1K2H A;  1S6I A;  1UWO A;  2O60 A;  3JVT C;  2MBX A;  1QX7 A;  2LMT A;  2I2R E;  4I5L B;  3EVR A;  1K94 A;  3KHE A;  3BUN B;  4P5O E;  5CSI A;  1F8H A;  2LMV A;  2LC5 A;  4NDD A;  3JTD C;  4M2P A;  1J1D A;  1DTL A;  3PN7 C;  3OHM B;  1SCV A;  3I5G C;  5KTY A;  1EXR A;  4TNC A;  2M29 A;  2BKH B;  1KK8 B;  1SL8 A;  2CTN A;  4QJ3 B;  1DJY A;  2LP3 A;  1JSA A;  2M9G A;  1JWD A;  2K7O A;  1B8L A;  2F8P A;  1QIV A;  2KI4 B;  3EVV A;  1CLM A;  1N0Y A;  5D7F A;  2JNF A;  4N1F A;  4PDZ A;  2K8M B;  2G2B A;  1E8A A;  1EG3 A;  1KSO A;  4CLN A;  5I8N A;  1WY9 A;  1B1G A;  1XYD A;  3EKH A;  2KYF A;  2M49 B;  1SNL A;  1DT7 B;  1TNP A;  3GK2 A;  5TNC A;  1ZFS A;  2MRD A;  3EKJ A;  2KAX A;  1LVC D;  1IRJ A;  1JF2 A;  3O78 A;  3SG4 A;  4DCK A;  1DGV A;  2KQ6 A;  2M3W A;  2CNP A;  4PE0 A;  2KBM A;  1TIZ A;  1GQM A;  4ORA B;  1M39 A;  2D8N A;  4QJ5 B;  5DKQ A;  1S3P A;  1BG1 A;  4M2O A;  2M0R A;  1EH2 A;  1F54 A;  1M46 A;  1ALW A;  5HLV A;  1J55 A;  2B1U A;  3ZNI A;  1R6P A;  3CR5 X;  5AFP A;  1V1G A;  2L50 A;  1U5I B;  1IQ3 A;  1DJG A;  1UUR A;  2JNX A;  1XK4 C;  2OS8 B;  1CNP A;  5HKY A;  1AP4 A;  3M0W A;  3VRP A;  1IJ6 A;  1J7P A;  5HLO A;  1TNQ A;  1QS7 A;  1XFW O;  1Y0V H;  3RLZ A;  1CFD A;  1ALV A;  1N65 A;  2BL0 C;  4XJK B;  1QXP A;  4GAO A;  1DJW A;  5DKR A;  1KK8 C;  2E6W A;  3H4S E;  4DIR A;  1TTX A;  3C1V A;  4AQJ A;  3AAK A;  1QLS A;  1K9K A;  3VRO A;  1RRO A;  1OQP A;  1G8I A;  1A2X A;  2FOT A;  2ZRT A;  1A29 A;  2KI4 C;  3O2P A;  4IL1 A;  3VRN A;  2JT3 A;  2LVK A;  1S5G Y;  1B8R A;  4MRX A;  1GGW A;  1YVH A;  2MA2 A;  1LXF C;  1M45 A;  1WLZ A;  1KFX L;  5JOL A;  1JF0 A;  4PE4 A;  4ORB B;  2Y1N A;  3MSE B;  3E3R A;  4GGF A;  4MZK A;  1YUT A;  3JTD B;  1CB1 A;  2LV7 A;  2WOR A;  3BYA A;  1V1F A;  1SL7 A;  3AKB A;  3I5G B;  1W7J B;  3OP0 A;  1QAS A;  1OMV A;  2LLS A;  2JT0 A;  2K2A A;  2KAY A;  2JQ6 A;  2KSP A;  2TN4 A;  1H8B A;  1SK6 D;  1H4B A;  3DD4 A;  3OX5 A;  1SW8 A;  1RJV A;  1K95 A;  2LHL A;  3LK1 A;  2JWW A;  2GV5 A;  1MUX A;  1PVB A;  1CM1 A;  1WRK A;  1M63 B;  1UHK A;  1UP5 A;  2ZNE A;  3AKA A;  1BMO A;  4GGN A;  1TNX A;  1A03 A;  1BR1 B;  1YX7 A;  1C7V A;  1K96 A;  1W7I B;  3F45 A;  4JWQ A;  5AXI A;  2HQW A;  4NQG A;  1KSM A;  3SG6 A;  2AAO A;  1AJ4 A;  3GK1 A;  4L9M A;  3LLE A;  4C0J A;  2F2O A;  2LNK A;  1C07 A;  1JBA A;  1TOP A;  3TDZ A;  2MHH A;  2JU0 A;  4MLW A;  1JFJ A;  1L2O C;  2OTG C;  2G9B A;  2L98 A;  3DF0 A;  1BOC A;  4YGD B;  4YGC B;  1F4O A;  4A4B A;  2A4J A;  2K7C A;  1F70 A;  1XFY O;  1KQM B;  3WXA A;  1PSR A;  1LA3 A;  1SCM B;  1CDP A;  3O6B A;  4M2Q A;  2KI6 D;  1SMG A;  2M97 A;  2M1K B;  1XFZ O;  1Y1A A;  2EGD A;  1S5G Z;  2KGB C;  4BY4 A;  1REC A;  1KFU L;  1BJF A;  1MHO A;  2Y5I A;  2NCP A;  1NX2 A;  1BT6 A;  3A4U B;  2LUC A;  2LM5 A;  1QTX A;  4PAL A;  2BL0 B;  3VRR A;  2ZN8 A;  1BR4 B;  1A4P A;  4HRG A;  2ISD A;  1SKT A;  4C0K A;  1F55 A;  3TZ1 A;  3GOF A;  4AQI A;  2BE4 A;  1S1E A;  2K0J A;  4OV2 A;  4XYN A;  3OB2 B;  1SPY A;  3LL8 B;  3D0Y A;  4MSP A;  2ZKM X;  1DMO A;  1NPQ A;  3BQ3 A;  2WND A;  1QIW A;  2K61 A;  3KPX A;  2BEC A;  2H61 C;  3BXK A;  4CPV A;  1TNW A;  1OZO A;  4PHJ A;  2KDH A;  1FBV A;  1AVS A;  3PLF B;  4PHN A;  4OR9 B;  1FI6 A;  1IH0 A;  4YRU A;  2AUC A;  1JUO A;  4YGA A;  3CWG A;  5I2Q A;  2PVB A;  1HQV A;  3D10 A;  3EK4 A;  4PCW A;  5I2O A;  1CDL A;  3CS1 A;  1NCY A;  2SAS A;  2JC2 A;  4U8D A;  1XFX O;  1A75 A;  4MZL A;  3SG7 A;  1RTP 1;  1WRL A;  1KQM C;  3DVJ A;  4E68 A;  1PVA A;  1QV1 A;  1SCM C;  2HQ8 A;  4JPZ B;  1CKK A;  2GGZ A;  5DKN A;  1ODB A;  1N2D A;  3TDU A;  4DS7 A;  1LKJ A;  3PFV A;  1MF8 B;  2BBN A;  2EHB A;  3VRQ A;  4AOM A;  5CPV A;  1B7T Y;  5J3X A;  3EK8 A;  3SG5 A;  3RM1 A;  2KNE A;  1K90 D;  1GGZ A;  2LVI A;  1SRA A;  1IKU A;  2R2I A;  4N1G A;  1QV0 A;  2FCD A;  1CTR A;  1S36 A;  2LUX A;  2PRU A;  2Q4U A;  2OPO A;  4HRE E;  1L2O B;  2I18 A;  2OTG B;  2WCE A;  1SL9 A;  4MEW A;  1PAL A;  4DRW A;  2JOJ A;  4PE1 A;  1Y1X A;  1CDN A;  2L0P A;  2FJU B;  3BOW B;  4I5N B;  5G08 A;  4OVN F;  4YI8 A;  1CLB A;  3DVE A;  3BUW B;  2CBL A;  4WQ2 A;  1UHN A;  1JC2 A;  2DOQ A;  3NSO A;  1QLK A;  4MVF A;  1KWO B;  1M31 A;  2K2F A;  1L7Z A;  4YI9 A;  2JZI A;  2RGI A;  1PRW A;  2AMI A;  2PAL A;  1XFV O;  2I94 A;  1BLQ A;  4F0Z B;  4CFQ A;  1FPW A;  4WRI A;  1QJT A;  2HF5 A;  1B9A A;  1YRT B;  1BOD A;  1ZAC A;  5I2L A;  2K7D A;  4MRY A;  1NIW A;  2ZRS A;  5KU1 A;  3NSK A;  2M1U A;  4I5K A;  1DF0 A;  1S6C A;  3LCP C;  5BPJ A;  2NCO A;  2L2E A;  3BUX B;  3IF7 A;  3SIB A;  2VRG A;  2LCP A;  1AHR A;  5K89 A;  2FCE A;  1G4Y R;  1GJY A;  1F71 A;  3SJS A;  2HPS A;  1LIN A;  4JQ0 D;  4YGE B;  1NSH A;  3CR2 A;  1SY9 A;  4MN0 A;  5KSZ A;  2KAV A;  3PAT A;  4NDB A;  2Q91 A;  1YUR A;  2JRF A;  2KHN A;  1RK9 A;  2QAC A;  3FWB A;  1ZOT B;  5CSN A;  1B7T Z;  3KF9 A;  1NP8 A;  1YVL A;  3AAJ A;  3FS7 A;  2LLT A;  4ICB A;  2F2P A;  1EJ3 A;  2L51 A;  5JJG A;  3IQQ A;  1UHH A;  1CMG A;  1RFJ A;  4USL A;  1RWY A;  2JPT A;  5ER4 X;  3VGO A;  2BCB A;  2LHI A;  4A4C A;  1VRK A;  2WC8 A;  2CXJ A;  1KWO C;  2CT9 A;  3CTN A;  1WDC B;  1G33 A;  3DF0 B;  1DVI A;  1EL4 A;  1XO5 A;  3PM8 A;  3FWC A;  3NXA A;  1D1O A;  1OOJ A;  1Y1U A;  1CFC A;  2LVJ A;  2IS9 A;  1TCF A;  2PSR A;  5HKW A;  4CID A;  3I5F C;  1YRU B;  1YX8 A;  4QJ4 B;  1B8C A;  1Q80 A;  4GGF C;  1SR6 B;  2KFG A;  3TUY C;  1WLM A;  1ZUZ A;  4NDC A;  1QX2 A;  1X02 A;  3HCM A;  5IBW A;  2JXL A;  2M7L A;  1NYA A;  2WCF A;  1F4Q A;  1DGU A;  1QVI Z;  1WRZ A;  2I7A A;  5CSJ A;  2BKI B;  4BY5 A;  1NX1 A;  1J1E A;  1KK7 Z;  5CSF A;  1MXL C;  1SYM A;  3I5H C;  2L4H A;  4WQ3 A;  1K93 D;  2JUL A;  4Q04 A;  2EC6 C;  1NCZ A;  3D0Y B;  1XA5 A;  2HET A;  2BE6 A;  3SIA A;  1R2U A;  2PMY A;  3QRX A;  4P2Y B;  3BUO B;  1UUS A;  1OMR A;  3PAL A;  1ZMZ A;  1UHI A;  2KOT A;  1CMF A;  2ZND A;  2JXC A;  2LVV A;  1TRF A;  1S26 D;  2PAS A;  2KFF A;  1NCX A;  3FIA A;  4ZCU A;  3A8R A;  1OE9 B;  4PHM A;  4UPG A;  2WOS A;  1DJX A;  1WDC C;  3OX6 A;  1BF5 A;  1A75 B;  1NX3 A;  1Y6W A;  3TS5 C;  1AK8 A;  2MJW B;  2NXQ A;  1C7W A;  3KEV A;  1YR5 A;  1U5I A;  2Y4Q A;  1B4C A;  4MBE A;  2KI6 C;  2K7B A;  1PK0 D;  3DVK A;  2V53 A;  2M7N A;  3KO0 A;  3CZT X;  2KBI A;  4HSZ A;  1XVJ A;  2M8U A;  3I5I C;  3O4Y A;  4MZJ A;  1K8U A;  1S6J A;  1SR6 C;  2KGR A;  1KFX S;  1MR8 A;  5AER A;  1FF1 A;  4DUQ A;  1CDM A;  1FW4 A;  1IG5 A;  1CFF A;  4XJK A;  1DJZ A;  1OZS A;  1SBJ A;  1NWD A;  1J7O A;  2BCX A;  1CM4 A;  2LE9 B;  2COL B;  1EG4 A;  1NX0 A;  4PE7 A;  1PUL A;  1K9U A;  2F33 A;  2KQY A;  1CLL A;  3PSR A;  5GQQ C;  2LAP A;  3BOW A;  2E30 A;  2SCP A;  4FQO A;  5AEQ A;  2F3Z A;  2Y1M A;  1AUI B;  3NSL A;  3SG2 A;  1KQV A;  4GBA A;  4YGB B;  2LAN A;  3I5F B;  3ZWH A;  2NLN A;  4YBH B;  1IQ5 A;  1QVI Y;  2MAZ A;  3TUY B;  5HYD A;  2LLU A;  3GK4 X;  5HKZ A;  5PAL A;  2WCB A;  5D69 A;  1LA0 A;  1NUB A;  4PHK A;  3OB1 B;  2GGM A;  1KK7 Y;  3SG3 A;  3JVT B;  1AJ5 A;  5B8I B;  1IGV A;  4GFT A;  2P6B B;  1CFP A;  2QPT A;  1DF0 B;  2O5G A;  1TCO B;  2KYC A;  1K9P A;  3WNX B;  3PN7 B;  4C0L A;  3I5H B;  2JT8 A;  1MQ1 A;  2JTT A;  3TDI A;  2BCA A;  1QX5 B;  2EC6 B;  3BUM B;  3WHU B;  5F6T A;  4ZCV A;  2ZFD A;  4HRH A;  1BU3 A;  1YTZ C;  1QAT A;  3K21 A;  2BBM A;  2L5X B;  2LP2 A;  3HX4 A;  2H61 A;  1OMD A;  2KFH A;  1YUS A;  1DJH A;  3DVM A;  4FTG A;  1DJI A;  4R1E A;  1KFU S;  3CGA A;  1UHJ A;  1XFU O;  1J7R A;  2MLF C;  2OS8 C;  4CFR A;  4OKH A;  1B47 A;  1HT9 A;  1PSB A;  4OCI A;  2ZN9 A;  3LK0 A;  4GNK B;  1JFK A;  5ER5 A;  2CCM A;  4I5J A;  2LMU A;  1YUU A;  1MXE A;  3EVU A;  5AAN A;  2NZ0 A;  4GUK A;  3TS5 B;  1IJ5 A;  1IWQ A;  2JTZ A;  3ICB A;  5FYX A;  1J7Q A;  3IQO A;  1FI5 A;  4N5X A;  3WHT B;  1XK4 A;  1TN4 A;  3CR4 X;  3EK7 A;  1KCY A;  3CLN A;  2MLE C;  4ETO A;  3NSI A; 
#chains in the Genus database with same CATH topology
 3I5I B;  2L4I A;  4ORC B;  2F3Y A;  1OSA A;  4GPL B;  2H2K A;  1MWN A;  4D1E A;  1K2H A;  1S6I A;  1UWO A;  2O60 A;  3JVT C;  2MBX A;  3FE9 A;  1QX7 A;  2LMT A;  2I2R E;  3L47 A;  3EVR A;  4I5L B;  1K94 A;  3KHE A;  3BUN B;  4P5O E;  5CSI A;  1F8H A;  2LMV A;  2LC5 A;  4NDD A;  3JTD C;  4M2P A;  1J1D A;  1DTL A;  3PN7 C;  3OHM B;  1SCV A;  3I5G C;  5KTY A;  2QEB A;  3CAB A;  1EXR A;  4TNC A;  2FJY A;  2M29 A;  2BKH B;  3BFA A;  1KK8 B;  1SL8 A;  2CTN A;  4QJ3 B;  1DJY A;  2LP3 A;  1JSA A;  2M9G A;  3S0D A;  1JWD A;  1T14 A;  1B8L A;  2K7O A;  2F8P A;  1QIV A;  2KI4 B;  3EVV A;  1CLM A;  1N0Y A;  5D7F A;  2JNF A;  3FE6 A;  5EL2 A;  1IIO A;  4N1F A;  4PDZ A;  2K8M B;  2G2B A;  1E8A A;  1EG3 A;  1KSO A;  4CLN A;  5I8N A;  1WY9 A;  1B1G A;  1XYD A;  3EKH A;  2KYF A;  2M49 B;  1SNL A;  1DT7 B;  1TNP A;  3GK2 A;  5TNC A;  3S0E A;  1ZFS A;  2MRD A;  2WCK A;  3EKJ A;  2KAX A;  1LVC D;  3NHT A;  4PT1 A;  1IRJ A;  1JF2 A;  3O78 A;  3SG4 A;  4DCK A;  1DGV A;  2KQ6 A;  2M3W A;  2CNP A;  2QEH A;  4PE0 A;  2KBM A;  4KYN A;  1TIZ A;  1GQM A;  4IJ7 A;  3DYE A;  4ORA B;  1M39 A;  2D8N A;  4QJ5 B;  5DKQ A;  1S3P A;  1BG1 A;  3IVT A;  3CDN A;  4M2O A;  4OZD A;  2M0R A;  2QEO A;  1EH2 A;  1F54 A;  2K60 A;  1M46 A;  1ALW A;  5HLV A;  1J55 A;  2B1U A;  3ZNI A;  1R6P A;  3CR5 X;  5AFP A;  1V1G A;  2L50 A;  1U5I B;  1IQ3 A;  1DJG A;  1UUR A;  2JNX A;  1XK4 C;  2OS8 B;  1CNP A;  5HKY A;  1AP4 A;  3M0W A;  3VRP A;  2P70 A;  1IJ6 A;  1J7P A;  5HLO A;  1TNQ A;  1QS7 A;  1XFW O;  1Y0V H;  3RLZ A;  1CFD A;  1ALV A;  5D3O A;  1N65 A;  2BL0 C;  4XJK B;  5DIC A;  5I94 A;  1QXP A;  4GAO A;  1DJW A;  5DKR A;  1KK8 C;  2E6W A;  3H4S E;  4DIR A;  1TTX A;  3C1V A;  4AQJ A;  3AAK A;  1QLS A;  1K9K A;  3VRO A;  1RRO A;  1OQP A;  1G8I A;  1A2X A;  2FOT A;  2ZRT A;  1A29 A;  1QWV A;  2KI4 C;  3O2P A;  4IL1 A;  3VRN A;  2JT3 A;  2LVK A;  1S5G Y;  1B8R A;  5HL1 A;  1Z2C B;  3OGN A;  4MRX A;  1GGW A;  1YVH A;  2MA2 A;  1LXF C;  1M45 A;  1WLZ A;  1KFX L;  5JOL A;  1JF0 A;  4PE4 A;  4ORB B;  3SS4 A;  2Y1N A;  3MSE B;  3E3R A;  4GGF A;  4MZK A;  1YUT A;  3JTD B;  1CB1 A;  2LV7 A;  2WOR A;  3BYA A;  3NHI A;  1V1F A;  1SL7 A;  3AKB A;  3I5G B;  1W7J B;  3OP0 A;  3BJH A;  1QAS A;  1OMV A;  2LLS A;  2JT0 A;  2K2A A;  2KAY A;  2JQ6 A;  2KSP A;  2TN4 A;  1H8B A;  1SK6 D;  1H4B A;  3DD4 A;  3OX5 A;  1SW8 A;  1RJV A;  1K95 A;  2LHL A;  3LK1 A;  2JWW A;  2GV5 A;  1MUX A;  1PVB A;  1CM1 A;  1WRK A;  1DC1 A;  2JPO A;  1M63 B;  1UHK A;  1UP5 A;  2ZNE A;  3AKA A;  1BMO A;  1DQE A;  3R1O A;  4GGN A;  1TNX A;  1A03 A;  1BR1 B;  1YX7 A;  1C7V A;  1K96 A;  1W7I B;  3F45 A;  4JWQ A;  5AXI A;  2HQW A;  4NQG A;  1KSM A;  3SG6 A;  2AAO A;  1AJ4 A;  3GK1 A;  4L9M A;  3LLE A;  4C0J A;  2F2O A;  2LNK A;  2KLD A;  1C07 A;  1JBA A;  1TOP A;  3TDZ A;  2MHH A;  2JU0 A;  4MLW A;  1JFJ A;  1L2O C;  3UNW A;  2OTG C;  2G9B A;  2L98 A;  3DF0 A;  1BOC A;  4YGD B;  4YGC B;  1F4O A;  4A4B A;  2A4J A;  2K7C A;  1F70 A;  1XFY O;  1KQM B;  3WXA A;  1PSR A;  3N7H A;  1LA3 A;  1SCM B;  1CDP A;  3O6B A;  4M2Q A;  2KI6 D;  1SMG A;  2M97 A;  2M1K B;  1XFZ O;  1Y1A A;  2EGD A;  1S5G Z;  2KGB C;  4BY4 A;  1REC A;  1KFU L;  1BJF A;  1MHO A;  2Y5I A;  2NCP A;  1NX2 A;  1BT6 A;  3A4U B;  2LUC A;  2P71 A;  2LM5 A;  1QTX A;  4PAL A;  2BL0 B;  3VRR A;  1C3Z A;  2ZN8 A;  3R1P A;  1BR4 B;  1A4P A;  4HRG A;  2ISD A;  2WCJ A;  1SKT A;  4C0K A;  1F55 A;  3TZ1 A;  3GOF A;  4AQI A;  2BE4 A;  1S1E A;  2K0J A;  3FE8 A;  3DZT A;  3R1V A;  3OB2 B;  4OV2 A;  1SPY A;  3LL8 B;  4XYN A;  3R72 A;  3D0Y A;  4MSP A;  2ZKM X;  1DMO A;  1NPQ A;  3BQ3 A;  2WND A;  1QIW A;  2K61 A;  3KPX A;  2BEC A;  2H61 C;  3BXK A;  4CPV A;  1TNW A;  1OZO A;  1OOF A;  4PHJ A;  2KDH A;  1FBV A;  1AVS A;  3PLF B;  4PHN A;  4OR9 B;  1FI6 A;  3V2L A;  1IH0 A;  1TUZ A;  4YRU A;  2AUC A;  1JUO A;  4YGA A;  3CWG A;  5I2Q A;  2PVB A;  1HQV A;  3D10 A;  3EK4 A;  4PCW A;  5I2O A;  1CDL A;  3CS1 A;  1NCY A;  2SAS A;  2JC2 A;  4U8D A;  1XFX O;  1A75 A;  4MZL A;  3SG7 A;  1RTP 1;  1WRL A;  1KQM C;  3DVJ A;  4E68 A;  1PVA A;  1QV1 A;  3S0F A;  1SCM C;  2HQ8 A;  3K1E A;  4JPZ B;  2GGZ A;  5DKN A;  1CKK A;  3B88 A;  1C3Y A;  1ODB A;  1LS8 A;  1N2D A;  3TDU A;  4DS7 A;  1LKJ A;  3PFV A;  1MF8 B;  2BBN A;  2EHB A;  3S0A A;  3VRQ A;  4AOM A;  5CPV A;  1B7T Y;  5J3X A;  3EK8 A;  3SG5 A;  3RM1 A;  2KNE A;  1K90 D;  1GGZ A;  2LVI A;  1SRA A;  2QDI A;  1IKU A;  2R2I A;  4N1G A;  1QV0 A;  2FCD A;  1CTR A;  1S36 A;  2LUX A;  2PRU A;  2Q4U A;  2OPO A;  2WCM A;  4HRE E;  1L2O B;  2I18 A;  2OTG B;  2WCE A;  3S0G A;  1SL9 A;  4MEW A;  1PAL A;  4DRW A;  2JOJ A;  3EG5 B;  4PE1 A;  1Y1X A;  1CDN A;  2L0P A;  2FJU B;  3BOW B;  4I5N B;  5G08 A;  4OVN F;  4YI8 A;  1CLB A;  1P28 A;  3DVE A;  3BUW B;  2CBL A;  3D75 A;  4WQ2 A;  1UHN A;  1JC2 A;  2DOQ A;  3NSO A;  1QLK A;  2QEV A;  1KWO B;  1M31 A;  4MVF A;  2K2F A;  1L7Z A;  4YI9 A;  2JZI A;  2RGI A;  3NGV A;  1PRW A;  2AMI A;  2PAL A;  1XFV O;  2I94 A;  1BLQ A;  4F0Z B;  4CFQ A;  1FPW A;  4WRI A;  1QJT A;  2HF5 A;  1B9A A;  1YRT B;  1BOD A;  1ZAC A;  5I2L A;  2K7D A;  4FQT A;  2YGU A;  4MRY A;  1NIW A;  2ZRS A;  5KU1 A;  3NSK A;  2M1U A;  4I5K A;  1DF0 A;  1S6C A;  3LCP C;  3OBV A;  3B86 A;  5BPJ A;  2NCO A;  2L2E A;  3BUX B;  3IF7 A;  3QME A;  3SIB A;  2VRG A;  2LCP A;  1AHR A;  5K89 A;  3D77 A;  2FCE A;  1G4Y R;  1GJY A;  1F71 A;  3SJS A;  2HPS A;  1LIN A;  4JQ0 D;  4YGE B;  1NSH A;  3CR2 A;  3L4A A;  1SY9 A;  1OOH A;  4MN0 A;  5KSZ A;  2KAV A;  3PAT A;  4NDB A;  4F7F A;  2Q91 A;  3O4X A;  1YUR A;  2KLE A;  2JRF A;  2KHN A;  3BFB A;  3D73 A;  1RK9 A;  2QAC A;  3FWB A;  1ZOT B;  5CSN A;  1B7T Z;  4INX A;  3DY9 A;  3KF9 A;  1NP8 A;  1YVL A;  3AAJ A;  3FS7 A;  2KPH A;  2LLT A;  4ICB A;  2F2P A;  1GM0 A;  1EJ3 A;  2PQL A;  2L51 A;  5JJG A;  3IQQ A;  1UHH A;  1CMG A;  1RFJ A;  4USL A;  3RZS A;  1RWY A;  2JPT A;  5ER4 X;  3VGO A;  2BCB A;  2LHI A;  1OOG A;  4A4C A;  1VRK A;  2WC8 A;  2CXJ A;  1KWO C;  2CT9 A;  3CTN A;  1WDC B;  1G33 A;  3DF0 B;  1DVI A;  1EL4 A;  1XO5 A;  3PM8 A;  3FWC A;  3NXA A;  1D1O A;  1OOJ A;  2PYQ A;  1Y1U A;  1CFC A;  2LVJ A;  3CZ1 A;  2IS9 A;  1TCF A;  2PSR A;  5HKW A;  4CID A;  2L5Y A;  5FI6 A;  1OW4 A;  3I5F C;  1YRU B;  1YX8 A;  4QJ4 B;  1B8C A;  1Q80 A;  4GGF C;  1SR6 B;  2KFG A;  3TUY C;  1WLM A;  1ZUZ A;  4NDC A;  1QX2 A;  1X02 A;  3HCM A;  3VB1 A;  3UO9 A;  5IBW A;  2JXL A;  2M7L A;  1NYA A;  2WCF A;  1F4Q A;  1DGU A;  1QVI Z;  1WRZ A;  2I7A A;  5CSJ A;  2BKI B;  4BY5 A;  1NX1 A;  1TWO A;  1OOI X;  1J1E A;  1KK7 Z;  5CSF A;  1MXL C;  3CYZ A;  1SYM A;  3I5H C;  2L4H A;  4WQ3 A;  1K93 D;  2JUL A;  4Q04 A;  2EC6 C;  1NCZ A;  3D0Y B;  1XA5 A;  2HET A;  2BE6 A;  3SS5 A;  3B87 A;  1R2U A;  3SIA A;  2PMY A;  3QRX A;  4P2Y B;  1ORG A;  3BFH A;  3BUO B;  1UUS A;  1OMR A;  3PAL A;  1ZMZ A;  1UHI A;  2KOT A;  3D76 A;  1CMF A;  2ZND A;  5FI2 A;  2GTE A;  2JXC A;  2LVV A;  1TRF A;  1S26 D;  2PAS A;  2KFF A;  1NCX A;  3FIA A;  4ZCU A;  3A8R A;  3SS3 A;  1OE9 B;  4PHM A;  4UPG A;  3B7A A;  5FI7 A;  2WOS A;  1DJX A;  1WDC C;  3OX6 A;  1BF5 A;  3CZ2 A;  1A75 B;  1NX3 A;  2BAP A;  1Y6W A;  3TS5 C;  1AK8 A;  2MJW B;  3D74 A;  2NXQ A;  1C7W A;  3KEV A;  1YR5 A;  1U5I A;  2Y4Q A;  1B4C A;  4MBE A;  3B6X A;  2KI6 C;  2K7B A;  1PK0 D;  3DVK A;  2V53 A;  2M7N A;  3KO0 A;  3CZT X;  2KBI A;  3D78 A;  4HSZ A;  1XVJ A;  2M8U A;  3I5I C;  3O4Y A;  4MZJ A;  1K8U A;  1S6J A;  1SR6 C;  2KGR A;  1KFX S;  1MR8 A;  5AER A;  1FF1 A;  4DUQ A;  1CDM A;  1FW4 A;  1IG5 A;  1CFF A;  4XJK A;  3L4L A;  1DJZ A;  1OZS A;  1SBJ A;  1NWD A;  1J7O A;  2BCX A;  1CM4 A;  2LE9 B;  2COL B;  1TUJ A;  1EG4 A;  1NX0 A;  4PE7 A;  3S0B A;  1PUL A;  1K9U A;  3PJI A;  2F33 A;  2KQY A;  4JD9 A;  1CLL A;  3PSR A;  5GQQ C;  2LAP A;  3BOW A;  2E30 A;  2SCP A;  2WCH A;  4FQO A;  5AEQ A;  2F3Z A;  2Y1M A;  1AUI B;  3NSL A;  3SG2 A;  1KQV A;  4GBA A;  4YGB B;  1XFR A;  2LAN A;  3I5F B;  2WC6 A;  3ZWH A;  2NLN A;  4YBH B;  1IQ5 A;  1QVI Y;  2MAZ A;  3DXL A;  3TUY B;  5HYD A;  2LLU A;  3GK4 X;  5HKZ A;  5PAL A;  2WCB A;  5D69 A;  1LA0 A;  1NUB A;  4PHK A;  3OB1 B;  2GGM A;  1KK7 Y;  2L2C A;  3JVT B;  1AJ5 A;  3SG3 A;  2WC5 A;  1IGV A;  5B8I B;  1SSE B;  4GFT A;  2P6B B;  1CFP A;  2QPT A;  3Q8I A;  1DF0 B;  2O5G A;  1TCO B;  2KYC A;  1K9P A;  3WNX B;  3PN7 B;  4C0L A;  3I5H B;  2JT8 A;  1MQ1 A;  2JTT A;  3TDI A;  2BCA A;  3CZ0 A;  1QX5 B;  2EC6 B;  3BUM B;  3WHU B;  5F6T A;  4ZCV A;  2ZFD A;  4HRH A;  1BU3 A;  1Z4H A;  1YTZ C;  1QAT A;  3K21 A;  2BBM A;  2L5X B;  2LP2 A;  3HX4 A;  2H61 A;  1OMD A;  2BNX A;  2KFH A;  1YUS A;  1DJH A;  3DVM A;  4FTG A;  1DJI A;  4R1E A;  1KFU S;  3CGA A;  1UHJ A;  1XFU O;  1J7R A;  2MLF C;  2OS8 C;  4CFR A;  4OKH A;  1DEK A;  1B47 A;  1HT9 A;  1PSB A;  4INW A;  4OCI A;  2ZN9 A;  3LK0 A;  3PM2 A;  4GNK B;  1JFK A;  5ER5 A;  2CCM A;  4I5J A;  2ERB A;  1DEL A;  2LMU A;  1YUU A;  1MXE A;  3EVU A;  5AAN A;  2NZ0 A;  4GUK A;  3TS5 B;  1IJ5 A;  4JKT A;  2WCL A;  1IWQ A;  2JTZ A;  3ICB A;  5FYX A;  1J7Q A;  3IQO A;  1FI5 A;  4N5X A;  3WHT B;  1XK4 A;  1TN4 A;  1W9Z A;  3CR4 X;  3EK7 A;  1KCY A;  2H8V A;  2MLE C;  3CLN A;  4ETO A;  3NSI A; 
#chains in the Genus database with same CATH homology
 3I5I B;  2L4I A;  4ORC B;  2F3Y A;  1OSA A;  4GPL B;  2H2K A;  1MWN A;  4D1E A;  1K2H A;  1S6I A;  1UWO A;  2O60 A;  3JVT C;  2MBX A;  1QX7 A;  2LMT A;  2I2R E;  4I5L B;  3EVR A;  1K94 A;  3KHE A;  3BUN B;  4P5O E;  5CSI A;  1F8H A;  2LMV A;  2LC5 A;  4NDD A;  3JTD C;  4M2P A;  1J1D A;  1DTL A;  3PN7 C;  3OHM B;  1SCV A;  3I5G C;  5KTY A;  1EXR A;  4TNC A;  2M29 A;  2BKH B;  1KK8 B;  1SL8 A;  2CTN A;  4QJ3 B;  1DJY A;  2LP3 A;  1JSA A;  2M9G A;  1JWD A;  2K7O A;  1B8L A;  2F8P A;  1QIV A;  2KI4 B;  3EVV A;  1CLM A;  1N0Y A;  5D7F A;  2JNF A;  4N1F A;  4PDZ A;  2K8M B;  2G2B A;  1E8A A;  1EG3 A;  1KSO A;  4CLN A;  5I8N A;  1WY9 A;  1B1G A;  1XYD A;  3EKH A;  2KYF A;  2M49 B;  1SNL A;  1DT7 B;  1TNP A;  3GK2 A;  5TNC A;  1ZFS A;  2MRD A;  3EKJ A;  2KAX A;  1LVC D;  1IRJ A;  1JF2 A;  3O78 A;  3SG4 A;  4DCK A;  1DGV A;  2KQ6 A;  2M3W A;  2CNP A;  4PE0 A;  2KBM A;  1TIZ A;  1GQM A;  4ORA B;  1M39 A;  2D8N A;  4QJ5 B;  5DKQ A;  1S3P A;  1BG1 A;  4M2O A;  2M0R A;  1EH2 A;  1F54 A;  1M46 A;  1ALW A;  5HLV A;  1J55 A;  2B1U A;  3ZNI A;  1R6P A;  3CR5 X;  5AFP A;  1V1G A;  2L50 A;  1U5I B;  1IQ3 A;  1DJG A;  1UUR A;  2JNX A;  1XK4 C;  2OS8 B;  1CNP A;  5HKY A;  1AP4 A;  3M0W A;  3VRP A;  1IJ6 A;  1J7P A;  5HLO A;  1TNQ A;  1QS7 A;  1XFW O;  1Y0V H;  3RLZ A;  1CFD A;  1ALV A;  1N65 A;  2BL0 C;  4XJK B;  1QXP A;  4GAO A;  1DJW A;  5DKR A;  1KK8 C;  2E6W A;  3H4S E;  4DIR A;  1TTX A;  3C1V A;  4AQJ A;  3AAK A;  1QLS A;  1K9K A;  3VRO A;  1RRO A;  1OQP A;  1G8I A;  1A2X A;  2FOT A;  2ZRT A;  1A29 A;  2KI4 C;  3O2P A;  4IL1 A;  3VRN A;  2JT3 A;  2LVK A;  1S5G Y;  1B8R A;  4MRX A;  1GGW A;  1YVH A;  2MA2 A;  1LXF C;  1M45 A;  1WLZ A;  1KFX L;  5JOL A;  1JF0 A;  4PE4 A;  4ORB B;  2Y1N A;  3MSE B;  3E3R A;  4GGF A;  4MZK A;  1YUT A;  3JTD B;  1CB1 A;  2LV7 A;  2WOR A;  3BYA A;  1V1F A;  1SL7 A;  3AKB A;  3I5G B;  1W7J B;  3OP0 A;  1QAS A;  1OMV A;  2LLS A;  2JT0 A;  2K2A A;  2KAY A;  2JQ6 A;  2KSP A;  2TN4 A;  1H8B A;  1SK6 D;  1H4B A;  3DD4 A;  3OX5 A;  1SW8 A;  1RJV A;  1K95 A;  2LHL A;  3LK1 A;  2JWW A;  2GV5 A;  1MUX A;  1PVB A;  1CM1 A;  1WRK A;  1M63 B;  1UHK A;  1UP5 A;  2ZNE A;  3AKA A;  1BMO A;  4GGN A;  1TNX A;  1A03 A;  1BR1 B;  1YX7 A;  1C7V A;  1K96 A;  1W7I B;  3F45 A;  4JWQ A;  5AXI A;  2HQW A;  4NQG A;  1KSM A;  3SG6 A;  2AAO A;  1AJ4 A;  3GK1 A;  4L9M A;  3LLE A;  4C0J A;  2F2O A;  2LNK A;  1C07 A;  1JBA A;  1TOP A;  3TDZ A;  2MHH A;  2JU0 A;  4MLW A;  1JFJ A;  1L2O C;  2OTG C;  2G9B A;  2L98 A;  3DF0 A;  1BOC A;  4YGD B;  4YGC B;  1F4O A;  4A4B A;  2A4J A;  2K7C A;  1F70 A;  1XFY O;  1KQM B;  3WXA A;  1PSR A;  1LA3 A;  1SCM B;  1CDP A;  3O6B A;  4M2Q A;  2KI6 D;  1SMG A;  2M97 A;  2M1K B;  1XFZ O;  1Y1A A;  2EGD A;  1S5G Z;  2KGB C;  4BY4 A;  1REC A;  1KFU L;  1BJF A;  1MHO A;  2Y5I A;  2NCP A;  1NX2 A;  1BT6 A;  3A4U B;  2LUC A;  2LM5 A;  1QTX A;  4PAL A;  2BL0 B;  3VRR A;  2ZN8 A;  1BR4 B;  1A4P A;  4HRG A;  2ISD A;  1SKT A;  4C0K A;  1F55 A;  3TZ1 A;  3GOF A;  4AQI A;  2BE4 A;  1S1E A;  2K0J A;  4OV2 A;  4XYN A;  3OB2 B;  1SPY A;  3LL8 B;  3D0Y A;  4MSP A;  2ZKM X;  1DMO A;  1NPQ A;  3BQ3 A;  2WND A;  1QIW A;  2K61 A;  3KPX A;  2BEC A;  2H61 C;  3BXK A;  4CPV A;  1TNW A;  1OZO A;  4PHJ A;  2KDH A;  1FBV A;  1AVS A;  3PLF B;  4PHN A;  4OR9 B;  1FI6 A;  1IH0 A;  4YRU A;  2AUC A;  1JUO A;  4YGA A;  3CWG A;  5I2Q A;  2PVB A;  1HQV A;  3D10 A;  3EK4 A;  4PCW A;  5I2O A;  1CDL A;  3CS1 A;  1NCY A;  2SAS A;  2JC2 A;  4U8D A;  1XFX O;  1A75 A;  4MZL A;  3SG7 A;  1RTP 1;  1WRL A;  1KQM C;  3DVJ A;  4E68 A;  1PVA A;  1QV1 A;  1SCM C;  2HQ8 A;  4JPZ B;  1CKK A;  2GGZ A;  5DKN A;  1ODB A;  1N2D A;  3TDU A;  4DS7 A;  1LKJ A;  3PFV A;  1MF8 B;  2BBN A;  2EHB A;  3VRQ A;  4AOM A;  5CPV A;  1B7T Y;  5J3X A;  3EK8 A;  3SG5 A;  3RM1 A;  2KNE A;  1K90 D;  1GGZ A;  2LVI A;  1SRA A;  1IKU A;  2R2I A;  4N1G A;  1QV0 A;  2FCD A;  1CTR A;  1S36 A;  2LUX A;  2PRU A;  2Q4U A;  2OPO A;  4HRE E;  1L2O B;  2I18 A;  2OTG B;  2WCE A;  1SL9 A;  4MEW A;  1PAL A;  4DRW A;  2JOJ A;  4PE1 A;  1Y1X A;  1CDN A;  2L0P A;  2FJU B;  3BOW B;  4I5N B;  5G08 A;  4OVN F;  4YI8 A;  1CLB A;  3DVE A;  3BUW B;  2CBL A;  4WQ2 A;  1UHN A;  1JC2 A;  2DOQ A;  3NSO A;  1QLK A;  4MVF A;  1KWO B;  1M31 A;  2K2F A;  1L7Z A;  4YI9 A;  2JZI A;  2RGI A;  1PRW A;  2AMI A;  2PAL A;  1XFV O;  2I94 A;  1BLQ A;  4F0Z B;  4CFQ A;  1FPW A;  4WRI A;  1QJT A;  2HF5 A;  1B9A A;  1YRT B;  1BOD A;  1ZAC A;  5I2L A;  2K7D A;  4MRY A;  1NIW A;  2ZRS A;  5KU1 A;  3NSK A;  2M1U A;  4I5K A;  1DF0 A;  1S6C A;  3LCP C;  5BPJ A;  2NCO A;  2L2E A;  3BUX B;  3IF7 A;  3SIB A;  2VRG A;  2LCP A;  1AHR A;  5K89 A;  2FCE A;  1G4Y R;  1GJY A;  1F71 A;  3SJS A;  2HPS A;  1LIN A;  4JQ0 D;  4YGE B;  1NSH A;  3CR2 A;  1SY9 A;  4MN0 A;  5KSZ A;  2KAV A;  3PAT A;  4NDB A;  2Q91 A;  1YUR A;  2JRF A;  2KHN A;  1RK9 A;  2QAC A;  3FWB A;  1ZOT B;  5CSN A;  1B7T Z;  3KF9 A;  1NP8 A;  1YVL A;  3AAJ A;  3FS7 A;  2LLT A;  4ICB A;  2F2P A;  1EJ3 A;  2L51 A;  5JJG A;  3IQQ A;  1UHH A;  1CMG A;  1RFJ A;  4USL A;  1RWY A;  2JPT A;  5ER4 X;  3VGO A;  2BCB A;  2LHI A;  4A4C A;  1VRK A;  2WC8 A;  2CXJ A;  1KWO C;  2CT9 A;  3CTN A;  1WDC B;  1G33 A;  3DF0 B;  1DVI A;  1EL4 A;  1XO5 A;  3PM8 A;  3FWC A;  3NXA A;  1D1O A;  1OOJ A;  1Y1U A;  1CFC A;  2LVJ A;  2IS9 A;  1TCF A;  2PSR A;  5HKW A;  4CID A;  3I5F C;  1YRU B;  1YX8 A;  4QJ4 B;  1B8C A;  1Q80 A;  4GGF C;  1SR6 B;  2KFG A;  3TUY C;  1WLM A;  1ZUZ A;  4NDC A;  1QX2 A;  1X02 A;  3HCM A;  5IBW A;  2JXL A;  2M7L A;  1NYA A;  2WCF A;  1F4Q A;  1DGU A;  1QVI Z;  1WRZ A;  2I7A A;  5CSJ A;  2BKI B;  4BY5 A;  1NX1 A;  1J1E A;  1KK7 Z;  5CSF A;  1MXL C;  1SYM A;  3I5H C;  2L4H A;  4WQ3 A;  1K93 D;  2JUL A;  4Q04 A;  2EC6 C;  1NCZ A;  3D0Y B;  1XA5 A;  2HET A;  2BE6 A;  3SIA A;  1R2U A;  2PMY A;  3QRX A;  4P2Y B;  3BUO B;  1UUS A;  1OMR A;  3PAL A;  1ZMZ A;  1UHI A;  2KOT A;  1CMF A;  2ZND A;  2JXC A;  2LVV A;  1TRF A;  1S26 D;  2PAS A;  2KFF A;  1NCX A;  3FIA A;  4ZCU A;  3A8R A;  1OE9 B;  4PHM A;  4UPG A;  2WOS A;  1DJX A;  1WDC C;  3OX6 A;  1BF5 A;  1A75 B;  1NX3 A;  1Y6W A;  3TS5 C;  1AK8 A;  2MJW B;  2NXQ A;  1C7W A;  3KEV A;  1YR5 A;  1U5I A;  2Y4Q A;  1B4C A;  4MBE A;  2KI6 C;  2K7B A;  1PK0 D;  3DVK A;  2V53 A;  2M7N A;  3KO0 A;  3CZT X;  2KBI A;  4HSZ A;  1XVJ A;  2M8U A;  3I5I C;  3O4Y A;  4MZJ A;  1K8U A;  1S6J A;  1SR6 C;  2KGR A;  1KFX S;  1MR8 A;  5AER A;  1FF1 A;  4DUQ A;  1CDM A;  1FW4 A;  1IG5 A;  1CFF A;  4XJK A;  1DJZ A;  1OZS A;  1SBJ A;  1NWD A;  1J7O A;  2BCX A;  1CM4 A;  2LE9 B;  2COL B;  1EG4 A;  1NX0 A;  4PE7 A;  1PUL A;  1K9U A;  2F33 A;  2KQY A;  1CLL A;  3PSR A;  5GQQ C;  2LAP A;  3BOW A;  2E30 A;  2SCP A;  4FQO A;  5AEQ A;  2F3Z A;  2Y1M A;  1AUI B;  3NSL A;  3SG2 A;  1KQV A;  4GBA A;  4YGB B;  2LAN A;  3I5F B;  3ZWH A;  2NLN A;  4YBH B;  1IQ5 A;  1QVI Y;  2MAZ A;  3TUY B;  5HYD A;  2LLU A;  3GK4 X;  5HKZ A;  5PAL A;  2WCB A;  5D69 A;  1LA0 A;  1NUB A;  4PHK A;  3OB1 B;  2GGM A;  1KK7 Y;  3SG3 A;  3JVT B;  1AJ5 A;  5B8I B;  1IGV A;  4GFT A;  2P6B B;  1CFP A;  2QPT A;  1DF0 B;  2O5G A;  1TCO B;  2KYC A;  1K9P A;  3WNX B;  3PN7 B;  4C0L A;  3I5H B;  2JT8 A;  1MQ1 A;  2JTT A;  3TDI A;  2BCA A;  1QX5 B;  2EC6 B;  3BUM B;  3WHU B;  5F6T A;  4ZCV A;  2ZFD A;  4HRH A;  1BU3 A;  1YTZ C;  1QAT A;  3K21 A;  2BBM A;  2L5X B;  2LP2 A;  3HX4 A;  2H61 A;  1OMD A;  2KFH A;  1YUS A;  1DJH A;  3DVM A;  4FTG A;  1DJI A;  4R1E A;  1KFU S;  3CGA A;  1UHJ A;  1XFU O;  1J7R A;  2MLF C;  2OS8 C;  4CFR A;  4OKH A;  1B47 A;  1HT9 A;  1PSB A;  4OCI A;  2ZN9 A;  3LK0 A;  4GNK B;  1JFK A;  5ER5 A;  2CCM A;  4I5J A;  2LMU A;  1YUU A;  1MXE A;  3EVU A;  5AAN A;  2NZ0 A;  4GUK A;  3TS5 B;  1IJ5 A;  1IWQ A;  2JTZ A;  3ICB A;  5FYX A;  1J7Q A;  3IQO A;  1FI5 A;  4N5X A;  3WHT B;  1XK4 A;  1TN4 A;  3CR4 X;  3EK7 A;  1KCY A;  3CLN A;  2MLE C;  4ETO A;  3NSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...