2KYFA

Solution structure of calcium-bound cpv3
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
108
structure length
108
Chain Sequence
SLTDILSPSDIAAALRDCQAPDSFSPKKFFQISGMSKKSSSQLKEIFRILDNDQSGFIEEDELKYFLQRFESGARVLTASETKTFLAAADHDGDGKIGAEEFQEMVQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium binding protein
molecule keywords Parvalbumin, thymic CPV3
publication title Solution structures of chicken parvalbumin 3 in the Ca(2+)-free and Ca(2+)-bound states.
pubmed doi rcsb
source organism Gallus gallus
total genus 14
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2010-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2kyfA00
2EGDA 1NCYA 1X02A 3JTDC 1CFCA 2CNPA 2GGZA 1MWNA 3H4SE 1EG4A 4WQ3A 3FWCA 1CLMA 3KPXA 3M0WA 1Y1XA 1DJWA 1XO5A 2K7DA 3K21A 4I5NB 2NCOA 1TTXA 1BU3A 1G33A 1DT7B 1TRFA 3VRRA 3A4UB 4XJKB 1IGVA 2CCMA 4ETOA 2CBLA 4UPGA 3DF0A 3PFVA 1SK6D 1SMGA 2L51A 4M2OA 2JC2A 1TNXA 2KFGA 3OP0A 3O2PA 5DKNA 1ALWA 1JFKA 1WRKA 2JU0A 1DJYA 2AMIA 1EXRA 3OB1B 4PHNA 3AKBA 5CSIA 1CM1A 5HKWA 2Y5IA 4ORBB 1NX0A 1YUSA 2WCEA 3I5IB 1F54A 2SCPA 1IJ5A 1K9PA 5KTYA 1QX7A 1PRWA 2COLB 5AXIA 3WNXB 3FWBA 1UWOA 2MRDA 4AQIA 2LC5A 3EVVA 1CFDA 4R1EA 1IWQA 3TDUA 1NUBA 1K96A 3D0YA 4MLWA 2WORA 1OQPA 3SG5A 1NWDA 2KQ6A 3EK8A 3EVRA 3OX6A 1BF5A 1FI5A 2LLUA 3PN7B 1CDLA 1M39A 3TZ1A 4HSZA 3HX4A 1KFXL 4CLNA 4AQJA 5J3XA 1AHRA 3PSRA 2WC8A 1XFZO 2K61A 2L0PA 4N1FA 1AJ4A 2MBXA 3AAKA 2PRUA 4D1EA 2JOJA 1UHHA 1N2DA 1OZOA 4XYNA 3SG6A 3ZWHA 2H2KA 5CSNA 4NDDA 4PE7A 4U8DA 5F6TA 3A8RA 4ORAB 1Y1UA 1CFPA 1ZACA 1QIWA 1K94A 2HF5A 4YI8A 4GUKA 4GGFC 1J1DA 1DVIA 3RLZA 4PALA 4YBHB 2JXCA 1SY9A 1L2OC 2JT3A 2Q91A 1AJ5A 1AVSA 3I5HB 5AFPA 1IG5A 2K2FA 1WRZA 4PHMA 1PULA 1AUIB 1WLMA 1JF0A 1EL4A 1YTZC 2WCFA 1JUOA 1JSAA 1RFJA 3SIAA 2I94A 2ZN8A 3I5FC 4GBAA 1SNLA 3LCPC 1EH2A 3VRQA 4L9MA 4NDCA 2FJUB 4NDBA 2TN4A 4N5XA 2KSPA 2FOTA 2LVIA 1M31A 4CFQA 2PSRA 4I5KA 1A2XA 5ER4X 3TUYC 1BLQA 1F70A 2JPTA 1QX2A 2CTNA 4QJ5B 2K7CA 1UHJA 3DF0B 3I5GB 1FPWA 5KSZA 1TCOB 2JZIA 1XFWO 2L2EA 1B1GA 2KYFA 1Q80A 1CLLA 4CFRA 1RECA 1SL7A 2NLNA 1DJGA 2D8NA 1YRTB 1ALVA 1CMFA 4GGNA 1YVHA 2KFHA 2ZRTA 2LVJA 1V1FA 2K8MB 2K7BA 1KQMC 2BBNA 1S3PA 2OTGB 1YR5A 2ZN9A 3BUMB 2Q4UA 4MRYA 1RROA 2H61A 3WHTB 3JVTC 2LM5A 4P5OE 4TNCA 2KQYA 4OCIA 2SASA 2M9GA 1JBAA 1UHIA 1F8HA 3D0YB 2F2PA 2JQ6A 3BUNB 2M3WA 4CPVA 2ZKMX 1D1OA 2M1UA 4GNKB 4YGAA 1R2UA 1JF2A 3I5GC 2I7AA 1PALA 2DOQA 1WDCC 1A4PA 1DJHA 1Y1AA 1TNQA 2LVKA 1TIZA 4I5LB 2HQ8A 1MXEA 2OS8B 1GQMA 1S26D 2BCXA 1SR6C 2FCEA 4WQ2A 1DJZA 1CLBA 1KWOB 1NP8A 1Y0VH 1LA0A 2ZNEA 2MLEC 1RJVA 2VRGA 4ICBA 3CGAA 3CR5X 1J7PA 1SYMA 3EVUA 1Y6WA 4MZKA 1IH0A 2Y1NA 5I2OA 2K7OA 1QASA 2KI4B 4AOMA 2L98A 4JQ0D 1C7WA 2O5GA 3VROA 1R6PA 4YI9A 2KYCA 5CSFA 1WRLA 2V53A 3DVMA 1QJTA 4YRUA 2OPOA 2L50A 2E30A 2BKHB 1ODBA 1M45A 2IS9A 1UHKA 3TDZA 1FW4A 4ZCUA 1CMGA 2LLSA 1OE9B 1XFYO 3OB2B 1KFUL 1OZSA 1KWOC 3PLFB 5CSJA 3O78A 1QLKA 1K9KA 3DVKA 1BG1A 1N65A 1DF0A 3IQQA 2JNXA 2B1UA 2GV5A 5HLOA 2ZRSA 3SG7A 2K2AA 2LE9B 3SG2A 4DIRA 2LANA 1QV0A 3ICBA 1MR8A 2HETA 2KI4C 2PMYA 3FS7A 2EC6B 4MVFA 5K89A 4PE4A 4C0JA 3KHEA 1S36A 3ZNIA 2LHLA 2F33A 1LINA 2QPTA 1K9UA 3RM1A 4GFTA 1F55A 4HRGA 3EKJA 3BUXB 3O4YA 2I2RE 2L4HA 3I5IC 1K93D 1TOPA 3FIAA 1SCMB 4MRXA 3EK4A 3BUOB 2E6WA 2G9BA 4PHJA 2BE6A 1J1EA 2F3ZA 3WXAA 1IJ6A 1JWDA 2WOSA 2NCPA 4OKHA 1DGUA 1BT6A 1IRJA 5AERA 1AP4A 3TS5B 1F4OA 1QVIY 3PN7C 1UUSA 3CLNA 2BKIB 2K0JA 1XK4A 1BODA 2F8PA 2M7LA 1IQ3A 1C7VA 2MJWB 3OX5A 4P2YB 1H8BA 1LXFC 1GJYA 5HKZA 4YGBB 2LP2A 1QATA 1KK8B 4MEWA 1NX3A 1QX5B 2A4JA 1XA5A 2EHBA 1J7RA 2BL0B 1DTLA 2NZ0A 3IF7A 1XFVO 2P6BB 2WCBA 4YGEB 1S1EA 3SG3A 4DRWA 3CTNA 3LLEA 1NSHA 1WLZA 3WHUB 2WNDA 3BOWA 1QTXA 3SG4A 5BPJA 1S6IA 3IQOA 1PK0D 1S6JA 2LUCA 1SPYA 1GGZA 5HKYA 3CR2A 5ER5A 2KGRA 1MF8B 1K90D 1LVCD 3I5HC 4GAOA 3NSIA 5DKRA 1J7OA 3BYAA 1FI6A 1BMOA 4A4BA 2G2BA 4F0ZB 1YVLA 5I8NA 1KQVA 2M29A 1FBVA 4GGFA 2M97A 1PVAA 2BBMA 3DD4A 1KFXS 2LMUA 1MQ1A 2PASA 2KAYA 2Y4QA 5GQQC 1ZMZA 2M8UA 1SBJA 1DF0B 1TNWA 1DJXA 1ZOTB 2L4IA 1NCZA 3JTDB 1A03A 2KOTA 2BECA 2GGMA 3VGOA 2LHIA 3AKAA 1KCYA 1IQ5A 2CT9A 4IL1A 4Q04A 1PVBA 4MZJA 1MXLC 1B4CA 1SL9A 1CKKA 1K8UA 1RK9A 3D10A 2MLFC 2PVBA 5JJGA 1UHNA 3C1VA 4PE1A 1QIVA 1B7TZ 4FQOA 1VRKA 4MBEA 2OTGC 1W7JB 1YX7A 1L7ZA 2KI6C 2JT0A 1KK7Y 2BCBA 1JC2A 1CNPA 2F3YA 4PDZA 1YX8A 1E8AA 1S5GY 4DUQA 1NPQA 2JTTA 3SJSA 2L5XB 3GK2A 4BY4A 4E68A 4OR9B 5IBWA 2LMTA 1PSRA 1SW8A 4QJ3B 1SCVA 1TN4A 2PALA 4HRHA 5D7FA 5HLVA 2BCAA 2F2OA 3PM8A 2JT8A 4FTGA 4DCKA 1BOCA 5I2QA 4C0LA 1DGVA 1BJFA 1QVIZ 1YURA 3BUWB 4C0KA 1U5IA 2KNEA 1F71A 3SIBA 1BR4B 2MA2A 1XFXO 2ZFDA 3KO0A 1UP5A 2I18A 4USLA 5PALA 1K2HA 1ZFSA 1YRUB 2R2IA 2MHHA 2KFFA 2OS8C 5I2LA 5AANA 2RGIA 1A75A 1OMRA 1SKTA 2M1KB 4NQGA 1CDNA 1DJIA 4M2QA 1UURA 1CM4A 1V1GA 1F4QA 4OV2A 1DMOA 1XVJA 3BOWB 1KSMA 1XYDA 2HQWA 2KBIA 3BQ3A 4JPZB 4QJ4B 3NSLA 4HREE 3O6BA 3AAJA 5DKQA 2ZNDA 1PSBA 1WY9A 2ISDA 1YUUA 1XK4C 2M0RA 4PCWA 1B7TY 1MHOA 2LVVA 2M49B 1QS7A 3BXKA 4JWQA 2CXJA 1C07A 4BY5A 1CDMA 2Y1MA 1L2OB 2LAPA 3MSEB 1CB1A 1IKUA 1RWYA 2O60A 3DVEA 1EJ3A 4MZLA 1HT9A 2LV7A 3CR4X 3I5FB 5D69A 4YGCB 2JRFA 2KAXA 1XFUO 2BE4A 2KHNA 1M63B 1W7IB 2EC6C 3TUYB 1LKJA 2HPSA 4A4CA 3PATA 3NSOA 1SRAA 1OMDA 1G4YR 4XJKA 5JOLA 3VRNA 3EK7A 5TNCA 3DVJA 2H61C 2JTZA 1KK7Z 1H4BA 4PE0A 1QXPA 1AK8A 1CDPA 3CZTX 3PALA 1A29A 1SCMC 1S5GZ 1CFFA 5G08A 1QV1A 2KBMA 1S6CA 2KAVA 1K95A 2JWWA 1BR1B 1B8RA 1KFUS 1RTP1 1KQMB 2M7NA 3HCMA 3NXAA 1ZUZA 3JVTB 2AUCA 3GK4X 1NX2A 1J7QA 1NX1A 4WRIA 1U5IB 3TS5C 2FCDA 2KDHA 4N1GA 1M46A 2LCPA 2KI6D 3TDIA 1JFJA 2MAZA 3GK1A 4YGDB 1B47A 3CWGA 1A75B 1NCXA 2JULA 2LMVA 3GOFA 3NSKA 4MN0A 3VRPA 1TCFA 1GGWA 1KK8C 1NYAA 5CPVA 1MUXA 4GPLB 1HQVA 2BL0C 4ZCVA 1WDCB 3LL8B 1KSOA 2LUXA 3CS1A 3E3RA 3LK1A 3KF9A 5KU1A 5AEQA 2KGBC 1SR6B 4ORCB 2NXQA 1QLSA 5FYXA 2JXLA 3QRXA 2LNKA 1B8CA 1B8LA 2LLTA 4I5JA 4DS7A 4CIDA 1N0YA 4OVNF 1EG3A 2AAOA 4M2PA 2JNFA 1FF1A 1SL8A 4PHKA 5B8IB 5HYDA 1CTRA 1TNPA 3KEVA 1OOJA 1YUTA 1J55A 1B9AA 1G8IA 3OHMB 2LP3A 2QACA 3LK0A 1OMVA 1OSAA 1LA3A 3EKHA 3F45A 1NIWA 4MSPA
chains in the Genus database with same CATH superfamily
2EGDA 1NCYA 1X02A 3JTDC 1CFCA 2CNPA 3BJHA 2GGZA 1MWNA 3H4SE 1EG4A 4WQ3A 3FWCA 1CLMA 3KPXA 3L47A 1Y1XA 3K1EA 3M0WA 3PJIA 1DJWA 1XO5A 2ERBA 2K7DA 3K21A 4I5NB 2NCOA 1TTXA 1BU3A 1G33A 3D77A 1DT7B 1TRFA 3VRRA 1GGWA 3A4UB 4XJKB 4OZDA 1IGVA 2CCMA 4ETOA 2CBLA 4UPGA 3DF0A 3PFVA 1SK6D 1SMGA 2L51A 4M2OA 2JC2A 1TNXA 2KFGA 3OP0A 3O2PA 5DKNA 1ALWA 1JFKA 1WRKA 2JU0A 4IJ7A 1DJYA 2AMIA 1EXRA 3OB1B 4PHNA 3AKBA 5CSIA 1CM1A 5HKWA 2Y5IA 4ORBB 1NX0A 1YUSA 2BAPA 4KYNA 2WCEA 3I5IB 1F54A 2SCPA 1IJ5A 1K9PA 5KTYA 1QX7A 1PRWA 2COLB 5AXIA 3WNXB 3FWBA 1UWOA 2MRDA 4AQIA 2LC5A 3EVVA 1CFDA 4R1EA 1IWQA 4FQTA 3TDUA 1NUBA 1K96A 3D0YA 4MLWA 2WORA 1OQPA 3SG5A 1NWDA 2KQ6A 3EK8A 3EVRA 3OX6A 1BF5A 1FI5A 2LLUA 3B6XA 3PN7B 1CDLA 2QEHA 1M39A 3TZ1A 4HSZA 3HX4A 1KFXL 4CLNA 4AQJA 5J3XA 1AHRA 3PSRA 2WC8A 1XFZO 2K61A 2L0PA 4N1FA 1AJ4A 1ORGA 2MBXA 3AAKA 2PRUA 4D1EA 2JOJA 1UHHA 1N2DA 1OZOA 3DZTA 4XYNA 3SG6A 3ZWHA 2H2KA 5CSNA 3NHIA 4NDDA 4PE7A 4U8DA 3A8RA 5F6TA 2FJYA 3BFAA 4ORAB 1Y1UA 3Q8IA 1CFPA 1ZACA 2QEBA 1QIWA 2K60A 1K94A 2HF5A 4YI8A 4GUKA 4GGFC 1J1DA 1DVIA 3RLZA 4PALA 4YBHB 2JXCA 1SY9A 2WCHA 1L2OC 2JT3A 2Q91A 1AJ5A 1AVSA 3I5HB 5AFPA 1IG5A 2K2FA 1WRZA 4PHMA 1PULA 2L5YA 1AUIB 1WLMA 1JF0A 1EL4A 1YTZC 2WCFA 1JUOA 3B7AA 3S0GA 1JSAA 1RFJA 3SIAA 2I94A 2ZN8A 3I5FC 4GBAA 1SNLA 3LCPC 3PM2A 3VRQA 4L9MA 1EH2A 3SS5A 4NDCA 3R1PA 2FJUB 3CZ1A 4INWA 4NDBA 2QEOA 2TN4A 4N5XA 2KSPA 2FOTA 2LVIA 1M31A 4CFQA 2PSRA 4I5KA 1A2XA 5ER4X 3TUYC 1BLQA 1F70A 2JPTA 1OOIX 1QX2A 2CTNA 4QJ5B 3RZSA 2K7CA 1UHJA 3DF0B 3I5GB 1FPWA 5KSZA 1TCOB 1P28A 1XFWO 2JZIA 2L2EA 2KYFA 1Q80A 1CLLA 4CFRA 1B1GA 1RECA 1SL7A 2NLNA 1DJGA 3CZ0A 2D8NA 3SS4A 1YRTB 1ALVA 1CMFA 4GGNA 1YVHA 2KFHA 2ZRTA 2LVJA 1V1FA 2K8MB 2K7BA 1KQMC 2BBNA 1S3PA 2OTGB 1YR5A 2ZN9A 3BUMB 2Q4UA 3R1VA 4MRYA 1RROA 2H61A 3WHTB 3JVTC 2LM5A 4P5OE 4TNCA 2KQYA 2YGUA 4OCIA 2SASA 2M9GA 3B88A 1JBAA 5I94A 3L4AA 1UHIA 1F8HA 3D0YB 2F2PA 2JQ6A 3BUNB 2M3WA 4CPVA 2ZKMX 1D1OA 2M1UA 4GNKB 4YGAA 1R2UA 1JF2A 3I5GC 2I7AA 1PALA 2DOQA 1WDCC 1A4PA 4PT1A 1DJHA 1Y1AA 1TNQA 2LVKA 1TIZA 4I5LB 3FE6A 1OOGA 3BFBA 2HQ8A 1MXEA 2OS8B 1TUZA 1GQMA 1S26D 2BCXA 1SR6C 2FCEA 4WQ2A 1DJZA 1CLBA 1KWOB 1NP8A 1Y0VH 1LA0A 2ZNEA 2WCKA 2MLEC 1RJVA 2VRGA 4ICBA 3CGAA 3CR5X 1J7PA 1SYMA 3EVUA 1Y6WA 4MZKA 1IH0A 1GM0A 2Y1NA 5I2OA 3OGNA 2K7OA 1QASA 2KI4B 4AOMA 2L98A 4JQ0D 1C7WA 2O5GA 3VROA 1R6PA 4YI9A 2KYCA 5CSFA 1WRLA 2V53A 3DVMA 1QJTA 4YRUA 2OPOA 3B87A 2L50A 2E30A 2BKHB 3NHTA 1ODBA 1M45A 1SSEB 3O4XA 2IS9A 1UHKA 3TDZA 1FW4A 1TUJA 4ZCUA 1CMGA 2LLSA 1OE9B 1XFYO 3DY9A 3DYEA 3OB2B 1KFUL 1OZSA 1KWOC 3PLFB 3BFHA 5CSJA 3O78A 1QLKA 1K9KA 3DVKA 3S0FA 1BG1A 1N65A 1DF0A 3IQQA 2JNXA 2B1UA 2GV5A 5HLOA 2ZRSA 3SG7A 2K2AA 2LE9B 5EL2A 3SG2A 4DIRA 2LANA 1QV0A 3ICBA 1MR8A 3B86A 2HETA 2KI4C 2PMYA 3FS7A 2EC6B 4MVFA 5K89A 4PE4A 4C0JA 3KHEA 1S36A 3CABA 3ZNIA 2LHLA 2F33A 1OOHA 3VB1A 1LINA 2QPTA 1K9UA 3RM1A 4GFTA 1F55A 3D76A 4HRGA 3EKJA 3BUXB 3O4YA 2I2RE 2L4HA 3I5IC 1K93D 1TOPA 3UO9A 1W9ZA 2BNXA 3FIAA 1SCMB 4MRXA 3CDNA 3EK4A 2WCLA 3BUOB 2QDIA 2E6WA 2G9BA 4PHJA 1J1EA 2BE6A 2F3ZA 3WXAA 1IJ6A 1JWDA 2WOSA 2NCPA 3FE9A 4OKHA 1DGUA 1BT6A 1IRJA 5AERA 1AP4A 3TS5B 1F4OA 1QVIY 3PN7C 1UUSA 3CLNA 2BKIB 2K0JA 1XK4A 1BODA 1DELA 2F8PA 2M7LA 1IQ3A 1C7VA 2MJWB 3OX5A 4P2YB 2KPHA 1H8BA 1LXFC 1GJYA 5HKZA 4YGBB 2LP2A 1QATA 1KK8B 4MEWA 1NX3A 1QX5B 2A4JA 1XA5A 2EHBA 1J7RA 2BL0B 1DTLA 1XFRA 2L2CA 2NZ0A 3IF7A 1XFVO 2P6BB 2WCBA 4YGEB 1S1EA 3SG3A 3R72A 4DRWA 3CTNA 3LLEA 1OW4A 1NSHA 1WLZA 3WHUB 2WNDA 3BOWA 1QTXA 3SG4A 5BPJA 1S6IA 3IQOA 1PK0D 1S6JA 2LUCA 1SPYA 1GGZA 5HKYA 3CR2A 5ER5A 2KGRA 1DQEA 1MF8B 1K90D 1LVCD 3I5HC 4GAOA 3IVTA 3NSIA 5DKRA 1J7OA 3BYAA 1FI6A 1BMOA 4A4BA 2G2BA 1Z2CB 1YVLA 4F0ZB 5I8NA 1KQVA 2M29A 1FBVA 3R1OA 4GGFA 2M97A 3D73A 1PVAA 2BBMA 3DD4A 1KFXS 2LMUA 1MQ1A 3EG5B 2PASA 2KAYA 2Y4QA 3CYZA 5GQQC 1ZMZA 2M8UA 1SBJA 1DF0B 1TNWA 1DJXA 1ZOTB 2L4IA 1NCZA 3JTDB 1A03A 3QMEA 2KOTA 2BECA 2GGMA 3VGOA 2LHIA 3AKAA 1KCYA 1IQ5A 2CT9A 4IL1A 4Q04A 1PVBA 3V2LA 4MZJA 1MXLC 1LS8A 1IIOA 1B4CA 1SL9A 1CKKA 1K8UA 1RK9A 2PQLA 2MLFC 2PVBA 3D10A 5JJGA 2P70A 1UHNA 3C1VA 4PE1A 3S0EA 1QIVA 1B7TZ 4FQOA 1VRKA 2WC5A 4MBEA 2OTGC 1W7JB 1YX7A 1C3ZA 1L7ZA 2KLDA 2KI6C 2JT0A 1KK7Y 2BCBA 1JC2A 2WCMA 1CNPA 2F3YA 3S0AA 4PDZA 1YX8A 1E8AA 1S5GY 4DUQA 1NPQA 2JTTA 3SJSA 2L5XB 3GK2A 4BY4A 4E68A 4OR9B 5IBWA 2LMTA 1PSRA 1SW8A 4QJ3B 1SCVA 1TN4A 2PALA 4HRHA 5D7FA 5HLVA 2BCAA 2F2OA 3PM8A 2JT8A 4FTGA 4DCKA 1BOCA 5I2QA 4C0LA 1DGVA 1BJFA 1QVIZ 5HL1A 1YURA 3BUWB 4C0KA 1U5IA 2KNEA 1F71A 3S0DA 3SIBA 1BR4B 2MA2A 1XFXO 2ZFDA 3KO0A 1UP5A 2I18A 2P71A 4USLA 5PALA 1K2HA 1ZFSA 3D74A 1YRUB 2R2IA 2MHHA 2KFFA 2OS8C 5I2LA 5AANA 2WC6A 5D3OA 2RGIA 1A75A 2JPOA 1OMRA 1SKTA 2M1KB 4NQGA 1CDNA 1DJIA 4M2QA 1UURA 1CM4A 3FE8A 1QWVA 1V1GA 1F4QA 1OOFA 4OV2A 1DMOA 1XVJA 3BOWB 1KSMA 1XYDA 3DXLA 2HQWA 2KBIA 3BQ3A 4JPZB 4QJ4B 3NSLA 4HREE 3S0BA 3O6BA 3D75A 3AAJA 3CZ2A 5DKQA 2ZNDA 1Z4HA 1PSBA 1WY9A 2ISDA 1YUUA 1XK4C 2M0RA 4PCWA 1B7TY 1MHOA 2LVVA 2M49B 1QS7A 3BXKA 4JWQA 2CXJA 1C07A 4BY5A 1CDMA 2Y1MA 1L2OB 2LAPA 3MSEB 1CB1A 1IKUA 1RWYA 2O60A 3DVEA 1EJ3A 4MZLA 1HT9A 2LV7A 2H8VA 3CR4X 3I5FB 2PYQA 4INXA 5D69A 4YGCB 2JRFA 2KAXA 3L4LA 1XFUO 2BE4A 2QEVA 3N7HA 2KHNA 1M63B 1W7IB 2EC6C 3TUYB 1LKJA 2HPSA 5DICA 3PATA 3SS3A 3NSOA 4A4CA 1SRAA 1OMDA 1G4YR 4XJKA 5JOLA 3VRNA 1C3YA 3EK7A 5TNCA 3DVJA 5FI7A 4F7FA 2H61C 2JTZA 1KK7Z 1H4BA 4PE0A 1QXPA 1AK8A 3NGVA 1CDPA 3CZTX 3PALA 1A29A 1SCMC 1S5GZ 1CFFA 1DC1A 1T14A 5G08A 1QV1A 2KBMA 1S6CA 2KAVA 1K95A 2JWWA 1BR1B 1B8RA 1KFUS 1RTP1 1KQMB 2M7NA 3HCMA 3NXAA 1ZUZA 3JVTB 2AUCA 3GK4X 1NX2A 1J7QA 1NX1A 4WRIA 1U5IB 3TS5C 2FCDA 2KDHA 4N1GA 1M46A 2LCPA 1TWOA 2KI6D 3TDIA 1JFJA 2MAZA 3GK1A 4YGDB 1DEKA 1B47A 3CWGA 1A75B 1NCXA 2GTEA 2JULA 2LMVA 3GOFA 3NSKA 4MN0A 1TCFA 3VRPA 1KK8C 1NYAA 5CPVA 3OBVA 1MUXA 4GPLB 1HQVA 2BL0C 4ZCVA 1WDCB 2WCJA 4JKTA 3LL8B 1KSOA 2LUXA 3CS1A 3E3RA 3LK1A 3KF9A 5KU1A 3D78A 5AEQA 3UNWA 2KGBC 1SR6B 4ORCB 2NXQA 1QLSA 4JD9A 5FYXA 2JXLA 3QRXA 2LNKA 1B8CA 1B8LA 2LLTA 4I5JA 5FI6A 4CIDA 4DS7A 1N0YA 4OVNF 1EG3A 2AAOA 4M2PA 2JNFA 1FF1A 1SL8A 4PHKA 5B8IB 5HYDA 1CTRA 1TNPA 3KEVA 1YUTA 1OOJA 1J55A 1B9AA 1G8IA 3OHMB 2LP3A 2QACA 3LK0A 1OMVA 1OSAA 1LA3A 3EKHA 3F45A 1NIWA 5FI2A 4MSPA 2KLEA
chains in the Genus database with same CATH topology
2EGDA 1NCYA 1X02A 3JTDC 1CFCA 2CNPA 2GGZA 1MWNA 3H4SE 1EG4A 4WQ3A 3FWCA 1CLMA 3KPXA 3M0WA 1Y1XA 1DJWA 1XO5A 2K7DA 3K21A 4I5NB 2NCOA 1TTXA 1BU3A 1G33A 1DT7B 1TRFA 3VRRA 3A4UB 4XJKB 1IGVA 2CCMA 4ETOA 2CBLA 4UPGA 3DF0A 3PFVA 1SK6D 1SMGA 2L51A 4M2OA 2JC2A 1TNXA 2KFGA 3OP0A 3O2PA 5DKNA 1ALWA 1JFKA 1WRKA 2JU0A 1DJYA 2AMIA 1EXRA 3OB1B 4PHNA 3AKBA 5CSIA 1CM1A 5HKWA 2Y5IA 4ORBB 1NX0A 1YUSA 2WCEA 3I5IB 1F54A 2SCPA 1IJ5A 1K9PA 5KTYA 1QX7A 1PRWA 2COLB 5AXIA 3WNXB 3FWBA 1UWOA 2MRDA 4AQIA 2LC5A 3EVVA 1CFDA 4R1EA 1IWQA 3TDUA 1NUBA 1K96A 3D0YA 4MLWA 2WORA 1OQPA 3SG5A 1NWDA 2KQ6A 3EK8A 3EVRA 3OX6A 1BF5A 1FI5A 2LLUA 3PN7B 1CDLA 1M39A 3TZ1A 4HSZA 3HX4A 1KFXL 4CLNA 4AQJA 5J3XA 1AHRA 3PSRA 2WC8A 1XFZO 2K61A 2L0PA 4N1FA 1AJ4A 2MBXA 3AAKA 2PRUA 4D1EA 2JOJA 1UHHA 1N2DA 1OZOA 4XYNA 3SG6A 3ZWHA 2H2KA 5CSNA 4NDDA 4PE7A 4U8DA 5F6TA 3A8RA 4ORAB 1Y1UA 1CFPA 1ZACA 1QIWA 1K94A 2HF5A 4YI8A 4GUKA 4GGFC 1J1DA 1DVIA 3RLZA 4PALA 4YBHB 2JXCA 1SY9A 1L2OC 2JT3A 2Q91A 1AJ5A 1AVSA 3I5HB 5AFPA 1IG5A 2K2FA 1WRZA 4PHMA 1PULA 1AUIB 1WLMA 1JF0A 1EL4A 1YTZC 2WCFA 1JUOA 1JSAA 1RFJA 3SIAA 2I94A 2ZN8A 3I5FC 4GBAA 1SNLA 3LCPC 1EH2A 3VRQA 4L9MA 4NDCA 2FJUB 4NDBA 2TN4A 4N5XA 2KSPA 2FOTA 2LVIA 1M31A 4CFQA 2PSRA 4I5KA 1A2XA 5ER4X 3TUYC 1BLQA 1F70A 2JPTA 1QX2A 2CTNA 4QJ5B 2K7CA 1UHJA 3DF0B 3I5GB 1FPWA 5KSZA 1TCOB 2JZIA 1XFWO 2L2EA 1B1GA 2KYFA 1Q80A 1CLLA 4CFRA 1RECA 1SL7A 2NLNA 1DJGA 2D8NA 1YRTB 1ALVA 1CMFA 4GGNA 1YVHA 2KFHA 2ZRTA 2LVJA 1V1FA 2K8MB 2K7BA 1KQMC 2BBNA 1S3PA 2OTGB 1YR5A 2ZN9A 3BUMB 2Q4UA 4MRYA 1RROA 2H61A 3WHTB 3JVTC 2LM5A 4P5OE 4TNCA 2KQYA 4OCIA 2SASA 2M9GA 1JBAA 1UHIA 1F8HA 3D0YB 2F2PA 2JQ6A 3BUNB 2M3WA 4CPVA 2ZKMX 1D1OA 2M1UA 4GNKB 4YGAA 1R2UA 1JF2A 3I5GC 2I7AA 1PALA 2DOQA 1WDCC 1A4PA 1DJHA 1Y1AA 1TNQA 2LVKA 1TIZA 4I5LB 2HQ8A 1MXEA 2OS8B 1GQMA 1S26D 2BCXA 1SR6C 2FCEA 4WQ2A 1DJZA 1CLBA 1KWOB 1NP8A 1Y0VH 1LA0A 2ZNEA 2MLEC 1RJVA 2VRGA 4ICBA 3CGAA 3CR5X 1J7PA 1SYMA 3EVUA 1Y6WA 4MZKA 1IH0A 2Y1NA 5I2OA 2K7OA 1QASA 2KI4B 4AOMA 2L98A 4JQ0D 1C7WA 2O5GA 3VROA 1R6PA 4YI9A 2KYCA 5CSFA 1WRLA 2V53A 3DVMA 1QJTA 4YRUA 2OPOA 2L50A 2E30A 2BKHB 1ODBA 1M45A 2IS9A 1UHKA 3TDZA 1FW4A 4ZCUA 1CMGA 2LLSA 1OE9B 1XFYO 3OB2B 1KFUL 1OZSA 1KWOC 3PLFB 5CSJA 3O78A 1QLKA 1K9KA 3DVKA 1BG1A 1N65A 1DF0A 3IQQA 2JNXA 2B1UA 2GV5A 5HLOA 2ZRSA 3SG7A 2K2AA 2LE9B 3SG2A 4DIRA 2LANA 1QV0A 3ICBA 1MR8A 2HETA 2KI4C 2PMYA 3FS7A 2EC6B 4MVFA 5K89A 4PE4A 4C0JA 3KHEA 1S36A 3ZNIA 2LHLA 2F33A 1LINA 2QPTA 1K9UA 3RM1A 4GFTA 1F55A 4HRGA 3EKJA 3BUXB 3O4YA 2I2RE 2L4HA 3I5IC 1K93D 1TOPA 3FIAA 1SCMB 4MRXA 3EK4A 3BUOB 2E6WA 2G9BA 4PHJA 2BE6A 1J1EA 2F3ZA 3WXAA 1IJ6A 1JWDA 2WOSA 2NCPA 4OKHA 1DGUA 1BT6A 1IRJA 5AERA 1AP4A 3TS5B 1F4OA 1QVIY 3PN7C 1UUSA 3CLNA 2BKIB 2K0JA 1XK4A 1BODA 2F8PA 2M7LA 1IQ3A 1C7VA 2MJWB 3OX5A 4P2YB 1H8BA 1LXFC 1GJYA 5HKZA 4YGBB 2LP2A 1QATA 1KK8B 4MEWA 1NX3A 1QX5B 2A4JA 1XA5A 2EHBA 1J7RA 2BL0B 1DTLA 2NZ0A 3IF7A 1XFVO 2P6BB 2WCBA 4YGEB 1S1EA 3SG3A 4DRWA 3CTNA 3LLEA 1NSHA 1WLZA 3WHUB 2WNDA 3BOWA 1QTXA 3SG4A 5BPJA 1S6IA 3IQOA 1PK0D 1S6JA 2LUCA 1SPYA 1GGZA 5HKYA 3CR2A 5ER5A 2KGRA 1MF8B 1K90D 1LVCD 3I5HC 4GAOA 3NSIA 5DKRA 1J7OA 3BYAA 1FI6A 1BMOA 4A4BA 2G2BA 4F0ZB 1YVLA 5I8NA 1KQVA 2M29A 1FBVA 4GGFA 2M97A 1PVAA 2BBMA 3DD4A 1KFXS 2LMUA 1MQ1A 2PASA 2KAYA 2Y4QA 5GQQC 1ZMZA 2M8UA 1SBJA 1DF0B 1TNWA 1DJXA 1ZOTB 2L4IA 1NCZA 3JTDB 1A03A 2KOTA 2BECA 2GGMA 3VGOA 2LHIA 3AKAA 1KCYA 1IQ5A 2CT9A 4IL1A 4Q04A 1PVBA 4MZJA 1MXLC 1B4CA 1SL9A 1CKKA 1K8UA 1RK9A 3D10A 2MLFC 2PVBA 5JJGA 1UHNA 3C1VA 4PE1A 1QIVA 1B7TZ 4FQOA 1VRKA 4MBEA 2OTGC 1W7JB 1YX7A 1L7ZA 2KI6C 2JT0A 1KK7Y 2BCBA 1JC2A 1CNPA 2F3YA 4PDZA 1YX8A 1E8AA 1S5GY 4DUQA 1NPQA 2JTTA 3SJSA 2L5XB 3GK2A 4BY4A 4E68A 4OR9B 5IBWA 2LMTA 1PSRA 1SW8A 4QJ3B 1SCVA 1TN4A 2PALA 4HRHA 5D7FA 5HLVA 2BCAA 2F2OA 3PM8A 2JT8A 4FTGA 4DCKA 1BOCA 5I2QA 4C0LA 1DGVA 1BJFA 1QVIZ 1YURA 3BUWB 4C0KA 1U5IA 2KNEA 1F71A 3SIBA 1BR4B 2MA2A 1XFXO 2ZFDA 3KO0A 1UP5A 2I18A 4USLA 5PALA 1K2HA 1ZFSA 1YRUB 2R2IA 2MHHA 2KFFA 2OS8C 5I2LA 5AANA 2RGIA 1A75A 1OMRA 1SKTA 2M1KB 4NQGA 1CDNA 1DJIA 4M2QA 1UURA 1CM4A 1V1GA 1F4QA 4OV2A 1DMOA 1XVJA 3BOWB 1KSMA 1XYDA 2HQWA 2KBIA 3BQ3A 4JPZB 4QJ4B 3NSLA 4HREE 3O6BA 3AAJA 5DKQA 2ZNDA 1PSBA 1WY9A 2ISDA 1YUUA 1XK4C 2M0RA 4PCWA 1B7TY 1MHOA 2LVVA 2M49B 1QS7A 3BXKA 4JWQA 2CXJA 1C07A 4BY5A 1CDMA 2Y1MA 1L2OB 2LAPA 3MSEB 1CB1A 1IKUA 1RWYA 2O60A 3DVEA 1EJ3A 4MZLA 1HT9A 2LV7A 3CR4X 3I5FB 5D69A 4YGCB 2JRFA 2KAXA 1XFUO 2BE4A 2KHNA 1M63B 1W7IB 2EC6C 3TUYB 1LKJA 2HPSA 4A4CA 3PATA 3NSOA 1SRAA 1OMDA 1G4YR 4XJKA 5JOLA 3VRNA 3EK7A 5TNCA 3DVJA 2H61C 2JTZA 1KK7Z 1H4BA 4PE0A 1QXPA 1AK8A 1CDPA 3CZTX 3PALA 1A29A 1SCMC 1S5GZ 1CFFA 5G08A 1QV1A 2KBMA 1S6CA 2KAVA 1K95A 2JWWA 1BR1B 1B8RA 1KFUS 1RTP1 1KQMB 2M7NA 3HCMA 3NXAA 1ZUZA 3JVTB 2AUCA 3GK4X 1NX2A 1J7QA 1NX1A 4WRIA 1U5IB 3TS5C 2FCDA 2KDHA 4N1GA 1M46A 2LCPA 2KI6D 3TDIA 1JFJA 2MAZA 3GK1A 4YGDB 1B47A 3CWGA 1A75B 1NCXA 2JULA 2LMVA 3GOFA 3NSKA 4MN0A 3VRPA 1TCFA 1GGWA 1KK8C 1NYAA 5CPVA 1MUXA 4GPLB 1HQVA 2BL0C 4ZCVA 1WDCB 3LL8B 1KSOA 2LUXA 3CS1A 3E3RA 3LK1A 3KF9A 5KU1A 5AEQA 2KGBC 1SR6B 4ORCB 2NXQA 1QLSA 5FYXA 2JXLA 3QRXA 2LNKA 1B8CA 1B8LA 2LLTA 4I5JA 4DS7A 4CIDA 1N0YA 4OVNF 1EG3A 2AAOA 4M2PA 2JNFA 1FF1A 1SL8A 4PHKA 5B8IB 5HYDA 1CTRA 1TNPA 3KEVA 1OOJA 1YUTA 1J55A 1B9AA 1G8IA 3OHMB 2LP3A 2QACA 3LK0A 1OMVA 1OSAA 1LA3A 3EKHA 3F45A 1NIWA 4MSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EGD A;  1NCY A;  1X02 A;  3JTD C;  1CFC A;  2CNP A;  2GGZ A;  1MWN A;  3H4S E;  1EG4 A;  4WQ3 A;  3FWC A;  1CLM A;  3KPX A;  3M0W A;  1Y1X A;  1DJW A;  1XO5 A;  2K7D A;  3K21 A;  4I5N B;  2NCO A;  1TTX A;  1BU3 A;  1G33 A;  1DT7 B;  1TRF A;  3VRR A;  3A4U B;  4XJK B;  1IGV A;  2CCM A;  4ETO A;  2CBL A;  4UPG A;  3DF0 A;  3PFV A;  1SK6 D;  1SMG A;  2L51 A;  4M2O A;  2JC2 A;  1TNX A;  2KFG A;  3OP0 A;  3O2P A;  5DKN A;  1ALW A;  1JFK A;  1WRK A;  2JU0 A;  1DJY A;  2AMI A;  1EXR A;  3OB1 B;  4PHN A;  3AKB A;  5CSI A;  1CM1 A;  5HKW A;  2Y5I A;  4ORB B;  1NX0 A;  1YUS A;  2WCE A;  3I5I B;  1F54 A;  2SCP A;  1IJ5 A;  1K9P A;  5KTY A;  1QX7 A;  1PRW A;  2COL B;  5AXI A;  3WNX B;  3FWB A;  1UWO A;  2MRD A;  4AQI A;  2LC5 A;  3EVV A;  1CFD A;  4R1E A;  1IWQ A;  3TDU A;  1NUB A;  1K96 A;  3D0Y A;  4MLW A;  2WOR A;  1OQP A;  3SG5 A;  1NWD A;  2KQ6 A;  3EK8 A;  3EVR A;  3OX6 A;  1BF5 A;  1FI5 A;  2LLU A;  3PN7 B;  1CDL A;  1M39 A;  3TZ1 A;  4HSZ A;  3HX4 A;  1KFX L;  4CLN A;  4AQJ A;  5J3X A;  1AHR A;  3PSR A;  2WC8 A;  1XFZ O;  2K61 A;  2L0P A;  4N1F A;  1AJ4 A;  2MBX A;  3AAK A;  2PRU A;  4D1E A;  2JOJ A;  1UHH A;  1N2D A;  1OZO A;  4XYN A;  3SG6 A;  3ZWH A;  2H2K A;  5CSN A;  4NDD A;  4PE7 A;  4U8D A;  5F6T A;  3A8R A;  4ORA B;  1Y1U A;  1CFP A;  1ZAC A;  1QIW A;  1K94 A;  2HF5 A;  4YI8 A;  4GUK A;  4GGF C;  1J1D A;  1DVI A;  3RLZ A;  4PAL A;  4YBH B;  2JXC A;  1SY9 A;  1L2O C;  2JT3 A;  2Q91 A;  1AJ5 A;  1AVS A;  3I5H B;  5AFP A;  1IG5 A;  2K2F A;  1WRZ A;  4PHM A;  1PUL A;  1AUI B;  1WLM A;  1JF0 A;  1EL4 A;  1YTZ C;  2WCF A;  1JUO A;  1JSA A;  1RFJ A;  3SIA A;  2I94 A;  2ZN8 A;  3I5F C;  4GBA A;  1SNL A;  3LCP C;  1EH2 A;  3VRQ A;  4L9M A;  4NDC A;  2FJU B;  4NDB A;  2TN4 A;  4N5X A;  2KSP A;  2FOT A;  2LVI A;  1M31 A;  4CFQ A;  2PSR A;  4I5K A;  1A2X A;  5ER4 X;  3TUY C;  1BLQ A;  1F70 A;  2JPT A;  1QX2 A;  2CTN A;  4QJ5 B;  2K7C A;  1UHJ A;  3DF0 B;  3I5G B;  1FPW A;  5KSZ A;  1TCO B;  2JZI A;  1XFW O;  2L2E A;  1B1G A;  2KYF A;  1Q80 A;  1CLL A;  4CFR A;  1REC A;  1SL7 A;  2NLN A;  1DJG A;  2D8N A;  1YRT B;  1ALV A;  1CMF A;  4GGN A;  1YVH A;  2KFH A;  2ZRT A;  2LVJ A;  1V1F A;  2K8M B;  2K7B A;  1KQM C;  2BBN A;  1S3P A;  2OTG B;  1YR5 A;  2ZN9 A;  3BUM B;  2Q4U A;  4MRY A;  1RRO A;  2H61 A;  3WHT B;  3JVT C;  2LM5 A;  4P5O E;  4TNC A;  2KQY A;  4OCI A;  2SAS A;  2M9G A;  1JBA A;  1UHI A;  1F8H A;  3D0Y B;  2F2P A;  2JQ6 A;  3BUN B;  2M3W A;  4CPV A;  2ZKM X;  1D1O A;  2M1U A;  4GNK B;  4YGA A;  1R2U A;  1JF2 A;  3I5G C;  2I7A A;  1PAL A;  2DOQ A;  1WDC C;  1A4P A;  1DJH A;  1Y1A A;  1TNQ A;  2LVK A;  1TIZ A;  4I5L B;  2HQ8 A;  1MXE A;  2OS8 B;  1GQM A;  1S26 D;  2BCX A;  1SR6 C;  2FCE A;  4WQ2 A;  1DJZ A;  1CLB A;  1KWO B;  1NP8 A;  1Y0V H;  1LA0 A;  2ZNE A;  2MLE C;  1RJV A;  2VRG A;  4ICB A;  3CGA A;  3CR5 X;  1J7P A;  1SYM A;  3EVU A;  1Y6W A;  4MZK A;  1IH0 A;  2Y1N A;  5I2O A;  2K7O A;  1QAS A;  2KI4 B;  4AOM A;  2L98 A;  4JQ0 D;  1C7W A;  2O5G A;  3VRO A;  1R6P A;  4YI9 A;  2KYC A;  5CSF A;  1WRL A;  2V53 A;  3DVM A;  1QJT A;  4YRU A;  2OPO A;  2L50 A;  2E30 A;  2BKH B;  1ODB A;  1M45 A;  2IS9 A;  1UHK A;  3TDZ A;  1FW4 A;  4ZCU A;  1CMG A;  2LLS A;  1OE9 B;  1XFY O;  3OB2 B;  1KFU L;  1OZS A;  1KWO C;  3PLF B;  5CSJ A;  3O78 A;  1QLK A;  1K9K A;  3DVK A;  1BG1 A;  1N65 A;  1DF0 A;  3IQQ A;  2JNX A;  2B1U A;  2GV5 A;  5HLO A;  2ZRS A;  3SG7 A;  2K2A A;  2LE9 B;  3SG2 A;  4DIR A;  2LAN A;  1QV0 A;  3ICB A;  1MR8 A;  2HET A;  2KI4 C;  2PMY A;  3FS7 A;  2EC6 B;  4MVF A;  5K89 A;  4PE4 A;  4C0J A;  3KHE A;  1S36 A;  3ZNI A;  2LHL A;  2F33 A;  1LIN A;  2QPT A;  1K9U A;  3RM1 A;  4GFT A;  1F55 A;  4HRG A;  3EKJ A;  3BUX B;  3O4Y A;  2I2R E;  2L4H A;  3I5I C;  1K93 D;  1TOP A;  3FIA A;  1SCM B;  4MRX A;  3EK4 A;  3BUO B;  2E6W A;  2G9B A;  4PHJ A;  2BE6 A;  1J1E A;  2F3Z A;  3WXA A;  1IJ6 A;  1JWD A;  2WOS A;  2NCP A;  4OKH A;  1DGU A;  1BT6 A;  1IRJ A;  5AER A;  1AP4 A;  3TS5 B;  1F4O A;  1QVI Y;  3PN7 C;  1UUS A;  3CLN A;  2BKI B;  2K0J A;  1XK4 A;  1BOD A;  2F8P A;  2M7L A;  1IQ3 A;  1C7V A;  2MJW B;  3OX5 A;  4P2Y B;  1H8B A;  1LXF C;  1GJY A;  5HKZ A;  4YGB B;  2LP2 A;  1QAT A;  1KK8 B;  4MEW A;  1NX3 A;  1QX5 B;  2A4J A;  1XA5 A;  2EHB A;  1J7R A;  2BL0 B;  1DTL A;  2NZ0 A;  3IF7 A;  1XFV O;  2P6B B;  2WCB A;  4YGE B;  1S1E A;  3SG3 A;  4DRW A;  3CTN A;  3LLE A;  1NSH A;  1WLZ A;  3WHU B;  2WND A;  3BOW A;  1QTX A;  3SG4 A;  5BPJ A;  1S6I A;  3IQO A;  1PK0 D;  1S6J A;  2LUC A;  1SPY A;  1GGZ A;  5HKY A;  3CR2 A;  5ER5 A;  2KGR A;  1MF8 B;  1K90 D;  1LVC D;  3I5H C;  4GAO A;  3NSI A;  5DKR A;  1J7O A;  3BYA A;  1FI6 A;  1BMO A;  4A4B A;  2G2B A;  4F0Z B;  1YVL A;  5I8N A;  1KQV A;  2M29 A;  1FBV A;  4GGF A;  2M97 A;  1PVA A;  2BBM A;  3DD4 A;  1KFX S;  2LMU A;  1MQ1 A;  2PAS A;  2KAY A;  2Y4Q A;  5GQQ C;  1ZMZ A;  2M8U A;  1SBJ A;  1DF0 B;  1TNW A;  1DJX A;  1ZOT B;  2L4I A;  1NCZ A;  3JTD B;  1A03 A;  2KOT A;  2BEC A;  2GGM A;  3VGO A;  2LHI A;  3AKA A;  1KCY A;  1IQ5 A;  2CT9 A;  4IL1 A;  4Q04 A;  1PVB A;  4MZJ A;  1MXL C;  1B4C A;  1SL9 A;  1CKK A;  1K8U A;  1RK9 A;  3D10 A;  2MLF C;  2PVB A;  5JJG A;  1UHN A;  3C1V A;  4PE1 A;  1QIV A;  1B7T Z;  4FQO A;  1VRK A;  4MBE A;  2OTG C;  1W7J B;  1YX7 A;  1L7Z A;  2KI6 C;  2JT0 A;  1KK7 Y;  2BCB A;  1JC2 A;  1CNP A;  2F3Y A;  4PDZ A;  1YX8 A;  1E8A A;  1S5G Y;  4DUQ A;  1NPQ A;  2JTT A;  3SJS A;  2L5X B;  3GK2 A;  4BY4 A;  4E68 A;  4OR9 B;  5IBW A;  2LMT A;  1PSR A;  1SW8 A;  4QJ3 B;  1SCV A;  1TN4 A;  2PAL A;  4HRH A;  5D7F A;  5HLV A;  2BCA A;  2F2O A;  3PM8 A;  2JT8 A;  4FTG A;  4DCK A;  1BOC A;  5I2Q A;  4C0L A;  1DGV A;  1BJF A;  1QVI Z;  1YUR A;  3BUW B;  4C0K A;  1U5I A;  2KNE A;  1F71 A;  3SIB A;  1BR4 B;  2MA2 A;  1XFX O;  2ZFD A;  3KO0 A;  1UP5 A;  2I18 A;  4USL A;  5PAL A;  1K2H A;  1ZFS A;  1YRU B;  2R2I A;  2MHH A;  2KFF A;  2OS8 C;  5I2L A;  5AAN A;  2RGI A;  1A75 A;  1OMR A;  1SKT A;  2M1K B;  4NQG A;  1CDN A;  1DJI A;  4M2Q A;  1UUR A;  1CM4 A;  1V1G A;  1F4Q A;  4OV2 A;  1DMO A;  1XVJ A;  3BOW B;  1KSM A;  1XYD A;  2HQW A;  2KBI A;  3BQ3 A;  4JPZ B;  4QJ4 B;  3NSL A;  4HRE E;  3O6B A;  3AAJ A;  5DKQ A;  2ZND A;  1PSB A;  1WY9 A;  2ISD A;  1YUU A;  1XK4 C;  2M0R A;  4PCW A;  1B7T Y;  1MHO A;  2LVV A;  2M49 B;  1QS7 A;  3BXK A;  4JWQ A;  2CXJ A;  1C07 A;  4BY5 A;  1CDM A;  2Y1M A;  1L2O B;  2LAP A;  3MSE B;  1CB1 A;  1IKU A;  1RWY A;  2O60 A;  3DVE A;  1EJ3 A;  4MZL A;  1HT9 A;  2LV7 A;  3CR4 X;  3I5F B;  5D69 A;  4YGC B;  2JRF A;  2KAX A;  1XFU O;  2BE4 A;  2KHN A;  1M63 B;  1W7I B;  2EC6 C;  3TUY B;  1LKJ A;  2HPS A;  4A4C A;  3PAT A;  3NSO A;  1SRA A;  1OMD A;  1G4Y R;  4XJK A;  5JOL A;  3VRN A;  3EK7 A;  5TNC A;  3DVJ A;  2H61 C;  2JTZ A;  1KK7 Z;  1H4B A;  4PE0 A;  1QXP A;  1AK8 A;  1CDP A;  3CZT X;  3PAL A;  1A29 A;  1SCM C;  1S5G Z;  1CFF A;  5G08 A;  1QV1 A;  2KBM A;  1S6C A;  2KAV A;  1K95 A;  2JWW A;  1BR1 B;  1B8R A;  1KFU S;  1RTP 1;  1KQM B;  2M7N A;  3HCM A;  3NXA A;  1ZUZ A;  3JVT B;  2AUC A;  3GK4 X;  1NX2 A;  1J7Q A;  1NX1 A;  4WRI A;  1U5I B;  3TS5 C;  2FCD A;  2KDH A;  4N1G A;  1M46 A;  2LCP A;  2KI6 D;  3TDI A;  1JFJ A;  2MAZ A;  3GK1 A;  4YGD B;  1B47 A;  3CWG A;  1A75 B;  1NCX A;  2JUL A;  2LMV A;  3GOF A;  3NSK A;  4MN0 A;  3VRP A;  1TCF A;  1GGW A;  1KK8 C;  1NYA A;  5CPV A;  1MUX A;  4GPL B;  1HQV A;  2BL0 C;  4ZCV A;  1WDC B;  3LL8 B;  1KSO A;  2LUX A;  3CS1 A;  3E3R A;  3LK1 A;  3KF9 A;  5KU1 A;  5AEQ A;  2KGB C;  1SR6 B;  4ORC B;  2NXQ A;  1QLS A;  5FYX A;  2JXL A;  3QRX A;  2LNK A;  1B8C A;  1B8L A;  2LLT A;  4I5J A;  4DS7 A;  4CID A;  1N0Y A;  4OVN F;  1EG3 A;  2AAO A;  4M2P A;  2JNF A;  1FF1 A;  1SL8 A;  4PHK A;  5B8I B;  5HYD A;  1CTR A;  1TNP A;  3KEV A;  1OOJ A;  1YUT A;  1J55 A;  1B9A A;  1G8I A;  3OHM B;  2LP3 A;  2QAC A;  3LK0 A;  1OMV A;  1OSA A;  1LA3 A;  3EKH A;  3F45 A;  1NIW A;  4MSP A; 
#chains in the Genus database with same CATH topology
 2EGD A;  1NCY A;  1X02 A;  3JTD C;  1CFC A;  2CNP A;  3BJH A;  2GGZ A;  1MWN A;  3H4S E;  1EG4 A;  4WQ3 A;  3FWC A;  1CLM A;  3KPX A;  3L47 A;  1Y1X A;  3K1E A;  3M0W A;  3PJI A;  1DJW A;  1XO5 A;  2ERB A;  2K7D A;  3K21 A;  4I5N B;  2NCO A;  1TTX A;  1BU3 A;  1G33 A;  3D77 A;  1DT7 B;  1TRF A;  3VRR A;  1GGW A;  3A4U B;  4XJK B;  4OZD A;  1IGV A;  2CCM A;  4ETO A;  2CBL A;  4UPG A;  3DF0 A;  3PFV A;  1SK6 D;  1SMG A;  2L51 A;  4M2O A;  2JC2 A;  1TNX A;  2KFG A;  3OP0 A;  3O2P A;  5DKN A;  1ALW A;  1JFK A;  1WRK A;  2JU0 A;  4IJ7 A;  1DJY A;  2AMI A;  1EXR A;  3OB1 B;  4PHN A;  3AKB A;  5CSI A;  1CM1 A;  5HKW A;  2Y5I A;  4ORB B;  1NX0 A;  1YUS A;  2BAP A;  4KYN A;  2WCE A;  3I5I B;  1F54 A;  2SCP A;  1IJ5 A;  1K9P A;  5KTY A;  1QX7 A;  1PRW A;  2COL B;  5AXI A;  3WNX B;  3FWB A;  1UWO A;  2MRD A;  4AQI A;  2LC5 A;  3EVV A;  1CFD A;  4R1E A;  1IWQ A;  4FQT A;  3TDU A;  1NUB A;  1K96 A;  3D0Y A;  4MLW A;  2WOR A;  1OQP A;  3SG5 A;  1NWD A;  2KQ6 A;  3EK8 A;  3EVR A;  3OX6 A;  1BF5 A;  1FI5 A;  2LLU A;  3B6X A;  3PN7 B;  1CDL A;  2QEH A;  1M39 A;  3TZ1 A;  4HSZ A;  3HX4 A;  1KFX L;  4CLN A;  4AQJ A;  5J3X A;  1AHR A;  3PSR A;  2WC8 A;  1XFZ O;  2K61 A;  2L0P A;  4N1F A;  1AJ4 A;  1ORG A;  2MBX A;  3AAK A;  2PRU A;  4D1E A;  2JOJ A;  1UHH A;  1N2D A;  1OZO A;  3DZT A;  4XYN A;  3SG6 A;  3ZWH A;  2H2K A;  5CSN A;  3NHI A;  4NDD A;  4PE7 A;  4U8D A;  3A8R A;  5F6T A;  2FJY A;  3BFA A;  4ORA B;  1Y1U A;  3Q8I A;  1CFP A;  1ZAC A;  2QEB A;  1QIW A;  2K60 A;  1K94 A;  2HF5 A;  4YI8 A;  4GUK A;  4GGF C;  1J1D A;  1DVI A;  3RLZ A;  4PAL A;  4YBH B;  2JXC A;  1SY9 A;  2WCH A;  1L2O C;  2JT3 A;  2Q91 A;  1AJ5 A;  1AVS A;  3I5H B;  5AFP A;  1IG5 A;  2K2F A;  1WRZ A;  4PHM A;  1PUL A;  2L5Y A;  1AUI B;  1WLM A;  1JF0 A;  1EL4 A;  1YTZ C;  2WCF A;  1JUO A;  3B7A A;  3S0G A;  1JSA A;  1RFJ A;  3SIA A;  2I94 A;  2ZN8 A;  3I5F C;  4GBA A;  1SNL A;  3LCP C;  3PM2 A;  3VRQ A;  4L9M A;  1EH2 A;  3SS5 A;  4NDC A;  3R1P A;  2FJU B;  3CZ1 A;  4INW A;  4NDB A;  2QEO A;  2TN4 A;  4N5X A;  2KSP A;  2FOT A;  2LVI A;  1M31 A;  4CFQ A;  2PSR A;  4I5K A;  1A2X A;  5ER4 X;  3TUY C;  1BLQ A;  1F70 A;  2JPT A;  1OOI X;  1QX2 A;  2CTN A;  4QJ5 B;  3RZS A;  2K7C A;  1UHJ A;  3DF0 B;  3I5G B;  1FPW A;  5KSZ A;  1TCO B;  1P28 A;  1XFW O;  2JZI A;  2L2E A;  2KYF A;  1Q80 A;  1CLL A;  4CFR A;  1B1G A;  1REC A;  1SL7 A;  2NLN A;  1DJG A;  3CZ0 A;  2D8N A;  3SS4 A;  1YRT B;  1ALV A;  1CMF A;  4GGN A;  1YVH A;  2KFH A;  2ZRT A;  2LVJ A;  1V1F A;  2K8M B;  2K7B A;  1KQM C;  2BBN A;  1S3P A;  2OTG B;  1YR5 A;  2ZN9 A;  3BUM B;  2Q4U A;  3R1V A;  4MRY A;  1RRO A;  2H61 A;  3WHT B;  3JVT C;  2LM5 A;  4P5O E;  4TNC A;  2KQY A;  2YGU A;  4OCI A;  2SAS A;  2M9G A;  3B88 A;  1JBA A;  5I94 A;  3L4A A;  1UHI A;  1F8H A;  3D0Y B;  2F2P A;  2JQ6 A;  3BUN B;  2M3W A;  4CPV A;  2ZKM X;  1D1O A;  2M1U A;  4GNK B;  4YGA A;  1R2U A;  1JF2 A;  3I5G C;  2I7A A;  1PAL A;  2DOQ A;  1WDC C;  1A4P A;  4PT1 A;  1DJH A;  1Y1A A;  1TNQ A;  2LVK A;  1TIZ A;  4I5L B;  3FE6 A;  1OOG A;  3BFB A;  2HQ8 A;  1MXE A;  2OS8 B;  1TUZ A;  1GQM A;  1S26 D;  2BCX A;  1SR6 C;  2FCE A;  4WQ2 A;  1DJZ A;  1CLB A;  1KWO B;  1NP8 A;  1Y0V H;  1LA0 A;  2ZNE A;  2WCK A;  2MLE C;  1RJV A;  2VRG A;  4ICB A;  3CGA A;  3CR5 X;  1J7P A;  1SYM A;  3EVU A;  1Y6W A;  4MZK A;  1IH0 A;  1GM0 A;  2Y1N A;  5I2O A;  3OGN A;  2K7O A;  1QAS A;  2KI4 B;  4AOM A;  2L98 A;  4JQ0 D;  1C7W A;  2O5G A;  3VRO A;  1R6P A;  4YI9 A;  2KYC A;  5CSF A;  1WRL A;  2V53 A;  3DVM A;  1QJT A;  4YRU A;  2OPO A;  3B87 A;  2L50 A;  2E30 A;  2BKH B;  3NHT A;  1ODB A;  1M45 A;  1SSE B;  3O4X A;  2IS9 A;  1UHK A;  3TDZ A;  1FW4 A;  1TUJ A;  4ZCU A;  1CMG A;  2LLS A;  1OE9 B;  1XFY O;  3DY9 A;  3DYE A;  3OB2 B;  1KFU L;  1OZS A;  1KWO C;  3PLF B;  3BFH A;  5CSJ A;  3O78 A;  1QLK A;  1K9K A;  3DVK A;  3S0F A;  1BG1 A;  1N65 A;  1DF0 A;  3IQQ A;  2JNX A;  2B1U A;  2GV5 A;  5HLO A;  2ZRS A;  3SG7 A;  2K2A A;  2LE9 B;  5EL2 A;  3SG2 A;  4DIR A;  2LAN A;  1QV0 A;  3ICB A;  1MR8 A;  3B86 A;  2HET A;  2KI4 C;  2PMY A;  3FS7 A;  2EC6 B;  4MVF A;  5K89 A;  4PE4 A;  4C0J A;  3KHE A;  1S36 A;  3CAB A;  3ZNI A;  2LHL A;  2F33 A;  1OOH A;  3VB1 A;  1LIN A;  2QPT A;  1K9U A;  3RM1 A;  4GFT A;  1F55 A;  3D76 A;  4HRG A;  3EKJ A;  3BUX B;  3O4Y A;  2I2R E;  2L4H A;  3I5I C;  1K93 D;  1TOP A;  3UO9 A;  1W9Z A;  2BNX A;  3FIA A;  1SCM B;  4MRX A;  3CDN A;  3EK4 A;  2WCL A;  3BUO B;  2QDI A;  2E6W A;  2G9B A;  4PHJ A;  1J1E A;  2BE6 A;  2F3Z A;  3WXA A;  1IJ6 A;  1JWD A;  2WOS A;  2NCP A;  3FE9 A;  4OKH A;  1DGU A;  1BT6 A;  1IRJ A;  5AER A;  1AP4 A;  3TS5 B;  1F4O A;  1QVI Y;  3PN7 C;  1UUS A;  3CLN A;  2BKI B;  2K0J A;  1XK4 A;  1BOD A;  1DEL A;  2F8P A;  2M7L A;  1IQ3 A;  1C7V A;  2MJW B;  3OX5 A;  4P2Y B;  2KPH A;  1H8B A;  1LXF C;  1GJY A;  5HKZ A;  4YGB B;  2LP2 A;  1QAT A;  1KK8 B;  4MEW A;  1NX3 A;  1QX5 B;  2A4J A;  1XA5 A;  2EHB A;  1J7R A;  2BL0 B;  1DTL A;  1XFR A;  2L2C A;  2NZ0 A;  3IF7 A;  1XFV O;  2P6B B;  2WCB A;  4YGE B;  1S1E A;  3SG3 A;  3R72 A;  4DRW A;  3CTN A;  3LLE A;  1OW4 A;  1NSH A;  1WLZ A;  3WHU B;  2WND A;  3BOW A;  1QTX A;  3SG4 A;  5BPJ A;  1S6I A;  3IQO A;  1PK0 D;  1S6J A;  2LUC A;  1SPY A;  1GGZ A;  5HKY A;  3CR2 A;  5ER5 A;  2KGR A;  1DQE A;  1MF8 B;  1K90 D;  1LVC D;  3I5H C;  4GAO A;  3IVT A;  3NSI A;  5DKR A;  1J7O A;  3BYA A;  1FI6 A;  1BMO A;  4A4B A;  2G2B A;  1Z2C B;  1YVL A;  4F0Z B;  5I8N A;  1KQV A;  2M29 A;  1FBV A;  3R1O A;  4GGF A;  2M97 A;  3D73 A;  1PVA A;  2BBM A;  3DD4 A;  1KFX S;  2LMU A;  1MQ1 A;  3EG5 B;  2PAS A;  2KAY A;  2Y4Q A;  3CYZ A;  5GQQ C;  1ZMZ A;  2M8U A;  1SBJ A;  1DF0 B;  1TNW A;  1DJX A;  1ZOT B;  2L4I A;  1NCZ A;  3JTD B;  1A03 A;  3QME A;  2KOT A;  2BEC A;  2GGM A;  3VGO A;  2LHI A;  3AKA A;  1KCY A;  1IQ5 A;  2CT9 A;  4IL1 A;  4Q04 A;  1PVB A;  3V2L A;  4MZJ A;  1MXL C;  1LS8 A;  1IIO A;  1B4C A;  1SL9 A;  1CKK A;  1K8U A;  1RK9 A;  2PQL A;  2MLF C;  2PVB A;  3D10 A;  5JJG A;  2P70 A;  1UHN A;  3C1V A;  4PE1 A;  3S0E A;  1QIV A;  1B7T Z;  4FQO A;  1VRK A;  2WC5 A;  4MBE A;  2OTG C;  1W7J B;  1YX7 A;  1C3Z A;  1L7Z A;  2KLD A;  2KI6 C;  2JT0 A;  1KK7 Y;  2BCB A;  1JC2 A;  2WCM A;  1CNP A;  2F3Y A;  3S0A A;  4PDZ A;  1YX8 A;  1E8A A;  1S5G Y;  4DUQ A;  1NPQ A;  2JTT A;  3SJS A;  2L5X B;  3GK2 A;  4BY4 A;  4E68 A;  4OR9 B;  5IBW A;  2LMT A;  1PSR A;  1SW8 A;  4QJ3 B;  1SCV A;  1TN4 A;  2PAL A;  4HRH A;  5D7F A;  5HLV A;  2BCA A;  2F2O A;  3PM8 A;  2JT8 A;  4FTG A;  4DCK A;  1BOC A;  5I2Q A;  4C0L A;  1DGV A;  1BJF A;  1QVI Z;  5HL1 A;  1YUR A;  3BUW B;  4C0K A;  1U5I A;  2KNE A;  1F71 A;  3S0D A;  3SIB A;  1BR4 B;  2MA2 A;  1XFX O;  2ZFD A;  3KO0 A;  1UP5 A;  2I18 A;  2P71 A;  4USL A;  5PAL A;  1K2H A;  1ZFS A;  3D74 A;  1YRU B;  2R2I A;  2MHH A;  2KFF A;  2OS8 C;  5I2L A;  5AAN A;  2WC6 A;  5D3O A;  2RGI A;  1A75 A;  2JPO A;  1OMR A;  1SKT A;  2M1K B;  4NQG A;  1CDN A;  1DJI A;  4M2Q A;  1UUR A;  1CM4 A;  3FE8 A;  1QWV A;  1V1G A;  1F4Q A;  1OOF A;  4OV2 A;  1DMO A;  1XVJ A;  3BOW B;  1KSM A;  1XYD A;  3DXL A;  2HQW A;  2KBI A;  3BQ3 A;  4JPZ B;  4QJ4 B;  3NSL A;  4HRE E;  3S0B A;  3O6B A;  3D75 A;  3AAJ A;  3CZ2 A;  5DKQ A;  2ZND A;  1Z4H A;  1PSB A;  1WY9 A;  2ISD A;  1YUU A;  1XK4 C;  2M0R A;  4PCW A;  1B7T Y;  1MHO A;  2LVV A;  2M49 B;  1QS7 A;  3BXK A;  4JWQ A;  2CXJ A;  1C07 A;  4BY5 A;  1CDM A;  2Y1M A;  1L2O B;  2LAP A;  3MSE B;  1CB1 A;  1IKU A;  1RWY A;  2O60 A;  3DVE A;  1EJ3 A;  4MZL A;  1HT9 A;  2LV7 A;  2H8V A;  3CR4 X;  3I5F B;  2PYQ A;  4INX A;  5D69 A;  4YGC B;  2JRF A;  2KAX A;  3L4L A;  1XFU O;  2BE4 A;  2QEV A;  3N7H A;  2KHN A;  1M63 B;  1W7I B;  2EC6 C;  3TUY B;  1LKJ A;  2HPS A;  5DIC A;  3PAT A;  3SS3 A;  3NSO A;  4A4C A;  1SRA A;  1OMD A;  1G4Y R;  4XJK A;  5JOL A;  3VRN A;  1C3Y A;  3EK7 A;  5TNC A;  3DVJ A;  5FI7 A;  4F7F A;  2H61 C;  2JTZ A;  1KK7 Z;  1H4B A;  4PE0 A;  1QXP A;  1AK8 A;  3NGV A;  1CDP A;  3CZT X;  3PAL A;  1A29 A;  1SCM C;  1S5G Z;  1CFF A;  1DC1 A;  1T14 A;  5G08 A;  1QV1 A;  2KBM A;  1S6C A;  2KAV A;  1K95 A;  2JWW A;  1BR1 B;  1B8R A;  1KFU S;  1RTP 1;  1KQM B;  2M7N A;  3HCM A;  3NXA A;  1ZUZ A;  3JVT B;  2AUC A;  3GK4 X;  1NX2 A;  1J7Q A;  1NX1 A;  4WRI A;  1U5I B;  3TS5 C;  2FCD A;  2KDH A;  4N1G A;  1M46 A;  2LCP A;  1TWO A;  2KI6 D;  3TDI A;  1JFJ A;  2MAZ A;  3GK1 A;  4YGD B;  1DEK A;  1B47 A;  3CWG A;  1A75 B;  1NCX A;  2GTE A;  2JUL A;  2LMV A;  3GOF A;  3NSK A;  4MN0 A;  1TCF A;  3VRP A;  1KK8 C;  1NYA A;  5CPV A;  3OBV A;  1MUX A;  4GPL B;  1HQV A;  2BL0 C;  4ZCV A;  1WDC B;  2WCJ A;  4JKT A;  3LL8 B;  1KSO A;  2LUX A;  3CS1 A;  3E3R A;  3LK1 A;  3KF9 A;  5KU1 A;  3D78 A;  5AEQ A;  3UNW A;  2KGB C;  1SR6 B;  4ORC B;  2NXQ A;  1QLS A;  4JD9 A;  5FYX A;  2JXL A;  3QRX A;  2LNK A;  1B8C A;  1B8L A;  2LLT A;  4I5J A;  5FI6 A;  4CID A;  4DS7 A;  1N0Y A;  4OVN F;  1EG3 A;  2AAO A;  4M2P A;  2JNF A;  1FF1 A;  1SL8 A;  4PHK A;  5B8I B;  5HYD A;  1CTR A;  1TNP A;  3KEV A;  1YUT A;  1OOJ A;  1J55 A;  1B9A A;  1G8I A;  3OHM B;  2LP3 A;  2QAC A;  3LK0 A;  1OMV A;  1OSA A;  1LA3 A;  3EKH A;  3F45 A;  1NIW A;  5FI2 A;  4MSP A;  2KLE A; 
#chains in the Genus database with same CATH homology
 2EGD A;  1NCY A;  1X02 A;  3JTD C;  1CFC A;  2CNP A;  2GGZ A;  1MWN A;  3H4S E;  1EG4 A;  4WQ3 A;  3FWC A;  1CLM A;  3KPX A;  3M0W A;  1Y1X A;  1DJW A;  1XO5 A;  2K7D A;  3K21 A;  4I5N B;  2NCO A;  1TTX A;  1BU3 A;  1G33 A;  1DT7 B;  1TRF A;  3VRR A;  3A4U B;  4XJK B;  1IGV A;  2CCM A;  4ETO A;  2CBL A;  4UPG A;  3DF0 A;  3PFV A;  1SK6 D;  1SMG A;  2L51 A;  4M2O A;  2JC2 A;  1TNX A;  2KFG A;  3OP0 A;  3O2P A;  5DKN A;  1ALW A;  1JFK A;  1WRK A;  2JU0 A;  1DJY A;  2AMI A;  1EXR A;  3OB1 B;  4PHN A;  3AKB A;  5CSI A;  1CM1 A;  5HKW A;  2Y5I A;  4ORB B;  1NX0 A;  1YUS A;  2WCE A;  3I5I B;  1F54 A;  2SCP A;  1IJ5 A;  1K9P A;  5KTY A;  1QX7 A;  1PRW A;  2COL B;  5AXI A;  3WNX B;  3FWB A;  1UWO A;  2MRD A;  4AQI A;  2LC5 A;  3EVV A;  1CFD A;  4R1E A;  1IWQ A;  3TDU A;  1NUB A;  1K96 A;  3D0Y A;  4MLW A;  2WOR A;  1OQP A;  3SG5 A;  1NWD A;  2KQ6 A;  3EK8 A;  3EVR A;  3OX6 A;  1BF5 A;  1FI5 A;  2LLU A;  3PN7 B;  1CDL A;  1M39 A;  3TZ1 A;  4HSZ A;  3HX4 A;  1KFX L;  4CLN A;  4AQJ A;  5J3X A;  1AHR A;  3PSR A;  2WC8 A;  1XFZ O;  2K61 A;  2L0P A;  4N1F A;  1AJ4 A;  2MBX A;  3AAK A;  2PRU A;  4D1E A;  2JOJ A;  1UHH A;  1N2D A;  1OZO A;  4XYN A;  3SG6 A;  3ZWH A;  2H2K A;  5CSN A;  4NDD A;  4PE7 A;  4U8D A;  5F6T A;  3A8R A;  4ORA B;  1Y1U A;  1CFP A;  1ZAC A;  1QIW A;  1K94 A;  2HF5 A;  4YI8 A;  4GUK A;  4GGF C;  1J1D A;  1DVI A;  3RLZ A;  4PAL A;  4YBH B;  2JXC A;  1SY9 A;  1L2O C;  2JT3 A;  2Q91 A;  1AJ5 A;  1AVS A;  3I5H B;  5AFP A;  1IG5 A;  2K2F A;  1WRZ A;  4PHM A;  1PUL A;  1AUI B;  1WLM A;  1JF0 A;  1EL4 A;  1YTZ C;  2WCF A;  1JUO A;  1JSA A;  1RFJ A;  3SIA A;  2I94 A;  2ZN8 A;  3I5F C;  4GBA A;  1SNL A;  3LCP C;  1EH2 A;  3VRQ A;  4L9M A;  4NDC A;  2FJU B;  4NDB A;  2TN4 A;  4N5X A;  2KSP A;  2FOT A;  2LVI A;  1M31 A;  4CFQ A;  2PSR A;  4I5K A;  1A2X A;  5ER4 X;  3TUY C;  1BLQ A;  1F70 A;  2JPT A;  1QX2 A;  2CTN A;  4QJ5 B;  2K7C A;  1UHJ A;  3DF0 B;  3I5G B;  1FPW A;  5KSZ A;  1TCO B;  2JZI A;  1XFW O;  2L2E A;  1B1G A;  2KYF A;  1Q80 A;  1CLL A;  4CFR A;  1REC A;  1SL7 A;  2NLN A;  1DJG A;  2D8N A;  1YRT B;  1ALV A;  1CMF A;  4GGN A;  1YVH A;  2KFH A;  2ZRT A;  2LVJ A;  1V1F A;  2K8M B;  2K7B A;  1KQM C;  2BBN A;  1S3P A;  2OTG B;  1YR5 A;  2ZN9 A;  3BUM B;  2Q4U A;  4MRY A;  1RRO A;  2H61 A;  3WHT B;  3JVT C;  2LM5 A;  4P5O E;  4TNC A;  2KQY A;  4OCI A;  2SAS A;  2M9G A;  1JBA A;  1UHI A;  1F8H A;  3D0Y B;  2F2P A;  2JQ6 A;  3BUN B;  2M3W A;  4CPV A;  2ZKM X;  1D1O A;  2M1U A;  4GNK B;  4YGA A;  1R2U A;  1JF2 A;  3I5G C;  2I7A A;  1PAL A;  2DOQ A;  1WDC C;  1A4P A;  1DJH A;  1Y1A A;  1TNQ A;  2LVK A;  1TIZ A;  4I5L B;  2HQ8 A;  1MXE A;  2OS8 B;  1GQM A;  1S26 D;  2BCX A;  1SR6 C;  2FCE A;  4WQ2 A;  1DJZ A;  1CLB A;  1KWO B;  1NP8 A;  1Y0V H;  1LA0 A;  2ZNE A;  2MLE C;  1RJV A;  2VRG A;  4ICB A;  3CGA A;  3CR5 X;  1J7P A;  1SYM A;  3EVU A;  1Y6W A;  4MZK A;  1IH0 A;  2Y1N A;  5I2O A;  2K7O A;  1QAS A;  2KI4 B;  4AOM A;  2L98 A;  4JQ0 D;  1C7W A;  2O5G A;  3VRO A;  1R6P A;  4YI9 A;  2KYC A;  5CSF A;  1WRL A;  2V53 A;  3DVM A;  1QJT A;  4YRU A;  2OPO A;  2L50 A;  2E30 A;  2BKH B;  1ODB A;  1M45 A;  2IS9 A;  1UHK A;  3TDZ A;  1FW4 A;  4ZCU A;  1CMG A;  2LLS A;  1OE9 B;  1XFY O;  3OB2 B;  1KFU L;  1OZS A;  1KWO C;  3PLF B;  5CSJ A;  3O78 A;  1QLK A;  1K9K A;  3DVK A;  1BG1 A;  1N65 A;  1DF0 A;  3IQQ A;  2JNX A;  2B1U A;  2GV5 A;  5HLO A;  2ZRS A;  3SG7 A;  2K2A A;  2LE9 B;  3SG2 A;  4DIR A;  2LAN A;  1QV0 A;  3ICB A;  1MR8 A;  2HET A;  2KI4 C;  2PMY A;  3FS7 A;  2EC6 B;  4MVF A;  5K89 A;  4PE4 A;  4C0J A;  3KHE A;  1S36 A;  3ZNI A;  2LHL A;  2F33 A;  1LIN A;  2QPT A;  1K9U A;  3RM1 A;  4GFT A;  1F55 A;  4HRG A;  3EKJ A;  3BUX B;  3O4Y A;  2I2R E;  2L4H A;  3I5I C;  1K93 D;  1TOP A;  3FIA A;  1SCM B;  4MRX A;  3EK4 A;  3BUO B;  2E6W A;  2G9B A;  4PHJ A;  2BE6 A;  1J1E A;  2F3Z A;  3WXA A;  1IJ6 A;  1JWD A;  2WOS A;  2NCP A;  4OKH A;  1DGU A;  1BT6 A;  1IRJ A;  5AER A;  1AP4 A;  3TS5 B;  1F4O A;  1QVI Y;  3PN7 C;  1UUS A;  3CLN A;  2BKI B;  2K0J A;  1XK4 A;  1BOD A;  2F8P A;  2M7L A;  1IQ3 A;  1C7V A;  2MJW B;  3OX5 A;  4P2Y B;  1H8B A;  1LXF C;  1GJY A;  5HKZ A;  4YGB B;  2LP2 A;  1QAT A;  1KK8 B;  4MEW A;  1NX3 A;  1QX5 B;  2A4J A;  1XA5 A;  2EHB A;  1J7R A;  2BL0 B;  1DTL A;  2NZ0 A;  3IF7 A;  1XFV O;  2P6B B;  2WCB A;  4YGE B;  1S1E A;  3SG3 A;  4DRW A;  3CTN A;  3LLE A;  1NSH A;  1WLZ A;  3WHU B;  2WND A;  3BOW A;  1QTX A;  3SG4 A;  5BPJ A;  1S6I A;  3IQO A;  1PK0 D;  1S6J A;  2LUC A;  1SPY A;  1GGZ A;  5HKY A;  3CR2 A;  5ER5 A;  2KGR A;  1MF8 B;  1K90 D;  1LVC D;  3I5H C;  4GAO A;  3NSI A;  5DKR A;  1J7O A;  3BYA A;  1FI6 A;  1BMO A;  4A4B A;  2G2B A;  4F0Z B;  1YVL A;  5I8N A;  1KQV A;  2M29 A;  1FBV A;  4GGF A;  2M97 A;  1PVA A;  2BBM A;  3DD4 A;  1KFX S;  2LMU A;  1MQ1 A;  2PAS A;  2KAY A;  2Y4Q A;  5GQQ C;  1ZMZ A;  2M8U A;  1SBJ A;  1DF0 B;  1TNW A;  1DJX A;  1ZOT B;  2L4I A;  1NCZ A;  3JTD B;  1A03 A;  2KOT A;  2BEC A;  2GGM A;  3VGO A;  2LHI A;  3AKA A;  1KCY A;  1IQ5 A;  2CT9 A;  4IL1 A;  4Q04 A;  1PVB A;  4MZJ A;  1MXL C;  1B4C A;  1SL9 A;  1CKK A;  1K8U A;  1RK9 A;  3D10 A;  2MLF C;  2PVB A;  5JJG A;  1UHN A;  3C1V A;  4PE1 A;  1QIV A;  1B7T Z;  4FQO A;  1VRK A;  4MBE A;  2OTG C;  1W7J B;  1YX7 A;  1L7Z A;  2KI6 C;  2JT0 A;  1KK7 Y;  2BCB A;  1JC2 A;  1CNP A;  2F3Y A;  4PDZ A;  1YX8 A;  1E8A A;  1S5G Y;  4DUQ A;  1NPQ A;  2JTT A;  3SJS A;  2L5X B;  3GK2 A;  4BY4 A;  4E68 A;  4OR9 B;  5IBW A;  2LMT A;  1PSR A;  1SW8 A;  4QJ3 B;  1SCV A;  1TN4 A;  2PAL A;  4HRH A;  5D7F A;  5HLV A;  2BCA A;  2F2O A;  3PM8 A;  2JT8 A;  4FTG A;  4DCK A;  1BOC A;  5I2Q A;  4C0L A;  1DGV A;  1BJF A;  1QVI Z;  1YUR A;  3BUW B;  4C0K A;  1U5I A;  2KNE A;  1F71 A;  3SIB A;  1BR4 B;  2MA2 A;  1XFX O;  2ZFD A;  3KO0 A;  1UP5 A;  2I18 A;  4USL A;  5PAL A;  1K2H A;  1ZFS A;  1YRU B;  2R2I A;  2MHH A;  2KFF A;  2OS8 C;  5I2L A;  5AAN A;  2RGI A;  1A75 A;  1OMR A;  1SKT A;  2M1K B;  4NQG A;  1CDN A;  1DJI A;  4M2Q A;  1UUR A;  1CM4 A;  1V1G A;  1F4Q A;  4OV2 A;  1DMO A;  1XVJ A;  3BOW B;  1KSM A;  1XYD A;  2HQW A;  2KBI A;  3BQ3 A;  4JPZ B;  4QJ4 B;  3NSL A;  4HRE E;  3O6B A;  3AAJ A;  5DKQ A;  2ZND A;  1PSB A;  1WY9 A;  2ISD A;  1YUU A;  1XK4 C;  2M0R A;  4PCW A;  1B7T Y;  1MHO A;  2LVV A;  2M49 B;  1QS7 A;  3BXK A;  4JWQ A;  2CXJ A;  1C07 A;  4BY5 A;  1CDM A;  2Y1M A;  1L2O B;  2LAP A;  3MSE B;  1CB1 A;  1IKU A;  1RWY A;  2O60 A;  3DVE A;  1EJ3 A;  4MZL A;  1HT9 A;  2LV7 A;  3CR4 X;  3I5F B;  5D69 A;  4YGC B;  2JRF A;  2KAX A;  1XFU O;  2BE4 A;  2KHN A;  1M63 B;  1W7I B;  2EC6 C;  3TUY B;  1LKJ A;  2HPS A;  4A4C A;  3PAT A;  3NSO A;  1SRA A;  1OMD A;  1G4Y R;  4XJK A;  5JOL A;  3VRN A;  3EK7 A;  5TNC A;  3DVJ A;  2H61 C;  2JTZ A;  1KK7 Z;  1H4B A;  4PE0 A;  1QXP A;  1AK8 A;  1CDP A;  3CZT X;  3PAL A;  1A29 A;  1SCM C;  1S5G Z;  1CFF A;  5G08 A;  1QV1 A;  2KBM A;  1S6C A;  2KAV A;  1K95 A;  2JWW A;  1BR1 B;  1B8R A;  1KFU S;  1RTP 1;  1KQM B;  2M7N A;  3HCM A;  3NXA A;  1ZUZ A;  3JVT B;  2AUC A;  3GK4 X;  1NX2 A;  1J7Q A;  1NX1 A;  4WRI A;  1U5I B;  3TS5 C;  2FCD A;  2KDH A;  4N1G A;  1M46 A;  2LCP A;  2KI6 D;  3TDI A;  1JFJ A;  2MAZ A;  3GK1 A;  4YGD B;  1B47 A;  3CWG A;  1A75 B;  1NCX A;  2JUL A;  2LMV A;  3GOF A;  3NSK A;  4MN0 A;  3VRP A;  1TCF A;  1GGW A;  1KK8 C;  1NYA A;  5CPV A;  1MUX A;  4GPL B;  1HQV A;  2BL0 C;  4ZCV A;  1WDC B;  3LL8 B;  1KSO A;  2LUX A;  3CS1 A;  3E3R A;  3LK1 A;  3KF9 A;  5KU1 A;  5AEQ A;  2KGB C;  1SR6 B;  4ORC B;  2NXQ A;  1QLS A;  5FYX A;  2JXL A;  3QRX A;  2LNK A;  1B8C A;  1B8L A;  2LLT A;  4I5J A;  4DS7 A;  4CID A;  1N0Y A;  4OVN F;  1EG3 A;  2AAO A;  4M2P A;  2JNF A;  1FF1 A;  1SL8 A;  4PHK A;  5B8I B;  5HYD A;  1CTR A;  1TNP A;  3KEV A;  1OOJ A;  1YUT A;  1J55 A;  1B9A A;  1G8I A;  3OHM B;  2LP3 A;  2QAC A;  3LK0 A;  1OMV A;  1OSA A;  1LA3 A;  3EKH A;  3F45 A;  1NIW A;  4MSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...