1B7TZ

Myosin digested by papain
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
153
structure length
153
Chain Sequence
KLSQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Myosin
molecule keywords MYOSIN HEAVY CHAIN
publication title Atomic structure of scallop myosin subfragment S1 complexed with MgADP: a novel conformation of the myosin head.
pubmed doi rcsb
total genus 41
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 1999-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1b7tZ01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1b7tZ02
2A4JA 1LXFC 2WCFA 2BKIB 2OTGB 5I2QA 2K7CA 2Y4QA 4MRXA 3VRRA 1M46A 2G2BA 2AUCA 2FOTA 1TIZA 2MHHA 1OQPA 4MZKA 1SY9A 4N1FA 1RWYA 1V1GA 1NUBA 2KI4C 2P6BB 2Q4UA 3VROA 2I2RE 2OS8C 3QRXA 2LNKA 4XYNA 2F8PA 2KDHA 2ZKMX 4YGBB 1NWDA 4ORAB 1NPQA 4P5OE 1DJXA 1HT9A 1K9PA 1NSHA 1XYDA 2JULA 4MZJA 1JSAA 2LVJA 5FYXA 2NCOA 2PRUA 2Y1NA 1S6IA 1EH2A 5AEQA 3D10A 2MAZA 3M0WA 4PE1A 2KOTA 3PN7B 3LL8B 3KHEA 2AMIA 3SIAA 1J1EA 1BT6A 1S36A 3A4UB 2K7BA 1HQVA 1VRKA 2CT9A 1JC2A 1AVSA 1WLZA 2DOQA 4MSPA 4CFRA 2CXJA 1F4QA 1IQ5A 1IG5A 3LK0A 1SL7A 4GGFA 1KSMA 1XFYO 1A2XA 4PHMA 2HF5A 1IKUA 1OOJA 3EVVA 1SKTA 2M97A 3I5FC 3OP0A 1F55A 4CPVA 3F45A 3GK4X 1CDNA 3I5GB 5BPJA 1M63B 2WCBA 1RK9A 1K95A 4I5NB 3SG3A 2EC6C 1ALVA 1SR6C 1OMVA 5HYDA 3DVJA 4PCWA 5DKQA 5KU1A 1A75A 1MUXA 1NCXA 1PULA 2LUXA 1DJHA 3I5IC 1OE9B 5F6TA 1XO5A 1MXEA 2M49B 4MLWA 4D1EA 1QTXA 4YRUA 2GV5A 4P2YB 1B1GA 1A29A 1C7WA 1UHKA 1ALWA 1IJ6A 1V1FA 1MHOA 1QVIZ 1U5IB 2JOJA 3EVRA 4M2OA 3NSLA 3RM1A 1J55A 1AJ5A 4JPZB 3O6BA 1B8RA 2BL0C 2JQ6A 2KGBC 3PATA 2MLFC 2K8MB 4QJ3B 2JTZA 4QJ4B 1TNXA 3MSEB 5IBWA 2LP3A 1QASA 1KFUS 4R1EA 1L2OB 2RGIA 1KFXL 1TNWA 1K8UA 3D0YA 4ZCVA 1KCYA 1QS7A 4WQ2A 1IJ5A 4I5JA 4YI8A 3IF7A 1CTRA 1PSRA 1Y1AA 1QLKA 2FCEA 3OX6A 3IQOA 4AQIA 2O60A 2ZRTA 1B7TY 1PALA 2JPTA 2M9GA 2ZRSA 2F3ZA 2KGRA 4PDZA 4BY4A 1SNLA 1DJZA 2PASA 5I2OA 2LVIA 1SMGA 3LK1A 2JU0A 3DVEA 1JUOA 1B9AA 3FWBA 3O4YA 2F2PA 1ZFSA 2NXQA 3PALA 3EKJA 5KTYA 1EG4A 4C0LA 2L51A 1WRZA 1XK4C 1SCVA 5GQQC 1QX2A 2ISDA 1J7PA 1N2DA 2WORA 2JXLA 1TCFA 4I5KA 1NX2A 3TDZA 1F71A 4HREE 2JC2A 1QIWA 2K61A 3DVMA 4YGAA 1YX7A 5CPVA 1A03A 1YTZC 3EK8A 3BUOB 1BG1A 1GGWA 2LUCA 4GPLB 1MQ1A 1A75B 1PSBA 1S6CA 1B47A 3BYAA 5CSNA 2KQ6A 2WC8A 4GGNA 1D1OA 1TTXA 2LP2A 1K90D 4CIDA 1WDCB 1F4OA 1KFUL 1OMDA 4JWQA 2I94A 1JF0A 3GK2A 3I5HB 3CR2A 1KK8B 3E3RA 1NCZA 3NSIA 3RLZA 1UP5A 1W7JB 1SPYA 1PVAA 4PE7A 2L0PA 1AHRA 5I2LA 1BLQA 2KI4B 4CLNA 1DGVA 1YVHA 2OS8B 2I7AA 1Y6WA 2COLB 2JWWA 1RTP1 1SL9A 1UUSA 3WHUB 3LLEA 2BCXA 4MBEA 2JTTA 1PRWA 3TS5C 2GGZA 2PMYA 2KSPA 1ZUZA 5DKNA 3FIAA 1TRFA 2BBMA 1QJTA 4OCIA 1CB1A 2LMVA 1YR5A 1CDLA 2Y1MA 3D0YB 4OVNF 4YI9A 1CFPA 4E68A 2LLSA 2HQ8A 3HCMA 3TUYC 1KFXS 1G4YR 1BJFA 2L5XB 2CCMA 3CLNA 1AP4A 1R2UA 4WRIA 1IRJA 1QVIY 3EKHA 3AKBA 3DD4A 2K7OA 3EVUA 3PN7C 4N1GA 4XJKA 3SG4A 1DVIA 2LANA 1NYAA 1XK4A 1A4PA 1FI5A 3NSOA 1EXRA 1BU3A 2EGDA 3BUNB 1EG3A 4UPGA 4OKHA 2QPTA 1XFVO 2Y5IA 1C07A 1DTLA 3CR5X 2ZNDA 1ZMZA 2K7DA 1FPWA 2M7LA 1UWOA 2SASA 3BUWB 2EC6B 1SR6B 1WY9A 1JFKA 4MRYA 1XFWO 1RJVA 4DS7A 1UHJA 2KHNA 1FF1A 1UHIA 2NCPA 2LC5A 4PHNA 1TNPA 3BXKA 1CFFA 2PSRA 4ICBA 3VRNA 1LA0A 1QLSA 3SG5A 1S26D 1S6JA 3JVTC 2EHBA 1L7ZA 1PK0D 1J7OA 1KQMC 1RFJA 1GJYA 2KBIA 5B8IB 1TOPA 1S5GY 4IL1A 1KWOB 1QXPA 2F2OA 2QACA 3TDUA 1KSOA 2BL0B 2LHLA 3ICBA 5D7FA 1B8CA 4ETOA 5ER5A 1N65A 3LCPC 1B4CA 1NCYA 2KAXA 1JFJA 2K2FA 2LAPA 2LLUA 1YVLA 5HLOA 4QJ5B 3VRQA 5AXIA 2L2EA 4NDBA 1ZOTB 3EK4A 1YRUB 1K94A 1S1EA 4M2QA 3SG6A 5K89A 2CTNA 2AAOA 1X02A 3OHMB 1BF5A 3C1VA 1K9UA 3IQQA 2KNEA 2HQWA 2CNPA 1MR8A 1NX0A 3BOWA 3KF9A 3NSKA 4USLA 2ZN8A 1L2OC 4AOMA 1CLLA 5AANA 1XFZO 2E6WA 4WQ3A 2JXCA 2Q91A 3EK7A 2JNFA 4ORBB 2PVBA 3CR4X 3O2PA 1BMOA 4L9MA 4NDCA 2F3YA 4XJKB 1NX3A 1FI6A 1QIVA 1DMOA 2BKHB 3PM8A 2SCPA 4PE0A 1E8AA 3FS7A 4DIRA 1XFUO 3SJSA 4GFTA 2H61C 2BCBA 2WNDA 1DJGA 2LVVA 1J7QA 3OB1B 3CWGA 1YRTB 2KFHA 1MWNA 2M3WA 3O78A 1Q80A 2KI6D 2KAYA 2CBLA 3VGOA 2NLNA 3PFVA 1QV1A 5D69A 4MVFA 5ER4X 1FBVA 4MEWA 2ZN9A 1SCMC 2V53A 2ZNEA 1UHHA 2JT8A 1M31A 3JTDC 3NXAA 3KEVA 2L50A 2IS9A 1TNQA 3FWCA 5G08A 1J7RA 2MA2A 2G9BA 5AFPA 5J3XA 3VRPA 2MBXA 1W7IB 1K93D 3BUMB 3AKAA 3KPXA 1SBJA 2L4IA 3CS1A 2ZFDA 2K2AA 1GQMA 4U8DA 4YBHB 2OTGC 1RROA 4TNCA 2HETA 1WDCC 2FJUB 2LMTA 3PSRA 1YURA 1CM1A 1CKKA 1IH0A 3I5HC 1BR4B 1KK8C 1NP8A 4GNKB 1KQVA 2LVKA 2M0RA 2VRGA 4YGDB 2JZIA 3TS5B 4DUQA 2B1UA 5AERA 2KFGA 4JQ0D 3CTNA 3BQ3A 4ORCB 1K2HA 2KAVA 1MF8B 1TCOB 1J1DA 3A8RA 2TN4A 2M1UA 4NDDA 2BE6A 4HRGA 3TUYB 4OR9B 3BOWB 3DVKA 4OV2A 4MN0A 1H8BA 1SK6D 4FQOA 3TDIA 2KBMA 2D8NA 1OZOA 1CDPA 2KI6C 4HRHA 1S3PA 1M39A 2JT3A 1Y1XA 3I5FB 2MJWB 1KK7Z 5CSFA 1PVBA 4GBAA 1YUSA 3PLFB 1G33A 2H61A 5PALA 1JWDA 3DF0A 4CFQA 2L4HA 3WHTB 2OPOA 1F54A 1LVCD 1QX7A 3OX5A 2JT0A 3SIBA 1RECA 2BCAA 5DKRA 2I18A 4AQJA 2LM5A 3I5IB 2WCEA 4HSZA 4PALA 1OSAA 4YGEB 5KSZA 1CMFA 3I5GC 1OZSA 1Y0VH 3TZ1A 1NX1A 2LLTA 4PE4A 4NQGA 2HPSA 1XVJA 3AAJA 1DF0A 1WRLA 3SG7A 3JVTB 2KYFA 1YX8A 1DGUA 1CMGA 1Y1UA 1KQMB 1K9KA 2M7NA 1DJIA 3ZNIA 4BY5A 1CM4A 5HLVA 2NZ0A 4DRWA 1SL8A 1SRAA 1FW4A 1LKJA 1SYMA 1CFDA 1EL4A 1OMRA 2M1KB 5JJGA 3GK1A 1UURA 1K96A 4A4CA 1ODBA 1GGZA 1C7VA 3KO0A 1AK8A 1IQ3A 1KWOC 1ZACA 1AJ4A 3OB2B 1G8IA 2O5GA 4MZLA 3AAKA 2LCPA 1JBAA 3K21A 3H4SE 4GAOA 4F0ZB 2LHIA 3WNXB 1B8LA 1DJWA 2MRDA 5HKZA 1BODA 5HKWA 2F33A 4Q04A 2LV7A 4PHKA 4YGCB 1F8HA 4ZCUA 1NIWA 2BBNA 3CZTX 1UHNA 1QV0A 5CSJA 1YUUA 2K0JA 3BUXB 1CNPA 1LA3A 2L98A 1IGVA 4DCKA 1BOCA 3WXAA 2R2IA 2FCDA 2PALA 1AUIB 1CFCA 3ZWHA 2BECA 1QX5B 1M45A 5I8NA 4PHJA 1S5GZ 2JNXA 3DF0B 4N5XA 1EJ3A 2LE9B 1BR1B 4GGFC 3SG2A 5TNCA 5HKYA 2KYCA 1DT7B 1N0YA 2H2KA 1LINA 2WOSA 1WRKA 1F70A 2GGMA 2M8UA 1SCMB 4M2PA 1XFXO 4A4BA 1MXLC 4C0KA 1CDMA 2KQYA 1QATA 1XA5A 1SW8A 1YUTA 2MLEC 1WLMA 3JTDB 1R6PA 1CLMA 5JOLA 2E30A 1CLBA 2BE4A 4GUKA 1B7TZ 1DF0B 1TN4A 1DJYA 3GOFA 5CSIA 2KFFA 3HX4A 2JRFA 3CGAA 1IWQA 1U5IA 1H4BA 2LMUA 4I5LB 4FTGA 4C0JA 2M29A 1JF2A 1KK7Y
chains in the Genus database with same CATH superfamily
2A4JA 1LXFC 2WCFA 2BKIB 2OTGB 5I2QA 2K7CA 2Y4QA 4MRXA 2YGUA 3VRRA 1M46A 2G2BA 3NGVA 2AUCA 2FOTA 1TIZA 2MHHA 1OQPA 4MZKA 1SY9A 4N1FA 1RWYA 1V1GA 1NUBA 2KI4C 2P6BB 3B6XA 2Q4UA 3VROA 2I2RE 2OS8C 3QRXA 2LNKA 4XYNA 2F8PA 2KDHA 2ZKMX 3B87A 1NWDA 4ORAB 1NPQA 1TUZA 4P5OE 4YGBB 1DJXA 1HT9A 1K9PA 1NSHA 1XYDA 2JULA 4MZJA 1JSAA 2LVJA 5FYXA 2NCOA 2PRUA 2Y1NA 1S6IA 1EH2A 5AEQA 3D10A 2MAZA 3M0WA 4PE1A 2KOTA 3PN7B 3S0BA 3LL8B 3KHEA 2AMIA 3SIAA 1J1EA 1BT6A 1S36A 3A4UB 2K7BA 1GM0A 1DQEA 1HQVA 1VRKA 2CT9A 1JC2A 1AVSA 1WLZA 2DOQA 4MSPA 4CFRA 2CXJA 1F4QA 1IQ5A 1IG5A 3LK0A 1SL7A 3NHIA 1KSMA 1XFYO 4GGFA 1A2XA 4PHMA 2HF5A 1IKUA 1OOJA 3EVVA 3FE8A 1SKTA 2M97A 3I5FC 3OP0A 3SS3A 1F55A 4CPVA 1ORGA 3D76A 3F45A 3GK4X 1CDNA 3I5GB 5BPJA 1M63B 2WCBA 1RK9A 1K95A 4I5NB 3SG3A 2EC6C 1ALVA 1SR6C 1OMVA 5HYDA 3DVJA 4PCWA 5DKQA 3VB1A 5KU1A 1A75A 1MUXA 1NCXA 1PULA 2LUXA 1DJHA 3I5IC 1OE9B 5F6TA 1XO5A 1MXEA 2M49B 4MLWA 4D1EA 1QTXA 4YRUA 2GV5A 4P2YB 1B1GA 1A29A 1C7WA 1UHKA 3RZSA 1ALWA 3IVTA 2WCKA 1IJ6A 1V1FA 1MHOA 1QVIZ 1U5IB 2JOJA 3EVRA 4INXA 4M2OA 5D3OA 3NSLA 3RM1A 3FE9A 3L4LA 1J55A 1AJ5A 4JPZB 3O6BA 1B8RA 2BL0C 2JQ6A 2KGBC 2PYQA 3PATA 2MLFC 3S0GA 2K8MB 3D75A 4QJ3B 2JTZA 4QJ4B 1TNXA 3MSEB 5IBWA 2LP3A 1QASA 1KFUS 4R1EA 1L2OB 2RGIA 1KFXL 1TNWA 1K8UA 3D0YA 4ZCVA 1KCYA 1QS7A 4WQ2A 1IJ5A 4I5JA 4YI8A 3IF7A 1CTRA 1PSRA 1Y1AA 1QLKA 2FCEA 2P71A 3OX6A 3IQOA 4AQIA 2O60A 2KLDA 2ZRTA 1B7TY 1PALA 2JPTA 2M9GA 2ZRSA 2F3ZA 2KGRA 4PDZA 3O4XA 4BY4A 1SNLA 1DJZA 2PASA 5I2OA 2LVIA 1SMGA 3LK1A 2JU0A 3DVEA 1JUOA 1B9AA 2H8VA 3FWBA 3O4YA 2F2PA 4IJ7A 1ZFSA 2NXQA 3PALA 3EKJA 5KTYA 1EG4A 3D77A 4C0LA 2L51A 1WRZA 1XK4C 2ERBA 4PT1A 1SCVA 3EG5B 5GQQC 1QX2A 2ISDA 1J7PA 2WC6A 1N2DA 2WORA 2JXLA 1TCFA 4I5KA 1NX2A 3TDZA 1F71A 4HREE 2JC2A 1QIWA 2K61A 1T14A 3DVMA 4YGAA 1YX7A 5CPVA 1A03A 1YTZC 3EK8A 2QEHA 3BUOB 1BG1A 1GGWA 4F7FA 2LUCA 4GPLB 1MQ1A 1A75B 1PSBA 1S6CA 1B47A 3BYAA 5CSNA 2KQ6A 2WC8A 4GGNA 1D1OA 1TTXA 2LP2A 1K90D 1P28A 4CIDA 1WDCB 1F4OA 1KFUL 1OMDA 3CABA 4JWQA 2I94A 1JF0A 3GK2A 3I5HB 3CR2A 1KK8B 3E3RA 1NCZA 3NSIA 3RLZA 1UP5A 1W7JB 3DXLA 1SPYA 1PVAA 4PE7A 2L0PA 1AHRA 5I2LA 1BLQA 2KI4B 4CLNA 1DGVA 1YVHA 2OS8B 2I7AA 1Y6WA 2COLB 2JWWA 1RTP1 1SL9A 1UUSA 3WHUB 1OOFA 3LLEA 2WCHA 2BCXA 4MBEA 2JTTA 3FE6A 1PRWA 3TS5C 2GGZA 2PMYA 2KSPA 1ZUZA 5DKNA 3FIAA 1TRFA 2BBMA 4JKTA 1QJTA 4OCIA 1CB1A 2LMVA 1YR5A 1CDLA 2QEBA 2Y1MA 3D0YB 4OVNF 4YI9A 1CFPA 4E68A 2BAPA 2L5YA 2LLSA 2HQ8A 3HCMA 3TUYC 4KYNA 1KFXS 1G4YR 3CYZA 3D73A 1BJFA 2L5XB 2CCMA 3CLNA 1AP4A 1R2UA 4WRIA 1IRJA 1QVIY 3EKHA 3AKBA 3DD4A 2K7OA 3EVUA 3PN7C 4N1GA 4XJKA 3SG4A 2L2CA 1DVIA 2LANA 1NYAA 1XK4A 3D78A 1A4PA 1FI5A 3NSOA 1EXRA 1BU3A 2EGDA 3BUNB 1EG3A 4UPGA 4OKHA 2QPTA 1XFVO 2Y5IA 3DY9A 1C07A 1DTLA 3CR5X 2ZNDA 1ZMZA 2K7DA 1FPWA 2QDIA 2M7LA 1DEKA 1UWOA 2SASA 3BUWB 2EC6B 1SR6B 1WY9A 1JFKA 1OOGA 4MRYA 1XFWO 1RJVA 4DS7A 1UHJA 2KHNA 1FF1A 3PM2A 2JPOA 2WCJA 1UHIA 2NCPA 2LC5A 2BNXA 4PHNA 1TNPA 3BXKA 1CFFA 2PSRA 4ICBA 3VRNA 1LA0A 1QLSA 3SG5A 1S26D 1S6JA 3JVTC 2EHBA 1L7ZA 1PK0D 1J7OA 2FJYA 3CDNA 1KQMC 1RFJA 1GJYA 2KBIA 5B8IB 1TOPA 1S5GY 4IL1A 3D74A 1KWOB 1QXPA 2F2OA 2QACA 3PJIA 3TDUA 1KSOA 2BL0B 2LHLA 3ICBA 4OZDA 5D7FA 1B8CA 4ETOA 5ER5A 1N65A 3LCPC 1B4CA 1NCYA 3R1OA 2KAXA 1JFJA 2K2FA 2LAPA 2LLUA 1YVLA 5HLOA 4QJ5B 3BFHA 3VRQA 5AXIA 2L2EA 4NDBA 1ZOTB 2QEOA 3EK4A 3QMEA 1YRUB 1K94A 1S1EA 4M2QA 2WC5A 3SG6A 5K89A 2CTNA 2AAOA 1OOHA 1X02A 3OHMB 1BF5A 3C1VA 3K1EA 1K9UA 3IQQA 2KNEA 2HQWA 2CNPA 1MR8A 1NX0A 3BOWA 3R1PA 3KF9A 3NSKA 4USLA 2ZN8A 1L2OC 4AOMA 1CLLA 2GTEA 5AANA 1XFZO 2QEVA 2E6WA 3B86A 4WQ3A 1DELA 2JXCA 2Q91A 3EK7A 2JNFA 4ORBB 2PVBA 2P70A 2WCMA 3CR4X 3O2PA 1BMOA 4L9MA 3R72A 4NDCA 2F3YA 5FI2A 4XJKB 1NX3A 1FI6A 1QIVA 1XFRA 2BKHB 3PM8A 2SCPA 4PE0A 1DMOA 1E8AA 3L47A 3FS7A 4DIRA 1XFUO 2KLEA 3SJSA 3DYEA 3BJHA 4GFTA 2H61C 2BCBA 2WNDA 1DJGA 2LVVA 1J7QA 3OB1B 3CWGA 1YRTB 2KFHA 1DC1A 1MWNA 2M3WA 3O78A 1Q80A 2KI6D 2KAYA 2CBLA 3VGOA 2NLNA 3PFVA 1QV1A 5D69A 4MVFA 5ER4X 1FBVA 5I94A 4MEWA 2ZN9A 1SCMC 2V53A 2ZNEA 1UHHA 2JT8A 3B88A 2PQLA 1M31A 3DZTA 3JTDC 3NXAA 3OBVA 3KEVA 2L50A 2IS9A 1TNQA 3FWCA 5G08A 1J7RA 2MA2A 2G9BA 5AFPA 5J3XA 3BFAA 2MBXA 3VRPA 1W7IB 1K93D 3BUMB 3AKAA 3KPXA 3S0EA 1SBJA 2L4IA 3CS1A 3SS4A 2ZFDA 3N7HA 2K2AA 1GQMA 4U8DA 3OGNA 4YBHB 1Z2CB 2OTGC 1RROA 4TNCA 2HETA 1WDCC 2FJUB 2LMTA 3PSRA 1YURA 1CM1A 1CKKA 1IH0A 3I5HC 3B7AA 1BR4B 1KK8C 1NP8A 3S0DA 4GNKB 1KQVA 2LVKA 2M0RA 2VRGA 4YGDB 2JZIA 3TS5B 4DUQA 3L4AA 2B1UA 5AERA 2KFGA 4JQ0D 3V2LA 3CTNA 3BQ3A 4ORCB 1K2HA 3SS5A 2KAVA 1MF8B 1TCOB 2WCLA 1J1DA 3A8RA 2TN4A 2M1UA 4NDDA 5FI7A 2BE6A 4HRGA 3TUYB 4OR9B 3BOWB 3DVKA 4OV2A 4MN0A 1H8BA 1SK6D 4FQOA 3TDIA 2KBMA 2D8NA 1OZOA 1CDPA 2KI6C 4HRHA 5DICA 1S3PA 1M39A 2JT3A 1Y1XA 1LS8A 3I5FB 2MJWB 1KK7Z 5CSFA 1PVBA 4GBAA 1YUSA 3PLFB 1G33A 2H61A 5PALA 1JWDA 1IIOA 3DF0A 4CFQA 2L4HA 3WHTB 2OPOA 1F54A 1LVCD 1QX7A 3OX5A 2JT0A 3SIBA 1RECA 2BCAA 5DKRA 2I18A 5HL1A 4AQJA 2LM5A 3I5IB 1C3YA 2WCEA 4FQTA 4HSZA 1OSAA 4PALA 4YGEB 5KSZA 1CMFA 3I5GC 3UO9A 1OZSA 1Y0VH 3TZ1A 1OOIX 1NX1A 2LLTA 4PE4A 3UNWA 4NQGA 2HPSA 1XVJA 3AAJA 1DF0A 1WRLA 3SG7A 3JVTB 3CZ0A 2KYFA 1YX8A 1DGUA 1CMGA 1Y1UA 1KQMB 1K9KA 2M7NA 1DJIA 3ZNIA 4BY5A 1CM4A 5HLVA 2NZ0A 4DRWA 1SL8A 1SRAA 1FW4A 3Q8IA 4INWA 1LKJA 1SYMA 1CFDA 1EL4A 1OMRA 2KPHA 2M1KB 5JJGA 3GK1A 1TWOA 1UURA 1K96A 1OW4A 3S0AA 4A4CA 1ODBA 1W9ZA 1GGZA 1C7VA 3KO0A 1AK8A 1IQ3A 1KWOC 1ZACA 1AJ4A 3OB2B 5FI6A 1G8IA 2O5GA 4MZLA 3AAKA 2LCPA 1JBAA 3K21A 3H4SE 3BFBA 4GAOA 4F0ZB 2LHIA 3WNXB 1B8LA 1DJWA 2MRDA 5HKZA 1BODA 5HKWA 5EL2A 2F33A 4Q04A 2LV7A 4PHKA 4YGCB 1F8HA 4ZCUA 1NIWA 2BBNA 3CZTX 1UHNA 1QV0A 5CSJA 1YUUA 3CZ2A 2K0JA 3BUXB 1C3ZA 1CNPA 1LA3A 2L98A 1IGVA 4DCKA 1QWVA 1BOCA 2K60A 2R2IA 1TUJA 3WXAA 2FCDA 2PALA 1AUIB 1CFCA 3ZWHA 2BECA 1SSEB 1QX5B 1M45A 5I8NA 4PHJA 1S5GZ 2JNXA 3DF0B 4N5XA 1EJ3A 2LE9B 1BR1B 4GGFC 3SG2A 5TNCA 5HKYA 2KYCA 1DT7B 3S0FA 3NHTA 4JD9A 1N0YA 2H2KA 1LINA 2WOSA 1WRKA 1F70A 2GGMA 2M8UA 1SCMB 4M2PA 1XFXO 4A4BA 1MXLC 4C0KA 1CDMA 2KQYA 1QATA 1XA5A 1SW8A 1YUTA 2MLEC 1WLMA 3JTDB 1R6PA 1CLMA 3CZ1A 5JOLA 1Z4HA 2E30A 1CLBA 2BE4A 4GUKA 1B7TZ 1DF0B 1TN4A 1DJYA 3GOFA 3R1VA 5CSIA 2KFFA 3HX4A 2JRFA 3CGAA 1IWQA 1U5IA 1H4BA 2LMUA 4I5LB 4FTGA 4C0JA 2M29A 1JF2A 1KK7Y
chains in the Genus database with same CATH topology
2A4JA 1LXFC 2WCFA 2BKIB 2OTGB 5I2QA 2K7CA 2Y4QA 4MRXA 3VRRA 1M46A 2G2BA 2AUCA 2FOTA 1TIZA 2MHHA 1OQPA 4MZKA 1SY9A 4N1FA 1RWYA 1V1GA 1NUBA 2KI4C 2P6BB 2Q4UA 3VROA 2I2RE 2OS8C 3QRXA 2LNKA 4XYNA 2F8PA 2KDHA 2ZKMX 4YGBB 1NWDA 4ORAB 1NPQA 4P5OE 1DJXA 1HT9A 1K9PA 1NSHA 1XYDA 2JULA 4MZJA 1JSAA 2LVJA 5FYXA 2NCOA 2PRUA 2Y1NA 1S6IA 1EH2A 5AEQA 3D10A 2MAZA 3M0WA 4PE1A 2KOTA 3PN7B 3LL8B 3KHEA 2AMIA 3SIAA 1J1EA 1BT6A 1S36A 3A4UB 2K7BA 1HQVA 1VRKA 2CT9A 1JC2A 1AVSA 1WLZA 2DOQA 4MSPA 4CFRA 2CXJA 1F4QA 1IQ5A 1IG5A 3LK0A 1SL7A 4GGFA 1KSMA 1XFYO 1A2XA 4PHMA 2HF5A 1IKUA 1OOJA 3EVVA 1SKTA 2M97A 3I5FC 3OP0A 1F55A 4CPVA 3F45A 3GK4X 1CDNA 3I5GB 5BPJA 1M63B 2WCBA 1RK9A 1K95A 4I5NB 3SG3A 2EC6C 1ALVA 1SR6C 1OMVA 5HYDA 3DVJA 4PCWA 5DKQA 5KU1A 1A75A 1MUXA 1NCXA 1PULA 2LUXA 1DJHA 3I5IC 1OE9B 5F6TA 1XO5A 1MXEA 2M49B 4MLWA 4D1EA 1QTXA 4YRUA 2GV5A 4P2YB 1B1GA 1A29A 1C7WA 1UHKA 1ALWA 1IJ6A 1V1FA 1MHOA 1QVIZ 1U5IB 2JOJA 3EVRA 4M2OA 3NSLA 3RM1A 1J55A 1AJ5A 4JPZB 3O6BA 1B8RA 2BL0C 2JQ6A 2KGBC 3PATA 2MLFC 2K8MB 4QJ3B 2JTZA 4QJ4B 1TNXA 3MSEB 5IBWA 2LP3A 1QASA 1KFUS 4R1EA 1L2OB 2RGIA 1KFXL 1TNWA 1K8UA 3D0YA 4ZCVA 1KCYA 1QS7A 4WQ2A 1IJ5A 4I5JA 4YI8A 3IF7A 1CTRA 1PSRA 1Y1AA 1QLKA 2FCEA 3OX6A 3IQOA 4AQIA 2O60A 2ZRTA 1B7TY 1PALA 2JPTA 2M9GA 2ZRSA 2F3ZA 2KGRA 4PDZA 4BY4A 1SNLA 1DJZA 2PASA 5I2OA 2LVIA 1SMGA 3LK1A 2JU0A 3DVEA 1JUOA 1B9AA 3FWBA 3O4YA 2F2PA 1ZFSA 2NXQA 3PALA 3EKJA 5KTYA 1EG4A 4C0LA 2L51A 1WRZA 1XK4C 1SCVA 5GQQC 1QX2A 2ISDA 1J7PA 1N2DA 2WORA 2JXLA 1TCFA 4I5KA 1NX2A 3TDZA 1F71A 4HREE 2JC2A 1QIWA 2K61A 3DVMA 4YGAA 1YX7A 5CPVA 1A03A 1YTZC 3EK8A 3BUOB 1BG1A 1GGWA 2LUCA 4GPLB 1MQ1A 1A75B 1PSBA 1S6CA 1B47A 3BYAA 5CSNA 2KQ6A 2WC8A 4GGNA 1D1OA 1TTXA 2LP2A 1K90D 4CIDA 1WDCB 1F4OA 1KFUL 1OMDA 4JWQA 2I94A 1JF0A 3GK2A 3I5HB 3CR2A 1KK8B 3E3RA 1NCZA 3NSIA 3RLZA 1UP5A 1W7JB 1SPYA 1PVAA 4PE7A 2L0PA 1AHRA 5I2LA 1BLQA 2KI4B 4CLNA 1DGVA 1YVHA 2OS8B 2I7AA 1Y6WA 2COLB 2JWWA 1RTP1 1SL9A 1UUSA 3WHUB 3LLEA 2BCXA 4MBEA 2JTTA 1PRWA 3TS5C 2GGZA 2PMYA 2KSPA 1ZUZA 5DKNA 3FIAA 1TRFA 2BBMA 1QJTA 4OCIA 1CB1A 2LMVA 1YR5A 1CDLA 2Y1MA 3D0YB 4OVNF 4YI9A 1CFPA 4E68A 2LLSA 2HQ8A 3HCMA 3TUYC 1KFXS 1G4YR 1BJFA 2L5XB 2CCMA 3CLNA 1AP4A 1R2UA 4WRIA 1IRJA 1QVIY 3EKHA 3AKBA 3DD4A 2K7OA 3EVUA 3PN7C 4N1GA 4XJKA 3SG4A 1DVIA 2LANA 1NYAA 1XK4A 1A4PA 1FI5A 3NSOA 1EXRA 1BU3A 2EGDA 3BUNB 1EG3A 4UPGA 4OKHA 2QPTA 1XFVO 2Y5IA 1C07A 1DTLA 3CR5X 2ZNDA 1ZMZA 2K7DA 1FPWA 2M7LA 1UWOA 2SASA 3BUWB 2EC6B 1SR6B 1WY9A 1JFKA 4MRYA 1XFWO 1RJVA 4DS7A 1UHJA 2KHNA 1FF1A 1UHIA 2NCPA 2LC5A 4PHNA 1TNPA 3BXKA 1CFFA 2PSRA 4ICBA 3VRNA 1LA0A 1QLSA 3SG5A 1S26D 1S6JA 3JVTC 2EHBA 1L7ZA 1PK0D 1J7OA 1KQMC 1RFJA 1GJYA 2KBIA 5B8IB 1TOPA 1S5GY 4IL1A 1KWOB 1QXPA 2F2OA 2QACA 3TDUA 1KSOA 2BL0B 2LHLA 3ICBA 5D7FA 1B8CA 4ETOA 5ER5A 1N65A 3LCPC 1B4CA 1NCYA 2KAXA 1JFJA 2K2FA 2LAPA 2LLUA 1YVLA 5HLOA 4QJ5B 3VRQA 5AXIA 2L2EA 4NDBA 1ZOTB 3EK4A 1YRUB 1K94A 1S1EA 4M2QA 3SG6A 5K89A 2CTNA 2AAOA 1X02A 3OHMB 1BF5A 3C1VA 1K9UA 3IQQA 2KNEA 2HQWA 2CNPA 1MR8A 1NX0A 3BOWA 3KF9A 3NSKA 4USLA 2ZN8A 1L2OC 4AOMA 1CLLA 5AANA 1XFZO 2E6WA 4WQ3A 2JXCA 2Q91A 3EK7A 2JNFA 4ORBB 2PVBA 3CR4X 3O2PA 1BMOA 4L9MA 4NDCA 2F3YA 4XJKB 1NX3A 1FI6A 1QIVA 1DMOA 2BKHB 3PM8A 2SCPA 4PE0A 1E8AA 3FS7A 4DIRA 1XFUO 3SJSA 4GFTA 2H61C 2BCBA 2WNDA 1DJGA 2LVVA 1J7QA 3OB1B 3CWGA 1YRTB 2KFHA 1MWNA 2M3WA 3O78A 1Q80A 2KI6D 2KAYA 2CBLA 3VGOA 2NLNA 3PFVA 1QV1A 5D69A 4MVFA 5ER4X 1FBVA 4MEWA 2ZN9A 1SCMC 2V53A 2ZNEA 1UHHA 2JT8A 1M31A 3JTDC 3NXAA 3KEVA 2L50A 2IS9A 1TNQA 3FWCA 5G08A 1J7RA 2MA2A 2G9BA 5AFPA 5J3XA 3VRPA 2MBXA 1W7IB 1K93D 3BUMB 3AKAA 3KPXA 1SBJA 2L4IA 3CS1A 2ZFDA 2K2AA 1GQMA 4U8DA 4YBHB 2OTGC 1RROA 4TNCA 2HETA 1WDCC 2FJUB 2LMTA 3PSRA 1YURA 1CM1A 1CKKA 1IH0A 3I5HC 1BR4B 1KK8C 1NP8A 4GNKB 1KQVA 2LVKA 2M0RA 2VRGA 4YGDB 2JZIA 3TS5B 4DUQA 2B1UA 5AERA 2KFGA 4JQ0D 3CTNA 3BQ3A 4ORCB 1K2HA 2KAVA 1MF8B 1TCOB 1J1DA 3A8RA 2TN4A 2M1UA 4NDDA 2BE6A 4HRGA 3TUYB 4OR9B 3BOWB 3DVKA 4OV2A 4MN0A 1H8BA 1SK6D 4FQOA 3TDIA 2KBMA 2D8NA 1OZOA 1CDPA 2KI6C 4HRHA 1S3PA 1M39A 2JT3A 1Y1XA 3I5FB 2MJWB 1KK7Z 5CSFA 1PVBA 4GBAA 1YUSA 3PLFB 1G33A 2H61A 5PALA 1JWDA 3DF0A 4CFQA 2L4HA 3WHTB 2OPOA 1F54A 1LVCD 1QX7A 3OX5A 2JT0A 3SIBA 1RECA 2BCAA 5DKRA 2I18A 4AQJA 2LM5A 3I5IB 2WCEA 4HSZA 4PALA 1OSAA 4YGEB 5KSZA 1CMFA 3I5GC 1OZSA 1Y0VH 3TZ1A 1NX1A 2LLTA 4PE4A 4NQGA 2HPSA 1XVJA 3AAJA 1DF0A 1WRLA 3SG7A 3JVTB 2KYFA 1YX8A 1DGUA 1CMGA 1Y1UA 1KQMB 1K9KA 2M7NA 1DJIA 3ZNIA 4BY5A 1CM4A 5HLVA 2NZ0A 4DRWA 1SL8A 1SRAA 1FW4A 1LKJA 1SYMA 1CFDA 1EL4A 1OMRA 2M1KB 5JJGA 3GK1A 1UURA 1K96A 4A4CA 1ODBA 1GGZA 1C7VA 3KO0A 1AK8A 1IQ3A 1KWOC 1ZACA 1AJ4A 3OB2B 1G8IA 2O5GA 4MZLA 3AAKA 2LCPA 1JBAA 3K21A 3H4SE 4GAOA 4F0ZB 2LHIA 3WNXB 1B8LA 1DJWA 2MRDA 5HKZA 1BODA 5HKWA 2F33A 4Q04A 2LV7A 4PHKA 4YGCB 1F8HA 4ZCUA 1NIWA 2BBNA 3CZTX 1UHNA 1QV0A 5CSJA 1YUUA 2K0JA 3BUXB 1CNPA 1LA3A 2L98A 1IGVA 4DCKA 1BOCA 3WXAA 2R2IA 2FCDA 2PALA 1AUIB 1CFCA 3ZWHA 2BECA 1QX5B 1M45A 5I8NA 4PHJA 1S5GZ 2JNXA 3DF0B 4N5XA 1EJ3A 2LE9B 1BR1B 4GGFC 3SG2A 5TNCA 5HKYA 2KYCA 1DT7B 1N0YA 2H2KA 1LINA 2WOSA 1WRKA 1F70A 2GGMA 2M8UA 1SCMB 4M2PA 1XFXO 4A4BA 1MXLC 4C0KA 1CDMA 2KQYA 1QATA 1XA5A 1SW8A 1YUTA 2MLEC 1WLMA 3JTDB 1R6PA 1CLMA 5JOLA 2E30A 1CLBA 2BE4A 4GUKA 1B7TZ 1DF0B 1TN4A 1DJYA 3GOFA 5CSIA 2KFFA 3HX4A 2JRFA 3CGAA 1IWQA 1U5IA 1H4BA 2LMUA 4I5LB 4FTGA 4C0JA 2M29A 1JF2A 1KK7Y
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A4J A;  1LXF C;  2WCF A;  2BKI B;  2OTG B;  5I2Q A;  2K7C A;  2Y4Q A;  4MRX A;  3VRR A;  1M46 A;  2G2B A;  2AUC A;  2FOT A;  1TIZ A;  2MHH A;  1OQP A;  4MZK A;  1SY9 A;  4N1F A;  1RWY A;  1V1G A;  1NUB A;  2KI4 C;  2P6B B;  2Q4U A;  3VRO A;  2I2R E;  2OS8 C;  3QRX A;  2LNK A;  4XYN A;  2F8P A;  2KDH A;  2ZKM X;  4YGB B;  1NWD A;  4ORA B;  1NPQ A;  4P5O E;  1DJX A;  1HT9 A;  1K9P A;  1NSH A;  1XYD A;  2JUL A;  4MZJ A;  1JSA A;  2LVJ A;  5FYX A;  2NCO A;  2PRU A;  2Y1N A;  1S6I A;  1EH2 A;  5AEQ A;  3D10 A;  2MAZ A;  3M0W A;  4PE1 A;  2KOT A;  3PN7 B;  3LL8 B;  3KHE A;  2AMI A;  3SIA A;  1J1E A;  1BT6 A;  1S36 A;  3A4U B;  2K7B A;  1HQV A;  1VRK A;  2CT9 A;  1JC2 A;  1AVS A;  1WLZ A;  2DOQ A;  4MSP A;  4CFR A;  2CXJ A;  1F4Q A;  1IQ5 A;  1IG5 A;  3LK0 A;  1SL7 A;  4GGF A;  1KSM A;  1XFY O;  1A2X A;  4PHM A;  2HF5 A;  1IKU A;  1OOJ A;  3EVV A;  1SKT A;  2M97 A;  3I5F C;  3OP0 A;  1F55 A;  4CPV A;  3F45 A;  3GK4 X;  1CDN A;  3I5G B;  5BPJ A;  1M63 B;  2WCB A;  1RK9 A;  1K95 A;  4I5N B;  3SG3 A;  2EC6 C;  1ALV A;  1SR6 C;  1OMV A;  5HYD A;  3DVJ A;  4PCW A;  5DKQ A;  5KU1 A;  1A75 A;  1MUX A;  1NCX A;  1PUL A;  2LUX A;  1DJH A;  3I5I C;  1OE9 B;  5F6T A;  1XO5 A;  1MXE A;  2M49 B;  4MLW A;  4D1E A;  1QTX A;  4YRU A;  2GV5 A;  4P2Y B;  1B1G A;  1A29 A;  1C7W A;  1UHK A;  1ALW A;  1IJ6 A;  1V1F A;  1MHO A;  1QVI Z;  1U5I B;  2JOJ A;  3EVR A;  4M2O A;  3NSL A;  3RM1 A;  1J55 A;  1AJ5 A;  4JPZ B;  3O6B A;  1B8R A;  2BL0 C;  2JQ6 A;  2KGB C;  3PAT A;  2MLF C;  2K8M B;  4QJ3 B;  2JTZ A;  4QJ4 B;  1TNX A;  3MSE B;  5IBW A;  2LP3 A;  1QAS A;  1KFU S;  4R1E A;  1L2O B;  2RGI A;  1KFX L;  1TNW A;  1K8U A;  3D0Y A;  4ZCV A;  1KCY A;  1QS7 A;  4WQ2 A;  1IJ5 A;  4I5J A;  4YI8 A;  3IF7 A;  1CTR A;  1PSR A;  1Y1A A;  1QLK A;  2FCE A;  3OX6 A;  3IQO A;  4AQI A;  2O60 A;  2ZRT A;  1B7T Y;  1PAL A;  2JPT A;  2M9G A;  2ZRS A;  2F3Z A;  2KGR A;  4PDZ A;  4BY4 A;  1SNL A;  1DJZ A;  2PAS A;  5I2O A;  2LVI A;  1SMG A;  3LK1 A;  2JU0 A;  3DVE A;  1JUO A;  1B9A A;  3FWB A;  3O4Y A;  2F2P A;  1ZFS A;  2NXQ A;  3PAL A;  3EKJ A;  5KTY A;  1EG4 A;  4C0L A;  2L51 A;  1WRZ A;  1XK4 C;  1SCV A;  5GQQ C;  1QX2 A;  2ISD A;  1J7P A;  1N2D A;  2WOR A;  2JXL A;  1TCF A;  4I5K A;  1NX2 A;  3TDZ A;  1F71 A;  4HRE E;  2JC2 A;  1QIW A;  2K61 A;  3DVM A;  4YGA A;  1YX7 A;  5CPV A;  1A03 A;  1YTZ C;  3EK8 A;  3BUO B;  1BG1 A;  1GGW A;  2LUC A;  4GPL B;  1MQ1 A;  1A75 B;  1PSB A;  1S6C A;  1B47 A;  3BYA A;  5CSN A;  2KQ6 A;  2WC8 A;  4GGN A;  1D1O A;  1TTX A;  2LP2 A;  1K90 D;  4CID A;  1WDC B;  1F4O A;  1KFU L;  1OMD A;  4JWQ A;  2I94 A;  1JF0 A;  3GK2 A;  3I5H B;  3CR2 A;  1KK8 B;  3E3R A;  1NCZ A;  3NSI A;  3RLZ A;  1UP5 A;  1W7J B;  1SPY A;  1PVA A;  4PE7 A;  2L0P A;  1AHR A;  5I2L A;  1BLQ A;  2KI4 B;  4CLN A;  1DGV A;  1YVH A;  2OS8 B;  2I7A A;  1Y6W A;  2COL B;  2JWW A;  1RTP 1;  1SL9 A;  1UUS A;  3WHU B;  3LLE A;  2BCX A;  4MBE A;  2JTT A;  1PRW A;  3TS5 C;  2GGZ A;  2PMY A;  2KSP A;  1ZUZ A;  5DKN A;  3FIA A;  1TRF A;  2BBM A;  1QJT A;  4OCI A;  1CB1 A;  2LMV A;  1YR5 A;  1CDL A;  2Y1M A;  3D0Y B;  4OVN F;  4YI9 A;  1CFP A;  4E68 A;  2LLS A;  2HQ8 A;  3HCM A;  3TUY C;  1KFX S;  1G4Y R;  1BJF A;  2L5X B;  2CCM A;  3CLN A;  1AP4 A;  1R2U A;  4WRI A;  1IRJ A;  1QVI Y;  3EKH A;  3AKB A;  3DD4 A;  2K7O A;  3EVU A;  3PN7 C;  4N1G A;  4XJK A;  3SG4 A;  1DVI A;  2LAN A;  1NYA A;  1XK4 A;  1A4P A;  1FI5 A;  3NSO A;  1EXR A;  1BU3 A;  2EGD A;  3BUN B;  1EG3 A;  4UPG A;  4OKH A;  2QPT A;  1XFV O;  2Y5I A;  1C07 A;  1DTL A;  3CR5 X;  2ZND A;  1ZMZ A;  2K7D A;  1FPW A;  2M7L A;  1UWO A;  2SAS A;  3BUW B;  2EC6 B;  1SR6 B;  1WY9 A;  1JFK A;  4MRY A;  1XFW O;  1RJV A;  4DS7 A;  1UHJ A;  2KHN A;  1FF1 A;  1UHI A;  2NCP A;  2LC5 A;  4PHN A;  1TNP A;  3BXK A;  1CFF A;  2PSR A;  4ICB A;  3VRN A;  1LA0 A;  1QLS A;  3SG5 A;  1S26 D;  1S6J A;  3JVT C;  2EHB A;  1L7Z A;  1PK0 D;  1J7O A;  1KQM C;  1RFJ A;  1GJY A;  2KBI A;  5B8I B;  1TOP A;  1S5G Y;  4IL1 A;  1KWO B;  1QXP A;  2F2O A;  2QAC A;  3TDU A;  1KSO A;  2BL0 B;  2LHL A;  3ICB A;  5D7F A;  1B8C A;  4ETO A;  5ER5 A;  1N65 A;  3LCP C;  1B4C A;  1NCY A;  2KAX A;  1JFJ A;  2K2F A;  2LAP A;  2LLU A;  1YVL A;  5HLO A;  4QJ5 B;  3VRQ A;  5AXI A;  2L2E A;  4NDB A;  1ZOT B;  3EK4 A;  1YRU B;  1K94 A;  1S1E A;  4M2Q A;  3SG6 A;  5K89 A;  2CTN A;  2AAO A;  1X02 A;  3OHM B;  1BF5 A;  3C1V A;  1K9U A;  3IQQ A;  2KNE A;  2HQW A;  2CNP A;  1MR8 A;  1NX0 A;  3BOW A;  3KF9 A;  3NSK A;  4USL A;  2ZN8 A;  1L2O C;  4AOM A;  1CLL A;  5AAN A;  1XFZ O;  2E6W A;  4WQ3 A;  2JXC A;  2Q91 A;  3EK7 A;  2JNF A;  4ORB B;  2PVB A;  3CR4 X;  3O2P A;  1BMO A;  4L9M A;  4NDC A;  2F3Y A;  4XJK B;  1NX3 A;  1FI6 A;  1QIV A;  1DMO A;  2BKH B;  3PM8 A;  2SCP A;  4PE0 A;  1E8A A;  3FS7 A;  4DIR A;  1XFU O;  3SJS A;  4GFT A;  2H61 C;  2BCB A;  2WND A;  1DJG A;  2LVV A;  1J7Q A;  3OB1 B;  3CWG A;  1YRT B;  2KFH A;  1MWN A;  2M3W A;  3O78 A;  1Q80 A;  2KI6 D;  2KAY A;  2CBL A;  3VGO A;  2NLN A;  3PFV A;  1QV1 A;  5D69 A;  4MVF A;  5ER4 X;  1FBV A;  4MEW A;  2ZN9 A;  1SCM C;  2V53 A;  2ZNE A;  1UHH A;  2JT8 A;  1M31 A;  3JTD C;  3NXA A;  3KEV A;  2L50 A;  2IS9 A;  1TNQ A;  3FWC A;  5G08 A;  1J7R A;  2MA2 A;  2G9B A;  5AFP A;  5J3X A;  3VRP A;  2MBX A;  1W7I B;  1K93 D;  3BUM B;  3AKA A;  3KPX A;  1SBJ A;  2L4I A;  3CS1 A;  2ZFD A;  2K2A A;  1GQM A;  4U8D A;  4YBH B;  2OTG C;  1RRO A;  4TNC A;  2HET A;  1WDC C;  2FJU B;  2LMT A;  3PSR A;  1YUR A;  1CM1 A;  1CKK A;  1IH0 A;  3I5H C;  1BR4 B;  1KK8 C;  1NP8 A;  4GNK B;  1KQV A;  2LVK A;  2M0R A;  2VRG A;  4YGD B;  2JZI A;  3TS5 B;  4DUQ A;  2B1U A;  5AER A;  2KFG A;  4JQ0 D;  3CTN A;  3BQ3 A;  4ORC B;  1K2H A;  2KAV A;  1MF8 B;  1TCO B;  1J1D A;  3A8R A;  2TN4 A;  2M1U A;  4NDD A;  2BE6 A;  4HRG A;  3TUY B;  4OR9 B;  3BOW B;  3DVK A;  4OV2 A;  4MN0 A;  1H8B A;  1SK6 D;  4FQO A;  3TDI A;  2KBM A;  2D8N A;  1OZO A;  1CDP A;  2KI6 C;  4HRH A;  1S3P A;  1M39 A;  2JT3 A;  1Y1X A;  3I5F B;  2MJW B;  1KK7 Z;  5CSF A;  1PVB A;  4GBA A;  1YUS A;  3PLF B;  1G33 A;  2H61 A;  5PAL A;  1JWD A;  3DF0 A;  4CFQ A;  2L4H A;  3WHT B;  2OPO A;  1F54 A;  1LVC D;  1QX7 A;  3OX5 A;  2JT0 A;  3SIB A;  1REC A;  2BCA A;  5DKR A;  2I18 A;  4AQJ A;  2LM5 A;  3I5I B;  2WCE A;  4HSZ A;  4PAL A;  1OSA A;  4YGE B;  5KSZ A;  1CMF A;  3I5G C;  1OZS A;  1Y0V H;  3TZ1 A;  1NX1 A;  2LLT A;  4PE4 A;  4NQG A;  2HPS A;  1XVJ A;  3AAJ A;  1DF0 A;  1WRL A;  3SG7 A;  3JVT B;  2KYF A;  1YX8 A;  1DGU A;  1CMG A;  1Y1U A;  1KQM B;  1K9K A;  2M7N A;  1DJI A;  3ZNI A;  4BY5 A;  1CM4 A;  5HLV A;  2NZ0 A;  4DRW A;  1SL8 A;  1SRA A;  1FW4 A;  1LKJ A;  1SYM A;  1CFD A;  1EL4 A;  1OMR A;  2M1K B;  5JJG A;  3GK1 A;  1UUR A;  1K96 A;  4A4C A;  1ODB A;  1GGZ A;  1C7V A;  3KO0 A;  1AK8 A;  1IQ3 A;  1KWO C;  1ZAC A;  1AJ4 A;  3OB2 B;  1G8I A;  2O5G A;  4MZL A;  3AAK A;  2LCP A;  1JBA A;  3K21 A;  3H4S E;  4GAO A;  4F0Z B;  2LHI A;  3WNX B;  1B8L A;  1DJW A;  2MRD A;  5HKZ A;  1BOD A;  5HKW A;  2F33 A;  4Q04 A;  2LV7 A;  4PHK A;  4YGC B;  1F8H A;  4ZCU A;  1NIW A;  2BBN A;  3CZT X;  1UHN A;  1QV0 A;  5CSJ A;  1YUU A;  2K0J A;  3BUX B;  1CNP A;  1LA3 A;  2L98 A;  1IGV A;  4DCK A;  1BOC A;  3WXA A;  2R2I A;  2FCD A;  2PAL A;  1AUI B;  1CFC A;  3ZWH A;  2BEC A;  1QX5 B;  1M45 A;  5I8N A;  4PHJ A;  1S5G Z;  2JNX A;  3DF0 B;  4N5X A;  1EJ3 A;  2LE9 B;  1BR1 B;  4GGF C;  3SG2 A;  5TNC A;  5HKY A;  2KYC A;  1DT7 B;  1N0Y A;  2H2K A;  1LIN A;  2WOS A;  1WRK A;  1F70 A;  2GGM A;  2M8U A;  1SCM B;  4M2P A;  1XFX O;  4A4B A;  1MXL C;  4C0K A;  1CDM A;  2KQY A;  1QAT A;  1XA5 A;  1SW8 A;  1YUT A;  2MLE C;  1WLM A;  3JTD B;  1R6P A;  1CLM A;  5JOL A;  2E30 A;  1CLB A;  2BE4 A;  4GUK A;  1B7T Z;  1DF0 B;  1TN4 A;  1DJY A;  3GOF A;  5CSI A;  2KFF A;  3HX4 A;  2JRF A;  3CGA A;  1IWQ A;  1U5I A;  1H4B A;  2LMU A;  4I5L B;  4FTG A;  4C0J A;  2M29 A;  1JF2 A;  1KK7 Y; 
#chains in the Genus database with same CATH topology
 2A4J A;  1LXF C;  2WCF A;  2BKI B;  2OTG B;  5I2Q A;  2K7C A;  2Y4Q A;  4MRX A;  2YGU A;  3VRR A;  1M46 A;  2G2B A;  3NGV A;  2AUC A;  2FOT A;  1TIZ A;  2MHH A;  1OQP A;  4MZK A;  1SY9 A;  4N1F A;  1RWY A;  1V1G A;  1NUB A;  2KI4 C;  2P6B B;  3B6X A;  2Q4U A;  3VRO A;  2I2R E;  2OS8 C;  3QRX A;  2LNK A;  4XYN A;  2F8P A;  2KDH A;  2ZKM X;  3B87 A;  1NWD A;  4ORA B;  1NPQ A;  1TUZ A;  4P5O E;  4YGB B;  1DJX A;  1HT9 A;  1K9P A;  1NSH A;  1XYD A;  2JUL A;  4MZJ A;  1JSA A;  2LVJ A;  5FYX A;  2NCO A;  2PRU A;  2Y1N A;  1S6I A;  1EH2 A;  5AEQ A;  3D10 A;  2MAZ A;  3M0W A;  4PE1 A;  2KOT A;  3PN7 B;  3S0B A;  3LL8 B;  3KHE A;  2AMI A;  3SIA A;  1J1E A;  1BT6 A;  1S36 A;  3A4U B;  2K7B A;  1GM0 A;  1DQE A;  1HQV A;  1VRK A;  2CT9 A;  1JC2 A;  1AVS A;  1WLZ A;  2DOQ A;  4MSP A;  4CFR A;  2CXJ A;  1F4Q A;  1IQ5 A;  1IG5 A;  3LK0 A;  1SL7 A;  3NHI A;  1KSM A;  1XFY O;  4GGF A;  1A2X A;  4PHM A;  2HF5 A;  1IKU A;  1OOJ A;  3EVV A;  3FE8 A;  1SKT A;  2M97 A;  3I5F C;  3OP0 A;  3SS3 A;  1F55 A;  4CPV A;  1ORG A;  3D76 A;  3F45 A;  3GK4 X;  1CDN A;  3I5G B;  5BPJ A;  1M63 B;  2WCB A;  1RK9 A;  1K95 A;  4I5N B;  3SG3 A;  2EC6 C;  1ALV A;  1SR6 C;  1OMV A;  5HYD A;  3DVJ A;  4PCW A;  5DKQ A;  3VB1 A;  5KU1 A;  1A75 A;  1MUX A;  1NCX A;  1PUL A;  2LUX A;  1DJH A;  3I5I C;  1OE9 B;  5F6T A;  1XO5 A;  1MXE A;  2M49 B;  4MLW A;  4D1E A;  1QTX A;  4YRU A;  2GV5 A;  4P2Y B;  1B1G A;  1A29 A;  1C7W A;  1UHK A;  3RZS A;  1ALW A;  3IVT A;  2WCK A;  1IJ6 A;  1V1F A;  1MHO A;  1QVI Z;  1U5I B;  2JOJ A;  3EVR A;  4INX A;  4M2O A;  5D3O A;  3NSL A;  3RM1 A;  3FE9 A;  3L4L A;  1J55 A;  1AJ5 A;  4JPZ B;  3O6B A;  1B8R A;  2BL0 C;  2JQ6 A;  2KGB C;  2PYQ A;  3PAT A;  2MLF C;  3S0G A;  2K8M B;  3D75 A;  4QJ3 B;  2JTZ A;  4QJ4 B;  1TNX A;  3MSE B;  5IBW A;  2LP3 A;  1QAS A;  1KFU S;  4R1E A;  1L2O B;  2RGI A;  1KFX L;  1TNW A;  1K8U A;  3D0Y A;  4ZCV A;  1KCY A;  1QS7 A;  4WQ2 A;  1IJ5 A;  4I5J A;  4YI8 A;  3IF7 A;  1CTR A;  1PSR A;  1Y1A A;  1QLK A;  2FCE A;  2P71 A;  3OX6 A;  3IQO A;  4AQI A;  2O60 A;  2KLD A;  2ZRT A;  1B7T Y;  1PAL A;  2JPT A;  2M9G A;  2ZRS A;  2F3Z A;  2KGR A;  4PDZ A;  3O4X A;  4BY4 A;  1SNL A;  1DJZ A;  2PAS A;  5I2O A;  2LVI A;  1SMG A;  3LK1 A;  2JU0 A;  3DVE A;  1JUO A;  1B9A A;  2H8V A;  3FWB A;  3O4Y A;  2F2P A;  4IJ7 A;  1ZFS A;  2NXQ A;  3PAL A;  3EKJ A;  5KTY A;  1EG4 A;  3D77 A;  4C0L A;  2L51 A;  1WRZ A;  1XK4 C;  2ERB A;  4PT1 A;  1SCV A;  3EG5 B;  5GQQ C;  1QX2 A;  2ISD A;  1J7P A;  2WC6 A;  1N2D A;  2WOR A;  2JXL A;  1TCF A;  4I5K A;  1NX2 A;  3TDZ A;  1F71 A;  4HRE E;  2JC2 A;  1QIW A;  2K61 A;  1T14 A;  3DVM A;  4YGA A;  1YX7 A;  5CPV A;  1A03 A;  1YTZ C;  3EK8 A;  2QEH A;  3BUO B;  1BG1 A;  1GGW A;  4F7F A;  2LUC A;  4GPL B;  1MQ1 A;  1A75 B;  1PSB A;  1S6C A;  1B47 A;  3BYA A;  5CSN A;  2KQ6 A;  2WC8 A;  4GGN A;  1D1O A;  1TTX A;  2LP2 A;  1K90 D;  1P28 A;  4CID A;  1WDC B;  1F4O A;  1KFU L;  1OMD A;  3CAB A;  4JWQ A;  2I94 A;  1JF0 A;  3GK2 A;  3I5H B;  3CR2 A;  1KK8 B;  3E3R A;  1NCZ A;  3NSI A;  3RLZ A;  1UP5 A;  1W7J B;  3DXL A;  1SPY A;  1PVA A;  4PE7 A;  2L0P A;  1AHR A;  5I2L A;  1BLQ A;  2KI4 B;  4CLN A;  1DGV A;  1YVH A;  2OS8 B;  2I7A A;  1Y6W A;  2COL B;  2JWW A;  1RTP 1;  1SL9 A;  1UUS A;  3WHU B;  1OOF A;  3LLE A;  2WCH A;  2BCX A;  4MBE A;  2JTT A;  3FE6 A;  1PRW A;  3TS5 C;  2GGZ A;  2PMY A;  2KSP A;  1ZUZ A;  5DKN A;  3FIA A;  1TRF A;  2BBM A;  4JKT A;  1QJT A;  4OCI A;  1CB1 A;  2LMV A;  1YR5 A;  1CDL A;  2QEB A;  2Y1M A;  3D0Y B;  4OVN F;  4YI9 A;  1CFP A;  4E68 A;  2BAP A;  2L5Y A;  2LLS A;  2HQ8 A;  3HCM A;  3TUY C;  4KYN A;  1KFX S;  1G4Y R;  3CYZ A;  3D73 A;  1BJF A;  2L5X B;  2CCM A;  3CLN A;  1AP4 A;  1R2U A;  4WRI A;  1IRJ A;  1QVI Y;  3EKH A;  3AKB A;  3DD4 A;  2K7O A;  3EVU A;  3PN7 C;  4N1G A;  4XJK A;  3SG4 A;  2L2C A;  1DVI A;  2LAN A;  1NYA A;  1XK4 A;  3D78 A;  1A4P A;  1FI5 A;  3NSO A;  1EXR A;  1BU3 A;  2EGD A;  3BUN B;  1EG3 A;  4UPG A;  4OKH A;  2QPT A;  1XFV O;  2Y5I A;  3DY9 A;  1C07 A;  1DTL A;  3CR5 X;  2ZND A;  1ZMZ A;  2K7D A;  1FPW A;  2QDI A;  2M7L A;  1DEK A;  1UWO A;  2SAS A;  3BUW B;  2EC6 B;  1SR6 B;  1WY9 A;  1JFK A;  1OOG A;  4MRY A;  1XFW O;  1RJV A;  4DS7 A;  1UHJ A;  2KHN A;  1FF1 A;  3PM2 A;  2JPO A;  2WCJ A;  1UHI A;  2NCP A;  2LC5 A;  2BNX A;  4PHN A;  1TNP A;  3BXK A;  1CFF A;  2PSR A;  4ICB A;  3VRN A;  1LA0 A;  1QLS A;  3SG5 A;  1S26 D;  1S6J A;  3JVT C;  2EHB A;  1L7Z A;  1PK0 D;  1J7O A;  2FJY A;  3CDN A;  1KQM C;  1RFJ A;  1GJY A;  2KBI A;  5B8I B;  1TOP A;  1S5G Y;  4IL1 A;  3D74 A;  1KWO B;  1QXP A;  2F2O A;  2QAC A;  3PJI A;  3TDU A;  1KSO A;  2BL0 B;  2LHL A;  3ICB A;  4OZD A;  5D7F A;  1B8C A;  4ETO A;  5ER5 A;  1N65 A;  3LCP C;  1B4C A;  1NCY A;  3R1O A;  2KAX A;  1JFJ A;  2K2F A;  2LAP A;  2LLU A;  1YVL A;  5HLO A;  4QJ5 B;  3BFH A;  3VRQ A;  5AXI A;  2L2E A;  4NDB A;  1ZOT B;  2QEO A;  3EK4 A;  3QME A;  1YRU B;  1K94 A;  1S1E A;  4M2Q A;  2WC5 A;  3SG6 A;  5K89 A;  2CTN A;  2AAO A;  1OOH A;  1X02 A;  3OHM B;  1BF5 A;  3C1V A;  3K1E A;  1K9U A;  3IQQ A;  2KNE A;  2HQW A;  2CNP A;  1MR8 A;  1NX0 A;  3BOW A;  3R1P A;  3KF9 A;  3NSK A;  4USL A;  2ZN8 A;  1L2O C;  4AOM A;  1CLL A;  2GTE A;  5AAN A;  1XFZ O;  2QEV A;  2E6W A;  3B86 A;  4WQ3 A;  1DEL A;  2JXC A;  2Q91 A;  3EK7 A;  2JNF A;  4ORB B;  2PVB A;  2P70 A;  2WCM A;  3CR4 X;  3O2P A;  1BMO A;  4L9M A;  3R72 A;  4NDC A;  2F3Y A;  5FI2 A;  4XJK B;  1NX3 A;  1FI6 A;  1QIV A;  1XFR A;  2BKH B;  3PM8 A;  2SCP A;  4PE0 A;  1DMO A;  1E8A A;  3L47 A;  3FS7 A;  4DIR A;  1XFU O;  2KLE A;  3SJS A;  3DYE A;  3BJH A;  4GFT A;  2H61 C;  2BCB A;  2WND A;  1DJG A;  2LVV A;  1J7Q A;  3OB1 B;  3CWG A;  1YRT B;  2KFH A;  1DC1 A;  1MWN A;  2M3W A;  3O78 A;  1Q80 A;  2KI6 D;  2KAY A;  2CBL A;  3VGO A;  2NLN A;  3PFV A;  1QV1 A;  5D69 A;  4MVF A;  5ER4 X;  1FBV A;  5I94 A;  4MEW A;  2ZN9 A;  1SCM C;  2V53 A;  2ZNE A;  1UHH A;  2JT8 A;  3B88 A;  2PQL A;  1M31 A;  3DZT A;  3JTD C;  3NXA A;  3OBV A;  3KEV A;  2L50 A;  2IS9 A;  1TNQ A;  3FWC A;  5G08 A;  1J7R A;  2MA2 A;  2G9B A;  5AFP A;  5J3X A;  3BFA A;  2MBX A;  3VRP A;  1W7I B;  1K93 D;  3BUM B;  3AKA A;  3KPX A;  3S0E A;  1SBJ A;  2L4I A;  3CS1 A;  3SS4 A;  2ZFD A;  3N7H A;  2K2A A;  1GQM A;  4U8D A;  3OGN A;  4YBH B;  1Z2C B;  2OTG C;  1RRO A;  4TNC A;  2HET A;  1WDC C;  2FJU B;  2LMT A;  3PSR A;  1YUR A;  1CM1 A;  1CKK A;  1IH0 A;  3I5H C;  3B7A A;  1BR4 B;  1KK8 C;  1NP8 A;  3S0D A;  4GNK B;  1KQV A;  2LVK A;  2M0R A;  2VRG A;  4YGD B;  2JZI A;  3TS5 B;  4DUQ A;  3L4A A;  2B1U A;  5AER A;  2KFG A;  4JQ0 D;  3V2L A;  3CTN A;  3BQ3 A;  4ORC B;  1K2H A;  3SS5 A;  2KAV A;  1MF8 B;  1TCO B;  2WCL A;  1J1D A;  3A8R A;  2TN4 A;  2M1U A;  4NDD A;  5FI7 A;  2BE6 A;  4HRG A;  3TUY B;  4OR9 B;  3BOW B;  3DVK A;  4OV2 A;  4MN0 A;  1H8B A;  1SK6 D;  4FQO A;  3TDI A;  2KBM A;  2D8N A;  1OZO A;  1CDP A;  2KI6 C;  4HRH A;  5DIC A;  1S3P A;  1M39 A;  2JT3 A;  1Y1X A;  1LS8 A;  3I5F B;  2MJW B;  1KK7 Z;  5CSF A;  1PVB A;  4GBA A;  1YUS A;  3PLF B;  1G33 A;  2H61 A;  5PAL A;  1JWD A;  1IIO A;  3DF0 A;  4CFQ A;  2L4H A;  3WHT B;  2OPO A;  1F54 A;  1LVC D;  1QX7 A;  3OX5 A;  2JT0 A;  3SIB A;  1REC A;  2BCA A;  5DKR A;  2I18 A;  5HL1 A;  4AQJ A;  2LM5 A;  3I5I B;  1C3Y A;  2WCE A;  4FQT A;  4HSZ A;  1OSA A;  4PAL A;  4YGE B;  5KSZ A;  1CMF A;  3I5G C;  3UO9 A;  1OZS A;  1Y0V H;  3TZ1 A;  1OOI X;  1NX1 A;  2LLT A;  4PE4 A;  3UNW A;  4NQG A;  2HPS A;  1XVJ A;  3AAJ A;  1DF0 A;  1WRL A;  3SG7 A;  3JVT B;  3CZ0 A;  2KYF A;  1YX8 A;  1DGU A;  1CMG A;  1Y1U A;  1KQM B;  1K9K A;  2M7N A;  1DJI A;  3ZNI A;  4BY5 A;  1CM4 A;  5HLV A;  2NZ0 A;  4DRW A;  1SL8 A;  1SRA A;  1FW4 A;  3Q8I A;  4INW A;  1LKJ A;  1SYM A;  1CFD A;  1EL4 A;  1OMR A;  2KPH A;  2M1K B;  5JJG A;  3GK1 A;  1TWO A;  1UUR A;  1K96 A;  1OW4 A;  3S0A A;  4A4C A;  1ODB A;  1W9Z A;  1GGZ A;  1C7V A;  3KO0 A;  1AK8 A;  1IQ3 A;  1KWO C;  1ZAC A;  1AJ4 A;  3OB2 B;  5FI6 A;  1G8I A;  2O5G A;  4MZL A;  3AAK A;  2LCP A;  1JBA A;  3K21 A;  3H4S E;  3BFB A;  4GAO A;  4F0Z B;  2LHI A;  3WNX B;  1B8L A;  1DJW A;  2MRD A;  5HKZ A;  1BOD A;  5HKW A;  5EL2 A;  2F33 A;  4Q04 A;  2LV7 A;  4PHK A;  4YGC B;  1F8H A;  4ZCU A;  1NIW A;  2BBN A;  3CZT X;  1UHN A;  1QV0 A;  5CSJ A;  1YUU A;  3CZ2 A;  2K0J A;  3BUX B;  1C3Z A;  1CNP A;  1LA3 A;  2L98 A;  1IGV A;  4DCK A;  1QWV A;  1BOC A;  2K60 A;  2R2I A;  1TUJ A;  3WXA A;  2FCD A;  2PAL A;  1AUI B;  1CFC A;  3ZWH A;  2BEC A;  1SSE B;  1QX5 B;  1M45 A;  5I8N A;  4PHJ A;  1S5G Z;  2JNX A;  3DF0 B;  4N5X A;  1EJ3 A;  2LE9 B;  1BR1 B;  4GGF C;  3SG2 A;  5TNC A;  5HKY A;  2KYC A;  1DT7 B;  3S0F A;  3NHT A;  4JD9 A;  1N0Y A;  2H2K A;  1LIN A;  2WOS A;  1WRK A;  1F70 A;  2GGM A;  2M8U A;  1SCM B;  4M2P A;  1XFX O;  4A4B A;  1MXL C;  4C0K A;  1CDM A;  2KQY A;  1QAT A;  1XA5 A;  1SW8 A;  1YUT A;  2MLE C;  1WLM A;  3JTD B;  1R6P A;  1CLM A;  3CZ1 A;  5JOL A;  1Z4H A;  2E30 A;  1CLB A;  2BE4 A;  4GUK A;  1B7T Z;  1DF0 B;  1TN4 A;  1DJY A;  3GOF A;  3R1V A;  5CSI A;  2KFF A;  3HX4 A;  2JRF A;  3CGA A;  1IWQ A;  1U5I A;  1H4B A;  2LMU A;  4I5L B;  4FTG A;  4C0J A;  2M29 A;  1JF2 A;  1KK7 Y; 
#chains in the Genus database with same CATH homology
 2A4J A;  1LXF C;  2WCF A;  2BKI B;  2OTG B;  5I2Q A;  2K7C A;  2Y4Q A;  4MRX A;  3VRR A;  1M46 A;  2G2B A;  2AUC A;  2FOT A;  1TIZ A;  2MHH A;  1OQP A;  4MZK A;  1SY9 A;  4N1F A;  1RWY A;  1V1G A;  1NUB A;  2KI4 C;  2P6B B;  2Q4U A;  3VRO A;  2I2R E;  2OS8 C;  3QRX A;  2LNK A;  4XYN A;  2F8P A;  2KDH A;  2ZKM X;  4YGB B;  1NWD A;  4ORA B;  1NPQ A;  4P5O E;  1DJX A;  1HT9 A;  1K9P A;  1NSH A;  1XYD A;  2JUL A;  4MZJ A;  1JSA A;  2LVJ A;  5FYX A;  2NCO A;  2PRU A;  2Y1N A;  1S6I A;  1EH2 A;  5AEQ A;  3D10 A;  2MAZ A;  3M0W A;  4PE1 A;  2KOT A;  3PN7 B;  3LL8 B;  3KHE A;  2AMI A;  3SIA A;  1J1E A;  1BT6 A;  1S36 A;  3A4U B;  2K7B A;  1HQV A;  1VRK A;  2CT9 A;  1JC2 A;  1AVS A;  1WLZ A;  2DOQ A;  4MSP A;  4CFR A;  2CXJ A;  1F4Q A;  1IQ5 A;  1IG5 A;  3LK0 A;  1SL7 A;  4GGF A;  1KSM A;  1XFY O;  1A2X A;  4PHM A;  2HF5 A;  1IKU A;  1OOJ A;  3EVV A;  1SKT A;  2M97 A;  3I5F C;  3OP0 A;  1F55 A;  4CPV A;  3F45 A;  3GK4 X;  1CDN A;  3I5G B;  5BPJ A;  1M63 B;  2WCB A;  1RK9 A;  1K95 A;  4I5N B;  3SG3 A;  2EC6 C;  1ALV A;  1SR6 C;  1OMV A;  5HYD A;  3DVJ A;  4PCW A;  5DKQ A;  5KU1 A;  1A75 A;  1MUX A;  1NCX A;  1PUL A;  2LUX A;  1DJH A;  3I5I C;  1OE9 B;  5F6T A;  1XO5 A;  1MXE A;  2M49 B;  4MLW A;  4D1E A;  1QTX A;  4YRU A;  2GV5 A;  4P2Y B;  1B1G A;  1A29 A;  1C7W A;  1UHK A;  1ALW A;  1IJ6 A;  1V1F A;  1MHO A;  1QVI Z;  1U5I B;  2JOJ A;  3EVR A;  4M2O A;  3NSL A;  3RM1 A;  1J55 A;  1AJ5 A;  4JPZ B;  3O6B A;  1B8R A;  2BL0 C;  2JQ6 A;  2KGB C;  3PAT A;  2MLF C;  2K8M B;  4QJ3 B;  2JTZ A;  4QJ4 B;  1TNX A;  3MSE B;  5IBW A;  2LP3 A;  1QAS A;  1KFU S;  4R1E A;  1L2O B;  2RGI A;  1KFX L;  1TNW A;  1K8U A;  3D0Y A;  4ZCV A;  1KCY A;  1QS7 A;  4WQ2 A;  1IJ5 A;  4I5J A;  4YI8 A;  3IF7 A;  1CTR A;  1PSR A;  1Y1A A;  1QLK A;  2FCE A;  3OX6 A;  3IQO A;  4AQI A;  2O60 A;  2ZRT A;  1B7T Y;  1PAL A;  2JPT A;  2M9G A;  2ZRS A;  2F3Z A;  2KGR A;  4PDZ A;  4BY4 A;  1SNL A;  1DJZ A;  2PAS A;  5I2O A;  2LVI A;  1SMG A;  3LK1 A;  2JU0 A;  3DVE A;  1JUO A;  1B9A A;  3FWB A;  3O4Y A;  2F2P A;  1ZFS A;  2NXQ A;  3PAL A;  3EKJ A;  5KTY A;  1EG4 A;  4C0L A;  2L51 A;  1WRZ A;  1XK4 C;  1SCV A;  5GQQ C;  1QX2 A;  2ISD A;  1J7P A;  1N2D A;  2WOR A;  2JXL A;  1TCF A;  4I5K A;  1NX2 A;  3TDZ A;  1F71 A;  4HRE E;  2JC2 A;  1QIW A;  2K61 A;  3DVM A;  4YGA A;  1YX7 A;  5CPV A;  1A03 A;  1YTZ C;  3EK8 A;  3BUO B;  1BG1 A;  1GGW A;  2LUC A;  4GPL B;  1MQ1 A;  1A75 B;  1PSB A;  1S6C A;  1B47 A;  3BYA A;  5CSN A;  2KQ6 A;  2WC8 A;  4GGN A;  1D1O A;  1TTX A;  2LP2 A;  1K90 D;  4CID A;  1WDC B;  1F4O A;  1KFU L;  1OMD A;  4JWQ A;  2I94 A;  1JF0 A;  3GK2 A;  3I5H B;  3CR2 A;  1KK8 B;  3E3R A;  1NCZ A;  3NSI A;  3RLZ A;  1UP5 A;  1W7J B;  1SPY A;  1PVA A;  4PE7 A;  2L0P A;  1AHR A;  5I2L A;  1BLQ A;  2KI4 B;  4CLN A;  1DGV A;  1YVH A;  2OS8 B;  2I7A A;  1Y6W A;  2COL B;  2JWW A;  1RTP 1;  1SL9 A;  1UUS A;  3WHU B;  3LLE A;  2BCX A;  4MBE A;  2JTT A;  1PRW A;  3TS5 C;  2GGZ A;  2PMY A;  2KSP A;  1ZUZ A;  5DKN A;  3FIA A;  1TRF A;  2BBM A;  1QJT A;  4OCI A;  1CB1 A;  2LMV A;  1YR5 A;  1CDL A;  2Y1M A;  3D0Y B;  4OVN F;  4YI9 A;  1CFP A;  4E68 A;  2LLS A;  2HQ8 A;  3HCM A;  3TUY C;  1KFX S;  1G4Y R;  1BJF A;  2L5X B;  2CCM A;  3CLN A;  1AP4 A;  1R2U A;  4WRI A;  1IRJ A;  1QVI Y;  3EKH A;  3AKB A;  3DD4 A;  2K7O A;  3EVU A;  3PN7 C;  4N1G A;  4XJK A;  3SG4 A;  1DVI A;  2LAN A;  1NYA A;  1XK4 A;  1A4P A;  1FI5 A;  3NSO A;  1EXR A;  1BU3 A;  2EGD A;  3BUN B;  1EG3 A;  4UPG A;  4OKH A;  2QPT A;  1XFV O;  2Y5I A;  1C07 A;  1DTL A;  3CR5 X;  2ZND A;  1ZMZ A;  2K7D A;  1FPW A;  2M7L A;  1UWO A;  2SAS A;  3BUW B;  2EC6 B;  1SR6 B;  1WY9 A;  1JFK A;  4MRY A;  1XFW O;  1RJV A;  4DS7 A;  1UHJ A;  2KHN A;  1FF1 A;  1UHI A;  2NCP A;  2LC5 A;  4PHN A;  1TNP A;  3BXK A;  1CFF A;  2PSR A;  4ICB A;  3VRN A;  1LA0 A;  1QLS A;  3SG5 A;  1S26 D;  1S6J A;  3JVT C;  2EHB A;  1L7Z A;  1PK0 D;  1J7O A;  1KQM C;  1RFJ A;  1GJY A;  2KBI A;  5B8I B;  1TOP A;  1S5G Y;  4IL1 A;  1KWO B;  1QXP A;  2F2O A;  2QAC A;  3TDU A;  1KSO A;  2BL0 B;  2LHL A;  3ICB A;  5D7F A;  1B8C A;  4ETO A;  5ER5 A;  1N65 A;  3LCP C;  1B4C A;  1NCY A;  2KAX A;  1JFJ A;  2K2F A;  2LAP A;  2LLU A;  1YVL A;  5HLO A;  4QJ5 B;  3VRQ A;  5AXI A;  2L2E A;  4NDB A;  1ZOT B;  3EK4 A;  1YRU B;  1K94 A;  1S1E A;  4M2Q A;  3SG6 A;  5K89 A;  2CTN A;  2AAO A;  1X02 A;  3OHM B;  1BF5 A;  3C1V A;  1K9U A;  3IQQ A;  2KNE A;  2HQW A;  2CNP A;  1MR8 A;  1NX0 A;  3BOW A;  3KF9 A;  3NSK A;  4USL A;  2ZN8 A;  1L2O C;  4AOM A;  1CLL A;  5AAN A;  1XFZ O;  2E6W A;  4WQ3 A;  2JXC A;  2Q91 A;  3EK7 A;  2JNF A;  4ORB B;  2PVB A;  3CR4 X;  3O2P A;  1BMO A;  4L9M A;  4NDC A;  2F3Y A;  4XJK B;  1NX3 A;  1FI6 A;  1QIV A;  1DMO A;  2BKH B;  3PM8 A;  2SCP A;  4PE0 A;  1E8A A;  3FS7 A;  4DIR A;  1XFU O;  3SJS A;  4GFT A;  2H61 C;  2BCB A;  2WND A;  1DJG A;  2LVV A;  1J7Q A;  3OB1 B;  3CWG A;  1YRT B;  2KFH A;  1MWN A;  2M3W A;  3O78 A;  1Q80 A;  2KI6 D;  2KAY A;  2CBL A;  3VGO A;  2NLN A;  3PFV A;  1QV1 A;  5D69 A;  4MVF A;  5ER4 X;  1FBV A;  4MEW A;  2ZN9 A;  1SCM C;  2V53 A;  2ZNE A;  1UHH A;  2JT8 A;  1M31 A;  3JTD C;  3NXA A;  3KEV A;  2L50 A;  2IS9 A;  1TNQ A;  3FWC A;  5G08 A;  1J7R A;  2MA2 A;  2G9B A;  5AFP A;  5J3X A;  3VRP A;  2MBX A;  1W7I B;  1K93 D;  3BUM B;  3AKA A;  3KPX A;  1SBJ A;  2L4I A;  3CS1 A;  2ZFD A;  2K2A A;  1GQM A;  4U8D A;  4YBH B;  2OTG C;  1RRO A;  4TNC A;  2HET A;  1WDC C;  2FJU B;  2LMT A;  3PSR A;  1YUR A;  1CM1 A;  1CKK A;  1IH0 A;  3I5H C;  1BR4 B;  1KK8 C;  1NP8 A;  4GNK B;  1KQV A;  2LVK A;  2M0R A;  2VRG A;  4YGD B;  2JZI A;  3TS5 B;  4DUQ A;  2B1U A;  5AER A;  2KFG A;  4JQ0 D;  3CTN A;  3BQ3 A;  4ORC B;  1K2H A;  2KAV A;  1MF8 B;  1TCO B;  1J1D A;  3A8R A;  2TN4 A;  2M1U A;  4NDD A;  2BE6 A;  4HRG A;  3TUY B;  4OR9 B;  3BOW B;  3DVK A;  4OV2 A;  4MN0 A;  1H8B A;  1SK6 D;  4FQO A;  3TDI A;  2KBM A;  2D8N A;  1OZO A;  1CDP A;  2KI6 C;  4HRH A;  1S3P A;  1M39 A;  2JT3 A;  1Y1X A;  3I5F B;  2MJW B;  1KK7 Z;  5CSF A;  1PVB A;  4GBA A;  1YUS A;  3PLF B;  1G33 A;  2H61 A;  5PAL A;  1JWD A;  3DF0 A;  4CFQ A;  2L4H A;  3WHT B;  2OPO A;  1F54 A;  1LVC D;  1QX7 A;  3OX5 A;  2JT0 A;  3SIB A;  1REC A;  2BCA A;  5DKR A;  2I18 A;  4AQJ A;  2LM5 A;  3I5I B;  2WCE A;  4HSZ A;  4PAL A;  1OSA A;  4YGE B;  5KSZ A;  1CMF A;  3I5G C;  1OZS A;  1Y0V H;  3TZ1 A;  1NX1 A;  2LLT A;  4PE4 A;  4NQG A;  2HPS A;  1XVJ A;  3AAJ A;  1DF0 A;  1WRL A;  3SG7 A;  3JVT B;  2KYF A;  1YX8 A;  1DGU A;  1CMG A;  1Y1U A;  1KQM B;  1K9K A;  2M7N A;  1DJI A;  3ZNI A;  4BY5 A;  1CM4 A;  5HLV A;  2NZ0 A;  4DRW A;  1SL8 A;  1SRA A;  1FW4 A;  1LKJ A;  1SYM A;  1CFD A;  1EL4 A;  1OMR A;  2M1K B;  5JJG A;  3GK1 A;  1UUR A;  1K96 A;  4A4C A;  1ODB A;  1GGZ A;  1C7V A;  3KO0 A;  1AK8 A;  1IQ3 A;  1KWO C;  1ZAC A;  1AJ4 A;  3OB2 B;  1G8I A;  2O5G A;  4MZL A;  3AAK A;  2LCP A;  1JBA A;  3K21 A;  3H4S E;  4GAO A;  4F0Z B;  2LHI A;  3WNX B;  1B8L A;  1DJW A;  2MRD A;  5HKZ A;  1BOD A;  5HKW A;  2F33 A;  4Q04 A;  2LV7 A;  4PHK A;  4YGC B;  1F8H A;  4ZCU A;  1NIW A;  2BBN A;  3CZT X;  1UHN A;  1QV0 A;  5CSJ A;  1YUU A;  2K0J A;  3BUX B;  1CNP A;  1LA3 A;  2L98 A;  1IGV A;  4DCK A;  1BOC A;  3WXA A;  2R2I A;  2FCD A;  2PAL A;  1AUI B;  1CFC A;  3ZWH A;  2BEC A;  1QX5 B;  1M45 A;  5I8N A;  4PHJ A;  1S5G Z;  2JNX A;  3DF0 B;  4N5X A;  1EJ3 A;  2LE9 B;  1BR1 B;  4GGF C;  3SG2 A;  5TNC A;  5HKY A;  2KYC A;  1DT7 B;  1N0Y A;  2H2K A;  1LIN A;  2WOS A;  1WRK A;  1F70 A;  2GGM A;  2M8U A;  1SCM B;  4M2P A;  1XFX O;  4A4B A;  1MXL C;  4C0K A;  1CDM A;  2KQY A;  1QAT A;  1XA5 A;  1SW8 A;  1YUT A;  2MLE C;  1WLM A;  3JTD B;  1R6P A;  1CLM A;  5JOL A;  2E30 A;  1CLB A;  2BE4 A;  4GUK A;  1B7T Z;  1DF0 B;  1TN4 A;  1DJY A;  3GOF A;  5CSI A;  2KFF A;  3HX4 A;  2JRF A;  3CGA A;  1IWQ A;  1U5I A;  1H4B A;  2LMU A;  4I5L B;  4FTG A;  4C0J A;  2M29 A;  1JF2 A;  1KK7 Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...