2KYFA

Solution structure of calcium-bound cpv3
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
108
structure length
108
Chain Sequence
SLTDILSPSDIAAALRDCQAPDSFSPKKFFQISGMSKKSSSQLKEIFRILDNDQSGFIEEDELKYFLQRFESGARVLTASETKTFLAAADHDGDGKIGAEEFQEMVQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Parvalbumin, thymic CPV3
publication title Solution structures of chicken parvalbumin 3 in the Ca(2+)-free and Ca(2+)-bound states.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Calcium binding protein
total genus 14
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2010-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2kyfA00
3O78A 1B7TZ 1DGUA 1OSAA 1SMGA 3BXKA 2LP2A 1U5IB 1C7VA 3H4SE 2RGIA 1FI5A 2LC5A 2GGMA 1QIWA 2M8UA 1DJYA 4DRWA 1K95A 1XK4A 2K8MB 1Y1UA 3EK4A 1QVIY 5AEQA 2Q4UA 1UWOA 2K2AA 3A8RA 1KQVA 1CNPA 4PE0A 3WHUB 1ZOTB 1SNLA 1TNXA 4DUQA 2VRGA 4R1EA 4YRUA 2LNKA 4DS7A 3DVKA 1MHOA 1V1FA 2F3ZA 5GQQC 2JT3A 1DJWA 4NQGA 2SASA 5DKRA 5HLVA 1A4PA 1LA3A 2CBLA 2KAVA 2KFFA 1K2HA 1UHJA 4QJ5B 4MN0A 2LLTA 5I2LA 2H2KA 3D0YA 1SBJA 1XYDA 1OOJA 3KF9A 3FIAA 3KHEA 1KFUS 1IH0A 1CM4A 4F0ZB 4GPLB 5AANA 1CMFA 2LCPA 1HQVA 1WDCB 1QX7A 2M29A 3PFVA 4OKHA 4XJKA 3OB1B 2O60A 1CDPA 1TIZA 3VGOA 4HRGA 1AJ4A 3SG4A 2KBMA 1XO5A 2KOTA 2NCOA 3EK8A 2JT8A 2KI4B 3I5IB 5HKWA 3OHMB 1JF0A 1CLLA 5IBWA 1J7PA 4OV2A 1OMDA 2ZRSA 2PALA 3CWGA 1M45A 1S3PA 2M7NA 3DVEA 3LK1A 5CSIA 1BOCA 1V1GA 4AQJA 3IQOA 2PASA 1MQ1A 3CR2A 1DF0A 1SL7A 4PDZA 3GK1A 4ZCUA 5KTYA 3EVVA 2PMYA 2MBXA 2MA2A 5PALA 2KFHA 2BKHB 1K96A 1F8HA 2EHBA 3LL8B 4PHMA 4C0KA 3SG7A 1XFUO 4ORBB 4CFQA 1SRAA 5I8NA 1S6JA 1UHNA 1NWDA 1MF8B 3TS5B 1N0YA 2E30A 2MRDA 2LUCA 4MSPA 2MAZA 2OTGC 1B8RA 2H61A 3PM8A 1MWNA 2LP3A 1K94A 1PALA 2BBMA 2ZNDA 3I5IC 1ZFSA 3CR4X 3RLZA 1EJ3A 2L4HA 1WLZA 2BE4A 1PK0D 2F2PA 3F45A 1YX8A 1UURA 2ZN9A 1IRJA 4CFRA 2KYCA 2LVVA 2WOSA 1OQPA 3I5GC 1IKUA 4N1GA 1PSRA 1CTRA 2KI6C 2L4IA 4CLNA 3CR5X 3DF0B 4PHKA 1JBAA 1B1GA 1AK8A 5JJGA 4QJ3B 3PN7B 5CSJA 2WCFA 1C07A 1A75B 2FJUB 2O5GA 2L5XB 2K0JA 3K21A 1QASA 3CZTX 5CPVA 1UP5A 1NCZA 3ICBA 1GQMA 2K7CA 2M7LA 2HF5A 1QTXA 1SPYA 2G2BA 2K61A 1UUSA 5J3XA 4YGDB 2JU0A 4YGCB 1RWYA 3VRNA 1ZUZA 1TOPA 3CGAA 1RECA 1BT6A 3KPXA 1KWOB 2M49B 1OE9B 2GGZA 4YBHB 3SIAA 5CSNA 1DT7B 1BG1A 1QATA 1YRUB 3HX4A 4GNKB 1N65A 3RM1A 2G9BA 1GJYA 2K7DA 1UHHA 1MR8A 3TDIA 1H8BA 2Y5IA 1XFVO 4Q04A 1XFZO 2BBNA 2I94A 1KK7Y 4GGNA 4CIDA 2LE9B 4WRIA 3M0WA 2JNXA 2KDHA 1NIWA 1JUOA 1XFWO 2CXJA 1YUSA 3BUXB 3BOWA 2CT9A 3PN7C 2WORA 4PE4A 1OZSA 4U8DA 2ZNEA 1S5GZ 1A2XA 1CDMA 1MUXA 1EL4A 2M3WA 2ZKMX 1F54A 4GGFA 1B7TY 1EXRA 4USLA 1TN4A 1EG4A 3ZNIA 1NCYA 1M31A 1L2OB 1K9PA 4M2PA 2LMTA 2KAYA 2V53A 2ZN8A 1MXEA 4IL1A 3TDZA 2F2OA 5CSFA 1ALWA 1KWOC 1JFKA 1LINA 2EC6C 2L50A 1TNQA 2KNEA 3LK0A 2IS9A 1S5GY 3I5FC 1WLMA 4P2YB 2CNPA 1BR1B 1DVIA 3OX5A 2K7BA 3CLNA 1TNPA 5D7FA 1SL9A 4PCWA 2KAXA 3AKBA 2LHLA 4FQOA 2JC2A 3VRQA 2LVKA 5HKZA 1TRFA 1SCVA 2OTGB 4M2QA 2ISDA 3SG2A 2AMIA 2BE6A 2LLSA 1OZOA 3PLFB 5HLOA 1CDNA 3DVJA 1KCYA 3BUMB 4WQ3A 1CMGA 1Y1AA 1CFDA 1FW4A 2F33A 2FCEA 1MXLC 1BR4B 1RTP1 1YVHA 4JQ0D 3PSRA 1VRKA 3ZWHA 3I5GB 1L2OC 1QIVA 3QRXA 1QV0A 4GFTA 2L2EA 2LVJA 1H4BA 4MVFA 2LAPA 2L0PA 1IJ6A 2LANA 1AP4A 2JNFA 4MBEA 2I2RE 2L98A 1F4QA 3NSLA 2K7OA 3GK2A 1B9AA 4GAOA 2CTNA 3JTDC 4HRHA 3OP0A 1S1EA 1Q80A 4D1EA 2JXLA 2QPTA 3LLEA 1KFUL 1G33A 1NCXA 4MRYA 4YGBB 4QJ4B 1D1OA 1SYMA 1SK6D 1F55A 1Y6WA 2GV5A 1U5IA 3WXAA 3KO0A 1Y0VH 3WNXB 4UPGA 2SCPA 2WCBA 4N5XA 1FBVA 2TN4A 1BLQA 1S6CA 1YRTB 3WHTB 4C0LA 1SR6B 1PRWA 2M97A 1YUTA 1CFPA 3DD4A 1ALVA 1K90D 5KU1A 2M1UA 1YX7A 5AFPA 4YGEB 2NCPA 3MSEB 1YURA 2BKIB 4A4CA 1GGWA 4DIRA 3TUYC 1ODBA 1S26D 3I5HC 1JF2A 2JPTA 2L51A 3D0YB 1SCMB 5AXIA 4AQIA 1IQ3A 1K9KA 4MLWA 4I5NB 2BECA 3GOFA 1DJHA 1UHKA 1K93D 4XJKB 2Y4QA 3D10A 1E8AA 1ZMZA 2EGDA 3O4YA 1DTLA 2M0RA 1J7QA 3PALA 1DJIA 1KFXS 1SW8A 2BCBA 1JWDA 1YVLA 1XK4C 4HSZA 3KEVA 3O6BA 2Y1MA 3HCMA 2JULA 2KQYA 4N1FA 3NXAA 2EC6B 2HPSA 2PRUA 3SG6A 4BY4A 3SG3A 3I5FB 1F71A 1SR6C 2WNDA 1QLSA 1WRLA 4E68A 3AAJA 5G08A 1B4CA 1YTZC 2KFGA 4M2OA 4DCKA 1K8UA 2KYFA 1XFXO 4HREE 1BMOA 1DF0B 4I5LB 3TDUA 1JC2A 1A29A 2BL0C 2WC8A 1SCMC 1NYAA 4NDDA 2BCAA 1QS7A 2KGRA 4ORCB 5DKQA 4AOMA 4A4BA 1W7JB 1B8CA 1QV1A 1TCFA 2OS8C 4OCIA 1HT9A 1G8IA 1R6PA 5KSZA 3C1VA 5HYDA 1DMOA 2KQ6A 2LM5A 2MJWB 1SY9A 1CFCA 1KSMA 3BUNB 4YI8A 1CKKA 1LKJA 1BODA 1TTXA 4I5KA 1LXFC 1G4YR 2NZ0A 1CM1A 1KFXL 1QX2A 1RFJA 2PVBA 1LA0A 3CTNA 3EVRA 3E3RA 3JVTC 1WRKA 1IJ5A 2JRFA 4YI9A 1DJZA 1M39A 5TNCA 1J7OA 1EH2A 2LMUA 3JTDB 4L9MA 3EKHA 2K2FA 4JWQA 4ICBA 2LHIA 1DGVA 3VROA 4MEWA 1PVBA 1RK9A 1CB1A 1N2DA 1QLKA 3LCPC 1QX5B 3BQ3A 2LUXA 2JTZA 2JOJA 4PHNA 2I18A 1NX3A 4BY5A 2JQ6A 1KK8C 4MZKA 1AJ5A 3EKJA 2Y1NA 2HETA 3DF0A 1M46A 1QXPA 1Y1XA 5ER4X 1IG5A 1A75A 2ZRTA 1XA5A 2NXQA 2MLFC 2LVIA 1A03A 3FWCA 1R2UA 3BUWB 3O2PA 5I2OA 4PHJA 3TUYB 1CLMA 3I5HB 2JZIA 1NP8A 2H61C 3CS1A 4ZCVA 2CCMA 4FTGA 2E6WA 2M1KB 5F6TA 1J1DA 1FF1A 2I7AA 3TZ1A 4NDBA 2AUCA 1CDLA 2PSRA 1WRZA 3OX6A 2P6BB 3GK4X 2WCEA 2DOQA 1AHRA 1TNWA 2B1UA 2COLB 3BUOB 2F8PA 1ZACA 1WY9A 4PE7A 3BYAA 2JWWA 4MRXA 3BOWB 3SG5A 1J55A 5DKNA 1F70A 1UHIA 5K89A 1RJVA 4TNCA 1L7ZA 5D69A 1KQMB 2KI6D 3OB2B 2KSPA 4I5JA 4MZLA 1NPQA 1FI6A 1M63B 1RROA 3AAKA 1K9UA 4P5OE 5AERA 3FWBA 1FPWA 1CFFA 1DJGA 1YR5A 1B8LA 1WDCC 2M9GA 4PE1A 1CLBA 2BL0B 1C7WA 1IGVA 2D8NA 1SKTA 1NX2A 1S36A 2FOTA 5JOLA 1PULA 2KBIA 3EVUA 4XYNA 1NX0A 3VRRA 1NSHA 3SJSA 2KI4C 2Q91A 4GBAA 1BJFA 2FCDA 2JTTA 3SIBA 2F3YA 2OS8B 4OVNF 4YGAA 5ER5A 5I2QA 1AVSA 4PALA 2KHNA 1JFJA 1OMRA 2A4JA 1PVAA 4C0JA 2MLEC 5FYXA 1XFYO 1AUIB 3NSKA 3IF7A 2R2IA 1QJTA 1KSOA 3PATA 1XVJA 4MZJA 4WQ2A 1PSBA 3JVTB 3NSIA 1IWQA 1NX1A 1J1EA 1TCOB 4JPZB 1KQMC 4GGFC 1NUBA 5HKYA 2NLNA 5BPJA 2QACA 1SL8A 1EG3A 2HQ8A 1LVCD 2LLUA 1BF5A 1GGZA 2AAOA 4ORAB 1KK7Z 2OPOA 1DJXA 1X02A 2JXCA 2LV7A 3A4UB 1J7RA 1W7IB 4ETOA 2ZFDA 1IQ5A 5B8IB 1F4OA 4NDCA 3TS5C 1BU3A 2BCXA 3AKAA 1KK8B 2JT0A 2KGBC 1QVIZ 3DVMA 4OR9B 2MHHA 3EK7A 1S6IA 2HQWA 3FS7A 3VRPA 3IQQA 1B47A 1YUUA 3NSOA 4CPVA 4GUKA 1JSAA 2LMVA 1OMVA
chains in the Genus database with same CATH superfamily
3O78A 1B7TZ 1DGUA 1OSAA 1SMGA 3BXKA 2LP2A 2WCJA 1U5IB 2P71A 3H4SE 1C7VA 3B7AA 4JKTA 2RGIA 1FI5A 2LC5A 2GGMA 1QIWA 2M8UA 1DJYA 4DRWA 1K95A 1XK4A 2K8MB 1Y1UA 3EK4A 1QVIY 5AEQA 2Q4UA 1UWOA 2K2AA 3A8RA 1KQVA 4FQTA 1CNPA 4PE0A 3WHUB 1ZOTB 5FI2A 1SNLA 1TNXA 4DUQA 2VRGA 4R1EA 4YRUA 2LNKA 4DS7A 3DVKA 1MHOA 1V1FA 2F3ZA 5GQQC 2JT3A 1DJWA 4NQGA 2SASA 5DKRA 5HLVA 1A4PA 1LA3A 2CBLA 2KAVA 2KFFA 3PM2A 1K2HA 1UHJA 2QDIA 4QJ5B 1TUJA 4MN0A 3R1PA 2LLTA 5I2LA 2H2KA 3D0YA 3NHIA 1SBJA 1XYDA 1OOJA 3KF9A 2GTEA 2L5YA 3FIAA 1KFUS 3KHEA 3K1EA 1IH0A 1CM4A 4F0ZB 4GPLB 5AANA 1CMFA 2LCPA 1HQVA 1WDCB 1QX7A 2M29A 3PFVA 4OKHA 4XJKA 3OB1B 2O60A 1CDPA 1TIZA 3VGOA 2KLDA 4HRGA 1AJ4A 3SG4A 2KBMA 1XO5A 2KOTA 2NCOA 3EK8A 2JT8A 2KI4B 3I5IB 5HKWA 3OHMB 1JF0A 3FE9A 3L47A 1CLLA 1EH2A 3NHTA 1DQEA 5IBWA 1J7PA 4OV2A 1OMDA 2ZRSA 2PALA 3CWGA 1M45A 1S3PA 2M7NA 3DVEA 3LK1A 5CSIA 1OOGA 1V1GA 3B87A 3IQOA 2PASA 4AQJA 1MQ1A 1Z2CB 1ORGA 3CR2A 1DF0A 1SL7A 4PDZA 3SS3A 3GK1A 4ZCUA 5KTYA 3EVVA 2PMYA 2MBXA 2MA2A 5PALA 2KFHA 2FJYA 2BKHB 1K96A 1F8HA 2EHBA 3LL8B 4PHMA 4C0KA 3SG7A 1XFUO 4ORBB 1DEKA 1SRAA 4CFQA 5I8NA 1S6JA 1UHNA 1NWDA 1MF8B 3TS5B 3DY9A 1N0YA 2E30A 2MRDA 2LUCA 4MSPA 3R1OA 2MAZA 2OTGC 1B8RA 2H61A 3PM8A 1MWNA 2LP3A 3FE8A 1K94A 1PALA 2BBMA 2ZNDA 3I5IC 1ZFSA 3CR4X 3D77A 3RLZA 1EJ3A 2L4HA 1WLZA 2BE4A 1PK0D 2F2PA 3F45A 5I94A 1YX8A 1UURA 2ZN9A 1IRJA 4CFRA 2KYCA 2LVVA 2WOSA 1OQPA 3I5GC 1IKUA 4N1GA 1PSRA 1CTRA 2KI6C 1BOCA 2L4IA 4CLNA 3CR5X 3DF0B 4PHKA 1JBAA 1B1GA 1AK8A 5JJGA 3FE6A 3PN7B 4QJ3B 2WCFA 5CSJA 1A75B 2FJUB 3DXLA 2O5GA 2L5XB 2K0JA 5FI6A 3K21A 1QASA 3CZTX 2QEBA 5CPVA 1UP5A 1NCZA 3ICBA 1GQMA 2K7CA 2M7LA 2HF5A 1QTXA 1SPYA 2G2BA 2K61A 1SSEB 1UUSA 5J3XA 3S0DA 4YGDB 2JU0A 3OBVA 4YGCB 3D75A 1OOHA 1RWYA 3VRNA 3B86A 1ZUZA 1TOPA 3CGAA 3S0EA 1C07A 1RECA 1BT6A 3KPXA 1KWOB 2M49B 1OE9B 2GGZA 4YBHB 3SIAA 5CSNA 1DT7B 1BG1A 3R1VA 1QATA 1YRUB 3HX4A 4GNKB 1N65A 3RM1A 2G9BA 1GJYA 2K7DA 1UHHA 1MR8A 3B6XA 3TDIA 1H8BA 2Y5IA 1XFVO 3BFBA 1XFZO 2BBNA 2I94A 1KK7Y 4GGNA 4Q04A 4CIDA 2LE9B 4WRIA 3M0WA 2JNXA 2KDHA 1NIWA 1JUOA 2QEHA 1XFWO 2CXJA 1YUSA 3BUXB 3BOWA 2CT9A 3PN7C 2WORA 4PE4A 1OZSA 2WCLA 2ZNEA 4U8DA 3CZ2A 1S5GZ 1A2XA 1CDMA 1MUXA 1EL4A 2M3WA 2ZKMX 1F54A 4GGFA 1B7TY 1EXRA 2L2CA 4USLA 1TN4A 1EG4A 3ZNIA 1NCYA 1M31A 1L2OB 1C3ZA 1K9PA 4M2PA 2LMTA 2KAYA 2V53A 2ZN8A 1MXEA 4IL1A 3TDZA 2F2OA 5CSFA 1ALWA 1KWOC 1JFKA 1LINA 1OW4A 2EC6C 2L50A 2KPHA 1TNQA 2KNEA 3LK0A 3CYZA 3CZ1A 4INWA 2IS9A 1S5GY 3I5FC 1WLMA 4P2YB 2CNPA 1BR1B 1DVIA 3SS4A 3OX5A 2K7BA 1W9ZA 1TNPA 3CLNA 5D7FA 1SL9A 4PCWA 2KAXA 3AKBA 2LHLA 4FQOA 2JC2A 3VRQA 2LVKA 5HKZA 1TRFA 1SCVA 2OTGB 4M2QA 2ISDA 3SG2A 2AMIA 2BE6A 2LLSA 2PQLA 1DC1A 1OZOA 3PLFB 5HLOA 1CDNA 3DVJA 1KCYA 3BUMB 3DYEA 4WQ3A 1CMGA 3D76A 1Y1AA 1CFDA 1FW4A 2F33A 2FCEA 1MXLC 1BR4B 1RTP1 1YVHA 4JQ0D 3PSRA 1VRKA 1DELA 1OOIX 3ZWHA 3I5GB 3RZSA 1L2OC 1QIVA 3QRXA 1QV0A 4GFTA 2L2EA 2LVJA 1H4BA 4MVFA 3DZTA 2LAPA 2L0PA 2JPOA 3N7HA 3UO9A 1IJ6A 2LANA 1AP4A 2JNFA 4MBEA 2I2RE 2L98A 1F4QA 3NSLA 2K7OA 3GK2A 1B9AA 4GAOA 3S0FA 2CTNA 3JTDC 4HRHA 3OP0A 1S1EA 1Q80A 3L4AA 4D1EA 2JXLA 2WCHA 2QPTA 3LLEA 3QMEA 1KFUL 1G33A 1NCXA 4MRYA 4YGBB 4QJ4B 1D1OA 1SYMA 1SK6D 1F55A 1Y6WA 2GV5A 1U5IA 3WXAA 3KO0A 1Y0VH 3WNXB 4UPGA 2SCPA 2KLEA 2WCBA 4N5XA 1FBVA 2TN4A 1BLQA 1S6CA 1YRTB 3VB1A 3WHTB 1SR6B 4C0LA 1PRWA 2M97A 1YUTA 3BFAA 4INXA 3DD4A 1ALVA 1K90D 1CFPA 5KU1A 2M1UA 1YX7A 5AFPA 4YGEB 2NCPA 3MSEB 1YURA 2BKIB 4A4CA 1GGWA 3EG5B 4DIRA 3TUYC 1ODBA 3D78A 1S26D 3I5HC 1JF2A 2JPTA 2L51A 2H8VA 3D0YB 1SCMB 5AXIA 4AQIA 1IQ3A 1K9KA 4MLWA 4I5NB 2BECA 3GOFA 1DJHA 1UHKA 1K93D 4XJKB 2Y4QA 3D10A 1E8AA 1ZMZA 2EGDA 3O4YA 3V2LA 1DTLA 2M0RA 1J7QA 3PALA 1DJIA 1KFXS 1SW8A 2BCBA 1JWDA 1YVLA 1XK4C 4HSZA 3KEVA 5FI7A 1IIOA 3O6BA 2ERBA 2Y1MA 3HCMA 2JULA 2KQYA 4N1FA 3NXAA 3UNWA 2EC6B 2HPSA 2PRUA 3SG6A 4BY4A 3SG3A 2QEOA 3I5FB 1F71A 1SR6C 1XFRA 3Q8IA 2WNDA 1QLSA 1WRLA 2QEVA 4E68A 3AAJA 5G08A 1B4CA 1YTZC 2KFGA 4M2OA 4DCKA 2BNXA 1K8UA 2KYFA 1XFXO 4HREE 1BMOA 1DF0B 4JD9A 4I5LB 3TDUA 1JC2A 1A29A 2BL0C 2WC8A 1SCMC 1NYAA 4NDDA 2BCAA 1QS7A 2KGRA 4ORCB 5DKQA 4AOMA 4A4BA 1W7JB 2BAPA 1B8CA 1QV1A 1TCFA 2OS8C 4OCIA 1HT9A 1G8IA 1R6PA 5KSZA 5HL1A 3C1VA 5HYDA 1DMOA 2KQ6A 2LM5A 2MJWB 1SY9A 1CFCA 1KSMA 3BUNB 4YI8A 1CKKA 3SS5A 1LKJA 1BODA 1TTXA 4I5KA 1LXFC 1G4YR 2NZ0A 1CM1A 1KFXL 1QX2A 1RFJA 2PVBA 1LA0A 3CTNA 3EVRA 3L4LA 3E3RA 3JVTC 1WRKA 5EL2A 1IJ5A 2JRFA 3R72A 1DJZA 1M39A 4YI9A 5TNCA 1J7OA 2LMUA 3D73A 3JTDB 4L9MA 3B88A 2K2FA 3EKHA 4JWQA 4ICBA 2LHIA 1DGVA 3VROA 4MEWA 2K60A 4PT1A 1PVBA 3IVTA 1RK9A 1CB1A 1C3YA 1N2DA 1QLKA 3LCPC 1QX5B 3BQ3A 1LS8A 2LUXA 2JTZA 2JOJA 4PHNA 2I18A 1NX3A 4BY5A 2JQ6A 1KK8C 4MZKA 1AJ5A 3EKJA 2Y1NA 2HETA 3DF0A 1OOFA 1M46A 1QXPA 1Y1XA 3PJIA 1IG5A 5ER4X 1GM0A 1A75A 2ZRTA 1XA5A 2NXQA 2MLFC 2LVIA 1A03A 3FWCA 1R2UA 3BUWB 3O2PA 5I2OA 3OGNA 4PHJA 3TUYB 1CLMA 3I5HB 2JZIA 3O4XA 1NP8A 2H61C 3CS1A 4ZCVA 2CCMA 4FTGA 2E6WA 2M1KB 5F6TA 1J1DA 1FF1A 2I7AA 3TZ1A 1QWVA 4NDBA 2AUCA 1CDLA 2PSRA 1WRZA 3OX6A 2WCMA 2P6BB 3GK4X 2WCEA 2DOQA 1AHRA 1TNWA 2B1UA 2COLB 3BUOB 2F8PA 1ZACA 1WY9A 4PE7A 3BYAA 2JWWA 4MRXA 3BOWB 3SG5A 1J55A 5DKNA 1F70A 3S0GA 1UHIA 2WC5A 5K89A 1RJVA 3NGVA 4TNCA 2WCKA 1L7ZA 5D69A 1KQMB 2KI6D 3OB2B 2KSPA 4I5JA 3S0AA 4MZLA 1NPQA 2PYQA 1FI6A 1M63B 1RROA 3AAKA 1K9UA 3BFHA 4P5OE 5AERA 1P28A 2WC6A 3FWBA 5DICA 1FPWA 1CFFA 1DJGA 1YR5A 1B8LA 1WDCC 2M9GA 4PE1A 1CLBA 2BL0B 1C7WA 1IGVA 2D8NA 1SKTA 1NX2A 1S36A 2FOTA 5JOLA 4IJ7A 1PULA 2KBIA 3EVUA 4XYNA 3D74A 4KYNA 1NX0A 1T14A 1NSHA 3VRRA 3SJSA 2KI4C 2Q91A 4GBAA 1BJFA 2FCDA 2JTTA 3SIBA 2F3YA 2OS8B 2P70A 4OVNF 4YGAA 5ER5A 1AVSA 4PALA 2KHNA 5I2QA 1JFJA 1OMRA 2A4JA 1PVAA 4C0JA 2MLEC 3BJHA 5FYXA 1XFYO 1AUIB 1TUZA 3NSKA 3IF7A 2R2IA 1QJTA 1KSOA 3PATA 1XVJA 2YGUA 4MZJA 4WQ2A 1PSBA 3JVTB 3NSIA 1IWQA 1NX1A 1J1EA 1TCOB 4JPZB 1KQMC 4F7FA 4GGFC 3S0BA 3CZ0A 1NUBA 5HKYA 4OZDA 2NLNA 5BPJA 1TWOA 2QACA 1SL8A 1EG3A 2HQ8A 1LVCD 2LLUA 1BF5A 1GGZA 2AAOA 3CABA 4ORAB 1KK7Z 2OPOA 1DJXA 1X02A 2JXCA 2LV7A 3A4UB 1J7RA 5D3OA 1W7IB 3CDNA 4ETOA 2ZFDA 1IQ5A 5B8IB 1F4OA 4NDCA 3TS5C 1BU3A 2BCXA 3AKAA 1KK8B 2JT0A 2KGBC 1QVIZ 1Z4HA 3DVMA 2MHHA 3EK7A 1S6IA 4OR9B 2HQWA 3FS7A 3VRPA 3IQQA 1B47A 1YUUA 3NSOA 4CPVA 4GUKA 1JSAA 2LMVA 1OMVA
chains in the Genus database with same CATH topology
3O78A 1B7TZ 1DGUA 1OSAA 1SMGA 3BXKA 2LP2A 1U5IB 1C7VA 3H4SE 2RGIA 1FI5A 2LC5A 2GGMA 1QIWA 2M8UA 1DJYA 4DRWA 1K95A 1XK4A 2K8MB 1Y1UA 3EK4A 1QVIY 5AEQA 2Q4UA 1UWOA 2K2AA 3A8RA 1KQVA 1CNPA 4PE0A 3WHUB 1ZOTB 1SNLA 1TNXA 4DUQA 2VRGA 4R1EA 4YRUA 2LNKA 4DS7A 3DVKA 1MHOA 1V1FA 2F3ZA 5GQQC 2JT3A 1DJWA 4NQGA 2SASA 5DKRA 5HLVA 1A4PA 1LA3A 2CBLA 2KAVA 2KFFA 1K2HA 1UHJA 4QJ5B 4MN0A 2LLTA 5I2LA 2H2KA 3D0YA 1SBJA 1XYDA 1OOJA 3KF9A 3FIAA 3KHEA 1KFUS 1IH0A 1CM4A 4F0ZB 4GPLB 5AANA 1CMFA 2LCPA 1HQVA 1WDCB 1QX7A 2M29A 3PFVA 4OKHA 4XJKA 3OB1B 2O60A 1CDPA 1TIZA 3VGOA 4HRGA 1AJ4A 3SG4A 2KBMA 1XO5A 2KOTA 2NCOA 3EK8A 2JT8A 2KI4B 3I5IB 5HKWA 3OHMB 1JF0A 1CLLA 5IBWA 1J7PA 4OV2A 1OMDA 2ZRSA 2PALA 3CWGA 1M45A 1S3PA 2M7NA 3DVEA 3LK1A 5CSIA 1BOCA 1V1GA 4AQJA 3IQOA 2PASA 1MQ1A 3CR2A 1DF0A 1SL7A 4PDZA 3GK1A 4ZCUA 5KTYA 3EVVA 2PMYA 2MBXA 2MA2A 5PALA 2KFHA 2BKHB 1K96A 1F8HA 2EHBA 3LL8B 4PHMA 4C0KA 3SG7A 1XFUO 4ORBB 4CFQA 1SRAA 5I8NA 1S6JA 1UHNA 1NWDA 1MF8B 3TS5B 1N0YA 2E30A 2MRDA 2LUCA 4MSPA 2MAZA 2OTGC 1B8RA 2H61A 3PM8A 1MWNA 2LP3A 1K94A 1PALA 2BBMA 2ZNDA 3I5IC 1ZFSA 3CR4X 3RLZA 1EJ3A 2L4HA 1WLZA 2BE4A 1PK0D 2F2PA 3F45A 1YX8A 1UURA 2ZN9A 1IRJA 4CFRA 2KYCA 2LVVA 2WOSA 1OQPA 3I5GC 1IKUA 4N1GA 1PSRA 1CTRA 2KI6C 2L4IA 4CLNA 3CR5X 3DF0B 4PHKA 1JBAA 1B1GA 1AK8A 5JJGA 4QJ3B 3PN7B 5CSJA 2WCFA 1C07A 1A75B 2FJUB 2O5GA 2L5XB 2K0JA 3K21A 1QASA 3CZTX 5CPVA 1UP5A 1NCZA 3ICBA 1GQMA 2K7CA 2M7LA 2HF5A 1QTXA 1SPYA 2G2BA 2K61A 1UUSA 5J3XA 4YGDB 2JU0A 4YGCB 1RWYA 3VRNA 1ZUZA 1TOPA 3CGAA 1RECA 1BT6A 3KPXA 1KWOB 2M49B 1OE9B 2GGZA 4YBHB 3SIAA 5CSNA 1DT7B 1BG1A 1QATA 1YRUB 3HX4A 4GNKB 1N65A 3RM1A 2G9BA 1GJYA 2K7DA 1UHHA 1MR8A 3TDIA 1H8BA 2Y5IA 1XFVO 4Q04A 1XFZO 2BBNA 2I94A 1KK7Y 4GGNA 4CIDA 2LE9B 4WRIA 3M0WA 2JNXA 2KDHA 1NIWA 1JUOA 1XFWO 2CXJA 1YUSA 3BUXB 3BOWA 2CT9A 3PN7C 2WORA 4PE4A 1OZSA 4U8DA 2ZNEA 1S5GZ 1A2XA 1CDMA 1MUXA 1EL4A 2M3WA 2ZKMX 1F54A 4GGFA 1B7TY 1EXRA 4USLA 1TN4A 1EG4A 3ZNIA 1NCYA 1M31A 1L2OB 1K9PA 4M2PA 2LMTA 2KAYA 2V53A 2ZN8A 1MXEA 4IL1A 3TDZA 2F2OA 5CSFA 1ALWA 1KWOC 1JFKA 1LINA 2EC6C 2L50A 1TNQA 2KNEA 3LK0A 2IS9A 1S5GY 3I5FC 1WLMA 4P2YB 2CNPA 1BR1B 1DVIA 3OX5A 2K7BA 3CLNA 1TNPA 5D7FA 1SL9A 4PCWA 2KAXA 3AKBA 2LHLA 4FQOA 2JC2A 3VRQA 2LVKA 5HKZA 1TRFA 1SCVA 2OTGB 4M2QA 2ISDA 3SG2A 2AMIA 2BE6A 2LLSA 1OZOA 3PLFB 5HLOA 1CDNA 3DVJA 1KCYA 3BUMB 4WQ3A 1CMGA 1Y1AA 1CFDA 1FW4A 2F33A 2FCEA 1MXLC 1BR4B 1RTP1 1YVHA 4JQ0D 3PSRA 1VRKA 3ZWHA 3I5GB 1L2OC 1QIVA 3QRXA 1QV0A 4GFTA 2L2EA 2LVJA 1H4BA 4MVFA 2LAPA 2L0PA 1IJ6A 2LANA 1AP4A 2JNFA 4MBEA 2I2RE 2L98A 1F4QA 3NSLA 2K7OA 3GK2A 1B9AA 4GAOA 2CTNA 3JTDC 4HRHA 3OP0A 1S1EA 1Q80A 4D1EA 2JXLA 2QPTA 3LLEA 1KFUL 1G33A 1NCXA 4MRYA 4YGBB 4QJ4B 1D1OA 1SYMA 1SK6D 1F55A 1Y6WA 2GV5A 1U5IA 3WXAA 3KO0A 1Y0VH 3WNXB 4UPGA 2SCPA 2WCBA 4N5XA 1FBVA 2TN4A 1BLQA 1S6CA 1YRTB 3WHTB 4C0LA 1SR6B 1PRWA 2M97A 1YUTA 1CFPA 3DD4A 1ALVA 1K90D 5KU1A 2M1UA 1YX7A 5AFPA 4YGEB 2NCPA 3MSEB 1YURA 2BKIB 4A4CA 1GGWA 4DIRA 3TUYC 1ODBA 1S26D 3I5HC 1JF2A 2JPTA 2L51A 3D0YB 1SCMB 5AXIA 4AQIA 1IQ3A 1K9KA 4MLWA 4I5NB 2BECA 3GOFA 1DJHA 1UHKA 1K93D 4XJKB 2Y4QA 3D10A 1E8AA 1ZMZA 2EGDA 3O4YA 1DTLA 2M0RA 1J7QA 3PALA 1DJIA 1KFXS 1SW8A 2BCBA 1JWDA 1YVLA 1XK4C 4HSZA 3KEVA 3O6BA 2Y1MA 3HCMA 2JULA 2KQYA 4N1FA 3NXAA 2EC6B 2HPSA 2PRUA 3SG6A 4BY4A 3SG3A 3I5FB 1F71A 1SR6C 2WNDA 1QLSA 1WRLA 4E68A 3AAJA 5G08A 1B4CA 1YTZC 2KFGA 4M2OA 4DCKA 1K8UA 2KYFA 1XFXO 4HREE 1BMOA 1DF0B 4I5LB 3TDUA 1JC2A 1A29A 2BL0C 2WC8A 1SCMC 1NYAA 4NDDA 2BCAA 1QS7A 2KGRA 4ORCB 5DKQA 4AOMA 4A4BA 1W7JB 1B8CA 1QV1A 1TCFA 2OS8C 4OCIA 1HT9A 1G8IA 1R6PA 5KSZA 3C1VA 5HYDA 1DMOA 2KQ6A 2LM5A 2MJWB 1SY9A 1CFCA 1KSMA 3BUNB 4YI8A 1CKKA 1LKJA 1BODA 1TTXA 4I5KA 1LXFC 1G4YR 2NZ0A 1CM1A 1KFXL 1QX2A 1RFJA 2PVBA 1LA0A 3CTNA 3EVRA 3E3RA 3JVTC 1WRKA 1IJ5A 2JRFA 4YI9A 1DJZA 1M39A 5TNCA 1J7OA 1EH2A 2LMUA 3JTDB 4L9MA 3EKHA 2K2FA 4JWQA 4ICBA 2LHIA 1DGVA 3VROA 4MEWA 1PVBA 1RK9A 1CB1A 1N2DA 1QLKA 3LCPC 1QX5B 3BQ3A 2LUXA 2JTZA 2JOJA 4PHNA 2I18A 1NX3A 4BY5A 2JQ6A 1KK8C 4MZKA 1AJ5A 3EKJA 2Y1NA 2HETA 3DF0A 1M46A 1QXPA 1Y1XA 5ER4X 1IG5A 1A75A 2ZRTA 1XA5A 2NXQA 2MLFC 2LVIA 1A03A 3FWCA 1R2UA 3BUWB 3O2PA 5I2OA 4PHJA 3TUYB 1CLMA 3I5HB 2JZIA 1NP8A 2H61C 3CS1A 4ZCVA 2CCMA 4FTGA 2E6WA 2M1KB 5F6TA 1J1DA 1FF1A 2I7AA 3TZ1A 4NDBA 2AUCA 1CDLA 2PSRA 1WRZA 3OX6A 2P6BB 3GK4X 2WCEA 2DOQA 1AHRA 1TNWA 2B1UA 2COLB 3BUOB 2F8PA 1ZACA 1WY9A 4PE7A 3BYAA 2JWWA 4MRXA 3BOWB 3SG5A 1J55A 5DKNA 1F70A 1UHIA 5K89A 1RJVA 4TNCA 1L7ZA 5D69A 1KQMB 2KI6D 3OB2B 2KSPA 4I5JA 4MZLA 1NPQA 1FI6A 1M63B 1RROA 3AAKA 1K9UA 4P5OE 5AERA 3FWBA 1FPWA 1CFFA 1DJGA 1YR5A 1B8LA 1WDCC 2M9GA 4PE1A 1CLBA 2BL0B 1C7WA 1IGVA 2D8NA 1SKTA 1NX2A 1S36A 2FOTA 5JOLA 1PULA 2KBIA 3EVUA 4XYNA 1NX0A 3VRRA 1NSHA 3SJSA 2KI4C 2Q91A 4GBAA 1BJFA 2FCDA 2JTTA 3SIBA 2F3YA 2OS8B 4OVNF 4YGAA 5ER5A 5I2QA 1AVSA 4PALA 2KHNA 1JFJA 1OMRA 2A4JA 1PVAA 4C0JA 2MLEC 5FYXA 1XFYO 1AUIB 3NSKA 3IF7A 2R2IA 1QJTA 1KSOA 3PATA 1XVJA 4MZJA 4WQ2A 1PSBA 3JVTB 3NSIA 1IWQA 1NX1A 1J1EA 1TCOB 4JPZB 1KQMC 4GGFC 1NUBA 5HKYA 2NLNA 5BPJA 2QACA 1SL8A 1EG3A 2HQ8A 1LVCD 2LLUA 1BF5A 1GGZA 2AAOA 4ORAB 1KK7Z 2OPOA 1DJXA 1X02A 2JXCA 2LV7A 3A4UB 1J7RA 1W7IB 4ETOA 2ZFDA 1IQ5A 5B8IB 1F4OA 4NDCA 3TS5C 1BU3A 2BCXA 3AKAA 1KK8B 2JT0A 2KGBC 1QVIZ 3DVMA 4OR9B 2MHHA 3EK7A 1S6IA 2HQWA 3FS7A 3VRPA 3IQQA 1B47A 1YUUA 3NSOA 4CPVA 4GUKA 1JSAA 2LMVA 1OMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O78 A;  1B7T Z;  1DGU A;  1OSA A;  1SMG A;  3BXK A;  2LP2 A;  1U5I B;  1C7V A;  3H4S E;  2RGI A;  1FI5 A;  2LC5 A;  2GGM A;  1QIW A;  2M8U A;  1DJY A;  4DRW A;  1K95 A;  1XK4 A;  2K8M B;  1Y1U A;  3EK4 A;  1QVI Y;  5AEQ A;  2Q4U A;  1UWO A;  2K2A A;  3A8R A;  1KQV A;  1CNP A;  4PE0 A;  3WHU B;  1ZOT B;  1SNL A;  1TNX A;  4DUQ A;  2VRG A;  4R1E A;  4YRU A;  2LNK A;  4DS7 A;  3DVK A;  1MHO A;  1V1F A;  2F3Z A;  5GQQ C;  2JT3 A;  1DJW A;  4NQG A;  2SAS A;  5DKR A;  5HLV A;  1A4P A;  1LA3 A;  2CBL A;  2KAV A;  2KFF A;  1K2H A;  1UHJ A;  4QJ5 B;  4MN0 A;  2LLT A;  5I2L A;  2H2K A;  3D0Y A;  1SBJ A;  1XYD A;  1OOJ A;  3KF9 A;  3FIA A;  3KHE A;  1KFU S;  1IH0 A;  1CM4 A;  4F0Z B;  4GPL B;  5AAN A;  1CMF A;  2LCP A;  1HQV A;  1WDC B;  1QX7 A;  2M29 A;  3PFV A;  4OKH A;  4XJK A;  3OB1 B;  2O60 A;  1CDP A;  1TIZ A;  3VGO A;  4HRG A;  1AJ4 A;  3SG4 A;  2KBM A;  1XO5 A;  2KOT A;  2NCO A;  3EK8 A;  2JT8 A;  2KI4 B;  3I5I B;  5HKW A;  3OHM B;  1JF0 A;  1CLL A;  5IBW A;  1J7P A;  4OV2 A;  1OMD A;  2ZRS A;  2PAL A;  3CWG A;  1M45 A;  1S3P A;  2M7N A;  3DVE A;  3LK1 A;  5CSI A;  1BOC A;  1V1G A;  4AQJ A;  3IQO A;  2PAS A;  1MQ1 A;  3CR2 A;  1DF0 A;  1SL7 A;  4PDZ A;  3GK1 A;  4ZCU A;  5KTY A;  3EVV A;  2PMY A;  2MBX A;  2MA2 A;  5PAL A;  2KFH A;  2BKH B;  1K96 A;  1F8H A;  2EHB A;  3LL8 B;  4PHM A;  4C0K A;  3SG7 A;  1XFU O;  4ORB B;  4CFQ A;  1SRA A;  5I8N A;  1S6J A;  1UHN A;  1NWD A;  1MF8 B;  3TS5 B;  1N0Y A;  2E30 A;  2MRD A;  2LUC A;  4MSP A;  2MAZ A;  2OTG C;  1B8R A;  2H61 A;  3PM8 A;  1MWN A;  2LP3 A;  1K94 A;  1PAL A;  2BBM A;  2ZND A;  3I5I C;  1ZFS A;  3CR4 X;  3RLZ A;  1EJ3 A;  2L4H A;  1WLZ A;  2BE4 A;  1PK0 D;  2F2P A;  3F45 A;  1YX8 A;  1UUR A;  2ZN9 A;  1IRJ A;  4CFR A;  2KYC A;  2LVV A;  2WOS A;  1OQP A;  3I5G C;  1IKU A;  4N1G A;  1PSR A;  1CTR A;  2KI6 C;  2L4I A;  4CLN A;  3CR5 X;  3DF0 B;  4PHK A;  1JBA A;  1B1G A;  1AK8 A;  5JJG A;  4QJ3 B;  3PN7 B;  5CSJ A;  2WCF A;  1C07 A;  1A75 B;  2FJU B;  2O5G A;  2L5X B;  2K0J A;  3K21 A;  1QAS A;  3CZT X;  5CPV A;  1UP5 A;  1NCZ A;  3ICB A;  1GQM A;  2K7C A;  2M7L A;  2HF5 A;  1QTX A;  1SPY A;  2G2B A;  2K61 A;  1UUS A;  5J3X A;  4YGD B;  2JU0 A;  4YGC B;  1RWY A;  3VRN A;  1ZUZ A;  1TOP A;  3CGA A;  1REC A;  1BT6 A;  3KPX A;  1KWO B;  2M49 B;  1OE9 B;  2GGZ A;  4YBH B;  3SIA A;  5CSN A;  1DT7 B;  1BG1 A;  1QAT A;  1YRU B;  3HX4 A;  4GNK B;  1N65 A;  3RM1 A;  2G9B A;  1GJY A;  2K7D A;  1UHH A;  1MR8 A;  3TDI A;  1H8B A;  2Y5I A;  1XFV O;  4Q04 A;  1XFZ O;  2BBN A;  2I94 A;  1KK7 Y;  4GGN A;  4CID A;  2LE9 B;  4WRI A;  3M0W A;  2JNX A;  2KDH A;  1NIW A;  1JUO A;  1XFW O;  2CXJ A;  1YUS A;  3BUX B;  3BOW A;  2CT9 A;  3PN7 C;  2WOR A;  4PE4 A;  1OZS A;  4U8D A;  2ZNE A;  1S5G Z;  1A2X A;  1CDM A;  1MUX A;  1EL4 A;  2M3W A;  2ZKM X;  1F54 A;  4GGF A;  1B7T Y;  1EXR A;  4USL A;  1TN4 A;  1EG4 A;  3ZNI A;  1NCY A;  1M31 A;  1L2O B;  1K9P A;  4M2P A;  2LMT A;  2KAY A;  2V53 A;  2ZN8 A;  1MXE A;  4IL1 A;  3TDZ A;  2F2O A;  5CSF A;  1ALW A;  1KWO C;  1JFK A;  1LIN A;  2EC6 C;  2L50 A;  1TNQ A;  2KNE A;  3LK0 A;  2IS9 A;  1S5G Y;  3I5F C;  1WLM A;  4P2Y B;  2CNP A;  1BR1 B;  1DVI A;  3OX5 A;  2K7B A;  3CLN A;  1TNP A;  5D7F A;  1SL9 A;  4PCW A;  2KAX A;  3AKB A;  2LHL A;  4FQO A;  2JC2 A;  3VRQ A;  2LVK A;  5HKZ A;  1TRF A;  1SCV A;  2OTG B;  4M2Q A;  2ISD A;  3SG2 A;  2AMI A;  2BE6 A;  2LLS A;  1OZO A;  3PLF B;  5HLO A;  1CDN A;  3DVJ A;  1KCY A;  3BUM B;  4WQ3 A;  1CMG A;  1Y1A A;  1CFD A;  1FW4 A;  2F33 A;  2FCE A;  1MXL C;  1BR4 B;  1RTP 1;  1YVH A;  4JQ0 D;  3PSR A;  1VRK A;  3ZWH A;  3I5G B;  1L2O C;  1QIV A;  3QRX A;  1QV0 A;  4GFT A;  2L2E A;  2LVJ A;  1H4B A;  4MVF A;  2LAP A;  2L0P A;  1IJ6 A;  2LAN A;  1AP4 A;  2JNF A;  4MBE A;  2I2R E;  2L98 A;  1F4Q A;  3NSL A;  2K7O A;  3GK2 A;  1B9A A;  4GAO A;  2CTN A;  3JTD C;  4HRH A;  3OP0 A;  1S1E A;  1Q80 A;  4D1E A;  2JXL A;  2QPT A;  3LLE A;  1KFU L;  1G33 A;  1NCX A;  4MRY A;  4YGB B;  4QJ4 B;  1D1O A;  1SYM A;  1SK6 D;  1F55 A;  1Y6W A;  2GV5 A;  1U5I A;  3WXA A;  3KO0 A;  1Y0V H;  3WNX B;  4UPG A;  2SCP A;  2WCB A;  4N5X A;  1FBV A;  2TN4 A;  1BLQ A;  1S6C A;  1YRT B;  3WHT B;  4C0L A;  1SR6 B;  1PRW A;  2M97 A;  1YUT A;  1CFP A;  3DD4 A;  1ALV A;  1K90 D;  5KU1 A;  2M1U A;  1YX7 A;  5AFP A;  4YGE B;  2NCP A;  3MSE B;  1YUR A;  2BKI B;  4A4C A;  1GGW A;  4DIR A;  3TUY C;  1ODB A;  1S26 D;  3I5H C;  1JF2 A;  2JPT A;  2L51 A;  3D0Y B;  1SCM B;  5AXI A;  4AQI A;  1IQ3 A;  1K9K A;  4MLW A;  4I5N B;  2BEC A;  3GOF A;  1DJH A;  1UHK A;  1K93 D;  4XJK B;  2Y4Q A;  3D10 A;  1E8A A;  1ZMZ A;  2EGD A;  3O4Y A;  1DTL A;  2M0R A;  1J7Q A;  3PAL A;  1DJI A;  1KFX S;  1SW8 A;  2BCB A;  1JWD A;  1YVL A;  1XK4 C;  4HSZ A;  3KEV A;  3O6B A;  2Y1M A;  3HCM A;  2JUL A;  2KQY A;  4N1F A;  3NXA A;  2EC6 B;  2HPS A;  2PRU A;  3SG6 A;  4BY4 A;  3SG3 A;  3I5F B;  1F71 A;  1SR6 C;  2WND A;  1QLS A;  1WRL A;  4E68 A;  3AAJ A;  5G08 A;  1B4C A;  1YTZ C;  2KFG A;  4M2O A;  4DCK A;  1K8U A;  2KYF A;  1XFX O;  4HRE E;  1BMO A;  1DF0 B;  4I5L B;  3TDU A;  1JC2 A;  1A29 A;  2BL0 C;  2WC8 A;  1SCM C;  1NYA A;  4NDD A;  2BCA A;  1QS7 A;  2KGR A;  4ORC B;  5DKQ A;  4AOM A;  4A4B A;  1W7J B;  1B8C A;  1QV1 A;  1TCF A;  2OS8 C;  4OCI A;  1HT9 A;  1G8I A;  1R6P A;  5KSZ A;  3C1V A;  5HYD A;  1DMO A;  2KQ6 A;  2LM5 A;  2MJW B;  1SY9 A;  1CFC A;  1KSM A;  3BUN B;  4YI8 A;  1CKK A;  1LKJ A;  1BOD A;  1TTX A;  4I5K A;  1LXF C;  1G4Y R;  2NZ0 A;  1CM1 A;  1KFX L;  1QX2 A;  1RFJ A;  2PVB A;  1LA0 A;  3CTN A;  3EVR A;  3E3R A;  3JVT C;  1WRK A;  1IJ5 A;  2JRF A;  4YI9 A;  1DJZ A;  1M39 A;  5TNC A;  1J7O A;  1EH2 A;  2LMU A;  3JTD B;  4L9M A;  3EKH A;  2K2F A;  4JWQ A;  4ICB A;  2LHI A;  1DGV A;  3VRO A;  4MEW A;  1PVB A;  1RK9 A;  1CB1 A;  1N2D A;  1QLK A;  3LCP C;  1QX5 B;  3BQ3 A;  2LUX A;  2JTZ A;  2JOJ A;  4PHN A;  2I18 A;  1NX3 A;  4BY5 A;  2JQ6 A;  1KK8 C;  4MZK A;  1AJ5 A;  3EKJ A;  2Y1N A;  2HET A;  3DF0 A;  1M46 A;  1QXP A;  1Y1X A;  5ER4 X;  1IG5 A;  1A75 A;  2ZRT A;  1XA5 A;  2NXQ A;  2MLF C;  2LVI A;  1A03 A;  3FWC A;  1R2U A;  3BUW B;  3O2P A;  5I2O A;  4PHJ A;  3TUY B;  1CLM A;  3I5H B;  2JZI A;  1NP8 A;  2H61 C;  3CS1 A;  4ZCV A;  2CCM A;  4FTG A;  2E6W A;  2M1K B;  5F6T A;  1J1D A;  1FF1 A;  2I7A A;  3TZ1 A;  4NDB A;  2AUC A;  1CDL A;  2PSR A;  1WRZ A;  3OX6 A;  2P6B B;  3GK4 X;  2WCE A;  2DOQ A;  1AHR A;  1TNW A;  2B1U A;  2COL B;  3BUO B;  2F8P A;  1ZAC A;  1WY9 A;  4PE7 A;  3BYA A;  2JWW A;  4MRX A;  3BOW B;  3SG5 A;  1J55 A;  5DKN A;  1F70 A;  1UHI A;  5K89 A;  1RJV A;  4TNC A;  1L7Z A;  5D69 A;  1KQM B;  2KI6 D;  3OB2 B;  2KSP A;  4I5J A;  4MZL A;  1NPQ A;  1FI6 A;  1M63 B;  1RRO A;  3AAK A;  1K9U A;  4P5O E;  5AER A;  3FWB A;  1FPW A;  1CFF A;  1DJG A;  1YR5 A;  1B8L A;  1WDC C;  2M9G A;  4PE1 A;  1CLB A;  2BL0 B;  1C7W A;  1IGV A;  2D8N A;  1SKT A;  1NX2 A;  1S36 A;  2FOT A;  5JOL A;  1PUL A;  2KBI A;  3EVU A;  4XYN A;  1NX0 A;  3VRR A;  1NSH A;  3SJS A;  2KI4 C;  2Q91 A;  4GBA A;  1BJF A;  2FCD A;  2JTT A;  3SIB A;  2F3Y A;  2OS8 B;  4OVN F;  4YGA A;  5ER5 A;  5I2Q A;  1AVS A;  4PAL A;  2KHN A;  1JFJ A;  1OMR A;  2A4J A;  1PVA A;  4C0J A;  2MLE C;  5FYX A;  1XFY O;  1AUI B;  3NSK A;  3IF7 A;  2R2I A;  1QJT A;  1KSO A;  3PAT A;  1XVJ A;  4MZJ A;  4WQ2 A;  1PSB A;  3JVT B;  3NSI A;  1IWQ A;  1NX1 A;  1J1E A;  1TCO B;  4JPZ B;  1KQM C;  4GGF C;  1NUB A;  5HKY A;  2NLN A;  5BPJ A;  2QAC A;  1SL8 A;  1EG3 A;  2HQ8 A;  1LVC D;  2LLU A;  1BF5 A;  1GGZ A;  2AAO A;  4ORA B;  1KK7 Z;  2OPO A;  1DJX A;  1X02 A;  2JXC A;  2LV7 A;  3A4U B;  1J7R A;  1W7I B;  4ETO A;  2ZFD A;  1IQ5 A;  5B8I B;  1F4O A;  4NDC A;  3TS5 C;  1BU3 A;  2BCX A;  3AKA A;  1KK8 B;  2JT0 A;  2KGB C;  1QVI Z;  3DVM A;  4OR9 B;  2MHH A;  3EK7 A;  1S6I A;  2HQW A;  3FS7 A;  3VRP A;  3IQQ A;  1B47 A;  1YUU A;  3NSO A;  4CPV A;  4GUK A;  1JSA A;  2LMV A;  1OMV A; 
#chains in the Genus database with same CATH topology
 3O78 A;  1B7T Z;  1DGU A;  1OSA A;  1SMG A;  3BXK A;  2LP2 A;  2WCJ A;  1U5I B;  2P71 A;  3H4S E;  1C7V A;  3B7A A;  4JKT A;  2RGI A;  1FI5 A;  2LC5 A;  2GGM A;  1QIW A;  2M8U A;  1DJY A;  4DRW A;  1K95 A;  1XK4 A;  2K8M B;  1Y1U A;  3EK4 A;  1QVI Y;  5AEQ A;  2Q4U A;  1UWO A;  2K2A A;  3A8R A;  1KQV A;  4FQT A;  1CNP A;  4PE0 A;  3WHU B;  1ZOT B;  5FI2 A;  1SNL A;  1TNX A;  4DUQ A;  2VRG A;  4R1E A;  4YRU A;  2LNK A;  4DS7 A;  3DVK A;  1MHO A;  1V1F A;  2F3Z A;  5GQQ C;  2JT3 A;  1DJW A;  4NQG A;  2SAS A;  5DKR A;  5HLV A;  1A4P A;  1LA3 A;  2CBL A;  2KAV A;  2KFF A;  3PM2 A;  1K2H A;  1UHJ A;  2QDI A;  4QJ5 B;  1TUJ A;  4MN0 A;  3R1P A;  2LLT A;  5I2L A;  2H2K A;  3D0Y A;  3NHI A;  1SBJ A;  1XYD A;  1OOJ A;  3KF9 A;  2GTE A;  2L5Y A;  3FIA A;  1KFU S;  3KHE A;  3K1E A;  1IH0 A;  1CM4 A;  4F0Z B;  4GPL B;  5AAN A;  1CMF A;  2LCP A;  1HQV A;  1WDC B;  1QX7 A;  2M29 A;  3PFV A;  4OKH A;  4XJK A;  3OB1 B;  2O60 A;  1CDP A;  1TIZ A;  3VGO A;  2KLD A;  4HRG A;  1AJ4 A;  3SG4 A;  2KBM A;  1XO5 A;  2KOT A;  2NCO A;  3EK8 A;  2JT8 A;  2KI4 B;  3I5I B;  5HKW A;  3OHM B;  1JF0 A;  3FE9 A;  3L47 A;  1CLL A;  1EH2 A;  3NHT A;  1DQE A;  5IBW A;  1J7P A;  4OV2 A;  1OMD A;  2ZRS A;  2PAL A;  3CWG A;  1M45 A;  1S3P A;  2M7N A;  3DVE A;  3LK1 A;  5CSI A;  1OOG A;  1V1G A;  3B87 A;  3IQO A;  2PAS A;  4AQJ A;  1MQ1 A;  1Z2C B;  1ORG A;  3CR2 A;  1DF0 A;  1SL7 A;  4PDZ A;  3SS3 A;  3GK1 A;  4ZCU A;  5KTY A;  3EVV A;  2PMY A;  2MBX A;  2MA2 A;  5PAL A;  2KFH A;  2FJY A;  2BKH B;  1K96 A;  1F8H A;  2EHB A;  3LL8 B;  4PHM A;  4C0K A;  3SG7 A;  1XFU O;  4ORB B;  1DEK A;  1SRA A;  4CFQ A;  5I8N A;  1S6J A;  1UHN A;  1NWD A;  1MF8 B;  3TS5 B;  3DY9 A;  1N0Y A;  2E30 A;  2MRD A;  2LUC A;  4MSP A;  3R1O A;  2MAZ A;  2OTG C;  1B8R A;  2H61 A;  3PM8 A;  1MWN A;  2LP3 A;  3FE8 A;  1K94 A;  1PAL A;  2BBM A;  2ZND A;  3I5I C;  1ZFS A;  3CR4 X;  3D77 A;  3RLZ A;  1EJ3 A;  2L4H A;  1WLZ A;  2BE4 A;  1PK0 D;  2F2P A;  3F45 A;  5I94 A;  1YX8 A;  1UUR A;  2ZN9 A;  1IRJ A;  4CFR A;  2KYC A;  2LVV A;  2WOS A;  1OQP A;  3I5G C;  1IKU A;  4N1G A;  1PSR A;  1CTR A;  2KI6 C;  1BOC A;  2L4I A;  4CLN A;  3CR5 X;  3DF0 B;  4PHK A;  1JBA A;  1B1G A;  1AK8 A;  5JJG A;  3FE6 A;  3PN7 B;  4QJ3 B;  2WCF A;  5CSJ A;  1A75 B;  2FJU B;  3DXL A;  2O5G A;  2L5X B;  2K0J A;  5FI6 A;  3K21 A;  1QAS A;  3CZT X;  2QEB A;  5CPV A;  1UP5 A;  1NCZ A;  3ICB A;  1GQM A;  2K7C A;  2M7L A;  2HF5 A;  1QTX A;  1SPY A;  2G2B A;  2K61 A;  1SSE B;  1UUS A;  5J3X A;  3S0D A;  4YGD B;  2JU0 A;  3OBV A;  4YGC B;  3D75 A;  1OOH A;  1RWY A;  3VRN A;  3B86 A;  1ZUZ A;  1TOP A;  3CGA A;  3S0E A;  1C07 A;  1REC A;  1BT6 A;  3KPX A;  1KWO B;  2M49 B;  1OE9 B;  2GGZ A;  4YBH B;  3SIA A;  5CSN A;  1DT7 B;  1BG1 A;  3R1V A;  1QAT A;  1YRU B;  3HX4 A;  4GNK B;  1N65 A;  3RM1 A;  2G9B A;  1GJY A;  2K7D A;  1UHH A;  1MR8 A;  3B6X A;  3TDI A;  1H8B A;  2Y5I A;  1XFV O;  3BFB A;  1XFZ O;  2BBN A;  2I94 A;  1KK7 Y;  4GGN A;  4Q04 A;  4CID A;  2LE9 B;  4WRI A;  3M0W A;  2JNX A;  2KDH A;  1NIW A;  1JUO A;  2QEH A;  1XFW O;  2CXJ A;  1YUS A;  3BUX B;  3BOW A;  2CT9 A;  3PN7 C;  2WOR A;  4PE4 A;  1OZS A;  2WCL A;  2ZNE A;  4U8D A;  3CZ2 A;  1S5G Z;  1A2X A;  1CDM A;  1MUX A;  1EL4 A;  2M3W A;  2ZKM X;  1F54 A;  4GGF A;  1B7T Y;  1EXR A;  2L2C A;  4USL A;  1TN4 A;  1EG4 A;  3ZNI A;  1NCY A;  1M31 A;  1L2O B;  1C3Z A;  1K9P A;  4M2P A;  2LMT A;  2KAY A;  2V53 A;  2ZN8 A;  1MXE A;  4IL1 A;  3TDZ A;  2F2O A;  5CSF A;  1ALW A;  1KWO C;  1JFK A;  1LIN A;  1OW4 A;  2EC6 C;  2L50 A;  2KPH A;  1TNQ A;  2KNE A;  3LK0 A;  3CYZ A;  3CZ1 A;  4INW A;  2IS9 A;  1S5G Y;  3I5F C;  1WLM A;  4P2Y B;  2CNP A;  1BR1 B;  1DVI A;  3SS4 A;  3OX5 A;  2K7B A;  1W9Z A;  1TNP A;  3CLN A;  5D7F A;  1SL9 A;  4PCW A;  2KAX A;  3AKB A;  2LHL A;  4FQO A;  2JC2 A;  3VRQ A;  2LVK A;  5HKZ A;  1TRF A;  1SCV A;  2OTG B;  4M2Q A;  2ISD A;  3SG2 A;  2AMI A;  2BE6 A;  2LLS A;  2PQL A;  1DC1 A;  1OZO A;  3PLF B;  5HLO A;  1CDN A;  3DVJ A;  1KCY A;  3BUM B;  3DYE A;  4WQ3 A;  1CMG A;  3D76 A;  1Y1A A;  1CFD A;  1FW4 A;  2F33 A;  2FCE A;  1MXL C;  1BR4 B;  1RTP 1;  1YVH A;  4JQ0 D;  3PSR A;  1VRK A;  1DEL A;  1OOI X;  3ZWH A;  3I5G B;  3RZS A;  1L2O C;  1QIV A;  3QRX A;  1QV0 A;  4GFT A;  2L2E A;  2LVJ A;  1H4B A;  4MVF A;  3DZT A;  2LAP A;  2L0P A;  2JPO A;  3N7H A;  3UO9 A;  1IJ6 A;  2LAN A;  1AP4 A;  2JNF A;  4MBE A;  2I2R E;  2L98 A;  1F4Q A;  3NSL A;  2K7O A;  3GK2 A;  1B9A A;  4GAO A;  3S0F A;  2CTN A;  3JTD C;  4HRH A;  3OP0 A;  1S1E A;  1Q80 A;  3L4A A;  4D1E A;  2JXL A;  2WCH A;  2QPT A;  3LLE A;  3QME A;  1KFU L;  1G33 A;  1NCX A;  4MRY A;  4YGB B;  4QJ4 B;  1D1O A;  1SYM A;  1SK6 D;  1F55 A;  1Y6W A;  2GV5 A;  1U5I A;  3WXA A;  3KO0 A;  1Y0V H;  3WNX B;  4UPG A;  2SCP A;  2KLE A;  2WCB A;  4N5X A;  1FBV A;  2TN4 A;  1BLQ A;  1S6C A;  1YRT B;  3VB1 A;  3WHT B;  1SR6 B;  4C0L A;  1PRW A;  2M97 A;  1YUT A;  3BFA A;  4INX A;  3DD4 A;  1ALV A;  1K90 D;  1CFP A;  5KU1 A;  2M1U A;  1YX7 A;  5AFP A;  4YGE B;  2NCP A;  3MSE B;  1YUR A;  2BKI B;  4A4C A;  1GGW A;  3EG5 B;  4DIR A;  3TUY C;  1ODB A;  3D78 A;  1S26 D;  3I5H C;  1JF2 A;  2JPT A;  2L51 A;  2H8V A;  3D0Y B;  1SCM B;  5AXI A;  4AQI A;  1IQ3 A;  1K9K A;  4MLW A;  4I5N B;  2BEC A;  3GOF A;  1DJH A;  1UHK A;  1K93 D;  4XJK B;  2Y4Q A;  3D10 A;  1E8A A;  1ZMZ A;  2EGD A;  3O4Y A;  3V2L A;  1DTL A;  2M0R A;  1J7Q A;  3PAL A;  1DJI A;  1KFX S;  1SW8 A;  2BCB A;  1JWD A;  1YVL A;  1XK4 C;  4HSZ A;  3KEV A;  5FI7 A;  1IIO A;  3O6B A;  2ERB A;  2Y1M A;  3HCM A;  2JUL A;  2KQY A;  4N1F A;  3NXA A;  3UNW A;  2EC6 B;  2HPS A;  2PRU A;  3SG6 A;  4BY4 A;  3SG3 A;  2QEO A;  3I5F B;  1F71 A;  1SR6 C;  1XFR A;  3Q8I A;  2WND A;  1QLS A;  1WRL A;  2QEV A;  4E68 A;  3AAJ A;  5G08 A;  1B4C A;  1YTZ C;  2KFG A;  4M2O A;  4DCK A;  2BNX A;  1K8U A;  2KYF A;  1XFX O;  4HRE E;  1BMO A;  1DF0 B;  4JD9 A;  4I5L B;  3TDU A;  1JC2 A;  1A29 A;  2BL0 C;  2WC8 A;  1SCM C;  1NYA A;  4NDD A;  2BCA A;  1QS7 A;  2KGR A;  4ORC B;  5DKQ A;  4AOM A;  4A4B A;  1W7J B;  2BAP A;  1B8C A;  1QV1 A;  1TCF A;  2OS8 C;  4OCI A;  1HT9 A;  1G8I A;  1R6P A;  5KSZ A;  5HL1 A;  3C1V A;  5HYD A;  1DMO A;  2KQ6 A;  2LM5 A;  2MJW B;  1SY9 A;  1CFC A;  1KSM A;  3BUN B;  4YI8 A;  1CKK A;  3SS5 A;  1LKJ A;  1BOD A;  1TTX A;  4I5K A;  1LXF C;  1G4Y R;  2NZ0 A;  1CM1 A;  1KFX L;  1QX2 A;  1RFJ A;  2PVB A;  1LA0 A;  3CTN A;  3EVR A;  3L4L A;  3E3R A;  3JVT C;  1WRK A;  5EL2 A;  1IJ5 A;  2JRF A;  3R72 A;  1DJZ A;  1M39 A;  4YI9 A;  5TNC A;  1J7O A;  2LMU A;  3D73 A;  3JTD B;  4L9M A;  3B88 A;  2K2F A;  3EKH A;  4JWQ A;  4ICB A;  2LHI A;  1DGV A;  3VRO A;  4MEW A;  2K60 A;  4PT1 A;  1PVB A;  3IVT A;  1RK9 A;  1CB1 A;  1C3Y A;  1N2D A;  1QLK A;  3LCP C;  1QX5 B;  3BQ3 A;  1LS8 A;  2LUX A;  2JTZ A;  2JOJ A;  4PHN A;  2I18 A;  1NX3 A;  4BY5 A;  2JQ6 A;  1KK8 C;  4MZK A;  1AJ5 A;  3EKJ A;  2Y1N A;  2HET A;  3DF0 A;  1OOF A;  1M46 A;  1QXP A;  1Y1X A;  3PJI A;  1IG5 A;  5ER4 X;  1GM0 A;  1A75 A;  2ZRT A;  1XA5 A;  2NXQ A;  2MLF C;  2LVI A;  1A03 A;  3FWC A;  1R2U A;  3BUW B;  3O2P A;  5I2O A;  3OGN A;  4PHJ A;  3TUY B;  1CLM A;  3I5H B;  2JZI A;  3O4X A;  1NP8 A;  2H61 C;  3CS1 A;  4ZCV A;  2CCM A;  4FTG A;  2E6W A;  2M1K B;  5F6T A;  1J1D A;  1FF1 A;  2I7A A;  3TZ1 A;  1QWV A;  4NDB A;  2AUC A;  1CDL A;  2PSR A;  1WRZ A;  3OX6 A;  2WCM A;  2P6B B;  3GK4 X;  2WCE A;  2DOQ A;  1AHR A;  1TNW A;  2B1U A;  2COL B;  3BUO B;  2F8P A;  1ZAC A;  1WY9 A;  4PE7 A;  3BYA A;  2JWW A;  4MRX A;  3BOW B;  3SG5 A;  1J55 A;  5DKN A;  1F70 A;  3S0G A;  1UHI A;  2WC5 A;  5K89 A;  1RJV A;  3NGV A;  4TNC A;  2WCK A;  1L7Z A;  5D69 A;  1KQM B;  2KI6 D;  3OB2 B;  2KSP A;  4I5J A;  3S0A A;  4MZL A;  1NPQ A;  2PYQ A;  1FI6 A;  1M63 B;  1RRO A;  3AAK A;  1K9U A;  3BFH A;  4P5O E;  5AER A;  1P28 A;  2WC6 A;  3FWB A;  5DIC A;  1FPW A;  1CFF A;  1DJG A;  1YR5 A;  1B8L A;  1WDC C;  2M9G A;  4PE1 A;  1CLB A;  2BL0 B;  1C7W A;  1IGV A;  2D8N A;  1SKT A;  1NX2 A;  1S36 A;  2FOT A;  5JOL A;  4IJ7 A;  1PUL A;  2KBI A;  3EVU A;  4XYN A;  3D74 A;  4KYN A;  1NX0 A;  1T14 A;  1NSH A;  3VRR A;  3SJS A;  2KI4 C;  2Q91 A;  4GBA A;  1BJF A;  2FCD A;  2JTT A;  3SIB A;  2F3Y A;  2OS8 B;  2P70 A;  4OVN F;  4YGA A;  5ER5 A;  1AVS A;  4PAL A;  2KHN A;  5I2Q A;  1JFJ A;  1OMR A;  2A4J A;  1PVA A;  4C0J A;  2MLE C;  3BJH A;  5FYX A;  1XFY O;  1AUI B;  1TUZ A;  3NSK A;  3IF7 A;  2R2I A;  1QJT A;  1KSO A;  3PAT A;  1XVJ A;  2YGU A;  4MZJ A;  4WQ2 A;  1PSB A;  3JVT B;  3NSI A;  1IWQ A;  1NX1 A;  1J1E A;  1TCO B;  4JPZ B;  1KQM C;  4F7F A;  4GGF C;  3S0B A;  3CZ0 A;  1NUB A;  5HKY A;  4OZD A;  2NLN A;  5BPJ A;  1TWO A;  2QAC A;  1SL8 A;  1EG3 A;  2HQ8 A;  1LVC D;  2LLU A;  1BF5 A;  1GGZ A;  2AAO A;  3CAB A;  4ORA B;  1KK7 Z;  2OPO A;  1DJX A;  1X02 A;  2JXC A;  2LV7 A;  3A4U B;  1J7R A;  5D3O A;  1W7I B;  3CDN A;  4ETO A;  2ZFD A;  1IQ5 A;  5B8I B;  1F4O A;  4NDC A;  3TS5 C;  1BU3 A;  2BCX A;  3AKA A;  1KK8 B;  2JT0 A;  2KGB C;  1QVI Z;  1Z4H A;  3DVM A;  2MHH A;  3EK7 A;  1S6I A;  4OR9 B;  2HQW A;  3FS7 A;  3VRP A;  3IQQ A;  1B47 A;  1YUU A;  3NSO A;  4CPV A;  4GUK A;  1JSA A;  2LMV A;  1OMV A; 
#chains in the Genus database with same CATH homology
 3O78 A;  1B7T Z;  1DGU A;  1OSA A;  1SMG A;  3BXK A;  2LP2 A;  1U5I B;  1C7V A;  3H4S E;  2RGI A;  1FI5 A;  2LC5 A;  2GGM A;  1QIW A;  2M8U A;  1DJY A;  4DRW A;  1K95 A;  1XK4 A;  2K8M B;  1Y1U A;  3EK4 A;  1QVI Y;  5AEQ A;  2Q4U A;  1UWO A;  2K2A A;  3A8R A;  1KQV A;  1CNP A;  4PE0 A;  3WHU B;  1ZOT B;  1SNL A;  1TNX A;  4DUQ A;  2VRG A;  4R1E A;  4YRU A;  2LNK A;  4DS7 A;  3DVK A;  1MHO A;  1V1F A;  2F3Z A;  5GQQ C;  2JT3 A;  1DJW A;  4NQG A;  2SAS A;  5DKR A;  5HLV A;  1A4P A;  1LA3 A;  2CBL A;  2KAV A;  2KFF A;  1K2H A;  1UHJ A;  4QJ5 B;  4MN0 A;  2LLT A;  5I2L A;  2H2K A;  3D0Y A;  1SBJ A;  1XYD A;  1OOJ A;  3KF9 A;  3FIA A;  3KHE A;  1KFU S;  1IH0 A;  1CM4 A;  4F0Z B;  4GPL B;  5AAN A;  1CMF A;  2LCP A;  1HQV A;  1WDC B;  1QX7 A;  2M29 A;  3PFV A;  4OKH A;  4XJK A;  3OB1 B;  2O60 A;  1CDP A;  1TIZ A;  3VGO A;  4HRG A;  1AJ4 A;  3SG4 A;  2KBM A;  1XO5 A;  2KOT A;  2NCO A;  3EK8 A;  2JT8 A;  2KI4 B;  3I5I B;  5HKW A;  3OHM B;  1JF0 A;  1CLL A;  5IBW A;  1J7P A;  4OV2 A;  1OMD A;  2ZRS A;  2PAL A;  3CWG A;  1M45 A;  1S3P A;  2M7N A;  3DVE A;  3LK1 A;  5CSI A;  1BOC A;  1V1G A;  4AQJ A;  3IQO A;  2PAS A;  1MQ1 A;  3CR2 A;  1DF0 A;  1SL7 A;  4PDZ A;  3GK1 A;  4ZCU A;  5KTY A;  3EVV A;  2PMY A;  2MBX A;  2MA2 A;  5PAL A;  2KFH A;  2BKH B;  1K96 A;  1F8H A;  2EHB A;  3LL8 B;  4PHM A;  4C0K A;  3SG7 A;  1XFU O;  4ORB B;  4CFQ A;  1SRA A;  5I8N A;  1S6J A;  1UHN A;  1NWD A;  1MF8 B;  3TS5 B;  1N0Y A;  2E30 A;  2MRD A;  2LUC A;  4MSP A;  2MAZ A;  2OTG C;  1B8R A;  2H61 A;  3PM8 A;  1MWN A;  2LP3 A;  1K94 A;  1PAL A;  2BBM A;  2ZND A;  3I5I C;  1ZFS A;  3CR4 X;  3RLZ A;  1EJ3 A;  2L4H A;  1WLZ A;  2BE4 A;  1PK0 D;  2F2P A;  3F45 A;  1YX8 A;  1UUR A;  2ZN9 A;  1IRJ A;  4CFR A;  2KYC A;  2LVV A;  2WOS A;  1OQP A;  3I5G C;  1IKU A;  4N1G A;  1PSR A;  1CTR A;  2KI6 C;  2L4I A;  4CLN A;  3CR5 X;  3DF0 B;  4PHK A;  1JBA A;  1B1G A;  1AK8 A;  5JJG A;  4QJ3 B;  3PN7 B;  5CSJ A;  2WCF A;  1C07 A;  1A75 B;  2FJU B;  2O5G A;  2L5X B;  2K0J A;  3K21 A;  1QAS A;  3CZT X;  5CPV A;  1UP5 A;  1NCZ A;  3ICB A;  1GQM A;  2K7C A;  2M7L A;  2HF5 A;  1QTX A;  1SPY A;  2G2B A;  2K61 A;  1UUS A;  5J3X A;  4YGD B;  2JU0 A;  4YGC B;  1RWY A;  3VRN A;  1ZUZ A;  1TOP A;  3CGA A;  1REC A;  1BT6 A;  3KPX A;  1KWO B;  2M49 B;  1OE9 B;  2GGZ A;  4YBH B;  3SIA A;  5CSN A;  1DT7 B;  1BG1 A;  1QAT A;  1YRU B;  3HX4 A;  4GNK B;  1N65 A;  3RM1 A;  2G9B A;  1GJY A;  2K7D A;  1UHH A;  1MR8 A;  3TDI A;  1H8B A;  2Y5I A;  1XFV O;  4Q04 A;  1XFZ O;  2BBN A;  2I94 A;  1KK7 Y;  4GGN A;  4CID A;  2LE9 B;  4WRI A;  3M0W A;  2JNX A;  2KDH A;  1NIW A;  1JUO A;  1XFW O;  2CXJ A;  1YUS A;  3BUX B;  3BOW A;  2CT9 A;  3PN7 C;  2WOR A;  4PE4 A;  1OZS A;  4U8D A;  2ZNE A;  1S5G Z;  1A2X A;  1CDM A;  1MUX A;  1EL4 A;  2M3W A;  2ZKM X;  1F54 A;  4GGF A;  1B7T Y;  1EXR A;  4USL A;  1TN4 A;  1EG4 A;  3ZNI A;  1NCY A;  1M31 A;  1L2O B;  1K9P A;  4M2P A;  2LMT A;  2KAY A;  2V53 A;  2ZN8 A;  1MXE A;  4IL1 A;  3TDZ A;  2F2O A;  5CSF A;  1ALW A;  1KWO C;  1JFK A;  1LIN A;  2EC6 C;  2L50 A;  1TNQ A;  2KNE A;  3LK0 A;  2IS9 A;  1S5G Y;  3I5F C;  1WLM A;  4P2Y B;  2CNP A;  1BR1 B;  1DVI A;  3OX5 A;  2K7B A;  3CLN A;  1TNP A;  5D7F A;  1SL9 A;  4PCW A;  2KAX A;  3AKB A;  2LHL A;  4FQO A;  2JC2 A;  3VRQ A;  2LVK A;  5HKZ A;  1TRF A;  1SCV A;  2OTG B;  4M2Q A;  2ISD A;  3SG2 A;  2AMI A;  2BE6 A;  2LLS A;  1OZO A;  3PLF B;  5HLO A;  1CDN A;  3DVJ A;  1KCY A;  3BUM B;  4WQ3 A;  1CMG A;  1Y1A A;  1CFD A;  1FW4 A;  2F33 A;  2FCE A;  1MXL C;  1BR4 B;  1RTP 1;  1YVH A;  4JQ0 D;  3PSR A;  1VRK A;  3ZWH A;  3I5G B;  1L2O C;  1QIV A;  3QRX A;  1QV0 A;  4GFT A;  2L2E A;  2LVJ A;  1H4B A;  4MVF A;  2LAP A;  2L0P A;  1IJ6 A;  2LAN A;  1AP4 A;  2JNF A;  4MBE A;  2I2R E;  2L98 A;  1F4Q A;  3NSL A;  2K7O A;  3GK2 A;  1B9A A;  4GAO A;  2CTN A;  3JTD C;  4HRH A;  3OP0 A;  1S1E A;  1Q80 A;  4D1E A;  2JXL A;  2QPT A;  3LLE A;  1KFU L;  1G33 A;  1NCX A;  4MRY A;  4YGB B;  4QJ4 B;  1D1O A;  1SYM A;  1SK6 D;  1F55 A;  1Y6W A;  2GV5 A;  1U5I A;  3WXA A;  3KO0 A;  1Y0V H;  3WNX B;  4UPG A;  2SCP A;  2WCB A;  4N5X A;  1FBV A;  2TN4 A;  1BLQ A;  1S6C A;  1YRT B;  3WHT B;  4C0L A;  1SR6 B;  1PRW A;  2M97 A;  1YUT A;  1CFP A;  3DD4 A;  1ALV A;  1K90 D;  5KU1 A;  2M1U A;  1YX7 A;  5AFP A;  4YGE B;  2NCP A;  3MSE B;  1YUR A;  2BKI B;  4A4C A;  1GGW A;  4DIR A;  3TUY C;  1ODB A;  1S26 D;  3I5H C;  1JF2 A;  2JPT A;  2L51 A;  3D0Y B;  1SCM B;  5AXI A;  4AQI A;  1IQ3 A;  1K9K A;  4MLW A;  4I5N B;  2BEC A;  3GOF A;  1DJH A;  1UHK A;  1K93 D;  4XJK B;  2Y4Q A;  3D10 A;  1E8A A;  1ZMZ A;  2EGD A;  3O4Y A;  1DTL A;  2M0R A;  1J7Q A;  3PAL A;  1DJI A;  1KFX S;  1SW8 A;  2BCB A;  1JWD A;  1YVL A;  1XK4 C;  4HSZ A;  3KEV A;  3O6B A;  2Y1M A;  3HCM A;  2JUL A;  2KQY A;  4N1F A;  3NXA A;  2EC6 B;  2HPS A;  2PRU A;  3SG6 A;  4BY4 A;  3SG3 A;  3I5F B;  1F71 A;  1SR6 C;  2WND A;  1QLS A;  1WRL A;  4E68 A;  3AAJ A;  5G08 A;  1B4C A;  1YTZ C;  2KFG A;  4M2O A;  4DCK A;  1K8U A;  2KYF A;  1XFX O;  4HRE E;  1BMO A;  1DF0 B;  4I5L B;  3TDU A;  1JC2 A;  1A29 A;  2BL0 C;  2WC8 A;  1SCM C;  1NYA A;  4NDD A;  2BCA A;  1QS7 A;  2KGR A;  4ORC B;  5DKQ A;  4AOM A;  4A4B A;  1W7J B;  1B8C A;  1QV1 A;  1TCF A;  2OS8 C;  4OCI A;  1HT9 A;  1G8I A;  1R6P A;  5KSZ A;  3C1V A;  5HYD A;  1DMO A;  2KQ6 A;  2LM5 A;  2MJW B;  1SY9 A;  1CFC A;  1KSM A;  3BUN B;  4YI8 A;  1CKK A;  1LKJ A;  1BOD A;  1TTX A;  4I5K A;  1LXF C;  1G4Y R;  2NZ0 A;  1CM1 A;  1KFX L;  1QX2 A;  1RFJ A;  2PVB A;  1LA0 A;  3CTN A;  3EVR A;  3E3R A;  3JVT C;  1WRK A;  1IJ5 A;  2JRF A;  4YI9 A;  1DJZ A;  1M39 A;  5TNC A;  1J7O A;  1EH2 A;  2LMU A;  3JTD B;  4L9M A;  3EKH A;  2K2F A;  4JWQ A;  4ICB A;  2LHI A;  1DGV A;  3VRO A;  4MEW A;  1PVB A;  1RK9 A;  1CB1 A;  1N2D A;  1QLK A;  3LCP C;  1QX5 B;  3BQ3 A;  2LUX A;  2JTZ A;  2JOJ A;  4PHN A;  2I18 A;  1NX3 A;  4BY5 A;  2JQ6 A;  1KK8 C;  4MZK A;  1AJ5 A;  3EKJ A;  2Y1N A;  2HET A;  3DF0 A;  1M46 A;  1QXP A;  1Y1X A;  5ER4 X;  1IG5 A;  1A75 A;  2ZRT A;  1XA5 A;  2NXQ A;  2MLF C;  2LVI A;  1A03 A;  3FWC A;  1R2U A;  3BUW B;  3O2P A;  5I2O A;  4PHJ A;  3TUY B;  1CLM A;  3I5H B;  2JZI A;  1NP8 A;  2H61 C;  3CS1 A;  4ZCV A;  2CCM A;  4FTG A;  2E6W A;  2M1K B;  5F6T A;  1J1D A;  1FF1 A;  2I7A A;  3TZ1 A;  4NDB A;  2AUC A;  1CDL A;  2PSR A;  1WRZ A;  3OX6 A;  2P6B B;  3GK4 X;  2WCE A;  2DOQ A;  1AHR A;  1TNW A;  2B1U A;  2COL B;  3BUO B;  2F8P A;  1ZAC A;  1WY9 A;  4PE7 A;  3BYA A;  2JWW A;  4MRX A;  3BOW B;  3SG5 A;  1J55 A;  5DKN A;  1F70 A;  1UHI A;  5K89 A;  1RJV A;  4TNC A;  1L7Z A;  5D69 A;  1KQM B;  2KI6 D;  3OB2 B;  2KSP A;  4I5J A;  4MZL A;  1NPQ A;  1FI6 A;  1M63 B;  1RRO A;  3AAK A;  1K9U A;  4P5O E;  5AER A;  3FWB A;  1FPW A;  1CFF A;  1DJG A;  1YR5 A;  1B8L A;  1WDC C;  2M9G A;  4PE1 A;  1CLB A;  2BL0 B;  1C7W A;  1IGV A;  2D8N A;  1SKT A;  1NX2 A;  1S36 A;  2FOT A;  5JOL A;  1PUL A;  2KBI A;  3EVU A;  4XYN A;  1NX0 A;  3VRR A;  1NSH A;  3SJS A;  2KI4 C;  2Q91 A;  4GBA A;  1BJF A;  2FCD A;  2JTT A;  3SIB A;  2F3Y A;  2OS8 B;  4OVN F;  4YGA A;  5ER5 A;  5I2Q A;  1AVS A;  4PAL A;  2KHN A;  1JFJ A;  1OMR A;  2A4J A;  1PVA A;  4C0J A;  2MLE C;  5FYX A;  1XFY O;  1AUI B;  3NSK A;  3IF7 A;  2R2I A;  1QJT A;  1KSO A;  3PAT A;  1XVJ A;  4MZJ A;  4WQ2 A;  1PSB A;  3JVT B;  3NSI A;  1IWQ A;  1NX1 A;  1J1E A;  1TCO B;  4JPZ B;  1KQM C;  4GGF C;  1NUB A;  5HKY A;  2NLN A;  5BPJ A;  2QAC A;  1SL8 A;  1EG3 A;  2HQ8 A;  1LVC D;  2LLU A;  1BF5 A;  1GGZ A;  2AAO A;  4ORA B;  1KK7 Z;  2OPO A;  1DJX A;  1X02 A;  2JXC A;  2LV7 A;  3A4U B;  1J7R A;  1W7I B;  4ETO A;  2ZFD A;  1IQ5 A;  5B8I B;  1F4O A;  4NDC A;  3TS5 C;  1BU3 A;  2BCX A;  3AKA A;  1KK8 B;  2JT0 A;  2KGB C;  1QVI Z;  3DVM A;  4OR9 B;  2MHH A;  3EK7 A;  1S6I A;  2HQW A;  3FS7 A;  3VRP A;  3IQQ A;  1B47 A;  1YUU A;  3NSO A;  4CPV A;  4GUK A;  1JSA A;  2LMV A;  1OMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...