1B7TZ

Myosin digested by papain
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
153
structure length
153
Chain Sequence
KLSQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYOSIN HEAVY CHAIN
publication title Atomic structure of scallop myosin subfragment S1 complexed with MgADP: a novel conformation of the myosin head.
pubmed doi rcsb
molecule tags Myosin
total genus 41
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 1999-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1b7tZ01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1b7tZ02
5I8NA 2LUCA 1H8BA 1DJGA 3DVMA 4IL1A 4OV2A 4R1EA 1CFFA 1B47A 1S1EA 1ZFSA 1NX2A 2CNPA 5FYXA 4CFRA 1Y1XA 1CMFA 1JFJA 2ZNEA 4C0LA 2ZKMX 3MSEB 1R2UA 1G4YR 1SR6B 3IF7A 4MEWA 2JT0A 2G2BA 4GAOA 3JVTB 3PN7C 2KBMA 5HKZA 2H61C 1TIZA 3O4YA 2I7AA 3OHMB 4DUQA 4UPGA 1F70A 2FCDA 4DS7A 1OZSA 2BKHB 2BKIB 3DVKA 2LLSA 4XJKB 5AXIA 2EC6B 2OS8B 1C7VA 5CSFA 3CWGA 4NDCA 3DVEA 4CPVA 1J7RA 1TNWA 5ER4X 2EHBA 4PE4A 3WXAA 4PHMA 1M46A 2KNEA 1FPWA 2JWWA 1DVIA 1W7JB 1UUSA 2KFFA 1YUSA 4P2YB 2Y1MA 1PULA 3NSKA 2Y4QA 1KK8C 3EVRA 2Y5IA 4M2PA 1B8LA 1J55A 2LLUA 1FF1A 1A4PA 2KSPA 5AANA 1JF0A 4ZCVA 3DVJA 4YGDB 1LINA 1PALA 1F54A 1SW8A 2KAXA 3NSLA 2Y1NA 3BUWB 2WCEA 4QJ5B 2BECA 5JOLA 5HLVA 4AOMA 1N0YA 1NX3A 1S6IA 2LCPA 3I5IC 1SBJA 2BBMA 1CDLA 3CTNA 2PVBA 4PE0A 1NUBA 1YR5A 3GOFA 4YI9A 2ZN8A 1EG4A 1KK8B 2WCFA 3FS7A 4BY5A 1J7PA 4ETOA 1YTZC 1BF5A 1EXRA 1OOJA 2ZNDA 4CIDA 1G8IA 1Q80A 3BUMB 3TS5C 1TRFA 1DJWA 1RECA 2BL0B 2FOTA 3DF0B 2M1UA 2KDHA 3LLEA 3K21A 2WORA 1ZMZA 3SG3A 2IS9A 1X02A 1ZACA 3TDIA 2JC2A 2KI4C 4F0ZB 1F55A 5TNCA 2K61A 2FJUB 1NCYA 1CFDA 2K7CA 3CLNA 3RLZA 1GJYA 5HKYA 1NCXA 1RWYA 1UHHA 1CNPA 1IH0A 1K9PA 1S6JA 3E3RA 1CTRA 4PCWA 2L51A 3JTDC 1EJ3A 2L5XB 1UHJA 3KPXA 1DGUA 2BCBA 2MJWB 1DJXA 1PVAA 1NIWA 3A8RA 4YBHB 3OB2B 3SG4A 4PALA 2E6WA 1BODA 1BR4B 2OPOA 5D69A 2JNFA 1QJTA 4FQOA 2M1KB 3TZ1A 1DF0B 1TNXA 4ZCUA 1YVLA 1SL7A 1RFJA 2GV5A 2OTGC 3IQOA 1UHIA 2KHNA 4WQ2A 5PALA 2NZ0A 1BR1B 1CDNA 1B9AA 1B7TY 3LK0A 3CS1A 2M97A 3JTDB 2LP2A 5J3XA 3TUYC 3D0YB 3D0YA 1DTLA 4I5JA 3RM1A 2M3WA 3KEVA 2DOQA 2RGIA 2KYCA 3AKBA 4YGEB 1YX8A 4P5OE 2ZN9A 2BCAA 4HRHA 2MAZA 4WRIA 4TNCA 4C0JA 1A75B 1A75A 4C0KA 1C07A 3TDZA 1XFUO 2LE9B 4A4BA 1WRKA 2M7LA 1HT9A 1G33A 1Y1AA 5K89A 1QVIY 3KO0A 2K7BA 1A29A 1FBVA 3CGAA 1SY9A 5BPJA 1KK7Y 2LMVA 1B1GA 3SG6A 1DJYA 1KFXS 2HQWA 3PFVA 4PDZA 1BJFA 1AHRA 1XK4A 2EGDA 2B1UA 3KF9A 4OCIA 3VRNA 2QPTA 5I2OA 1UHNA 1QLKA 1MUXA 2I94A 1KFUS 4E68A 1E8AA 1RJVA 1S6CA 1F4OA 2L0PA 1QASA 2JU0A 2LNKA 3VROA 3WHUB 5CSJA 1JF2A 1PSRA 1QLSA 1KFXL 2TN4A 4PHKA 2E30A 4D1EA 4XJKA 1IRJA 1PK0D 1XYDA 4MSPA 3AKAA 4GNKB 4ICBA 4JQ0D 1FI6A 2LMUA 2KFGA 2L4IA 1MWNA 2NCPA 1WLZA 4MZLA 4ORCB 2MA2A 3DD4A 4AQJA 1OSAA 4HREE 1KFUL 4MVFA 2LVKA 3NSOA 1DT7B 1RTP1 1FI5A 1SL9A 2KI6D 1AJ4A 4XYNA 2CT9A 3HX4A 1QX7A 2MRDA 2JTZA 3PLFB 3PN7B 3KHEA 2MLFC 1DGVA 4HRGA 1ALWA 1B4CA 4OKHA 1L2OC 2H61A 3QRXA 1K90D 3PATA 4GBAA 2Q4UA 3SIBA 2KAVA 2I2RE 4U8DA 4CLNA 1H4BA 3ICBA 1B7TZ 2A4JA 3ZNIA 3O2PA 2F8PA 1CMGA 2LMTA 1XFZO 1F4QA 2NXQA 2K7DA 2LM5A 1JFKA 2BE6A 4MZKA 1TNQA 2K7OA 4NDBA 1U5IB 1IJ6A 3WNXB 2JULA 1C7WA 1BG1A 3BUOB 4Q04A 5ER5A 1NX0A 2M7NA 5DKRA 4HSZA 1CFPA 2O5GA 4I5NB 3EK7A 4JWQA 4PE1A 3VRQA 1QX2A 1QVIZ 3I5GC 3O6BA 2K8MB 3OP0A 2LP3A 2CXJA 1K93D 1KK7Z 2JT8A 3BUXB 1KQMC 1J7QA 2JQ6A 1UURA 1IQ5A 1SL8A 1ALVA 3DF0A 2PSRA 1S3PA 1NYAA 1YRUB 2WCBA 4PE7A 1AVSA 1JUOA 3I5IB 2LUXA 1CFCA 1F8HA 1BU3A 1GGWA 2K2FA 2LC5A 4A4CA 1DJIA 1SCMC 2F3YA 2HPSA 4GFTA 3FIAA 3BXKA 3SG7A 2AMIA 1KWOC 1OE9B 1NWDA 3LL8B 4MBEA 3TS5B 1SK6D 1IJ5A 2JOJA 4GPLB 4MRXA 4N1GA 1R6PA 3BQ3A 1QV1A 1MXEA 2F33A 2JNXA 1K8UA 2K0JA 1MXLC 3F45A 2ISDA 2HETA 2KI4B 3D10A 2D8NA 3EK8A 1MF8B 2WNDA 2KI6C 1DF0A 1SCMB 2L50A 1M39A 1QIWA 2M0RA 2P6BB 2PRUA 4L9MA 1JWDA 1S36A 2JXLA 3FWBA 1KCYA 1KWOB 2NLNA 5I2QA 3PSRA 2CCMA 1YX7A 2O60A 1TCFA 1DMOA 1YUUA 2G9BA 1YURA 2LVVA 2M8UA 2MHHA 4GGFA 1B8RA 3EKHA 2KQYA 1XFYO 4YGBB 3IQQA 1M31A 1F71A 1OQPA 3AAKA 1M63B 1DJZA 3H4SE 4M2OA 3BOWB 4MLWA 1KQVA 1K2HA 2OTGB 3OX6A 1LKJA 1XK4C 3LK1A 1SR6C 4MN0A 1LVCD 1AK8A 1SMGA 3EKJA 2KGBC 1XO5A 1DJHA 2JZIA 2LVIA 1TCOB 1NPQA 1TOPA 1HQVA 1K9UA 3JVTC 3TUYB 1CB1A 1PSBA 1YUTA 1K94A 1MHOA 1OMRA 2JTTA 2F2OA 3VGOA 3WHTB 1MR8A 4N1FA 2KFHA 3I5HC 4YGAA 3TDUA 2KAYA 1VRKA 2KGRA 4NQGA 1JBAA 1SYMA 2LHLA 2EC6C 2OS8C 2QACA 3OB1B 4YGCB 4ORBB 1LXFC 1ZOTB 3HCMA 2R2IA 2FCEA 4ORAB 3A4UB 3EVUA 1AUIB 4MZJA 1L7ZA 1EL4A 2M49B 4PHNA 1WRZA 5KU1A 3CR5X 2LLTA 2PASA 5HYDA 5GQQC 2LV7A 1IWQA 1UHKA 1NX1A 1W7IB 5DKQA 4AQIA 2WOSA 1JSAA 1BLQA 3I5HB 2GGZA 4JPZB 1EH2A 1CLLA 1QX5B 1WLMA 1XVJA 1N65A 1BT6A 1CLMA 4I5KA 1S26D 2ZFDA 4GGNA 1YRTB 2WC8A 3LCPC 4NDDA 1U5IA 2JPTA 3FWCA 2KOTA 1MQ1A 1IKUA 1KSMA 1PVBA 3SG5A 1S5GY 2KYFA 1D1OA 5CSNA 1L2OB 2JRFA 2M9GA 1LA3A 1CM4A 1BMOA 1SNLA 1WDCC 1WY9A 3CR2A 1Y1UA 4DIRA 1A03A 4DRWA 2BL0C 1V1FA 3OX5A 5IBWA 1YVHA 1QIVA 2GGMA 1CLBA 5CSIA 1J1DA 1NSHA 2H2KA 1N2DA 1J7OA 2L2EA 1XFXO 2ZRSA 1B8CA 1K9KA 1UWOA 3PALA 2LVJA 1QXPA 2LHIA 3VRRA 1QV0A 2PMYA 1XA5A 3GK1A 3GK2A 2Q91A 2JXCA 3SG2A 1ODBA 1WDCB 1SRAA 3I5GB 5JJGA 1CDMA 2COLB 2MLEC 3BUNB 5G08A 1CM1A 3PM8A 1KQMB 1A2XA 1SCVA 1GGZA 1KSOA 1CDPA 1FW4A 5AERA 1IGVA 1M45A 1QATA 4GUKA 2PALA 4QJ4B 4DCKA 2ZRTA 1JC2A 3NXAA 3I5FC 4YI8A 1K96A 3EVVA 2JT3A 3AAJA 2M29A 5HKWA 4QJ3B 5HLOA 1V1GA 2MBXA 2SASA 2SCPA 1Y6WA 1AJ5A 5CPVA 4BY4A 3C1VA 3O78A 4MRYA 4OR9B 1NCZA 1BOCA 2F3ZA 2VRGA 1CKKA 5KSZA 5D7FA 1NP8A 1QS7A 1XFVO 4USLA 4CFQA 1AP4A 2BE4A 1OMVA 1EG3A 4WQ3A 2NCOA 3I5FB 1OMDA 2I18A 1S5GZ 3GK4X 4GGFC 4PHJA 2BCXA 1SKTA 3CZTX 4FTGA 1J1EA 4I5LB 5KTYA 3VRPA 1PRWA 3BOWA 1OZOA 5AEQA 3SJSA 1IQ3A 1LA0A 2HF5A 4OVNF 1K95A 2AAOA 5F6TA 1XFWO 1IG5A 2AUCA 1SPYA 2L98A 1QTXA 3CR4X 2L4HA 1UP5A 2HQ8A 1TN4A 1WRLA 3BYAA 1Y0VH 1ZUZA 2V53A 5DKNA 5AFPA 3SIAA 2LANA 5I2LA 2KQ6A 3NSIA 4YRUA 3EK4A 2CTNA 5B8IB 2K2AA 1GQMA 2F2PA 3ZWHA 2CBLA 4N5XA 3M0WA 1RROA 1TTXA 2BBNA 2KBIA 4M2QA 1TNPA 1RK9A 2LAPA
chains in the Genus database with same CATH superfamily
5I8NA 2LUCA 1H8BA 1DJGA 3DVMA 4IL1A 4OV2A 4R1EA 1CFFA 1DELA 1B47A 1S1EA 1ZFSA 1NX2A 2CNPA 5FYXA 4CFRA 1Y1XA 1CMFA 1JFJA 2ZNEA 1T14A 4C0LA 2ZKMX 3MSEB 3L4LA 1R2UA 1G4YR 1SR6B 3IF7A 3FE8A 3OGNA 4MEWA 2JT0A 2G2BA 4GAOA 3JVTB 3PN7C 2KBMA 5HKZA 1Z2CB 2H61C 1TIZA 3O4YA 2I7AA 3OHMB 4DUQA 3CZ0A 4UPGA 2FCDA 1F70A 4DS7A 3B87A 1OZSA 2BKHB 2BKIB 4JKTA 3DVKA 5FI6A 2LLSA 4XJKB 5AXIA 2EC6B 2OS8B 1C7VA 5CSFA 3CWGA 4NDCA 3DVEA 1OW4A 1J7RA 1TNWA 3FE9A 4CPVA 5ER4X 2EHBA 4PE4A 3WXAA 2QEBA 4PHMA 1M46A 2KNEA 1FPWA 2JWWA 1DVIA 1W7JB 1UUSA 2KFFA 1YUSA 4P2YB 2Y1MA 1PULA 3NSKA 2Y4QA 1KK8C 3S0FA 3EVRA 2Y5IA 3NGVA 4M2PA 1B8LA 1J55A 2LLUA 1FF1A 1A4PA 2KSPA 5AANA 1JF0A 4ZCVA 1OOHA 3B88A 3DVJA 4YGDB 1LINA 1PALA 1F54A 1SW8A 2KAXA 3NSLA 4KYNA 2L5YA 2Y1NA 3BUWB 2WCEA 4QJ5B 2BECA 2YGUA 5JOLA 5HLVA 4AOMA 1N0YA 1NX3A 1S6IA 2LCPA 3I5IC 1SBJA 2BBMA 1CDLA 3CTNA 2QDIA 2PVBA 3BFHA 1NUBA 1YR5A 3GOFA 4PE0A 4YI9A 3UNWA 2ZN8A 1EG4A 1KK8B 2WCFA 2PYQA 3FS7A 4BY5A 1J7PA 4ETOA 1YTZC 2WC5A 1BF5A 3DZTA 1EXRA 1OOJA 2ZNDA 4CIDA 1G8IA 1Q80A 3BUMB 3TS5C 1TRFA 1DJWA 1RECA 2BL0B 2FOTA 3DF0B 2M1UA 2KDHA 3LLEA 3K21A 3S0DA 2WORA 1ZMZA 3SG3A 2IS9A 4AQJA 1TUJA 1X02A 1ZACA 3TDIA 2JC2A 1OOIX 2KI4C 4F0ZB 1F55A 5TNCA 2K61A 1OOFA 1ORGA 2FJUB 3OBVA 1NCYA 1CFDA 2K7CA 3CLNA 3RLZA 1GJYA 5HKYA 1NCXA 1RWYA 1UHHA 1CNPA 1IH0A 1K9PA 1S6JA 3E3RA 1CTRA 4PCWA 4IJ7A 2L51A 3JTDC 2WCHA 1EJ3A 2L5XB 1UHJA 3KPXA 1DGUA 2BCBA 2MJWB 1DJXA 1PVAA 1NIWA 3A8RA 4YBHB 3OB2B 3SG4A 3BFBA 4PALA 2E6WA 1BODA 1BR4B 2OPOA 5D69A 4FQTA 2JNFA 1QJTA 4FQOA 2M1KB 3TZ1A 1DF0B 1TNXA 4ZCUA 1YVLA 1SL7A 1RFJA 2GV5A 2OTGC 3IQOA 1UHIA 2KHNA 4WQ2A 5PALA 1DEKA 2NZ0A 1BR1B 1CDNA 5FI7A 1B9AA 1B7TY 3LK0A 3CS1A 2M97A 3BJHA 3JTDB 2LP2A 5J3XA 5I94A 3TUYC 3D0YB 3D0YA 1DTLA 4I5JA 1SSEB 1Z4HA 2M3WA 3RM1A 3KEVA 2DOQA 2RGIA 2KYCA 3AKBA 4YGEB 1YX8A 4P5OE 2ZN9A 2BCAA 3B86A 4HRHA 2KLEA 2MAZA 4TNCA 4WRIA 1A75B 1A75A 4C0KA 4C0JA 1C07A 3TDZA 1XFUO 2LE9B 4A4BA 1WRKA 5FI2A 2M7LA 2KPHA 1HT9A 1G33A 1Y1AA 5K89A 1QVIY 3KO0A 2K7BA 1A29A 1FBVA 2WC6A 3CGAA 1SY9A 3DXLA 5BPJA 3PJIA 1KK7Y 4OZDA 2LMVA 2QEOA 3SG6A 1DJYA 1KFXS 2HQWA 3PFVA 4PDZA 1BJFA 1AHRA 1XK4A 2EGDA 2B1UA 3KF9A 4OCIA 3VRNA 2QPTA 5I2OA 1UHNA 1QLKA 5AFPA 1MUXA 2I94A 1KFUS 4E68A 1E8AA 1RJVA 1S6CA 1F4OA 2L0PA 1QASA 2JU0A 2LNKA 3VROA 3WHUB 5CSJA 1JF2A 1PSRA 1QLSA 1KFXL 2TN4A 4PHKA 2E30A 4D1EA 4XJKA 1LS8A 1IRJA 1PK0D 2WCMA 1XYDA 4MSPA 3AKAA 4GNKB 4ICBA 4JQ0D 1FI6A 2LMUA 2KFGA 2L4IA 1MWNA 2NCPA 1P28A 1WLZA 4MZLA 2MA2A 3DD4A 4ORCB 1OSAA 4HREE 1KFUL 3K1EA 2LVKA 3DYEA 3NSOA 1RTP1 3R1PA 1SL9A 2KI6D 1AJ4A 4XYNA 1DT7B 2CT9A 3HX4A 1QX7A 2MRDA 3S0GA 2JTZA 3PLFB 3PN7B 3KHEA 2MLFC 1DGVA 3BFAA 3D78A 4HRGA 3VB1A 1ALWA 1B4CA 4OKHA 1L2OC 2H61A 3QRXA 1K90D 3PATA 4GBAA 2Q4UA 3SIBA 2KAVA 2I2RE 4U8DA 3SS4A 4CLNA 1H4BA 3ICBA 1B7TZ 2A4JA 3ZNIA 3O2PA 2F8PA 1CMGA 2LMTA 1XFZO 1F4QA 2NXQA 2K7DA 2LM5A 3N7HA 1JFKA 2BE6A 4MZKA 1TNQA 2K7OA 4NDBA 1DQEA 1IJ6A 1U5IB 3V2LA 2JULA 1C7WA 3WNXB 3BUOB 4INWA 4Q04A 5ER5A 1NX0A 2M7NA 5DKRA 1BG1A 4HSZA 2K60A 1CFPA 2O5GA 4I5NB 3EK7A 4JWQA 4PE1A 3S0BA 1QX2A 3PM2A 3VRQA 1QVIZ 3I5GC 3O6BA 2K8MB 3OP0A 2LP3A 2CXJA 1K93D 1KK7Z 2JT8A 3BUXB 1KQMC 1W9ZA 1J7QA 3UO9A 2JQ6A 1UURA 1IQ5A 1SL8A 5DICA 1ALVA 3DF0A 2PSRA 1S3PA 1NYAA 2L2CA 4INXA 3FE6A 1YRUB 2WCBA 4PE7A 3O4XA 1AVSA 1JUOA 3I5IB 2LUXA 1CFCA 1F8HA 1BU3A 1GGWA 2K2FA 2LC5A 4A4CA 1DJIA 1SCMC 3D76A 2F3YA 2HPSA 3QMEA 4GFTA 3FIAA 3BXKA 3SG7A 2AMIA 1TWOA 1KWOC 1OE9B 1NWDA 3LL8B 4MBEA 3TS5B 1SK6D 1IJ5A 2JOJA 4GPLB 4MRXA 4N1GA 1R6PA 3BQ3A 1QV1A 1MXEA 2F33A 2JNXA 1K8UA 2K0JA 1MXLC 3F45A 2ISDA 2HETA 2KI4B 3D10A 2D8NA 3EK8A 1MF8B 2WNDA 2KI6C 1DF0A 1SCMB 1C3YA 2L50A 1FI5A 1M39A 2BNXA 1QIWA 2M0RA 2P6BB 2PRUA 3R72A 4L9MA 4MVFA 1JWDA 1S36A 2JXLA 3FWBA 3S0EA 3EG5B 1KWOB 1KCYA 2NLNA 5I2QA 3PSRA 2CCMA 1YX7A 4PT1A 3D74A 3RZSA 2O60A 1TCFA 1DMOA 1YUUA 2G9BA 1YURA 2LVVA 2M8UA 2MHHA 4GGFA 1B8RA 3EKHA 2KQYA 1XFYO 4YGBB 3IQQA 1M31A 1F71A 1OQPA 3AAKA 3R1OA 1M63B 1DJZA 3H4SE 4M2OA 3BOWB 4MLWA 1KQVA 1K2HA 2OTGB 3DY9A 5D3OA 3OX6A 1LKJA 1XK4C 3LK1A 2PQLA 1SR6C 4MN0A 1LVCD 1AK8A 1SMGA 3EKJA 2KGBC 1XO5A 1DJHA 2JZIA 2LVIA 1TCOB 1NPQA 1TOPA 1HQVA 1K9UA 3JVTC 3TUYB 1CB1A 1IIOA 1PSBA 2KLDA 1YUTA 1K94A 1MHOA 1OMRA 1OOGA 2F2OA 2JTTA 3VGOA 4JD9A 3WHTB 1MR8A 4N1FA 2KFHA 3I5HC 3NHTA 4YGAA 3TDUA 2KAYA 1VRKA 2KGRA 4NQGA 1JBAA 1SYMA 2LHLA 2EC6C 2OS8C 2QACA 3OB1B 4YGCB 4ORBB 1LXFC 1ZOTB 3HCMA 2R2IA 2FCEA 3L4AA 3A4UB 3EVUA 4ORAB 1AUIB 5EL2A 4MZJA 1L7ZA 1EL4A 2M49B 4PHNA 1WRZA 5KU1A 3CR5X 2LLTA 2PASA 5HYDA 5GQQC 2LV7A 1IWQA 1UHKA 1NX1A 1W7IB 3B7AA 5DKQA 4AQIA 2WOSA 1QWVA 1JSAA 1BLQA 3I5HB 3S0AA 2GGZA 4JPZB 1EH2A 1CLLA 1QX5B 1WLMA 1XVJA 1N65A 2JPOA 1BT6A 3L47A 1CLMA 4I5KA 1S26D 2ZFDA 4GGNA 1YRTB 2WC8A 3LCPC 4NDDA 2P70A 3IVTA 1U5IA 2JPTA 3FWCA 2KOTA 1MQ1A 1IKUA 1KSMA 1PVBA 3SG5A 1S5GY 2KYFA 1D1OA 5CSNA 3CYZA 1L2OB 2JRFA 2M9GA 3CABA 1LA3A 1CM4A 1BMOA 1SNLA 1WDCC 1WY9A 3SS5A 3CR2A 3D73A 2WCLA 4F7FA 1Y1UA 4DIRA 1A03A 4DRWA 2BL0C 1C3ZA 1V1FA 3OX5A 5IBWA 1YVHA 1QIVA 2GGMA 3B6XA 1CLBA 5CSIA 1DC1A 1J1DA 1NSHA 2FJYA 1N2DA 2H2KA 2L2EA 1J7OA 1XFXO 2ZRSA 1B8CA 1K9KA 1UWOA 3PALA 2LVJA 1QXPA 2LHIA 3VRRA 1QV0A 2PMYA 1XA5A 3GK1A 3GK2A 2Q91A 2JXCA 2P71A 3SG2A 1ODBA 1WDCB 1SRAA 3I5GB 3SS3A 5JJGA 1CDMA 2COLB 2MLEC 3BUNB 5G08A 1CM1A 3PM8A 1KQMB 1A2XA 1SCVA 1GGZA 1KSOA 1CDPA 1FW4A 3CZ2A 1IGVA 5AERA 1M45A 1QATA 4GUKA 2PALA 4QJ4B 4DCKA 2ZRTA 1JC2A 3NXAA 3CZ1A 3I5FC 4YI8A 1K96A 3EVVA 2JT3A 3CDNA 2WCKA 1B1GA 3AAJA 2M29A 5HKWA 4QJ3B 5HLOA 1V1GA 2MBXA 2SASA 2SCPA 1Y6WA 1AJ5A 5CPVA 4BY4A 3C1VA 3O78A 4MRYA 4OR9B 1NCZA 1BOCA 2F3ZA 2VRGA 1CKKA 5KSZA 5D7FA 1NP8A 1QS7A 1XFVO 3NHIA 4USLA 4CFQA 2BE4A 1OMVA 1AP4A 1EG3A 4WQ3A 2NCOA 3I5FB 1OMDA 2I18A 1S5GZ 2GTEA 3GK4X 4GGFC 4PHJA 2BCXA 1SKTA 3CZTX 4FTGA 1J1EA 1TUZA 4I5LB 5KTYA 3VRPA 1PRWA 3D75A 3BOWA 1OZOA 5AEQA 3SJSA 1IQ3A 1LA0A 2HF5A 4OVNF 1K95A 2ERBA 2H8VA 2AAOA 5F6TA 1XFWO 3R1VA 1IG5A 2AUCA 1SPYA 2L98A 1QTXA 3CR4X 1XFRA 2L4HA 1UP5A 2HQ8A 2QEHA 1TN4A 1WRLA 3BYAA 2BAPA 3D77A 5HL1A 1Y0VH 1ZUZA 2V53A 5DKNA 2QEVA 3SIAA 2LANA 5I2LA 2KQ6A 3NSIA 4YRUA 3EK4A 2CTNA 5B8IB 2K2AA 1GQMA 2F2PA 3ZWHA 2CBLA 4N5XA 3M0WA 1RROA 1TTXA 2BBNA 2KBIA 2WCJA 4M2QA 1GM0A 1TNPA 3Q8IA 1RK9A 2LAPA
chains in the Genus database with same CATH topology
5I8NA 2LUCA 1H8BA 1DJGA 3DVMA 4IL1A 4OV2A 4R1EA 1CFFA 1B47A 1S1EA 1ZFSA 1NX2A 2CNPA 5FYXA 4CFRA 1Y1XA 1CMFA 1JFJA 2ZNEA 4C0LA 2ZKMX 3MSEB 1R2UA 1G4YR 1SR6B 3IF7A 4MEWA 2JT0A 2G2BA 4GAOA 3JVTB 3PN7C 2KBMA 5HKZA 2H61C 1TIZA 3O4YA 2I7AA 3OHMB 4DUQA 4UPGA 1F70A 2FCDA 4DS7A 1OZSA 2BKHB 2BKIB 3DVKA 2LLSA 4XJKB 5AXIA 2EC6B 2OS8B 1C7VA 5CSFA 3CWGA 4NDCA 3DVEA 4CPVA 1J7RA 1TNWA 5ER4X 2EHBA 4PE4A 3WXAA 4PHMA 1M46A 2KNEA 1FPWA 2JWWA 1DVIA 1W7JB 1UUSA 2KFFA 1YUSA 4P2YB 2Y1MA 1PULA 3NSKA 2Y4QA 1KK8C 3EVRA 2Y5IA 4M2PA 1B8LA 1J55A 2LLUA 1FF1A 1A4PA 2KSPA 5AANA 1JF0A 4ZCVA 3DVJA 4YGDB 1LINA 1PALA 1F54A 1SW8A 2KAXA 3NSLA 2Y1NA 3BUWB 2WCEA 4QJ5B 2BECA 5JOLA 5HLVA 4AOMA 1N0YA 1NX3A 1S6IA 2LCPA 3I5IC 1SBJA 2BBMA 1CDLA 3CTNA 2PVBA 4PE0A 1NUBA 1YR5A 3GOFA 4YI9A 2ZN8A 1EG4A 1KK8B 2WCFA 3FS7A 4BY5A 1J7PA 4ETOA 1YTZC 1BF5A 1EXRA 1OOJA 2ZNDA 4CIDA 1G8IA 1Q80A 3BUMB 3TS5C 1TRFA 1DJWA 1RECA 2BL0B 2FOTA 3DF0B 2M1UA 2KDHA 3LLEA 3K21A 2WORA 1ZMZA 3SG3A 2IS9A 1X02A 1ZACA 3TDIA 2JC2A 2KI4C 4F0ZB 1F55A 5TNCA 2K61A 2FJUB 1NCYA 1CFDA 2K7CA 3CLNA 3RLZA 1GJYA 5HKYA 1NCXA 1RWYA 1UHHA 1CNPA 1IH0A 1K9PA 1S6JA 3E3RA 1CTRA 4PCWA 2L51A 3JTDC 1EJ3A 2L5XB 1UHJA 3KPXA 1DGUA 2BCBA 2MJWB 1DJXA 1PVAA 1NIWA 3A8RA 4YBHB 3OB2B 3SG4A 4PALA 2E6WA 1BODA 1BR4B 2OPOA 5D69A 2JNFA 1QJTA 4FQOA 2M1KB 3TZ1A 1DF0B 1TNXA 4ZCUA 1YVLA 1SL7A 1RFJA 2GV5A 2OTGC 3IQOA 1UHIA 2KHNA 4WQ2A 5PALA 2NZ0A 1BR1B 1CDNA 1B9AA 1B7TY 3LK0A 3CS1A 2M97A 3JTDB 2LP2A 5J3XA 3TUYC 3D0YB 3D0YA 1DTLA 4I5JA 3RM1A 2M3WA 3KEVA 2DOQA 2RGIA 2KYCA 3AKBA 4YGEB 1YX8A 4P5OE 2ZN9A 2BCAA 4HRHA 2MAZA 4WRIA 4TNCA 4C0JA 1A75B 1A75A 4C0KA 1C07A 3TDZA 1XFUO 2LE9B 4A4BA 1WRKA 2M7LA 1HT9A 1G33A 1Y1AA 5K89A 1QVIY 3KO0A 2K7BA 1A29A 1FBVA 3CGAA 1SY9A 5BPJA 1KK7Y 2LMVA 1B1GA 3SG6A 1DJYA 1KFXS 2HQWA 3PFVA 4PDZA 1BJFA 1AHRA 1XK4A 2EGDA 2B1UA 3KF9A 4OCIA 3VRNA 2QPTA 5I2OA 1UHNA 1QLKA 1MUXA 2I94A 1KFUS 4E68A 1E8AA 1RJVA 1S6CA 1F4OA 2L0PA 1QASA 2JU0A 2LNKA 3VROA 3WHUB 5CSJA 1JF2A 1PSRA 1QLSA 1KFXL 2TN4A 4PHKA 2E30A 4D1EA 4XJKA 1IRJA 1PK0D 1XYDA 4MSPA 3AKAA 4GNKB 4ICBA 4JQ0D 1FI6A 2LMUA 2KFGA 2L4IA 1MWNA 2NCPA 1WLZA 4MZLA 4ORCB 2MA2A 3DD4A 4AQJA 1OSAA 4HREE 1KFUL 4MVFA 2LVKA 3NSOA 1DT7B 1RTP1 1FI5A 1SL9A 2KI6D 1AJ4A 4XYNA 2CT9A 3HX4A 1QX7A 2MRDA 2JTZA 3PLFB 3PN7B 3KHEA 2MLFC 1DGVA 4HRGA 1ALWA 1B4CA 4OKHA 1L2OC 2H61A 3QRXA 1K90D 3PATA 4GBAA 2Q4UA 3SIBA 2KAVA 2I2RE 4U8DA 4CLNA 1H4BA 3ICBA 1B7TZ 2A4JA 3ZNIA 3O2PA 2F8PA 1CMGA 2LMTA 1XFZO 1F4QA 2NXQA 2K7DA 2LM5A 1JFKA 2BE6A 4MZKA 1TNQA 2K7OA 4NDBA 1U5IB 1IJ6A 3WNXB 2JULA 1C7WA 1BG1A 3BUOB 4Q04A 5ER5A 1NX0A 2M7NA 5DKRA 4HSZA 1CFPA 2O5GA 4I5NB 3EK7A 4JWQA 4PE1A 3VRQA 1QX2A 1QVIZ 3I5GC 3O6BA 2K8MB 3OP0A 2LP3A 2CXJA 1K93D 1KK7Z 2JT8A 3BUXB 1KQMC 1J7QA 2JQ6A 1UURA 1IQ5A 1SL8A 1ALVA 3DF0A 2PSRA 1S3PA 1NYAA 1YRUB 2WCBA 4PE7A 1AVSA 1JUOA 3I5IB 2LUXA 1CFCA 1F8HA 1BU3A 1GGWA 2K2FA 2LC5A 4A4CA 1DJIA 1SCMC 2F3YA 2HPSA 4GFTA 3FIAA 3BXKA 3SG7A 2AMIA 1KWOC 1OE9B 1NWDA 3LL8B 4MBEA 3TS5B 1SK6D 1IJ5A 2JOJA 4GPLB 4MRXA 4N1GA 1R6PA 3BQ3A 1QV1A 1MXEA 2F33A 2JNXA 1K8UA 2K0JA 1MXLC 3F45A 2ISDA 2HETA 2KI4B 3D10A 2D8NA 3EK8A 1MF8B 2WNDA 2KI6C 1DF0A 1SCMB 2L50A 1M39A 1QIWA 2M0RA 2P6BB 2PRUA 4L9MA 1JWDA 1S36A 2JXLA 3FWBA 1KCYA 1KWOB 2NLNA 5I2QA 3PSRA 2CCMA 1YX7A 2O60A 1TCFA 1DMOA 1YUUA 2G9BA 1YURA 2LVVA 2M8UA 2MHHA 4GGFA 1B8RA 3EKHA 2KQYA 1XFYO 4YGBB 3IQQA 1M31A 1F71A 1OQPA 3AAKA 1M63B 1DJZA 3H4SE 4M2OA 3BOWB 4MLWA 1KQVA 1K2HA 2OTGB 3OX6A 1LKJA 1XK4C 3LK1A 1SR6C 4MN0A 1LVCD 1AK8A 1SMGA 3EKJA 2KGBC 1XO5A 1DJHA 2JZIA 2LVIA 1TCOB 1NPQA 1TOPA 1HQVA 1K9UA 3JVTC 3TUYB 1CB1A 1PSBA 1YUTA 1K94A 1MHOA 1OMRA 2JTTA 2F2OA 3VGOA 3WHTB 1MR8A 4N1FA 2KFHA 3I5HC 4YGAA 3TDUA 2KAYA 1VRKA 2KGRA 4NQGA 1JBAA 1SYMA 2LHLA 2EC6C 2OS8C 2QACA 3OB1B 4YGCB 4ORBB 1LXFC 1ZOTB 3HCMA 2R2IA 2FCEA 4ORAB 3A4UB 3EVUA 1AUIB 4MZJA 1L7ZA 1EL4A 2M49B 4PHNA 1WRZA 5KU1A 3CR5X 2LLTA 2PASA 5HYDA 5GQQC 2LV7A 1IWQA 1UHKA 1NX1A 1W7IB 5DKQA 4AQIA 2WOSA 1JSAA 1BLQA 3I5HB 2GGZA 4JPZB 1EH2A 1CLLA 1QX5B 1WLMA 1XVJA 1N65A 1BT6A 1CLMA 4I5KA 1S26D 2ZFDA 4GGNA 1YRTB 2WC8A 3LCPC 4NDDA 1U5IA 2JPTA 3FWCA 2KOTA 1MQ1A 1IKUA 1KSMA 1PVBA 3SG5A 1S5GY 2KYFA 1D1OA 5CSNA 1L2OB 2JRFA 2M9GA 1LA3A 1CM4A 1BMOA 1SNLA 1WDCC 1WY9A 3CR2A 1Y1UA 4DIRA 1A03A 4DRWA 2BL0C 1V1FA 3OX5A 5IBWA 1YVHA 1QIVA 2GGMA 1CLBA 5CSIA 1J1DA 1NSHA 2H2KA 1N2DA 1J7OA 2L2EA 1XFXO 2ZRSA 1B8CA 1K9KA 1UWOA 3PALA 2LVJA 1QXPA 2LHIA 3VRRA 1QV0A 2PMYA 1XA5A 3GK1A 3GK2A 2Q91A 2JXCA 3SG2A 1ODBA 1WDCB 1SRAA 3I5GB 5JJGA 1CDMA 2COLB 2MLEC 3BUNB 5G08A 1CM1A 3PM8A 1KQMB 1A2XA 1SCVA 1GGZA 1KSOA 1CDPA 1FW4A 5AERA 1IGVA 1M45A 1QATA 4GUKA 2PALA 4QJ4B 4DCKA 2ZRTA 1JC2A 3NXAA 3I5FC 4YI8A 1K96A 3EVVA 2JT3A 3AAJA 2M29A 5HKWA 4QJ3B 5HLOA 1V1GA 2MBXA 2SASA 2SCPA 1Y6WA 1AJ5A 5CPVA 4BY4A 3C1VA 3O78A 4MRYA 4OR9B 1NCZA 1BOCA 2F3ZA 2VRGA 1CKKA 5KSZA 5D7FA 1NP8A 1QS7A 1XFVO 4USLA 4CFQA 1AP4A 2BE4A 1OMVA 1EG3A 4WQ3A 2NCOA 3I5FB 1OMDA 2I18A 1S5GZ 3GK4X 4GGFC 4PHJA 2BCXA 1SKTA 3CZTX 4FTGA 1J1EA 4I5LB 5KTYA 3VRPA 1PRWA 3BOWA 1OZOA 5AEQA 3SJSA 1IQ3A 1LA0A 2HF5A 4OVNF 1K95A 2AAOA 5F6TA 1XFWO 1IG5A 2AUCA 1SPYA 2L98A 1QTXA 3CR4X 2L4HA 1UP5A 2HQ8A 1TN4A 1WRLA 3BYAA 1Y0VH 1ZUZA 2V53A 5DKNA 5AFPA 3SIAA 2LANA 5I2LA 2KQ6A 3NSIA 4YRUA 3EK4A 2CTNA 5B8IB 2K2AA 1GQMA 2F2PA 3ZWHA 2CBLA 4N5XA 3M0WA 1RROA 1TTXA 2BBNA 2KBIA 4M2QA 1TNPA 1RK9A 2LAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I8N A;  2LUC A;  1H8B A;  1DJG A;  3DVM A;  4IL1 A;  4OV2 A;  4R1E A;  1CFF A;  1B47 A;  1S1E A;  1ZFS A;  1NX2 A;  2CNP A;  5FYX A;  4CFR A;  1Y1X A;  1CMF A;  1JFJ A;  2ZNE A;  4C0L A;  2ZKM X;  3MSE B;  1R2U A;  1G4Y R;  1SR6 B;  3IF7 A;  4MEW A;  2JT0 A;  2G2B A;  4GAO A;  3JVT B;  3PN7 C;  2KBM A;  5HKZ A;  2H61 C;  1TIZ A;  3O4Y A;  2I7A A;  3OHM B;  4DUQ A;  4UPG A;  1F70 A;  2FCD A;  4DS7 A;  1OZS A;  2BKH B;  2BKI B;  3DVK A;  2LLS A;  4XJK B;  5AXI A;  2EC6 B;  2OS8 B;  1C7V A;  5CSF A;  3CWG A;  4NDC A;  3DVE A;  4CPV A;  1J7R A;  1TNW A;  5ER4 X;  2EHB A;  4PE4 A;  3WXA A;  4PHM A;  1M46 A;  2KNE A;  1FPW A;  2JWW A;  1DVI A;  1W7J B;  1UUS A;  2KFF A;  1YUS A;  4P2Y B;  2Y1M A;  1PUL A;  3NSK A;  2Y4Q A;  1KK8 C;  3EVR A;  2Y5I A;  4M2P A;  1B8L A;  1J55 A;  2LLU A;  1FF1 A;  1A4P A;  2KSP A;  5AAN A;  1JF0 A;  4ZCV A;  3DVJ A;  4YGD B;  1LIN A;  1PAL A;  1F54 A;  1SW8 A;  2KAX A;  3NSL A;  2Y1N A;  3BUW B;  2WCE A;  4QJ5 B;  2BEC A;  5JOL A;  5HLV A;  4AOM A;  1N0Y A;  1NX3 A;  1S6I A;  2LCP A;  3I5I C;  1SBJ A;  2BBM A;  1CDL A;  3CTN A;  2PVB A;  4PE0 A;  1NUB A;  1YR5 A;  3GOF A;  4YI9 A;  2ZN8 A;  1EG4 A;  1KK8 B;  2WCF A;  3FS7 A;  4BY5 A;  1J7P A;  4ETO A;  1YTZ C;  1BF5 A;  1EXR A;  1OOJ A;  2ZND A;  4CID A;  1G8I A;  1Q80 A;  3BUM B;  3TS5 C;  1TRF A;  1DJW A;  1REC A;  2BL0 B;  2FOT A;  3DF0 B;  2M1U A;  2KDH A;  3LLE A;  3K21 A;  2WOR A;  1ZMZ A;  3SG3 A;  2IS9 A;  1X02 A;  1ZAC A;  3TDI A;  2JC2 A;  2KI4 C;  4F0Z B;  1F55 A;  5TNC A;  2K61 A;  2FJU B;  1NCY A;  1CFD A;  2K7C A;  3CLN A;  3RLZ A;  1GJY A;  5HKY A;  1NCX A;  1RWY A;  1UHH A;  1CNP A;  1IH0 A;  1K9P A;  1S6J A;  3E3R A;  1CTR A;  4PCW A;  2L51 A;  3JTD C;  1EJ3 A;  2L5X B;  1UHJ A;  3KPX A;  1DGU A;  2BCB A;  2MJW B;  1DJX A;  1PVA A;  1NIW A;  3A8R A;  4YBH B;  3OB2 B;  3SG4 A;  4PAL A;  2E6W A;  1BOD A;  1BR4 B;  2OPO A;  5D69 A;  2JNF A;  1QJT A;  4FQO A;  2M1K B;  3TZ1 A;  1DF0 B;  1TNX A;  4ZCU A;  1YVL A;  1SL7 A;  1RFJ A;  2GV5 A;  2OTG C;  3IQO A;  1UHI A;  2KHN A;  4WQ2 A;  5PAL A;  2NZ0 A;  1BR1 B;  1CDN A;  1B9A A;  1B7T Y;  3LK0 A;  3CS1 A;  2M97 A;  3JTD B;  2LP2 A;  5J3X A;  3TUY C;  3D0Y B;  3D0Y A;  1DTL A;  4I5J A;  3RM1 A;  2M3W A;  3KEV A;  2DOQ A;  2RGI A;  2KYC A;  3AKB A;  4YGE B;  1YX8 A;  4P5O E;  2ZN9 A;  2BCA A;  4HRH A;  2MAZ A;  4WRI A;  4TNC A;  4C0J A;  1A75 B;  1A75 A;  4C0K A;  1C07 A;  3TDZ A;  1XFU O;  2LE9 B;  4A4B A;  1WRK A;  2M7L A;  1HT9 A;  1G33 A;  1Y1A A;  5K89 A;  1QVI Y;  3KO0 A;  2K7B A;  1A29 A;  1FBV A;  3CGA A;  1SY9 A;  5BPJ A;  1KK7 Y;  2LMV A;  1B1G A;  3SG6 A;  1DJY A;  1KFX S;  2HQW A;  3PFV A;  4PDZ A;  1BJF A;  1AHR A;  1XK4 A;  2EGD A;  2B1U A;  3KF9 A;  4OCI A;  3VRN A;  2QPT A;  5I2O A;  1UHN A;  1QLK A;  1MUX A;  2I94 A;  1KFU S;  4E68 A;  1E8A A;  1RJV A;  1S6C A;  1F4O A;  2L0P A;  1QAS A;  2JU0 A;  2LNK A;  3VRO A;  3WHU B;  5CSJ A;  1JF2 A;  1PSR A;  1QLS A;  1KFX L;  2TN4 A;  4PHK A;  2E30 A;  4D1E A;  4XJK A;  1IRJ A;  1PK0 D;  1XYD A;  4MSP A;  3AKA A;  4GNK B;  4ICB A;  4JQ0 D;  1FI6 A;  2LMU A;  2KFG A;  2L4I A;  1MWN A;  2NCP A;  1WLZ A;  4MZL A;  4ORC B;  2MA2 A;  3DD4 A;  4AQJ A;  1OSA A;  4HRE E;  1KFU L;  4MVF A;  2LVK A;  3NSO A;  1DT7 B;  1RTP 1;  1FI5 A;  1SL9 A;  2KI6 D;  1AJ4 A;  4XYN A;  2CT9 A;  3HX4 A;  1QX7 A;  2MRD A;  2JTZ A;  3PLF B;  3PN7 B;  3KHE A;  2MLF C;  1DGV A;  4HRG A;  1ALW A;  1B4C A;  4OKH A;  1L2O C;  2H61 A;  3QRX A;  1K90 D;  3PAT A;  4GBA A;  2Q4U A;  3SIB A;  2KAV A;  2I2R E;  4U8D A;  4CLN A;  1H4B A;  3ICB A;  1B7T Z;  2A4J A;  3ZNI A;  3O2P A;  2F8P A;  1CMG A;  2LMT A;  1XFZ O;  1F4Q A;  2NXQ A;  2K7D A;  2LM5 A;  1JFK A;  2BE6 A;  4MZK A;  1TNQ A;  2K7O A;  4NDB A;  1U5I B;  1IJ6 A;  3WNX B;  2JUL A;  1C7W A;  1BG1 A;  3BUO B;  4Q04 A;  5ER5 A;  1NX0 A;  2M7N A;  5DKR A;  4HSZ A;  1CFP A;  2O5G A;  4I5N B;  3EK7 A;  4JWQ A;  4PE1 A;  3VRQ A;  1QX2 A;  1QVI Z;  3I5G C;  3O6B A;  2K8M B;  3OP0 A;  2LP3 A;  2CXJ A;  1K93 D;  1KK7 Z;  2JT8 A;  3BUX B;  1KQM C;  1J7Q A;  2JQ6 A;  1UUR A;  1IQ5 A;  1SL8 A;  1ALV A;  3DF0 A;  2PSR A;  1S3P A;  1NYA A;  1YRU B;  2WCB A;  4PE7 A;  1AVS A;  1JUO A;  3I5I B;  2LUX A;  1CFC A;  1F8H A;  1BU3 A;  1GGW A;  2K2F A;  2LC5 A;  4A4C A;  1DJI A;  1SCM C;  2F3Y A;  2HPS A;  4GFT A;  3FIA A;  3BXK A;  3SG7 A;  2AMI A;  1KWO C;  1OE9 B;  1NWD A;  3LL8 B;  4MBE A;  3TS5 B;  1SK6 D;  1IJ5 A;  2JOJ A;  4GPL B;  4MRX A;  4N1G A;  1R6P A;  3BQ3 A;  1QV1 A;  1MXE A;  2F33 A;  2JNX A;  1K8U A;  2K0J A;  1MXL C;  3F45 A;  2ISD A;  2HET A;  2KI4 B;  3D10 A;  2D8N A;  3EK8 A;  1MF8 B;  2WND A;  2KI6 C;  1DF0 A;  1SCM B;  2L50 A;  1M39 A;  1QIW A;  2M0R A;  2P6B B;  2PRU A;  4L9M A;  1JWD A;  1S36 A;  2JXL A;  3FWB A;  1KCY A;  1KWO B;  2NLN A;  5I2Q A;  3PSR A;  2CCM A;  1YX7 A;  2O60 A;  1TCF A;  1DMO A;  1YUU A;  2G9B A;  1YUR A;  2LVV A;  2M8U A;  2MHH A;  4GGF A;  1B8R A;  3EKH A;  2KQY A;  1XFY O;  4YGB B;  3IQQ A;  1M31 A;  1F71 A;  1OQP A;  3AAK A;  1M63 B;  1DJZ A;  3H4S E;  4M2O A;  3BOW B;  4MLW A;  1KQV A;  1K2H A;  2OTG B;  3OX6 A;  1LKJ A;  1XK4 C;  3LK1 A;  1SR6 C;  4MN0 A;  1LVC D;  1AK8 A;  1SMG A;  3EKJ A;  2KGB C;  1XO5 A;  1DJH A;  2JZI A;  2LVI A;  1TCO B;  1NPQ A;  1TOP A;  1HQV A;  1K9U A;  3JVT C;  3TUY B;  1CB1 A;  1PSB A;  1YUT A;  1K94 A;  1MHO A;  1OMR A;  2JTT A;  2F2O A;  3VGO A;  3WHT B;  1MR8 A;  4N1F A;  2KFH A;  3I5H C;  4YGA A;  3TDU A;  2KAY A;  1VRK A;  2KGR A;  4NQG A;  1JBA A;  1SYM A;  2LHL A;  2EC6 C;  2OS8 C;  2QAC A;  3OB1 B;  4YGC B;  4ORB B;  1LXF C;  1ZOT B;  3HCM A;  2R2I A;  2FCE A;  4ORA B;  3A4U B;  3EVU A;  1AUI B;  4MZJ A;  1L7Z A;  1EL4 A;  2M49 B;  4PHN A;  1WRZ A;  5KU1 A;  3CR5 X;  2LLT A;  2PAS A;  5HYD A;  5GQQ C;  2LV7 A;  1IWQ A;  1UHK A;  1NX1 A;  1W7I B;  5DKQ A;  4AQI A;  2WOS A;  1JSA A;  1BLQ A;  3I5H B;  2GGZ A;  4JPZ B;  1EH2 A;  1CLL A;  1QX5 B;  1WLM A;  1XVJ A;  1N65 A;  1BT6 A;  1CLM A;  4I5K A;  1S26 D;  2ZFD A;  4GGN A;  1YRT B;  2WC8 A;  3LCP C;  4NDD A;  1U5I A;  2JPT A;  3FWC A;  2KOT A;  1MQ1 A;  1IKU A;  1KSM A;  1PVB A;  3SG5 A;  1S5G Y;  2KYF A;  1D1O A;  5CSN A;  1L2O B;  2JRF A;  2M9G A;  1LA3 A;  1CM4 A;  1BMO A;  1SNL A;  1WDC C;  1WY9 A;  3CR2 A;  1Y1U A;  4DIR A;  1A03 A;  4DRW A;  2BL0 C;  1V1F A;  3OX5 A;  5IBW A;  1YVH A;  1QIV A;  2GGM A;  1CLB A;  5CSI A;  1J1D A;  1NSH A;  2H2K A;  1N2D A;  1J7O A;  2L2E A;  1XFX O;  2ZRS A;  1B8C A;  1K9K A;  1UWO A;  3PAL A;  2LVJ A;  1QXP A;  2LHI A;  3VRR A;  1QV0 A;  2PMY A;  1XA5 A;  3GK1 A;  3GK2 A;  2Q91 A;  2JXC A;  3SG2 A;  1ODB A;  1WDC B;  1SRA A;  3I5G B;  5JJG A;  1CDM A;  2COL B;  2MLE C;  3BUN B;  5G08 A;  1CM1 A;  3PM8 A;  1KQM B;  1A2X A;  1SCV A;  1GGZ A;  1KSO A;  1CDP A;  1FW4 A;  5AER A;  1IGV A;  1M45 A;  1QAT A;  4GUK A;  2PAL A;  4QJ4 B;  4DCK A;  2ZRT A;  1JC2 A;  3NXA A;  3I5F C;  4YI8 A;  1K96 A;  3EVV A;  2JT3 A;  3AAJ A;  2M29 A;  5HKW A;  4QJ3 B;  5HLO A;  1V1G A;  2MBX A;  2SAS A;  2SCP A;  1Y6W A;  1AJ5 A;  5CPV A;  4BY4 A;  3C1V A;  3O78 A;  4MRY A;  4OR9 B;  1NCZ A;  1BOC A;  2F3Z A;  2VRG A;  1CKK A;  5KSZ A;  5D7F A;  1NP8 A;  1QS7 A;  1XFV O;  4USL A;  4CFQ A;  1AP4 A;  2BE4 A;  1OMV A;  1EG3 A;  4WQ3 A;  2NCO A;  3I5F B;  1OMD A;  2I18 A;  1S5G Z;  3GK4 X;  4GGF C;  4PHJ A;  2BCX A;  1SKT A;  3CZT X;  4FTG A;  1J1E A;  4I5L B;  5KTY A;  3VRP A;  1PRW A;  3BOW A;  1OZO A;  5AEQ A;  3SJS A;  1IQ3 A;  1LA0 A;  2HF5 A;  4OVN F;  1K95 A;  2AAO A;  5F6T A;  1XFW O;  1IG5 A;  2AUC A;  1SPY A;  2L98 A;  1QTX A;  3CR4 X;  2L4H A;  1UP5 A;  2HQ8 A;  1TN4 A;  1WRL A;  3BYA A;  1Y0V H;  1ZUZ A;  2V53 A;  5DKN A;  5AFP A;  3SIA A;  2LAN A;  5I2L A;  2KQ6 A;  3NSI A;  4YRU A;  3EK4 A;  2CTN A;  5B8I B;  2K2A A;  1GQM A;  2F2P A;  3ZWH A;  2CBL A;  4N5X A;  3M0W A;  1RRO A;  1TTX A;  2BBN A;  2KBI A;  4M2Q A;  1TNP A;  1RK9 A;  2LAP A; 
#chains in the Genus database with same CATH topology
 5I8N A;  2LUC A;  1H8B A;  1DJG A;  3DVM A;  4IL1 A;  4OV2 A;  4R1E A;  1CFF A;  1DEL A;  1B47 A;  1S1E A;  1ZFS A;  1NX2 A;  2CNP A;  5FYX A;  4CFR A;  1Y1X A;  1CMF A;  1JFJ A;  2ZNE A;  1T14 A;  4C0L A;  2ZKM X;  3MSE B;  3L4L A;  1R2U A;  1G4Y R;  1SR6 B;  3IF7 A;  3FE8 A;  3OGN A;  4MEW A;  2JT0 A;  2G2B A;  4GAO A;  3JVT B;  3PN7 C;  2KBM A;  5HKZ A;  1Z2C B;  2H61 C;  1TIZ A;  3O4Y A;  2I7A A;  3OHM B;  4DUQ A;  3CZ0 A;  4UPG A;  2FCD A;  1F70 A;  4DS7 A;  3B87 A;  1OZS A;  2BKH B;  2BKI B;  4JKT A;  3DVK A;  5FI6 A;  2LLS A;  4XJK B;  5AXI A;  2EC6 B;  2OS8 B;  1C7V A;  5CSF A;  3CWG A;  4NDC A;  3DVE A;  1OW4 A;  1J7R A;  1TNW A;  3FE9 A;  4CPV A;  5ER4 X;  2EHB A;  4PE4 A;  3WXA A;  2QEB A;  4PHM A;  1M46 A;  2KNE A;  1FPW A;  2JWW A;  1DVI A;  1W7J B;  1UUS A;  2KFF A;  1YUS A;  4P2Y B;  2Y1M A;  1PUL A;  3NSK A;  2Y4Q A;  1KK8 C;  3S0F A;  3EVR A;  2Y5I A;  3NGV A;  4M2P A;  1B8L A;  1J55 A;  2LLU A;  1FF1 A;  1A4P A;  2KSP A;  5AAN A;  1JF0 A;  4ZCV A;  1OOH A;  3B88 A;  3DVJ A;  4YGD B;  1LIN A;  1PAL A;  1F54 A;  1SW8 A;  2KAX A;  3NSL A;  4KYN A;  2L5Y A;  2Y1N A;  3BUW B;  2WCE A;  4QJ5 B;  2BEC A;  2YGU A;  5JOL A;  5HLV A;  4AOM A;  1N0Y A;  1NX3 A;  1S6I A;  2LCP A;  3I5I C;  1SBJ A;  2BBM A;  1CDL A;  3CTN A;  2QDI A;  2PVB A;  3BFH A;  1NUB A;  1YR5 A;  3GOF A;  4PE0 A;  4YI9 A;  3UNW A;  2ZN8 A;  1EG4 A;  1KK8 B;  2WCF A;  2PYQ A;  3FS7 A;  4BY5 A;  1J7P A;  4ETO A;  1YTZ C;  2WC5 A;  1BF5 A;  3DZT A;  1EXR A;  1OOJ A;  2ZND A;  4CID A;  1G8I A;  1Q80 A;  3BUM B;  3TS5 C;  1TRF A;  1DJW A;  1REC A;  2BL0 B;  2FOT A;  3DF0 B;  2M1U A;  2KDH A;  3LLE A;  3K21 A;  3S0D A;  2WOR A;  1ZMZ A;  3SG3 A;  2IS9 A;  4AQJ A;  1TUJ A;  1X02 A;  1ZAC A;  3TDI A;  2JC2 A;  1OOI X;  2KI4 C;  4F0Z B;  1F55 A;  5TNC A;  2K61 A;  1OOF A;  1ORG A;  2FJU B;  3OBV A;  1NCY A;  1CFD A;  2K7C A;  3CLN A;  3RLZ A;  1GJY A;  5HKY A;  1NCX A;  1RWY A;  1UHH A;  1CNP A;  1IH0 A;  1K9P A;  1S6J A;  3E3R A;  1CTR A;  4PCW A;  4IJ7 A;  2L51 A;  3JTD C;  2WCH A;  1EJ3 A;  2L5X B;  1UHJ A;  3KPX A;  1DGU A;  2BCB A;  2MJW B;  1DJX A;  1PVA A;  1NIW A;  3A8R A;  4YBH B;  3OB2 B;  3SG4 A;  3BFB A;  4PAL A;  2E6W A;  1BOD A;  1BR4 B;  2OPO A;  5D69 A;  4FQT A;  2JNF A;  1QJT A;  4FQO A;  2M1K B;  3TZ1 A;  1DF0 B;  1TNX A;  4ZCU A;  1YVL A;  1SL7 A;  1RFJ A;  2GV5 A;  2OTG C;  3IQO A;  1UHI A;  2KHN A;  4WQ2 A;  5PAL A;  1DEK A;  2NZ0 A;  1BR1 B;  1CDN A;  5FI7 A;  1B9A A;  1B7T Y;  3LK0 A;  3CS1 A;  2M97 A;  3BJH A;  3JTD B;  2LP2 A;  5J3X A;  5I94 A;  3TUY C;  3D0Y B;  3D0Y A;  1DTL A;  4I5J A;  1SSE B;  1Z4H A;  2M3W A;  3RM1 A;  3KEV A;  2DOQ A;  2RGI A;  2KYC A;  3AKB A;  4YGE B;  1YX8 A;  4P5O E;  2ZN9 A;  2BCA A;  3B86 A;  4HRH A;  2KLE A;  2MAZ A;  4TNC A;  4WRI A;  1A75 B;  1A75 A;  4C0K A;  4C0J A;  1C07 A;  3TDZ A;  1XFU O;  2LE9 B;  4A4B A;  1WRK A;  5FI2 A;  2M7L A;  2KPH A;  1HT9 A;  1G33 A;  1Y1A A;  5K89 A;  1QVI Y;  3KO0 A;  2K7B A;  1A29 A;  1FBV A;  2WC6 A;  3CGA A;  1SY9 A;  3DXL A;  5BPJ A;  3PJI A;  1KK7 Y;  4OZD A;  2LMV A;  2QEO A;  3SG6 A;  1DJY A;  1KFX S;  2HQW A;  3PFV A;  4PDZ A;  1BJF A;  1AHR A;  1XK4 A;  2EGD A;  2B1U A;  3KF9 A;  4OCI A;  3VRN A;  2QPT A;  5I2O A;  1UHN A;  1QLK A;  5AFP A;  1MUX A;  2I94 A;  1KFU S;  4E68 A;  1E8A A;  1RJV A;  1S6C A;  1F4O A;  2L0P A;  1QAS A;  2JU0 A;  2LNK A;  3VRO A;  3WHU B;  5CSJ A;  1JF2 A;  1PSR A;  1QLS A;  1KFX L;  2TN4 A;  4PHK A;  2E30 A;  4D1E A;  4XJK A;  1LS8 A;  1IRJ A;  1PK0 D;  2WCM A;  1XYD A;  4MSP A;  3AKA A;  4GNK B;  4ICB A;  4JQ0 D;  1FI6 A;  2LMU A;  2KFG A;  2L4I A;  1MWN A;  2NCP A;  1P28 A;  1WLZ A;  4MZL A;  2MA2 A;  3DD4 A;  4ORC B;  1OSA A;  4HRE E;  1KFU L;  3K1E A;  2LVK A;  3DYE A;  3NSO A;  1RTP 1;  3R1P A;  1SL9 A;  2KI6 D;  1AJ4 A;  4XYN A;  1DT7 B;  2CT9 A;  3HX4 A;  1QX7 A;  2MRD A;  3S0G A;  2JTZ A;  3PLF B;  3PN7 B;  3KHE A;  2MLF C;  1DGV A;  3BFA A;  3D78 A;  4HRG A;  3VB1 A;  1ALW A;  1B4C A;  4OKH A;  1L2O C;  2H61 A;  3QRX A;  1K90 D;  3PAT A;  4GBA A;  2Q4U A;  3SIB A;  2KAV A;  2I2R E;  4U8D A;  3SS4 A;  4CLN A;  1H4B A;  3ICB A;  1B7T Z;  2A4J A;  3ZNI A;  3O2P A;  2F8P A;  1CMG A;  2LMT A;  1XFZ O;  1F4Q A;  2NXQ A;  2K7D A;  2LM5 A;  3N7H A;  1JFK A;  2BE6 A;  4MZK A;  1TNQ A;  2K7O A;  4NDB A;  1DQE A;  1IJ6 A;  1U5I B;  3V2L A;  2JUL A;  1C7W A;  3WNX B;  3BUO B;  4INW A;  4Q04 A;  5ER5 A;  1NX0 A;  2M7N A;  5DKR A;  1BG1 A;  4HSZ A;  2K60 A;  1CFP A;  2O5G A;  4I5N B;  3EK7 A;  4JWQ A;  4PE1 A;  3S0B A;  1QX2 A;  3PM2 A;  3VRQ A;  1QVI Z;  3I5G C;  3O6B A;  2K8M B;  3OP0 A;  2LP3 A;  2CXJ A;  1K93 D;  1KK7 Z;  2JT8 A;  3BUX B;  1KQM C;  1W9Z A;  1J7Q A;  3UO9 A;  2JQ6 A;  1UUR A;  1IQ5 A;  1SL8 A;  5DIC A;  1ALV A;  3DF0 A;  2PSR A;  1S3P A;  1NYA A;  2L2C A;  4INX A;  3FE6 A;  1YRU B;  2WCB A;  4PE7 A;  3O4X A;  1AVS A;  1JUO A;  3I5I B;  2LUX A;  1CFC A;  1F8H A;  1BU3 A;  1GGW A;  2K2F A;  2LC5 A;  4A4C A;  1DJI A;  1SCM C;  3D76 A;  2F3Y A;  2HPS A;  3QME A;  4GFT A;  3FIA A;  3BXK A;  3SG7 A;  2AMI A;  1TWO A;  1KWO C;  1OE9 B;  1NWD A;  3LL8 B;  4MBE A;  3TS5 B;  1SK6 D;  1IJ5 A;  2JOJ A;  4GPL B;  4MRX A;  4N1G A;  1R6P A;  3BQ3 A;  1QV1 A;  1MXE A;  2F33 A;  2JNX A;  1K8U A;  2K0J A;  1MXL C;  3F45 A;  2ISD A;  2HET A;  2KI4 B;  3D10 A;  2D8N A;  3EK8 A;  1MF8 B;  2WND A;  2KI6 C;  1DF0 A;  1SCM B;  1C3Y A;  2L50 A;  1FI5 A;  1M39 A;  2BNX A;  1QIW A;  2M0R A;  2P6B B;  2PRU A;  3R72 A;  4L9M A;  4MVF A;  1JWD A;  1S36 A;  2JXL A;  3FWB A;  3S0E A;  3EG5 B;  1KWO B;  1KCY A;  2NLN A;  5I2Q A;  3PSR A;  2CCM A;  1YX7 A;  4PT1 A;  3D74 A;  3RZS A;  2O60 A;  1TCF A;  1DMO A;  1YUU A;  2G9B A;  1YUR A;  2LVV A;  2M8U A;  2MHH A;  4GGF A;  1B8R A;  3EKH A;  2KQY A;  1XFY O;  4YGB B;  3IQQ A;  1M31 A;  1F71 A;  1OQP A;  3AAK A;  3R1O A;  1M63 B;  1DJZ A;  3H4S E;  4M2O A;  3BOW B;  4MLW A;  1KQV A;  1K2H A;  2OTG B;  3DY9 A;  5D3O A;  3OX6 A;  1LKJ A;  1XK4 C;  3LK1 A;  2PQL A;  1SR6 C;  4MN0 A;  1LVC D;  1AK8 A;  1SMG A;  3EKJ A;  2KGB C;  1XO5 A;  1DJH A;  2JZI A;  2LVI A;  1TCO B;  1NPQ A;  1TOP A;  1HQV A;  1K9U A;  3JVT C;  3TUY B;  1CB1 A;  1IIO A;  1PSB A;  2KLD A;  1YUT A;  1K94 A;  1MHO A;  1OMR A;  1OOG A;  2F2O A;  2JTT A;  3VGO A;  4JD9 A;  3WHT B;  1MR8 A;  4N1F A;  2KFH A;  3I5H C;  3NHT A;  4YGA A;  3TDU A;  2KAY A;  1VRK A;  2KGR A;  4NQG A;  1JBA A;  1SYM A;  2LHL A;  2EC6 C;  2OS8 C;  2QAC A;  3OB1 B;  4YGC B;  4ORB B;  1LXF C;  1ZOT B;  3HCM A;  2R2I A;  2FCE A;  3L4A A;  3A4U B;  3EVU A;  4ORA B;  1AUI B;  5EL2 A;  4MZJ A;  1L7Z A;  1EL4 A;  2M49 B;  4PHN A;  1WRZ A;  5KU1 A;  3CR5 X;  2LLT A;  2PAS A;  5HYD A;  5GQQ C;  2LV7 A;  1IWQ A;  1UHK A;  1NX1 A;  1W7I B;  3B7A A;  5DKQ A;  4AQI A;  2WOS A;  1QWV A;  1JSA A;  1BLQ A;  3I5H B;  3S0A A;  2GGZ A;  4JPZ B;  1EH2 A;  1CLL A;  1QX5 B;  1WLM A;  1XVJ A;  1N65 A;  2JPO A;  1BT6 A;  3L47 A;  1CLM A;  4I5K A;  1S26 D;  2ZFD A;  4GGN A;  1YRT B;  2WC8 A;  3LCP C;  4NDD A;  2P70 A;  3IVT A;  1U5I A;  2JPT A;  3FWC A;  2KOT A;  1MQ1 A;  1IKU A;  1KSM A;  1PVB A;  3SG5 A;  1S5G Y;  2KYF A;  1D1O A;  5CSN A;  3CYZ A;  1L2O B;  2JRF A;  2M9G A;  3CAB A;  1LA3 A;  1CM4 A;  1BMO A;  1SNL A;  1WDC C;  1WY9 A;  3SS5 A;  3CR2 A;  3D73 A;  2WCL A;  4F7F A;  1Y1U A;  4DIR A;  1A03 A;  4DRW A;  2BL0 C;  1C3Z A;  1V1F A;  3OX5 A;  5IBW A;  1YVH A;  1QIV A;  2GGM A;  3B6X A;  1CLB A;  5CSI A;  1DC1 A;  1J1D A;  1NSH A;  2FJY A;  1N2D A;  2H2K A;  2L2E A;  1J7O A;  1XFX O;  2ZRS A;  1B8C A;  1K9K A;  1UWO A;  3PAL A;  2LVJ A;  1QXP A;  2LHI A;  3VRR A;  1QV0 A;  2PMY A;  1XA5 A;  3GK1 A;  3GK2 A;  2Q91 A;  2JXC A;  2P71 A;  3SG2 A;  1ODB A;  1WDC B;  1SRA A;  3I5G B;  3SS3 A;  5JJG A;  1CDM A;  2COL B;  2MLE C;  3BUN B;  5G08 A;  1CM1 A;  3PM8 A;  1KQM B;  1A2X A;  1SCV A;  1GGZ A;  1KSO A;  1CDP A;  1FW4 A;  3CZ2 A;  1IGV A;  5AER A;  1M45 A;  1QAT A;  4GUK A;  2PAL A;  4QJ4 B;  4DCK A;  2ZRT A;  1JC2 A;  3NXA A;  3CZ1 A;  3I5F C;  4YI8 A;  1K96 A;  3EVV A;  2JT3 A;  3CDN A;  2WCK A;  1B1G A;  3AAJ A;  2M29 A;  5HKW A;  4QJ3 B;  5HLO A;  1V1G A;  2MBX A;  2SAS A;  2SCP A;  1Y6W A;  1AJ5 A;  5CPV A;  4BY4 A;  3C1V A;  3O78 A;  4MRY A;  4OR9 B;  1NCZ A;  1BOC A;  2F3Z A;  2VRG A;  1CKK A;  5KSZ A;  5D7F A;  1NP8 A;  1QS7 A;  1XFV O;  3NHI A;  4USL A;  4CFQ A;  2BE4 A;  1OMV A;  1AP4 A;  1EG3 A;  4WQ3 A;  2NCO A;  3I5F B;  1OMD A;  2I18 A;  1S5G Z;  2GTE A;  3GK4 X;  4GGF C;  4PHJ A;  2BCX A;  1SKT A;  3CZT X;  4FTG A;  1J1E A;  1TUZ A;  4I5L B;  5KTY A;  3VRP A;  1PRW A;  3D75 A;  3BOW A;  1OZO A;  5AEQ A;  3SJS A;  1IQ3 A;  1LA0 A;  2HF5 A;  4OVN F;  1K95 A;  2ERB A;  2H8V A;  2AAO A;  5F6T A;  1XFW O;  3R1V A;  1IG5 A;  2AUC A;  1SPY A;  2L98 A;  1QTX A;  3CR4 X;  1XFR A;  2L4H A;  1UP5 A;  2HQ8 A;  2QEH A;  1TN4 A;  1WRL A;  3BYA A;  2BAP A;  3D77 A;  5HL1 A;  1Y0V H;  1ZUZ A;  2V53 A;  5DKN A;  2QEV A;  3SIA A;  2LAN A;  5I2L A;  2KQ6 A;  3NSI A;  4YRU A;  3EK4 A;  2CTN A;  5B8I B;  2K2A A;  1GQM A;  2F2P A;  3ZWH A;  2CBL A;  4N5X A;  3M0W A;  1RRO A;  1TTX A;  2BBN A;  2KBI A;  2WCJ A;  4M2Q A;  1GM0 A;  1TNP A;  3Q8I A;  1RK9 A;  2LAP A; 
#chains in the Genus database with same CATH homology
 5I8N A;  2LUC A;  1H8B A;  1DJG A;  3DVM A;  4IL1 A;  4OV2 A;  4R1E A;  1CFF A;  1B47 A;  1S1E A;  1ZFS A;  1NX2 A;  2CNP A;  5FYX A;  4CFR A;  1Y1X A;  1CMF A;  1JFJ A;  2ZNE A;  4C0L A;  2ZKM X;  3MSE B;  1R2U A;  1G4Y R;  1SR6 B;  3IF7 A;  4MEW A;  2JT0 A;  2G2B A;  4GAO A;  3JVT B;  3PN7 C;  2KBM A;  5HKZ A;  2H61 C;  1TIZ A;  3O4Y A;  2I7A A;  3OHM B;  4DUQ A;  4UPG A;  1F70 A;  2FCD A;  4DS7 A;  1OZS A;  2BKH B;  2BKI B;  3DVK A;  2LLS A;  4XJK B;  5AXI A;  2EC6 B;  2OS8 B;  1C7V A;  5CSF A;  3CWG A;  4NDC A;  3DVE A;  4CPV A;  1J7R A;  1TNW A;  5ER4 X;  2EHB A;  4PE4 A;  3WXA A;  4PHM A;  1M46 A;  2KNE A;  1FPW A;  2JWW A;  1DVI A;  1W7J B;  1UUS A;  2KFF A;  1YUS A;  4P2Y B;  2Y1M A;  1PUL A;  3NSK A;  2Y4Q A;  1KK8 C;  3EVR A;  2Y5I A;  4M2P A;  1B8L A;  1J55 A;  2LLU A;  1FF1 A;  1A4P A;  2KSP A;  5AAN A;  1JF0 A;  4ZCV A;  3DVJ A;  4YGD B;  1LIN A;  1PAL A;  1F54 A;  1SW8 A;  2KAX A;  3NSL A;  2Y1N A;  3BUW B;  2WCE A;  4QJ5 B;  2BEC A;  5JOL A;  5HLV A;  4AOM A;  1N0Y A;  1NX3 A;  1S6I A;  2LCP A;  3I5I C;  1SBJ A;  2BBM A;  1CDL A;  3CTN A;  2PVB A;  4PE0 A;  1NUB A;  1YR5 A;  3GOF A;  4YI9 A;  2ZN8 A;  1EG4 A;  1KK8 B;  2WCF A;  3FS7 A;  4BY5 A;  1J7P A;  4ETO A;  1YTZ C;  1BF5 A;  1EXR A;  1OOJ A;  2ZND A;  4CID A;  1G8I A;  1Q80 A;  3BUM B;  3TS5 C;  1TRF A;  1DJW A;  1REC A;  2BL0 B;  2FOT A;  3DF0 B;  2M1U A;  2KDH A;  3LLE A;  3K21 A;  2WOR A;  1ZMZ A;  3SG3 A;  2IS9 A;  1X02 A;  1ZAC A;  3TDI A;  2JC2 A;  2KI4 C;  4F0Z B;  1F55 A;  5TNC A;  2K61 A;  2FJU B;  1NCY A;  1CFD A;  2K7C A;  3CLN A;  3RLZ A;  1GJY A;  5HKY A;  1NCX A;  1RWY A;  1UHH A;  1CNP A;  1IH0 A;  1K9P A;  1S6J A;  3E3R A;  1CTR A;  4PCW A;  2L51 A;  3JTD C;  1EJ3 A;  2L5X B;  1UHJ A;  3KPX A;  1DGU A;  2BCB A;  2MJW B;  1DJX A;  1PVA A;  1NIW A;  3A8R A;  4YBH B;  3OB2 B;  3SG4 A;  4PAL A;  2E6W A;  1BOD A;  1BR4 B;  2OPO A;  5D69 A;  2JNF A;  1QJT A;  4FQO A;  2M1K B;  3TZ1 A;  1DF0 B;  1TNX A;  4ZCU A;  1YVL A;  1SL7 A;  1RFJ A;  2GV5 A;  2OTG C;  3IQO A;  1UHI A;  2KHN A;  4WQ2 A;  5PAL A;  2NZ0 A;  1BR1 B;  1CDN A;  1B9A A;  1B7T Y;  3LK0 A;  3CS1 A;  2M97 A;  3JTD B;  2LP2 A;  5J3X A;  3TUY C;  3D0Y B;  3D0Y A;  1DTL A;  4I5J A;  3RM1 A;  2M3W A;  3KEV A;  2DOQ A;  2RGI A;  2KYC A;  3AKB A;  4YGE B;  1YX8 A;  4P5O E;  2ZN9 A;  2BCA A;  4HRH A;  2MAZ A;  4WRI A;  4TNC A;  4C0J A;  1A75 B;  1A75 A;  4C0K A;  1C07 A;  3TDZ A;  1XFU O;  2LE9 B;  4A4B A;  1WRK A;  2M7L A;  1HT9 A;  1G33 A;  1Y1A A;  5K89 A;  1QVI Y;  3KO0 A;  2K7B A;  1A29 A;  1FBV A;  3CGA A;  1SY9 A;  5BPJ A;  1KK7 Y;  2LMV A;  1B1G A;  3SG6 A;  1DJY A;  1KFX S;  2HQW A;  3PFV A;  4PDZ A;  1BJF A;  1AHR A;  1XK4 A;  2EGD A;  2B1U A;  3KF9 A;  4OCI A;  3VRN A;  2QPT A;  5I2O A;  1UHN A;  1QLK A;  1MUX A;  2I94 A;  1KFU S;  4E68 A;  1E8A A;  1RJV A;  1S6C A;  1F4O A;  2L0P A;  1QAS A;  2JU0 A;  2LNK A;  3VRO A;  3WHU B;  5CSJ A;  1JF2 A;  1PSR A;  1QLS A;  1KFX L;  2TN4 A;  4PHK A;  2E30 A;  4D1E A;  4XJK A;  1IRJ A;  1PK0 D;  1XYD A;  4MSP A;  3AKA A;  4GNK B;  4ICB A;  4JQ0 D;  1FI6 A;  2LMU A;  2KFG A;  2L4I A;  1MWN A;  2NCP A;  1WLZ A;  4MZL A;  4ORC B;  2MA2 A;  3DD4 A;  4AQJ A;  1OSA A;  4HRE E;  1KFU L;  4MVF A;  2LVK A;  3NSO A;  1DT7 B;  1RTP 1;  1FI5 A;  1SL9 A;  2KI6 D;  1AJ4 A;  4XYN A;  2CT9 A;  3HX4 A;  1QX7 A;  2MRD A;  2JTZ A;  3PLF B;  3PN7 B;  3KHE A;  2MLF C;  1DGV A;  4HRG A;  1ALW A;  1B4C A;  4OKH A;  1L2O C;  2H61 A;  3QRX A;  1K90 D;  3PAT A;  4GBA A;  2Q4U A;  3SIB A;  2KAV A;  2I2R E;  4U8D A;  4CLN A;  1H4B A;  3ICB A;  1B7T Z;  2A4J A;  3ZNI A;  3O2P A;  2F8P A;  1CMG A;  2LMT A;  1XFZ O;  1F4Q A;  2NXQ A;  2K7D A;  2LM5 A;  1JFK A;  2BE6 A;  4MZK A;  1TNQ A;  2K7O A;  4NDB A;  1U5I B;  1IJ6 A;  3WNX B;  2JUL A;  1C7W A;  1BG1 A;  3BUO B;  4Q04 A;  5ER5 A;  1NX0 A;  2M7N A;  5DKR A;  4HSZ A;  1CFP A;  2O5G A;  4I5N B;  3EK7 A;  4JWQ A;  4PE1 A;  3VRQ A;  1QX2 A;  1QVI Z;  3I5G C;  3O6B A;  2K8M B;  3OP0 A;  2LP3 A;  2CXJ A;  1K93 D;  1KK7 Z;  2JT8 A;  3BUX B;  1KQM C;  1J7Q A;  2JQ6 A;  1UUR A;  1IQ5 A;  1SL8 A;  1ALV A;  3DF0 A;  2PSR A;  1S3P A;  1NYA A;  1YRU B;  2WCB A;  4PE7 A;  1AVS A;  1JUO A;  3I5I B;  2LUX A;  1CFC A;  1F8H A;  1BU3 A;  1GGW A;  2K2F A;  2LC5 A;  4A4C A;  1DJI A;  1SCM C;  2F3Y A;  2HPS A;  4GFT A;  3FIA A;  3BXK A;  3SG7 A;  2AMI A;  1KWO C;  1OE9 B;  1NWD A;  3LL8 B;  4MBE A;  3TS5 B;  1SK6 D;  1IJ5 A;  2JOJ A;  4GPL B;  4MRX A;  4N1G A;  1R6P A;  3BQ3 A;  1QV1 A;  1MXE A;  2F33 A;  2JNX A;  1K8U A;  2K0J A;  1MXL C;  3F45 A;  2ISD A;  2HET A;  2KI4 B;  3D10 A;  2D8N A;  3EK8 A;  1MF8 B;  2WND A;  2KI6 C;  1DF0 A;  1SCM B;  2L50 A;  1M39 A;  1QIW A;  2M0R A;  2P6B B;  2PRU A;  4L9M A;  1JWD A;  1S36 A;  2JXL A;  3FWB A;  1KCY A;  1KWO B;  2NLN A;  5I2Q A;  3PSR A;  2CCM A;  1YX7 A;  2O60 A;  1TCF A;  1DMO A;  1YUU A;  2G9B A;  1YUR A;  2LVV A;  2M8U A;  2MHH A;  4GGF A;  1B8R A;  3EKH A;  2KQY A;  1XFY O;  4YGB B;  3IQQ A;  1M31 A;  1F71 A;  1OQP A;  3AAK A;  1M63 B;  1DJZ A;  3H4S E;  4M2O A;  3BOW B;  4MLW A;  1KQV A;  1K2H A;  2OTG B;  3OX6 A;  1LKJ A;  1XK4 C;  3LK1 A;  1SR6 C;  4MN0 A;  1LVC D;  1AK8 A;  1SMG A;  3EKJ A;  2KGB C;  1XO5 A;  1DJH A;  2JZI A;  2LVI A;  1TCO B;  1NPQ A;  1TOP A;  1HQV A;  1K9U A;  3JVT C;  3TUY B;  1CB1 A;  1PSB A;  1YUT A;  1K94 A;  1MHO A;  1OMR A;  2JTT A;  2F2O A;  3VGO A;  3WHT B;  1MR8 A;  4N1F A;  2KFH A;  3I5H C;  4YGA A;  3TDU A;  2KAY A;  1VRK A;  2KGR A;  4NQG A;  1JBA A;  1SYM A;  2LHL A;  2EC6 C;  2OS8 C;  2QAC A;  3OB1 B;  4YGC B;  4ORB B;  1LXF C;  1ZOT B;  3HCM A;  2R2I A;  2FCE A;  4ORA B;  3A4U B;  3EVU A;  1AUI B;  4MZJ A;  1L7Z A;  1EL4 A;  2M49 B;  4PHN A;  1WRZ A;  5KU1 A;  3CR5 X;  2LLT A;  2PAS A;  5HYD A;  5GQQ C;  2LV7 A;  1IWQ A;  1UHK A;  1NX1 A;  1W7I B;  5DKQ A;  4AQI A;  2WOS A;  1JSA A;  1BLQ A;  3I5H B;  2GGZ A;  4JPZ B;  1EH2 A;  1CLL A;  1QX5 B;  1WLM A;  1XVJ A;  1N65 A;  1BT6 A;  1CLM A;  4I5K A;  1S26 D;  2ZFD A;  4GGN A;  1YRT B;  2WC8 A;  3LCP C;  4NDD A;  1U5I A;  2JPT A;  3FWC A;  2KOT A;  1MQ1 A;  1IKU A;  1KSM A;  1PVB A;  3SG5 A;  1S5G Y;  2KYF A;  1D1O A;  5CSN A;  1L2O B;  2JRF A;  2M9G A;  1LA3 A;  1CM4 A;  1BMO A;  1SNL A;  1WDC C;  1WY9 A;  3CR2 A;  1Y1U A;  4DIR A;  1A03 A;  4DRW A;  2BL0 C;  1V1F A;  3OX5 A;  5IBW A;  1YVH A;  1QIV A;  2GGM A;  1CLB A;  5CSI A;  1J1D A;  1NSH A;  2H2K A;  1N2D A;  1J7O A;  2L2E A;  1XFX O;  2ZRS A;  1B8C A;  1K9K A;  1UWO A;  3PAL A;  2LVJ A;  1QXP A;  2LHI A;  3VRR A;  1QV0 A;  2PMY A;  1XA5 A;  3GK1 A;  3GK2 A;  2Q91 A;  2JXC A;  3SG2 A;  1ODB A;  1WDC B;  1SRA A;  3I5G B;  5JJG A;  1CDM A;  2COL B;  2MLE C;  3BUN B;  5G08 A;  1CM1 A;  3PM8 A;  1KQM B;  1A2X A;  1SCV A;  1GGZ A;  1KSO A;  1CDP A;  1FW4 A;  5AER A;  1IGV A;  1M45 A;  1QAT A;  4GUK A;  2PAL A;  4QJ4 B;  4DCK A;  2ZRT A;  1JC2 A;  3NXA A;  3I5F C;  4YI8 A;  1K96 A;  3EVV A;  2JT3 A;  3AAJ A;  2M29 A;  5HKW A;  4QJ3 B;  5HLO A;  1V1G A;  2MBX A;  2SAS A;  2SCP A;  1Y6W A;  1AJ5 A;  5CPV A;  4BY4 A;  3C1V A;  3O78 A;  4MRY A;  4OR9 B;  1NCZ A;  1BOC A;  2F3Z A;  2VRG A;  1CKK A;  5KSZ A;  5D7F A;  1NP8 A;  1QS7 A;  1XFV O;  4USL A;  4CFQ A;  1AP4 A;  2BE4 A;  1OMV A;  1EG3 A;  4WQ3 A;  2NCO A;  3I5F B;  1OMD A;  2I18 A;  1S5G Z;  3GK4 X;  4GGF C;  4PHJ A;  2BCX A;  1SKT A;  3CZT X;  4FTG A;  1J1E A;  4I5L B;  5KTY A;  3VRP A;  1PRW A;  3BOW A;  1OZO A;  5AEQ A;  3SJS A;  1IQ3 A;  1LA0 A;  2HF5 A;  4OVN F;  1K95 A;  2AAO A;  5F6T A;  1XFW O;  1IG5 A;  2AUC A;  1SPY A;  2L98 A;  1QTX A;  3CR4 X;  2L4H A;  1UP5 A;  2HQ8 A;  1TN4 A;  1WRL A;  3BYA A;  1Y0V H;  1ZUZ A;  2V53 A;  5DKN A;  5AFP A;  3SIA A;  2LAN A;  5I2L A;  2KQ6 A;  3NSI A;  4YRU A;  3EK4 A;  2CTN A;  5B8I B;  2K2A A;  1GQM A;  2F2P A;  3ZWH A;  2CBL A;  4N5X A;  3M0W A;  1RRO A;  1TTX A;  2BBN A;  2KBI A;  4M2Q A;  1TNP A;  1RK9 A;  2LAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...