1B7TZ

Myosin digested by papain
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
153
structure length
153
Chain Sequence
KLSQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYOSIN HEAVY CHAIN
publication title Atomic structure of scallop myosin subfragment S1 complexed with MgADP: a novel conformation of the myosin head.
pubmed doi rcsb
molecule tags Myosin
total genus 41
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 1999-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1b7tZ01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1b7tZ02
2LVJA 1TCFA 3DF0A 3SIAA 1HQVA 1NWDA 2Q4UA 2LCPA 4YGCB 3OB1B 1XFYO 1L7ZA 1Y1AA 2KGRA 3TDZA 3IQOA 2KOTA 2LP3A 2CT9A 1CMGA 1YVLA 1S1EA 4OKHA 1IH0A 1A75B 2EC6C 4PHJA 4GGNA 5HKZA 1XFVO 1S36A 1F55A 4P5OE 3I5GB 2AAOA 2LLSA 1DJIA 1B1GA 4GAOA 4USLA 1OMVA 1NYAA 1NSHA 4DIRA 1OOJA 2F2OA 3M0WA 1CDLA 1RJVA 2KNEA 5CSJA 5ER4X 1UUSA 1F54A 1ODBA 3TS5B 2LMUA 4MN0A 1FI5A 5AERA 1QX5B 1J7OA 1SL8A 3TDUA 1S5GZ 2LE9B 1ZFSA 5D7FA 5I8NA 5J3XA 2JULA 4PCWA 4U8DA 1AJ4A 4GUKA 4XYNA 3EKJA 1EXRA 2MAZA 2EGDA 2WOSA 3E3RA 4MRXA 3IQQA 1SNLA 2JPTA 4WQ2A 1JF2A 1QJTA 2BBMA 1PSBA 1UHKA 2HPSA 4PE7A 2M7NA 4I5KA 1OQPA 5GQQC 3H4SE 5D69A 2LUXA 1F8HA 1WY9A 4BY4A 2LP2A 2M8UA 1EL4A 4BY5A 2BKHB 2Q91A 4A4CA 1AUIB 2P6BB 1M46A 3CWGA 4JWQA 3BOWA 4N1FA 1J7RA 3PFVA 3SIBA 1FPWA 2O5GA 1TIZA 1GGWA 5IBWA 2F33A 2FJUB 2JRFA 2KYFA 4E68A 4M2QA 3WXAA 2FCEA 4YGBB 4DRWA 1QIWA 3SG4A 3IF7A 3OHMB 1J7PA 4NQGA 4MLWA 1ZOTB 2F2PA 1DVIA 4UPGA 2CXJA 4PE1A 5CSIA 1WRZA 3NSIA 1CDPA 4JPZB 1Y0VH 2M1UA 4GFTA 5AEQA 3BYAA 3KO0A 1SR6C 2Y4QA 4YGEB 4HSZA 1SY9A 4M2OA 4PHKA 4PDZA 3CZTX 3PN7C 1QASA 1EJ3A 5HKYA 1B9AA 3BQ3A 3FS7A 2LLTA 1ALWA 1G8IA 1UHNA 1OZOA 2WCBA 2GGZA 1CFDA 1OZSA 1A03A 4P2YB 2I18A 1DF0A 1UURA 1BMOA 2OS8B 2M7LA 1Y1XA 5HYDA 1YRUB 2LMTA 1L2OC 4JQ0D 3BUNB 2ZFDA 3DD4A 2L98A 2PASA 1WLZA 4DCKA 1W7JB 1J1EA 2JT3A 2L4IA 5CPVA 1TNPA 4TNCA 1GQMA 1DTLA 1SYMA 1A75A 1S6CA 1QS7A 1TNQA 3SJSA 1KQMB 3D10A 1N65A 1AVSA 3VRQA 1NUBA 4PE0A 5AANA 3BUWB 3TUYC 2KI4C 2MLEC 4I5NB 2L5XB 2BL0C 2ZKMX 3EK7A 3BXKA 1J7QA 1NCZA 2K7BA 1G33A 2M1KB 1J1DA 1JBAA 2PRUA 3D0YB 3VRPA 4YI9A 4C0LA 2PSRA 1SBJA 1CLMA 5AXIA 1CMFA 3ZWHA 1NCXA 1F4QA 2K8MB 1XK4A 1MR8A 2LVVA 2KYCA 4FQOA 2JT8A 3SG5A 3I5IC 1K9PA 2ZN9A 1UP5A 1K95A 4QJ4B 1DJGA 1BODA 3I5FC 5G08A 1ALVA 4I5LB 1CKKA 1DJHA 1DGUA 3C1VA 2M3WA 3GK1A 2JT0A 1AHRA 3LK1A 3O4YA 1BT6A 2HETA 1LVCD 1QTXA 5I2OA 1KSMA 2H2KA 3JTDB 1NX0A 1UHHA 1NX2A 1LINA 1SMGA 1H4BA 5PALA 1PULA 1K9KA 1B8CA 1CB1A 1VRKA 2F3YA 2BE6A 1IKUA 1KFUS 1SW8A 4ZCUA 1R2UA 2HQWA 2LV7A 4OR9B 1LA3A 3EK4A 3SG2A 1DMOA 2M0RA 2LHIA 1S3PA 1L2OB 4NDBA 2KAYA 2CCMA 4CFQA 1QVIY 1AP4A 1ZMZA 4M2PA 2KAXA 2ZNEA 2TN4A 2M49B 1JF0A 2KFFA 3AAJA 1DJZA 1QLSA 2F8PA 5BPJA 4NDCA 3PM8A 3KF9A 1JSAA 5JJGA 1B4CA 2KI6C 1B7TY 1IG5A 3DVMA 5FYXA 3LCPC 1SL9A 2M29A 3CS1A 1RFJA 1V1GA 2K2FA 2KI6D 1S6IA 1K90D 3TZ1A 4MVFA 2KQ6A 3I5HC 2WCFA 3TUYB 1K8UA 3AKAA 4L9MA 1KWOB 1RTP1 3OX5A 5KU1A 1AK8A 2M9GA 4IL1A 1BF5A 3BUOB 2AUCA 3ICBA 1CFFA 4CFRA 2CBLA 2H61A 1MHOA 1CM1A 1NIWA 2KFHA 2KQYA 1F71A 1SL7A 4OCIA 2RGIA 4ORBB 2OTGB 1RECA 4GGFA 3KEVA 2JNXA 2O60A 3WHUB 1A29A 2E30A 1N2DA 3WNXB 1F70A 2NLNA 2ZN8A 5CSFA 1PRWA 2BE4A 2LUCA 3I5IB 3NXAA 1KCYA 2L0PA 1FI6A 1XFXO 1BR1B 2I94A 1KQVA 2F3ZA 2JC2A 2KAVA 1EG3A 1QV0A 2JZIA 3CLNA 2EC6B 3CR4X 3K21A 3PALA 5I2LA 4F0ZB 1M45A 1H8BA 1A4PA 1Y6WA 2HQ8A 2PMYA 4WQ3A 4C0JA 2PALA 3O2PA 1W7IB 2M97A 3VGOA 1C07A 1SK6D 4XJKA 1NP8A 1ZACA 3LK0A 2KHNA 2MRDA 3D0YA 1YX8A 1K9UA 4ETOA 1CFCA 1IWQA 2JTTA 2KSPA 3GK2A 3ZNIA 1TRFA 1V1FA 4OVNF 4C0KA 1UHJA 2R2IA 5K89A 2K2AA 1QX7A 4Q04A 5I2QA 1N0YA 2I2RE 3SG6A 5HKWA 2L51A 1NX3A 1YVHA 3DVKA 3TDIA 2KBMA 3RM1A 3TS5C 2KDHA 1LKJA 2K61A 2SASA 2LM5A 4CPVA 3BOWB 4FTGA 3LLEA 2LVKA 2FOTA 1DJWA 3DVEA 2NZ0A 1KK7Y 1XK4C 1TTXA 2K7CA 3EKHA 2ZRSA 4AQJA 2FCDA 4HRHA 1KFXS 1DJXA 1F4OA 1LXFC 1MXEA 1KK8C 4ZCVA 4GNKB 1B47A 1SCVA 2WORA 1PVBA 1JWDA 2GGMA 4MSPA 1CFPA 3FWCA 2LAPA 1JC2A 2E6WA 3JVTC 1BJFA 4N5XA 2SCPA 3A4UB 2KGBC 3DVJA 2ZRTA 3HCMA 3KPXA 4HRGA 1K96A 5B8IB 1FBVA 1KSOA 2I7AA 1MWNA 2MBXA 2BECA 3VRRA 2KFGA 4ORCB 1S6JA 2NCOA 1XYDA 2L50A 4GPLB 1IQ3A 4D1EA 2A4JA 1UWOA 1SRAA 2GV5A 3CR2A 2Y1MA 1DF0B 1QV1A 1CLLA 1U5IB 4AOMA 2PVBA 1RWYA 1NCYA 2JU0A 5DKNA 3CR5X 1SR6B 2AMIA 1B7TZ 1TCOB 1YX7A 5CSNA 1PALA 1NPQA 3A8RA 2L4HA 2K7OA 3PN7B 1J55A 1SCMC 2B1UA 1DJYA 3O78A 3HX4A 2QPTA 1Q80A 1XFUO 2V53A 4N1GA 2JTZA 4NDDA 1TN4A 4MRYA 2WCEA 3FIAA 3PATA 1M63B 4ICBA 3MSEB 4YBHB 3NSKA 3BUMB 1YRTB 2OS8C 4AQIA 1BOCA 1OMRA 3FWBA 1K93D 3WHTB 1GGZA 1BLQA 1IRJA 1G4YR 1E8AA 1LA0A 2H61C 2NXQA 1IGVA 1WRLA 2MLFC 1SKTA 4YRUA 1QLKA 4GGFC 1RK9A 1S26D 2KBIA 1KFUL 3PLFB 5TNCA 3DF0B 1XFZO 1C7WA 2D8NA 2LC5A 3NSLA 2JQ6A 2LANA 1KQMC 2VRGA 4YGAA 2KI4B 4MZJA 3LL8B 3KHEA 1KK8B 1R6PA 5JOLA 1X02A 2BL0B 3EVUA 4CLNA 3GOFA 2LLUA 1TOPA 2BBNA 4A4BA 1DT7B 1M31A 1IQ5A 3F45A 2IS9A 1XO5A 3JVTB 2BCBA 3RLZA 2WC8A 1K2HA 2L2EA 4PHMA 5DKRA 2Y1NA 1GJYA 4MBEA 2QACA 3OP0A 2BKIB 1KK7Z 2K7DA 1BG1A 1JUOA 1ZUZA 1OMDA 2JWWA 2K0JA 2MJWB 1PSRA 1WDCC 2CTNA 3VRNA 1BU3A 1YR5A 2MHHA 1MUXA 3I5FB 2EHBA 1XFWO 1TNXA 1WRKA 1JFJA 3SG7A 1FF1A 3PSRA 1S5GY 5DKQA 2NCPA 2JNFA 3I5GC 1CDNA 2ISDA 3BUXB 1MQ1A 1SCMB 1CTRA 1QX2A 4YGDB 4CIDA 1JFKA 1YTZC 1OE9B 1A2XA 1FW4A 1HT9A 2WNDA 3JTDC 1AJ5A 1XVJA 3SG3A 1CM4A 2G2BA 2MA2A 1OSAA 4WRIA 1QIVA 4I5JA 1XA5A 5KTYA 1U5IA 4PE4A 3O6BA 3EVRA 5F6TA 2OPOA 2JXLA 1B8RA 1EG4A 3QRXA 4HREE 5HLOA 3OB2B 2LHLA 1CDMA 3AKBA 4PALA 1YUUA 3CTNA 1IJ6A 1K94A 4MZKA 5HLVA 2G9BA 4DS7A 1YURA 1SPYA 1MXLC 2LMVA 1QXPA 3EVVA 4YI8A 1IJ5A 4DUQA 2Y5IA 1DGVA 2CNPA 5ER5A 4PHNA 1UHIA 1RROA 2LNKA 3OX6A 4MZLA 3I5HB 4MEWA 1QVIZ 3NSOA 4ORAB 1CNPA 3EK8A 1QATA 3AAKA 3VROA 1YUTA 2JXCA 4OV2A 1WLMA 1D1OA 2COLB 1CLBA 1KWOC 4GBAA 2LVIA 1KFXL 2BCXA 1EH2A 3CGAA 1NX1A 4XJKB 4QJ5B 1M39A 5KSZA 2ZNDA 2JOJA 3GK4X 1MF8B 5AFPA 1C7VA 1YUSA 2DOQA 4QJ3B 1Y1UA 1B8LA 2BCAA 2OTGC 1PVAA 2HF5A 1WDCB 1TNWA 4R1EA 1PK0D 1BR4B
chains in the Genus database with same CATH superfamily
2LVJA 1TCFA 3DF0A 3SIAA 1HQVA 1NWDA 2Q4UA 2LCPA 4YGCB 3OB1B 1XFYO 1L7ZA 1Y1AA 2KGRA 2P70A 3TDZA 3IQOA 2KOTA 2LP3A 2CT9A 1CMGA 1YVLA 1S1EA 4OKHA 1IH0A 1A75B 2EC6C 4PHJA 4GGNA 5HKZA 1XFVO 1S36A 1F55A 4P5OE 3I5GB 3B86A 2AAOA 2LLSA 1DJIA 1B1GA 4GAOA 4USLA 3CDNA 1OMVA 1NYAA 1NSHA 4DIRA 1OOJA 2F2OA 3M0WA 1CDLA 1RJVA 2KNEA 5CSJA 5ER4X 3L47A 1UUSA 1F54A 1ODBA 3TS5B 1TUJA 2LMUA 4MN0A 1FI5A 5AERA 1QX5B 1J7OA 1SL8A 3TDUA 3QMEA 1S5GZ 2LE9B 1ZFSA 2K60A 5D7FA 3S0EA 5I8NA 5J3XA 2JULA 4PCWA 4U8DA 1AJ4A 4GUKA 4F7FA 4XYNA 3EKJA 1EXRA 2MAZA 2EGDA 2WOSA 3E3RA 4MRXA 3IQQA 1SNLA 2JPTA 3S0BA 4WQ2A 1JF2A 3D76A 1QJTA 2BBMA 1PSBA 1UHKA 2HPSA 4PE7A 2M7NA 4I5KA 1OQPA 3NHTA 5GQQC 3H4SE 2L5YA 5D69A 2JPOA 2LUXA 1F8HA 1WY9A 4BY4A 2LP2A 2M8UA 1EL4A 4BY5A 2BKHB 2Q91A 4A4CA 1AUIB 2P6BB 1M46A 3CWGA 4JWQA 2P71A 3BOWA 5D3OA 4N1FA 2KPHA 1J7RA 3PFVA 3SIBA 1FPWA 2O5GA 1TIZA 1GGWA 5IBWA 2F33A 2FJUB 2JRFA 2KYFA 4E68A 4M2QA 3WXAA 2FCEA 4YGBB 4DRWA 1QIWA 1LS8A 3SG4A 3IF7A 3OHMB 3R1VA 3VB1A 4NQGA 1J7PA 4MLWA 2WC6A 1ZOTB 4KYNA 2F2PA 1DVIA 4UPGA 2CXJA 4PE1A 5CSIA 1WRZA 3NSIA 1CDPA 4JPZB 1Y0VH 2M1UA 4GFTA 5AEQA 3BYAA 2PQLA 3KO0A 1SR6C 1TUZA 2Y4QA 4YGEB 4HSZA 1SY9A 4M2OA 4PHKA 4PDZA 3CZTX 3PN7C 1QASA 1EJ3A 5HKYA 1B9AA 3V2LA 3N7HA 3BQ3A 3FS7A 2LLTA 1ALWA 1G8IA 1UHNA 1OZOA 2WCBA 2GGZA 1CFDA 1OZSA 3D75A 4P2YB 1A03A 2I18A 1DF0A 1UURA 1BMOA 2OS8B 3DYEA 2M7LA 1Y1XA 4JD9A 5HYDA 4FQTA 1YRUB 2LMTA 1L2OC 4JQ0D 3BUNB 1Z4HA 2ZFDA 3DD4A 3UNWA 2L98A 2PASA 3K1EA 1C3ZA 1WLZA 4DCKA 1W7JB 1J1EA 2JT3A 2L4IA 3NGVA 5CPVA 1TNPA 4TNCA 1GQMA 1DTLA 1SYMA 1A75A 3B6XA 1S6CA 1QS7A 1TNQA 3OBVA 3SJSA 1KQMB 3D10A 1N65A 2ERBA 1AVSA 3VRQA 1NUBA 1OOIX 4PE0A 3BUWB 5AANA 2KI4C 3S0AA 3TUYC 2MLEC 4I5NB 2L5XB 3L4AA 2BL0C 2ZKMX 3EK7A 3BXKA 1J7QA 1NCZA 3D77A 2K7BA 1G33A 2M1KB 1J1DA 1JBAA 2PRUA 3D0YB 3VRPA 4YI9A 4C0LA 2PSRA 1SBJA 1CLMA 5FI2A 5AXIA 1CMFA 1OW4A 2QDIA 3ZWHA 1NCXA 1F4QA 1DEKA 2K8MB 3D74A 1XK4A 1MR8A 2LVVA 2KYCA 4FQOA 2JT8A 3SG5A 3I5IC 1K9PA 2ZN9A 3B87A 1UP5A 1T14A 1K95A 4QJ4B 1DJGA 1BODA 3I5FC 5G08A 1ALVA 4I5LB 1CKKA 1DJHA 1DGUA 3C1VA 2M3WA 3GK1A 2JT0A 1AHRA 3LK1A 3O4YA 1BT6A 2HETA 1LVCD 1QTXA 5I2OA 1KSMA 2H2KA 3JTDB 1NX0A 1UHHA 1NX2A 1LINA 1ORGA 1SMGA 4IJ7A 1H4BA 5PALA 1PULA 1K9KA 1B8CA 1CB1A 1VRKA 2F3YA 2BE6A 1IKUA 1KFUS 1SW8A 4ZCUA 1R2UA 2HQWA 2LV7A 4OR9B 1LA3A 3EK4A 3BJHA 3SG2A 2M0RA 1DMOA 2LHIA 1S3PA 1L2OB 3CABA 4NDBA 2KAYA 2CCMA 4CFQA 1QVIY 1AP4A 1ZMZA 1Z2CB 4M2PA 1P28A 2KAXA 2ZNEA 2TN4A 2M49B 1JF0A 2KFFA 3AAJA 1DJZA 1QLSA 2F8PA 5BPJA 4NDCA 3PM8A 3KF9A 1JSAA 5JJGA 1B4CA 2KI6C 1B7TY 1IG5A 3DVMA 5FYXA 3LCPC 1SL9A 1C3YA 2M29A 3CS1A 1RFJA 1V1GA 2K2FA 5FI6A 2KI6D 1S6IA 1K90D 3TZ1A 2YGUA 2KQ6A 4MVFA 3I5HC 2WCFA 3S0DA 2PYQA 3TUYB 1K8UA 3AKAA 4L9MA 1KWOB 1RTP1 3OX5A 5KU1A 2WCKA 1AK8A 2WCHA 2M9GA 4IL1A 1BF5A 2FJYA 3BUOB 2AUCA 3ICBA 1CFFA 4CFRA 2CBLA 2H61A 1MHOA 1DC1A 1CM1A 1NIWA 2KFHA 2KQYA 1F71A 1SL7A 4OCIA 3SS3A 2RGIA 4ORBB 2OTGB 1RECA 4GGFA 3KEVA 2JNXA 2O60A 3WHUB 1A29A 2E30A 1N2DA 3WNXB 1F70A 2NLNA 2ZN8A 5CSFA 1PRWA 1TWOA 2BE4A 2LUCA 3I5IB 3NXAA 1KCYA 2L0PA 1FI6A 1XFXO 1BR1B 2I94A 1KQVA 2F3ZA 2JC2A 2KAVA 1EG3A 1QV0A 2JZIA 3CLNA 2EC6B 3CR4X 3K21A 3PALA 5I2LA 4F0ZB 1M45A 1H8BA 1A4PA 1Y6WA 2HQ8A 2PMYA 1OOHA 4WQ3A 4C0JA 2PALA 3O2PA 1W7IB 2M97A 3VGOA 1C07A 1SK6D 4XJKA 1NP8A 1ZACA 3LK0A 2KHNA 2MRDA 3D0YA 1YX8A 1K9UA 3PJIA 4ETOA 1CFCA 1IWQA 2JTTA 2KSPA 3GK2A 3ZNIA 1TRFA 1V1FA 4OVNF 4C0KA 1UHJA 2R2IA 5K89A 2K2AA 1QX7A 4Q04A 5I2QA 1N0YA 2I2RE 3SG6A 5HKWA 2L51A 1NX3A 1YVHA 3DVKA 3TDIA 2KBMA 3RM1A 3TS5C 2KDHA 1LKJA 2K61A 2SASA 2LM5A 4CPVA 3BOWB 4FTGA 4OZDA 3LLEA 2LVKA 2FOTA 1DJWA 3DVEA 2NZ0A 1KK7Y 1XK4C 1TTXA 2K7CA 3EKHA 3L4LA 2ZRSA 4AQJA 5DICA 2FCDA 4HRHA 1OOGA 1KFXS 1DJXA 3R1PA 1F4OA 1LXFC 1MXEA 1KK8C 4ZCVA 4GNKB 1B47A 1SCVA 2KLEA 2WORA 1PVBA 1JWDA 2GGMA 4MSPA 1CFPA 3FWCA 2LAPA 1JC2A 3D73A 2E6WA 3JVTC 1OOFA 1BJFA 2WCJA 2SCPA 4N5XA 3A4UB 3DXLA 2KGBC 3D78A 3DVJA 2ZRTA 3HCMA 3KPXA 4HRGA 1K96A 5B8IB 1FBVA 1KSOA 2WCMA 2I7AA 1MWNA 2MBXA 2BECA 3VRRA 2KFGA 4ORCB 1S6JA 2BAPA 2NCOA 1XYDA 2L50A 4GPLB 1IQ3A 4D1EA 2A4JA 1UWOA 1SRAA 2GV5A 3CR2A 2Y1MA 1DF0B 1QV1A 1CLLA 1U5IB 4AOMA 2PVBA 1RWYA 1NCYA 3SS5A 2JU0A 5DKNA 3CR5X 1SR6B 2AMIA 1B7TZ 1TCOB 1YX7A 5CSNA 1PALA 1NPQA 3A8RA 2QEHA 2L4HA 2K7OA 3PN7B 1J55A 2WC5A 1SCMC 2B1UA 1DJYA 3O78A 3HX4A 2KLDA 2QPTA 1Q80A 2GTEA 1XFUO 3Q8IA 2V53A 4N1GA 2JTZA 4NDDA 3RZSA 3R1OA 1TN4A 4MRYA 2WCEA 3FIAA 3PATA 1M63B 4ICBA 3MSEB 4YBHB 3NSKA 3BUMB 1YRTB 2OS8C 3CZ1A 4AQIA 1BOCA 1OMRA 3FWBA 3NHIA 1K93D 3WHTB 1GGZA 1BLQA 1IRJA 1G4YR 1E8AA 1LA0A 2H8VA 1DQEA 2H61C 1QWVA 2NXQA 1IGVA 3CYZA 5HL1A 1WRLA 2MLFC 1SKTA 1W9ZA 4YRUA 3FE6A 1QLKA 3CZ2A 4GGFC 1RK9A 1S26D 2KBIA 1KFUL 3PLFB 3FE8A 5TNCA 3DF0B 3O4XA 1XFZO 1C7WA 2D8NA 2LC5A 3NSLA 2JQ6A 2LANA 1KQMC 2VRGA 4YGAA 2KI4B 4MZJA 3LL8B 3KHEA 4PT1A 1KK8B 1R6PA 2BNXA 5JOLA 1X02A 2BL0B 3EVUA 4CLNA 3GOFA 2LLUA 1TOPA 2BBNA 4A4BA 1DT7B 1M31A 1IQ5A 3F45A 2IS9A 1XO5A 3JVTB 2BCBA 3RLZA 2WC8A 5I94A 3S0FA 1K2HA 2L2EA 4PHMA 5DKRA 2Y1NA 1GJYA 4MBEA 2QACA 3OP0A 2BKIB 1KK7Z 2K7DA 1BG1A 1JUOA 1ZUZA 1OMDA 2JWWA 2K0JA 2MJWB 1PSRA 1WDCC 2CTNA 3VRNA 1BU3A 3BFHA 3FE9A 3SS4A 1YR5A 1GM0A 2MHHA 1SSEB 4INXA 1MUXA 3I5FB 3UO9A 3IVTA 2EHBA 1XFWO 1TNXA 1WRKA 1JFJA 3SG7A 1FF1A 3PSRA 1S5GY 5DKQA 5FI7A 1IIOA 2NCPA 2JNFA 3I5GC 1CDNA 2ISDA 3BUXB 1MQ1A 1SCMB 1CTRA 1QX2A 4YGDB 4CIDA 1JFKA 1DELA 1YTZC 1OE9B 1FW4A 1A2XA 1HT9A 2WNDA 3JTDC 1AJ5A 3BFBA 3EG5B 3DZTA 3B7AA 1XVJA 3B88A 3SG3A 1CM4A 2G2BA 2MA2A 1OSAA 2WCLA 4WRIA 1QIVA 4I5JA 1XA5A 5KTYA 1U5IA 4PE4A 3O6BA 3EVRA 5F6TA 2OPOA 2JXLA 1B8RA 1EG4A 3QRXA 4HREE 5HLOA 3OB2B 2LHLA 1CDMA 3AKBA 3S0GA 4PALA 1YUUA 3CTNA 1IJ6A 1K94A 4MZKA 5HLVA 2G9BA 4DS7A 1YURA 1SPYA 1MXLC 2LMVA 3PM2A 1QXPA 2QEVA 3EVVA 4YI8A 1XFRA 2QEBA 1IJ5A 4INWA 4DUQA 2Y5IA 1DGVA 2L2CA 2CNPA 5ER5A 4PHNA 1UHIA 1RROA 2LNKA 3OX6A 4MZLA 3I5HB 4MEWA 1QVIZ 3NSOA 4ORAB 1CNPA 3EK8A 1QATA 3OGNA 3AAKA 3R72A 3VROA 2QEOA 1YUTA 4JKTA 2JXCA 4OV2A 1WLMA 1D1OA 2COLB 1CLBA 1KWOC 4GBAA 2LVIA 1KFXL 2BCXA 3CZ0A 5EL2A 1EH2A 3CGAA 1NX1A 4XJKB 4QJ5B 1M39A 5KSZA 3BFAA 2ZNDA 2JOJA 3DY9A 1MF8B 3GK4X 5AFPA 1C7VA 1YUSA 2DOQA 4QJ3B 1Y1UA 1B8LA 2BCAA 2OTGC 1PVAA 2HF5A 1WDCB 1TNWA 4R1EA 1PK0D 1BR4B
chains in the Genus database with same CATH topology
2LVJA 1TCFA 3DF0A 3SIAA 1HQVA 1NWDA 2Q4UA 2LCPA 4YGCB 3OB1B 1XFYO 1L7ZA 1Y1AA 2KGRA 3TDZA 3IQOA 2KOTA 2LP3A 2CT9A 1CMGA 1YVLA 1S1EA 4OKHA 1IH0A 1A75B 2EC6C 4PHJA 4GGNA 5HKZA 1XFVO 1S36A 1F55A 4P5OE 3I5GB 2AAOA 2LLSA 1DJIA 1B1GA 4GAOA 4USLA 1OMVA 1NYAA 1NSHA 4DIRA 1OOJA 2F2OA 3M0WA 1CDLA 1RJVA 2KNEA 5CSJA 5ER4X 1UUSA 1F54A 1ODBA 3TS5B 2LMUA 4MN0A 1FI5A 5AERA 1QX5B 1J7OA 1SL8A 3TDUA 1S5GZ 2LE9B 1ZFSA 5D7FA 5I8NA 5J3XA 2JULA 4PCWA 4U8DA 1AJ4A 4GUKA 4XYNA 3EKJA 1EXRA 2MAZA 2EGDA 2WOSA 3E3RA 4MRXA 3IQQA 1SNLA 2JPTA 4WQ2A 1JF2A 1QJTA 2BBMA 1PSBA 1UHKA 2HPSA 4PE7A 2M7NA 4I5KA 1OQPA 5GQQC 3H4SE 5D69A 2LUXA 1F8HA 1WY9A 4BY4A 2LP2A 2M8UA 1EL4A 4BY5A 2BKHB 2Q91A 4A4CA 1AUIB 2P6BB 1M46A 3CWGA 4JWQA 3BOWA 4N1FA 1J7RA 3PFVA 3SIBA 1FPWA 2O5GA 1TIZA 1GGWA 5IBWA 2F33A 2FJUB 2JRFA 2KYFA 4E68A 4M2QA 3WXAA 2FCEA 4YGBB 4DRWA 1QIWA 3SG4A 3IF7A 3OHMB 1J7PA 4NQGA 4MLWA 1ZOTB 2F2PA 1DVIA 4UPGA 2CXJA 4PE1A 5CSIA 1WRZA 3NSIA 1CDPA 4JPZB 1Y0VH 2M1UA 4GFTA 5AEQA 3BYAA 3KO0A 1SR6C 2Y4QA 4YGEB 4HSZA 1SY9A 4M2OA 4PHKA 4PDZA 3CZTX 3PN7C 1QASA 1EJ3A 5HKYA 1B9AA 3BQ3A 3FS7A 2LLTA 1ALWA 1G8IA 1UHNA 1OZOA 2WCBA 2GGZA 1CFDA 1OZSA 1A03A 4P2YB 2I18A 1DF0A 1UURA 1BMOA 2OS8B 2M7LA 1Y1XA 5HYDA 1YRUB 2LMTA 1L2OC 4JQ0D 3BUNB 2ZFDA 3DD4A 2L98A 2PASA 1WLZA 4DCKA 1W7JB 1J1EA 2JT3A 2L4IA 5CPVA 1TNPA 4TNCA 1GQMA 1DTLA 1SYMA 1A75A 1S6CA 1QS7A 1TNQA 3SJSA 1KQMB 3D10A 1N65A 1AVSA 3VRQA 1NUBA 4PE0A 5AANA 3BUWB 3TUYC 2KI4C 2MLEC 4I5NB 2L5XB 2BL0C 2ZKMX 3EK7A 3BXKA 1J7QA 1NCZA 2K7BA 1G33A 2M1KB 1J1DA 1JBAA 2PRUA 3D0YB 3VRPA 4YI9A 4C0LA 2PSRA 1SBJA 1CLMA 5AXIA 1CMFA 3ZWHA 1NCXA 1F4QA 2K8MB 1XK4A 1MR8A 2LVVA 2KYCA 4FQOA 2JT8A 3SG5A 3I5IC 1K9PA 2ZN9A 1UP5A 1K95A 4QJ4B 1DJGA 1BODA 3I5FC 5G08A 1ALVA 4I5LB 1CKKA 1DJHA 1DGUA 3C1VA 2M3WA 3GK1A 2JT0A 1AHRA 3LK1A 3O4YA 1BT6A 2HETA 1LVCD 1QTXA 5I2OA 1KSMA 2H2KA 3JTDB 1NX0A 1UHHA 1NX2A 1LINA 1SMGA 1H4BA 5PALA 1PULA 1K9KA 1B8CA 1CB1A 1VRKA 2F3YA 2BE6A 1IKUA 1KFUS 1SW8A 4ZCUA 1R2UA 2HQWA 2LV7A 4OR9B 1LA3A 3EK4A 3SG2A 1DMOA 2M0RA 2LHIA 1S3PA 1L2OB 4NDBA 2KAYA 2CCMA 4CFQA 1QVIY 1AP4A 1ZMZA 4M2PA 2KAXA 2ZNEA 2TN4A 2M49B 1JF0A 2KFFA 3AAJA 1DJZA 1QLSA 2F8PA 5BPJA 4NDCA 3PM8A 3KF9A 1JSAA 5JJGA 1B4CA 2KI6C 1B7TY 1IG5A 3DVMA 5FYXA 3LCPC 1SL9A 2M29A 3CS1A 1RFJA 1V1GA 2K2FA 2KI6D 1S6IA 1K90D 3TZ1A 4MVFA 2KQ6A 3I5HC 2WCFA 3TUYB 1K8UA 3AKAA 4L9MA 1KWOB 1RTP1 3OX5A 5KU1A 1AK8A 2M9GA 4IL1A 1BF5A 3BUOB 2AUCA 3ICBA 1CFFA 4CFRA 2CBLA 2H61A 1MHOA 1CM1A 1NIWA 2KFHA 2KQYA 1F71A 1SL7A 4OCIA 2RGIA 4ORBB 2OTGB 1RECA 4GGFA 3KEVA 2JNXA 2O60A 3WHUB 1A29A 2E30A 1N2DA 3WNXB 1F70A 2NLNA 2ZN8A 5CSFA 1PRWA 2BE4A 2LUCA 3I5IB 3NXAA 1KCYA 2L0PA 1FI6A 1XFXO 1BR1B 2I94A 1KQVA 2F3ZA 2JC2A 2KAVA 1EG3A 1QV0A 2JZIA 3CLNA 2EC6B 3CR4X 3K21A 3PALA 5I2LA 4F0ZB 1M45A 1H8BA 1A4PA 1Y6WA 2HQ8A 2PMYA 4WQ3A 4C0JA 2PALA 3O2PA 1W7IB 2M97A 3VGOA 1C07A 1SK6D 4XJKA 1NP8A 1ZACA 3LK0A 2KHNA 2MRDA 3D0YA 1YX8A 1K9UA 4ETOA 1CFCA 1IWQA 2JTTA 2KSPA 3GK2A 3ZNIA 1TRFA 1V1FA 4OVNF 4C0KA 1UHJA 2R2IA 5K89A 2K2AA 1QX7A 4Q04A 5I2QA 1N0YA 2I2RE 3SG6A 5HKWA 2L51A 1NX3A 1YVHA 3DVKA 3TDIA 2KBMA 3RM1A 3TS5C 2KDHA 1LKJA 2K61A 2SASA 2LM5A 4CPVA 3BOWB 4FTGA 3LLEA 2LVKA 2FOTA 1DJWA 3DVEA 2NZ0A 1KK7Y 1XK4C 1TTXA 2K7CA 3EKHA 2ZRSA 4AQJA 2FCDA 4HRHA 1KFXS 1DJXA 1F4OA 1LXFC 1MXEA 1KK8C 4ZCVA 4GNKB 1B47A 1SCVA 2WORA 1PVBA 1JWDA 2GGMA 4MSPA 1CFPA 3FWCA 2LAPA 1JC2A 2E6WA 3JVTC 1BJFA 4N5XA 2SCPA 3A4UB 2KGBC 3DVJA 2ZRTA 3HCMA 3KPXA 4HRGA 1K96A 5B8IB 1FBVA 1KSOA 2I7AA 1MWNA 2MBXA 2BECA 3VRRA 2KFGA 4ORCB 1S6JA 2NCOA 1XYDA 2L50A 4GPLB 1IQ3A 4D1EA 2A4JA 1UWOA 1SRAA 2GV5A 3CR2A 2Y1MA 1DF0B 1QV1A 1CLLA 1U5IB 4AOMA 2PVBA 1RWYA 1NCYA 2JU0A 5DKNA 3CR5X 1SR6B 2AMIA 1B7TZ 1TCOB 1YX7A 5CSNA 1PALA 1NPQA 3A8RA 2L4HA 2K7OA 3PN7B 1J55A 1SCMC 2B1UA 1DJYA 3O78A 3HX4A 2QPTA 1Q80A 1XFUO 2V53A 4N1GA 2JTZA 4NDDA 1TN4A 4MRYA 2WCEA 3FIAA 3PATA 1M63B 4ICBA 3MSEB 4YBHB 3NSKA 3BUMB 1YRTB 2OS8C 4AQIA 1BOCA 1OMRA 3FWBA 1K93D 3WHTB 1GGZA 1BLQA 1IRJA 1G4YR 1E8AA 1LA0A 2H61C 2NXQA 1IGVA 1WRLA 2MLFC 1SKTA 4YRUA 1QLKA 4GGFC 1RK9A 1S26D 2KBIA 1KFUL 3PLFB 5TNCA 3DF0B 1XFZO 1C7WA 2D8NA 2LC5A 3NSLA 2JQ6A 2LANA 1KQMC 2VRGA 4YGAA 2KI4B 4MZJA 3LL8B 3KHEA 1KK8B 1R6PA 5JOLA 1X02A 2BL0B 3EVUA 4CLNA 3GOFA 2LLUA 1TOPA 2BBNA 4A4BA 1DT7B 1M31A 1IQ5A 3F45A 2IS9A 1XO5A 3JVTB 2BCBA 3RLZA 2WC8A 1K2HA 2L2EA 4PHMA 5DKRA 2Y1NA 1GJYA 4MBEA 2QACA 3OP0A 2BKIB 1KK7Z 2K7DA 1BG1A 1JUOA 1ZUZA 1OMDA 2JWWA 2K0JA 2MJWB 1PSRA 1WDCC 2CTNA 3VRNA 1BU3A 1YR5A 2MHHA 1MUXA 3I5FB 2EHBA 1XFWO 1TNXA 1WRKA 1JFJA 3SG7A 1FF1A 3PSRA 1S5GY 5DKQA 2NCPA 2JNFA 3I5GC 1CDNA 2ISDA 3BUXB 1MQ1A 1SCMB 1CTRA 1QX2A 4YGDB 4CIDA 1JFKA 1YTZC 1OE9B 1A2XA 1FW4A 1HT9A 2WNDA 3JTDC 1AJ5A 1XVJA 3SG3A 1CM4A 2G2BA 2MA2A 1OSAA 4WRIA 1QIVA 4I5JA 1XA5A 5KTYA 1U5IA 4PE4A 3O6BA 3EVRA 5F6TA 2OPOA 2JXLA 1B8RA 1EG4A 3QRXA 4HREE 5HLOA 3OB2B 2LHLA 1CDMA 3AKBA 4PALA 1YUUA 3CTNA 1IJ6A 1K94A 4MZKA 5HLVA 2G9BA 4DS7A 1YURA 1SPYA 1MXLC 2LMVA 1QXPA 3EVVA 4YI8A 1IJ5A 4DUQA 2Y5IA 1DGVA 2CNPA 5ER5A 4PHNA 1UHIA 1RROA 2LNKA 3OX6A 4MZLA 3I5HB 4MEWA 1QVIZ 3NSOA 4ORAB 1CNPA 3EK8A 1QATA 3AAKA 3VROA 1YUTA 2JXCA 4OV2A 1WLMA 1D1OA 2COLB 1CLBA 1KWOC 4GBAA 2LVIA 1KFXL 2BCXA 1EH2A 3CGAA 1NX1A 4XJKB 4QJ5B 1M39A 5KSZA 2ZNDA 2JOJA 3GK4X 1MF8B 5AFPA 1C7VA 1YUSA 2DOQA 4QJ3B 1Y1UA 1B8LA 2BCAA 2OTGC 1PVAA 2HF5A 1WDCB 1TNWA 4R1EA 1PK0D 1BR4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LVJ A;  1TCF A;  3DF0 A;  3SIA A;  1HQV A;  1NWD A;  2Q4U A;  2LCP A;  4YGC B;  3OB1 B;  1XFY O;  1L7Z A;  1Y1A A;  2KGR A;  3TDZ A;  3IQO A;  2KOT A;  2LP3 A;  2CT9 A;  1CMG A;  1YVL A;  1S1E A;  4OKH A;  1IH0 A;  1A75 B;  2EC6 C;  4PHJ A;  4GGN A;  5HKZ A;  1XFV O;  1S36 A;  1F55 A;  4P5O E;  3I5G B;  2AAO A;  2LLS A;  1DJI A;  1B1G A;  4GAO A;  4USL A;  1OMV A;  1NYA A;  1NSH A;  4DIR A;  1OOJ A;  2F2O A;  3M0W A;  1CDL A;  1RJV A;  2KNE A;  5CSJ A;  5ER4 X;  1UUS A;  1F54 A;  1ODB A;  3TS5 B;  2LMU A;  4MN0 A;  1FI5 A;  5AER A;  1QX5 B;  1J7O A;  1SL8 A;  3TDU A;  1S5G Z;  2LE9 B;  1ZFS A;  5D7F A;  5I8N A;  5J3X A;  2JUL A;  4PCW A;  4U8D A;  1AJ4 A;  4GUK A;  4XYN A;  3EKJ A;  1EXR A;  2MAZ A;  2EGD A;  2WOS A;  3E3R A;  4MRX A;  3IQQ A;  1SNL A;  2JPT A;  4WQ2 A;  1JF2 A;  1QJT A;  2BBM A;  1PSB A;  1UHK A;  2HPS A;  4PE7 A;  2M7N A;  4I5K A;  1OQP A;  5GQQ C;  3H4S E;  5D69 A;  2LUX A;  1F8H A;  1WY9 A;  4BY4 A;  2LP2 A;  2M8U A;  1EL4 A;  4BY5 A;  2BKH B;  2Q91 A;  4A4C A;  1AUI B;  2P6B B;  1M46 A;  3CWG A;  4JWQ A;  3BOW A;  4N1F A;  1J7R A;  3PFV A;  3SIB A;  1FPW A;  2O5G A;  1TIZ A;  1GGW A;  5IBW A;  2F33 A;  2FJU B;  2JRF A;  2KYF A;  4E68 A;  4M2Q A;  3WXA A;  2FCE A;  4YGB B;  4DRW A;  1QIW A;  3SG4 A;  3IF7 A;  3OHM B;  1J7P A;  4NQG A;  4MLW A;  1ZOT B;  2F2P A;  1DVI A;  4UPG A;  2CXJ A;  4PE1 A;  5CSI A;  1WRZ A;  3NSI A;  1CDP A;  4JPZ B;  1Y0V H;  2M1U A;  4GFT A;  5AEQ A;  3BYA A;  3KO0 A;  1SR6 C;  2Y4Q A;  4YGE B;  4HSZ A;  1SY9 A;  4M2O A;  4PHK A;  4PDZ A;  3CZT X;  3PN7 C;  1QAS A;  1EJ3 A;  5HKY A;  1B9A A;  3BQ3 A;  3FS7 A;  2LLT A;  1ALW A;  1G8I A;  1UHN A;  1OZO A;  2WCB A;  2GGZ A;  1CFD A;  1OZS A;  1A03 A;  4P2Y B;  2I18 A;  1DF0 A;  1UUR A;  1BMO A;  2OS8 B;  2M7L A;  1Y1X A;  5HYD A;  1YRU B;  2LMT A;  1L2O C;  4JQ0 D;  3BUN B;  2ZFD A;  3DD4 A;  2L98 A;  2PAS A;  1WLZ A;  4DCK A;  1W7J B;  1J1E A;  2JT3 A;  2L4I A;  5CPV A;  1TNP A;  4TNC A;  1GQM A;  1DTL A;  1SYM A;  1A75 A;  1S6C A;  1QS7 A;  1TNQ A;  3SJS A;  1KQM B;  3D10 A;  1N65 A;  1AVS A;  3VRQ A;  1NUB A;  4PE0 A;  5AAN A;  3BUW B;  3TUY C;  2KI4 C;  2MLE C;  4I5N B;  2L5X B;  2BL0 C;  2ZKM X;  3EK7 A;  3BXK A;  1J7Q A;  1NCZ A;  2K7B A;  1G33 A;  2M1K B;  1J1D A;  1JBA A;  2PRU A;  3D0Y B;  3VRP A;  4YI9 A;  4C0L A;  2PSR A;  1SBJ A;  1CLM A;  5AXI A;  1CMF A;  3ZWH A;  1NCX A;  1F4Q A;  2K8M B;  1XK4 A;  1MR8 A;  2LVV A;  2KYC A;  4FQO A;  2JT8 A;  3SG5 A;  3I5I C;  1K9P A;  2ZN9 A;  1UP5 A;  1K95 A;  4QJ4 B;  1DJG A;  1BOD A;  3I5F C;  5G08 A;  1ALV A;  4I5L B;  1CKK A;  1DJH A;  1DGU A;  3C1V A;  2M3W A;  3GK1 A;  2JT0 A;  1AHR A;  3LK1 A;  3O4Y A;  1BT6 A;  2HET A;  1LVC D;  1QTX A;  5I2O A;  1KSM A;  2H2K A;  3JTD B;  1NX0 A;  1UHH A;  1NX2 A;  1LIN A;  1SMG A;  1H4B A;  5PAL A;  1PUL A;  1K9K A;  1B8C A;  1CB1 A;  1VRK A;  2F3Y A;  2BE6 A;  1IKU A;  1KFU S;  1SW8 A;  4ZCU A;  1R2U A;  2HQW A;  2LV7 A;  4OR9 B;  1LA3 A;  3EK4 A;  3SG2 A;  1DMO A;  2M0R A;  2LHI A;  1S3P A;  1L2O B;  4NDB A;  2KAY A;  2CCM A;  4CFQ A;  1QVI Y;  1AP4 A;  1ZMZ A;  4M2P A;  2KAX A;  2ZNE A;  2TN4 A;  2M49 B;  1JF0 A;  2KFF A;  3AAJ A;  1DJZ A;  1QLS A;  2F8P A;  5BPJ A;  4NDC A;  3PM8 A;  3KF9 A;  1JSA A;  5JJG A;  1B4C A;  2KI6 C;  1B7T Y;  1IG5 A;  3DVM A;  5FYX A;  3LCP C;  1SL9 A;  2M29 A;  3CS1 A;  1RFJ A;  1V1G A;  2K2F A;  2KI6 D;  1S6I A;  1K90 D;  3TZ1 A;  4MVF A;  2KQ6 A;  3I5H C;  2WCF A;  3TUY B;  1K8U A;  3AKA A;  4L9M A;  1KWO B;  1RTP 1;  3OX5 A;  5KU1 A;  1AK8 A;  2M9G A;  4IL1 A;  1BF5 A;  3BUO B;  2AUC A;  3ICB A;  1CFF A;  4CFR A;  2CBL A;  2H61 A;  1MHO A;  1CM1 A;  1NIW A;  2KFH A;  2KQY A;  1F71 A;  1SL7 A;  4OCI A;  2RGI A;  4ORB B;  2OTG B;  1REC A;  4GGF A;  3KEV A;  2JNX A;  2O60 A;  3WHU B;  1A29 A;  2E30 A;  1N2D A;  3WNX B;  1F70 A;  2NLN A;  2ZN8 A;  5CSF A;  1PRW A;  2BE4 A;  2LUC A;  3I5I B;  3NXA A;  1KCY A;  2L0P A;  1FI6 A;  1XFX O;  1BR1 B;  2I94 A;  1KQV A;  2F3Z A;  2JC2 A;  2KAV A;  1EG3 A;  1QV0 A;  2JZI A;  3CLN A;  2EC6 B;  3CR4 X;  3K21 A;  3PAL A;  5I2L A;  4F0Z B;  1M45 A;  1H8B A;  1A4P A;  1Y6W A;  2HQ8 A;  2PMY A;  4WQ3 A;  4C0J A;  2PAL A;  3O2P A;  1W7I B;  2M97 A;  3VGO A;  1C07 A;  1SK6 D;  4XJK A;  1NP8 A;  1ZAC A;  3LK0 A;  2KHN A;  2MRD A;  3D0Y A;  1YX8 A;  1K9U A;  4ETO A;  1CFC A;  1IWQ A;  2JTT A;  2KSP A;  3GK2 A;  3ZNI A;  1TRF A;  1V1F A;  4OVN F;  4C0K A;  1UHJ A;  2R2I A;  5K89 A;  2K2A A;  1QX7 A;  4Q04 A;  5I2Q A;  1N0Y A;  2I2R E;  3SG6 A;  5HKW A;  2L51 A;  1NX3 A;  1YVH A;  3DVK A;  3TDI A;  2KBM A;  3RM1 A;  3TS5 C;  2KDH A;  1LKJ A;  2K61 A;  2SAS A;  2LM5 A;  4CPV A;  3BOW B;  4FTG A;  3LLE A;  2LVK A;  2FOT A;  1DJW A;  3DVE A;  2NZ0 A;  1KK7 Y;  1XK4 C;  1TTX A;  2K7C A;  3EKH A;  2ZRS A;  4AQJ A;  2FCD A;  4HRH A;  1KFX S;  1DJX A;  1F4O A;  1LXF C;  1MXE A;  1KK8 C;  4ZCV A;  4GNK B;  1B47 A;  1SCV A;  2WOR A;  1PVB A;  1JWD A;  2GGM A;  4MSP A;  1CFP A;  3FWC A;  2LAP A;  1JC2 A;  2E6W A;  3JVT C;  1BJF A;  4N5X A;  2SCP A;  3A4U B;  2KGB C;  3DVJ A;  2ZRT A;  3HCM A;  3KPX A;  4HRG A;  1K96 A;  5B8I B;  1FBV A;  1KSO A;  2I7A A;  1MWN A;  2MBX A;  2BEC A;  3VRR A;  2KFG A;  4ORC B;  1S6J A;  2NCO A;  1XYD A;  2L50 A;  4GPL B;  1IQ3 A;  4D1E A;  2A4J A;  1UWO A;  1SRA A;  2GV5 A;  3CR2 A;  2Y1M A;  1DF0 B;  1QV1 A;  1CLL A;  1U5I B;  4AOM A;  2PVB A;  1RWY A;  1NCY A;  2JU0 A;  5DKN A;  3CR5 X;  1SR6 B;  2AMI A;  1B7T Z;  1TCO B;  1YX7 A;  5CSN A;  1PAL A;  1NPQ A;  3A8R A;  2L4H A;  2K7O A;  3PN7 B;  1J55 A;  1SCM C;  2B1U A;  1DJY A;  3O78 A;  3HX4 A;  2QPT A;  1Q80 A;  1XFU O;  2V53 A;  4N1G A;  2JTZ A;  4NDD A;  1TN4 A;  4MRY A;  2WCE A;  3FIA A;  3PAT A;  1M63 B;  4ICB A;  3MSE B;  4YBH B;  3NSK A;  3BUM B;  1YRT B;  2OS8 C;  4AQI A;  1BOC A;  1OMR A;  3FWB A;  1K93 D;  3WHT B;  1GGZ A;  1BLQ A;  1IRJ A;  1G4Y R;  1E8A A;  1LA0 A;  2H61 C;  2NXQ A;  1IGV A;  1WRL A;  2MLF C;  1SKT A;  4YRU A;  1QLK A;  4GGF C;  1RK9 A;  1S26 D;  2KBI A;  1KFU L;  3PLF B;  5TNC A;  3DF0 B;  1XFZ O;  1C7W A;  2D8N A;  2LC5 A;  3NSL A;  2JQ6 A;  2LAN A;  1KQM C;  2VRG A;  4YGA A;  2KI4 B;  4MZJ A;  3LL8 B;  3KHE A;  1KK8 B;  1R6P A;  5JOL A;  1X02 A;  2BL0 B;  3EVU A;  4CLN A;  3GOF A;  2LLU A;  1TOP A;  2BBN A;  4A4B A;  1DT7 B;  1M31 A;  1IQ5 A;  3F45 A;  2IS9 A;  1XO5 A;  3JVT B;  2BCB A;  3RLZ A;  2WC8 A;  1K2H A;  2L2E A;  4PHM A;  5DKR A;  2Y1N A;  1GJY A;  4MBE A;  2QAC A;  3OP0 A;  2BKI B;  1KK7 Z;  2K7D A;  1BG1 A;  1JUO A;  1ZUZ A;  1OMD A;  2JWW A;  2K0J A;  2MJW B;  1PSR A;  1WDC C;  2CTN A;  3VRN A;  1BU3 A;  1YR5 A;  2MHH A;  1MUX A;  3I5F B;  2EHB A;  1XFW O;  1TNX A;  1WRK A;  1JFJ A;  3SG7 A;  1FF1 A;  3PSR A;  1S5G Y;  5DKQ A;  2NCP A;  2JNF A;  3I5G C;  1CDN A;  2ISD A;  3BUX B;  1MQ1 A;  1SCM B;  1CTR A;  1QX2 A;  4YGD B;  4CID A;  1JFK A;  1YTZ C;  1OE9 B;  1A2X A;  1FW4 A;  1HT9 A;  2WND A;  3JTD C;  1AJ5 A;  1XVJ A;  3SG3 A;  1CM4 A;  2G2B A;  2MA2 A;  1OSA A;  4WRI A;  1QIV A;  4I5J A;  1XA5 A;  5KTY A;  1U5I A;  4PE4 A;  3O6B A;  3EVR A;  5F6T A;  2OPO A;  2JXL A;  1B8R A;  1EG4 A;  3QRX A;  4HRE E;  5HLO A;  3OB2 B;  2LHL A;  1CDM A;  3AKB A;  4PAL A;  1YUU A;  3CTN A;  1IJ6 A;  1K94 A;  4MZK A;  5HLV A;  2G9B A;  4DS7 A;  1YUR A;  1SPY A;  1MXL C;  2LMV A;  1QXP A;  3EVV A;  4YI8 A;  1IJ5 A;  4DUQ A;  2Y5I A;  1DGV A;  2CNP A;  5ER5 A;  4PHN A;  1UHI A;  1RRO A;  2LNK A;  3OX6 A;  4MZL A;  3I5H B;  4MEW A;  1QVI Z;  3NSO A;  4ORA B;  1CNP A;  3EK8 A;  1QAT A;  3AAK A;  3VRO A;  1YUT A;  2JXC A;  4OV2 A;  1WLM A;  1D1O A;  2COL B;  1CLB A;  1KWO C;  4GBA A;  2LVI A;  1KFX L;  2BCX A;  1EH2 A;  3CGA A;  1NX1 A;  4XJK B;  4QJ5 B;  1M39 A;  5KSZ A;  2ZND A;  2JOJ A;  3GK4 X;  1MF8 B;  5AFP A;  1C7V A;  1YUS A;  2DOQ A;  4QJ3 B;  1Y1U A;  1B8L A;  2BCA A;  2OTG C;  1PVA A;  2HF5 A;  1WDC B;  1TNW A;  4R1E A;  1PK0 D;  1BR4 B; 
#chains in the Genus database with same CATH topology
 2LVJ A;  1TCF A;  3DF0 A;  3SIA A;  1HQV A;  1NWD A;  2Q4U A;  2LCP A;  4YGC B;  3OB1 B;  1XFY O;  1L7Z A;  1Y1A A;  2KGR A;  2P70 A;  3TDZ A;  3IQO A;  2KOT A;  2LP3 A;  2CT9 A;  1CMG A;  1YVL A;  1S1E A;  4OKH A;  1IH0 A;  1A75 B;  2EC6 C;  4PHJ A;  4GGN A;  5HKZ A;  1XFV O;  1S36 A;  1F55 A;  4P5O E;  3I5G B;  3B86 A;  2AAO A;  2LLS A;  1DJI A;  1B1G A;  4GAO A;  4USL A;  3CDN A;  1OMV A;  1NYA A;  1NSH A;  4DIR A;  1OOJ A;  2F2O A;  3M0W A;  1CDL A;  1RJV A;  2KNE A;  5CSJ A;  5ER4 X;  3L47 A;  1UUS A;  1F54 A;  1ODB A;  3TS5 B;  1TUJ A;  2LMU A;  4MN0 A;  1FI5 A;  5AER A;  1QX5 B;  1J7O A;  1SL8 A;  3TDU A;  3QME A;  1S5G Z;  2LE9 B;  1ZFS A;  2K60 A;  5D7F A;  3S0E A;  5I8N A;  5J3X A;  2JUL A;  4PCW A;  4U8D A;  1AJ4 A;  4GUK A;  4F7F A;  4XYN A;  3EKJ A;  1EXR A;  2MAZ A;  2EGD A;  2WOS A;  3E3R A;  4MRX A;  3IQQ A;  1SNL A;  2JPT A;  3S0B A;  4WQ2 A;  1JF2 A;  3D76 A;  1QJT A;  2BBM A;  1PSB A;  1UHK A;  2HPS A;  4PE7 A;  2M7N A;  4I5K A;  1OQP A;  3NHT A;  5GQQ C;  3H4S E;  2L5Y A;  5D69 A;  2JPO A;  2LUX A;  1F8H A;  1WY9 A;  4BY4 A;  2LP2 A;  2M8U A;  1EL4 A;  4BY5 A;  2BKH B;  2Q91 A;  4A4C A;  1AUI B;  2P6B B;  1M46 A;  3CWG A;  4JWQ A;  2P71 A;  3BOW A;  5D3O A;  4N1F A;  2KPH A;  1J7R A;  3PFV A;  3SIB A;  1FPW A;  2O5G A;  1TIZ A;  1GGW A;  5IBW A;  2F33 A;  2FJU B;  2JRF A;  2KYF A;  4E68 A;  4M2Q A;  3WXA A;  2FCE A;  4YGB B;  4DRW A;  1QIW A;  1LS8 A;  3SG4 A;  3IF7 A;  3OHM B;  3R1V A;  3VB1 A;  4NQG A;  1J7P A;  4MLW A;  2WC6 A;  1ZOT B;  4KYN A;  2F2P A;  1DVI A;  4UPG A;  2CXJ A;  4PE1 A;  5CSI A;  1WRZ A;  3NSI A;  1CDP A;  4JPZ B;  1Y0V H;  2M1U A;  4GFT A;  5AEQ A;  3BYA A;  2PQL A;  3KO0 A;  1SR6 C;  1TUZ A;  2Y4Q A;  4YGE B;  4HSZ A;  1SY9 A;  4M2O A;  4PHK A;  4PDZ A;  3CZT X;  3PN7 C;  1QAS A;  1EJ3 A;  5HKY A;  1B9A A;  3V2L A;  3N7H A;  3BQ3 A;  3FS7 A;  2LLT A;  1ALW A;  1G8I A;  1UHN A;  1OZO A;  2WCB A;  2GGZ A;  1CFD A;  1OZS A;  3D75 A;  4P2Y B;  1A03 A;  2I18 A;  1DF0 A;  1UUR A;  1BMO A;  2OS8 B;  3DYE A;  2M7L A;  1Y1X A;  4JD9 A;  5HYD A;  4FQT A;  1YRU B;  2LMT A;  1L2O C;  4JQ0 D;  3BUN B;  1Z4H A;  2ZFD A;  3DD4 A;  3UNW A;  2L98 A;  2PAS A;  3K1E A;  1C3Z A;  1WLZ A;  4DCK A;  1W7J B;  1J1E A;  2JT3 A;  2L4I A;  3NGV A;  5CPV A;  1TNP A;  4TNC A;  1GQM A;  1DTL A;  1SYM A;  1A75 A;  3B6X A;  1S6C A;  1QS7 A;  1TNQ A;  3OBV A;  3SJS A;  1KQM B;  3D10 A;  1N65 A;  2ERB A;  1AVS A;  3VRQ A;  1NUB A;  1OOI X;  4PE0 A;  3BUW B;  5AAN A;  2KI4 C;  3S0A A;  3TUY C;  2MLE C;  4I5N B;  2L5X B;  3L4A A;  2BL0 C;  2ZKM X;  3EK7 A;  3BXK A;  1J7Q A;  1NCZ A;  3D77 A;  2K7B A;  1G33 A;  2M1K B;  1J1D A;  1JBA A;  2PRU A;  3D0Y B;  3VRP A;  4YI9 A;  4C0L A;  2PSR A;  1SBJ A;  1CLM A;  5FI2 A;  5AXI A;  1CMF A;  1OW4 A;  2QDI A;  3ZWH A;  1NCX A;  1F4Q A;  1DEK A;  2K8M B;  3D74 A;  1XK4 A;  1MR8 A;  2LVV A;  2KYC A;  4FQO A;  2JT8 A;  3SG5 A;  3I5I C;  1K9P A;  2ZN9 A;  3B87 A;  1UP5 A;  1T14 A;  1K95 A;  4QJ4 B;  1DJG A;  1BOD A;  3I5F C;  5G08 A;  1ALV A;  4I5L B;  1CKK A;  1DJH A;  1DGU A;  3C1V A;  2M3W A;  3GK1 A;  2JT0 A;  1AHR A;  3LK1 A;  3O4Y A;  1BT6 A;  2HET A;  1LVC D;  1QTX A;  5I2O A;  1KSM A;  2H2K A;  3JTD B;  1NX0 A;  1UHH A;  1NX2 A;  1LIN A;  1ORG A;  1SMG A;  4IJ7 A;  1H4B A;  5PAL A;  1PUL A;  1K9K A;  1B8C A;  1CB1 A;  1VRK A;  2F3Y A;  2BE6 A;  1IKU A;  1KFU S;  1SW8 A;  4ZCU A;  1R2U A;  2HQW A;  2LV7 A;  4OR9 B;  1LA3 A;  3EK4 A;  3BJH A;  3SG2 A;  2M0R A;  1DMO A;  2LHI A;  1S3P A;  1L2O B;  3CAB A;  4NDB A;  2KAY A;  2CCM A;  4CFQ A;  1QVI Y;  1AP4 A;  1ZMZ A;  1Z2C B;  4M2P A;  1P28 A;  2KAX A;  2ZNE A;  2TN4 A;  2M49 B;  1JF0 A;  2KFF A;  3AAJ A;  1DJZ A;  1QLS A;  2F8P A;  5BPJ A;  4NDC A;  3PM8 A;  3KF9 A;  1JSA A;  5JJG A;  1B4C A;  2KI6 C;  1B7T Y;  1IG5 A;  3DVM A;  5FYX A;  3LCP C;  1SL9 A;  1C3Y A;  2M29 A;  3CS1 A;  1RFJ A;  1V1G A;  2K2F A;  5FI6 A;  2KI6 D;  1S6I A;  1K90 D;  3TZ1 A;  2YGU A;  2KQ6 A;  4MVF A;  3I5H C;  2WCF A;  3S0D A;  2PYQ A;  3TUY B;  1K8U A;  3AKA A;  4L9M A;  1KWO B;  1RTP 1;  3OX5 A;  5KU1 A;  2WCK A;  1AK8 A;  2WCH A;  2M9G A;  4IL1 A;  1BF5 A;  2FJY A;  3BUO B;  2AUC A;  3ICB A;  1CFF A;  4CFR A;  2CBL A;  2H61 A;  1MHO A;  1DC1 A;  1CM1 A;  1NIW A;  2KFH A;  2KQY A;  1F71 A;  1SL7 A;  4OCI A;  3SS3 A;  2RGI A;  4ORB B;  2OTG B;  1REC A;  4GGF A;  3KEV A;  2JNX A;  2O60 A;  3WHU B;  1A29 A;  2E30 A;  1N2D A;  3WNX B;  1F70 A;  2NLN A;  2ZN8 A;  5CSF A;  1PRW A;  1TWO A;  2BE4 A;  2LUC A;  3I5I B;  3NXA A;  1KCY A;  2L0P A;  1FI6 A;  1XFX O;  1BR1 B;  2I94 A;  1KQV A;  2F3Z A;  2JC2 A;  2KAV A;  1EG3 A;  1QV0 A;  2JZI A;  3CLN A;  2EC6 B;  3CR4 X;  3K21 A;  3PAL A;  5I2L A;  4F0Z B;  1M45 A;  1H8B A;  1A4P A;  1Y6W A;  2HQ8 A;  2PMY A;  1OOH A;  4WQ3 A;  4C0J A;  2PAL A;  3O2P A;  1W7I B;  2M97 A;  3VGO A;  1C07 A;  1SK6 D;  4XJK A;  1NP8 A;  1ZAC A;  3LK0 A;  2KHN A;  2MRD A;  3D0Y A;  1YX8 A;  1K9U A;  3PJI A;  4ETO A;  1CFC A;  1IWQ A;  2JTT A;  2KSP A;  3GK2 A;  3ZNI A;  1TRF A;  1V1F A;  4OVN F;  4C0K A;  1UHJ A;  2R2I A;  5K89 A;  2K2A A;  1QX7 A;  4Q04 A;  5I2Q A;  1N0Y A;  2I2R E;  3SG6 A;  5HKW A;  2L51 A;  1NX3 A;  1YVH A;  3DVK A;  3TDI A;  2KBM A;  3RM1 A;  3TS5 C;  2KDH A;  1LKJ A;  2K61 A;  2SAS A;  2LM5 A;  4CPV A;  3BOW B;  4FTG A;  4OZD A;  3LLE A;  2LVK A;  2FOT A;  1DJW A;  3DVE A;  2NZ0 A;  1KK7 Y;  1XK4 C;  1TTX A;  2K7C A;  3EKH A;  3L4L A;  2ZRS A;  4AQJ A;  5DIC A;  2FCD A;  4HRH A;  1OOG A;  1KFX S;  1DJX A;  3R1P A;  1F4O A;  1LXF C;  1MXE A;  1KK8 C;  4ZCV A;  4GNK B;  1B47 A;  1SCV A;  2KLE A;  2WOR A;  1PVB A;  1JWD A;  2GGM A;  4MSP A;  1CFP A;  3FWC A;  2LAP A;  1JC2 A;  3D73 A;  2E6W A;  3JVT C;  1OOF A;  1BJF A;  2WCJ A;  2SCP A;  4N5X A;  3A4U B;  3DXL A;  2KGB C;  3D78 A;  3DVJ A;  2ZRT A;  3HCM A;  3KPX A;  4HRG A;  1K96 A;  5B8I B;  1FBV A;  1KSO A;  2WCM A;  2I7A A;  1MWN A;  2MBX A;  2BEC A;  3VRR A;  2KFG A;  4ORC B;  1S6J A;  2BAP A;  2NCO A;  1XYD A;  2L50 A;  4GPL B;  1IQ3 A;  4D1E A;  2A4J A;  1UWO A;  1SRA A;  2GV5 A;  3CR2 A;  2Y1M A;  1DF0 B;  1QV1 A;  1CLL A;  1U5I B;  4AOM A;  2PVB A;  1RWY A;  1NCY A;  3SS5 A;  2JU0 A;  5DKN A;  3CR5 X;  1SR6 B;  2AMI A;  1B7T Z;  1TCO B;  1YX7 A;  5CSN A;  1PAL A;  1NPQ A;  3A8R A;  2QEH A;  2L4H A;  2K7O A;  3PN7 B;  1J55 A;  2WC5 A;  1SCM C;  2B1U A;  1DJY A;  3O78 A;  3HX4 A;  2KLD A;  2QPT A;  1Q80 A;  2GTE A;  1XFU O;  3Q8I A;  2V53 A;  4N1G A;  2JTZ A;  4NDD A;  3RZS A;  3R1O A;  1TN4 A;  4MRY A;  2WCE A;  3FIA A;  3PAT A;  1M63 B;  4ICB A;  3MSE B;  4YBH B;  3NSK A;  3BUM B;  1YRT B;  2OS8 C;  3CZ1 A;  4AQI A;  1BOC A;  1OMR A;  3FWB A;  3NHI A;  1K93 D;  3WHT B;  1GGZ A;  1BLQ A;  1IRJ A;  1G4Y R;  1E8A A;  1LA0 A;  2H8V A;  1DQE A;  2H61 C;  1QWV A;  2NXQ A;  1IGV A;  3CYZ A;  5HL1 A;  1WRL A;  2MLF C;  1SKT A;  1W9Z A;  4YRU A;  3FE6 A;  1QLK A;  3CZ2 A;  4GGF C;  1RK9 A;  1S26 D;  2KBI A;  1KFU L;  3PLF B;  3FE8 A;  5TNC A;  3DF0 B;  3O4X A;  1XFZ O;  1C7W A;  2D8N A;  2LC5 A;  3NSL A;  2JQ6 A;  2LAN A;  1KQM C;  2VRG A;  4YGA A;  2KI4 B;  4MZJ A;  3LL8 B;  3KHE A;  4PT1 A;  1KK8 B;  1R6P A;  2BNX A;  5JOL A;  1X02 A;  2BL0 B;  3EVU A;  4CLN A;  3GOF A;  2LLU A;  1TOP A;  2BBN A;  4A4B A;  1DT7 B;  1M31 A;  1IQ5 A;  3F45 A;  2IS9 A;  1XO5 A;  3JVT B;  2BCB A;  3RLZ A;  2WC8 A;  5I94 A;  3S0F A;  1K2H A;  2L2E A;  4PHM A;  5DKR A;  2Y1N A;  1GJY A;  4MBE A;  2QAC A;  3OP0 A;  2BKI B;  1KK7 Z;  2K7D A;  1BG1 A;  1JUO A;  1ZUZ A;  1OMD A;  2JWW A;  2K0J A;  2MJW B;  1PSR A;  1WDC C;  2CTN A;  3VRN A;  1BU3 A;  3BFH A;  3FE9 A;  3SS4 A;  1YR5 A;  1GM0 A;  2MHH A;  1SSE B;  4INX A;  1MUX A;  3I5F B;  3UO9 A;  3IVT A;  2EHB A;  1XFW O;  1TNX A;  1WRK A;  1JFJ A;  3SG7 A;  1FF1 A;  3PSR A;  1S5G Y;  5DKQ A;  5FI7 A;  1IIO A;  2NCP A;  2JNF A;  3I5G C;  1CDN A;  2ISD A;  3BUX B;  1MQ1 A;  1SCM B;  1CTR A;  1QX2 A;  4YGD B;  4CID A;  1JFK A;  1DEL A;  1YTZ C;  1OE9 B;  1FW4 A;  1A2X A;  1HT9 A;  2WND A;  3JTD C;  1AJ5 A;  3BFB A;  3EG5 B;  3DZT A;  3B7A A;  1XVJ A;  3B88 A;  3SG3 A;  1CM4 A;  2G2B A;  2MA2 A;  1OSA A;  2WCL A;  4WRI A;  1QIV A;  4I5J A;  1XA5 A;  5KTY A;  1U5I A;  4PE4 A;  3O6B A;  3EVR A;  5F6T A;  2OPO A;  2JXL A;  1B8R A;  1EG4 A;  3QRX A;  4HRE E;  5HLO A;  3OB2 B;  2LHL A;  1CDM A;  3AKB A;  3S0G A;  4PAL A;  1YUU A;  3CTN A;  1IJ6 A;  1K94 A;  4MZK A;  5HLV A;  2G9B A;  4DS7 A;  1YUR A;  1SPY A;  1MXL C;  2LMV A;  3PM2 A;  1QXP A;  2QEV A;  3EVV A;  4YI8 A;  1XFR A;  2QEB A;  1IJ5 A;  4INW A;  4DUQ A;  2Y5I A;  1DGV A;  2L2C A;  2CNP A;  5ER5 A;  4PHN A;  1UHI A;  1RRO A;  2LNK A;  3OX6 A;  4MZL A;  3I5H B;  4MEW A;  1QVI Z;  3NSO A;  4ORA B;  1CNP A;  3EK8 A;  1QAT A;  3OGN A;  3AAK A;  3R72 A;  3VRO A;  2QEO A;  1YUT A;  4JKT A;  2JXC A;  4OV2 A;  1WLM A;  1D1O A;  2COL B;  1CLB A;  1KWO C;  4GBA A;  2LVI A;  1KFX L;  2BCX A;  3CZ0 A;  5EL2 A;  1EH2 A;  3CGA A;  1NX1 A;  4XJK B;  4QJ5 B;  1M39 A;  5KSZ A;  3BFA A;  2ZND A;  2JOJ A;  3DY9 A;  1MF8 B;  3GK4 X;  5AFP A;  1C7V A;  1YUS A;  2DOQ A;  4QJ3 B;  1Y1U A;  1B8L A;  2BCA A;  2OTG C;  1PVA A;  2HF5 A;  1WDC B;  1TNW A;  4R1E A;  1PK0 D;  1BR4 B; 
#chains in the Genus database with same CATH homology
 2LVJ A;  1TCF A;  3DF0 A;  3SIA A;  1HQV A;  1NWD A;  2Q4U A;  2LCP A;  4YGC B;  3OB1 B;  1XFY O;  1L7Z A;  1Y1A A;  2KGR A;  3TDZ A;  3IQO A;  2KOT A;  2LP3 A;  2CT9 A;  1CMG A;  1YVL A;  1S1E A;  4OKH A;  1IH0 A;  1A75 B;  2EC6 C;  4PHJ A;  4GGN A;  5HKZ A;  1XFV O;  1S36 A;  1F55 A;  4P5O E;  3I5G B;  2AAO A;  2LLS A;  1DJI A;  1B1G A;  4GAO A;  4USL A;  1OMV A;  1NYA A;  1NSH A;  4DIR A;  1OOJ A;  2F2O A;  3M0W A;  1CDL A;  1RJV A;  2KNE A;  5CSJ A;  5ER4 X;  1UUS A;  1F54 A;  1ODB A;  3TS5 B;  2LMU A;  4MN0 A;  1FI5 A;  5AER A;  1QX5 B;  1J7O A;  1SL8 A;  3TDU A;  1S5G Z;  2LE9 B;  1ZFS A;  5D7F A;  5I8N A;  5J3X A;  2JUL A;  4PCW A;  4U8D A;  1AJ4 A;  4GUK A;  4XYN A;  3EKJ A;  1EXR A;  2MAZ A;  2EGD A;  2WOS A;  3E3R A;  4MRX A;  3IQQ A;  1SNL A;  2JPT A;  4WQ2 A;  1JF2 A;  1QJT A;  2BBM A;  1PSB A;  1UHK A;  2HPS A;  4PE7 A;  2M7N A;  4I5K A;  1OQP A;  5GQQ C;  3H4S E;  5D69 A;  2LUX A;  1F8H A;  1WY9 A;  4BY4 A;  2LP2 A;  2M8U A;  1EL4 A;  4BY5 A;  2BKH B;  2Q91 A;  4A4C A;  1AUI B;  2P6B B;  1M46 A;  3CWG A;  4JWQ A;  3BOW A;  4N1F A;  1J7R A;  3PFV A;  3SIB A;  1FPW A;  2O5G A;  1TIZ A;  1GGW A;  5IBW A;  2F33 A;  2FJU B;  2JRF A;  2KYF A;  4E68 A;  4M2Q A;  3WXA A;  2FCE A;  4YGB B;  4DRW A;  1QIW A;  3SG4 A;  3IF7 A;  3OHM B;  1J7P A;  4NQG A;  4MLW A;  1ZOT B;  2F2P A;  1DVI A;  4UPG A;  2CXJ A;  4PE1 A;  5CSI A;  1WRZ A;  3NSI A;  1CDP A;  4JPZ B;  1Y0V H;  2M1U A;  4GFT A;  5AEQ A;  3BYA A;  3KO0 A;  1SR6 C;  2Y4Q A;  4YGE B;  4HSZ A;  1SY9 A;  4M2O A;  4PHK A;  4PDZ A;  3CZT X;  3PN7 C;  1QAS A;  1EJ3 A;  5HKY A;  1B9A A;  3BQ3 A;  3FS7 A;  2LLT A;  1ALW A;  1G8I A;  1UHN A;  1OZO A;  2WCB A;  2GGZ A;  1CFD A;  1OZS A;  1A03 A;  4P2Y B;  2I18 A;  1DF0 A;  1UUR A;  1BMO A;  2OS8 B;  2M7L A;  1Y1X A;  5HYD A;  1YRU B;  2LMT A;  1L2O C;  4JQ0 D;  3BUN B;  2ZFD A;  3DD4 A;  2L98 A;  2PAS A;  1WLZ A;  4DCK A;  1W7J B;  1J1E A;  2JT3 A;  2L4I A;  5CPV A;  1TNP A;  4TNC A;  1GQM A;  1DTL A;  1SYM A;  1A75 A;  1S6C A;  1QS7 A;  1TNQ A;  3SJS A;  1KQM B;  3D10 A;  1N65 A;  1AVS A;  3VRQ A;  1NUB A;  4PE0 A;  5AAN A;  3BUW B;  3TUY C;  2KI4 C;  2MLE C;  4I5N B;  2L5X B;  2BL0 C;  2ZKM X;  3EK7 A;  3BXK A;  1J7Q A;  1NCZ A;  2K7B A;  1G33 A;  2M1K B;  1J1D A;  1JBA A;  2PRU A;  3D0Y B;  3VRP A;  4YI9 A;  4C0L A;  2PSR A;  1SBJ A;  1CLM A;  5AXI A;  1CMF A;  3ZWH A;  1NCX A;  1F4Q A;  2K8M B;  1XK4 A;  1MR8 A;  2LVV A;  2KYC A;  4FQO A;  2JT8 A;  3SG5 A;  3I5I C;  1K9P A;  2ZN9 A;  1UP5 A;  1K95 A;  4QJ4 B;  1DJG A;  1BOD A;  3I5F C;  5G08 A;  1ALV A;  4I5L B;  1CKK A;  1DJH A;  1DGU A;  3C1V A;  2M3W A;  3GK1 A;  2JT0 A;  1AHR A;  3LK1 A;  3O4Y A;  1BT6 A;  2HET A;  1LVC D;  1QTX A;  5I2O A;  1KSM A;  2H2K A;  3JTD B;  1NX0 A;  1UHH A;  1NX2 A;  1LIN A;  1SMG A;  1H4B A;  5PAL A;  1PUL A;  1K9K A;  1B8C A;  1CB1 A;  1VRK A;  2F3Y A;  2BE6 A;  1IKU A;  1KFU S;  1SW8 A;  4ZCU A;  1R2U A;  2HQW A;  2LV7 A;  4OR9 B;  1LA3 A;  3EK4 A;  3SG2 A;  1DMO A;  2M0R A;  2LHI A;  1S3P A;  1L2O B;  4NDB A;  2KAY A;  2CCM A;  4CFQ A;  1QVI Y;  1AP4 A;  1ZMZ A;  4M2P A;  2KAX A;  2ZNE A;  2TN4 A;  2M49 B;  1JF0 A;  2KFF A;  3AAJ A;  1DJZ A;  1QLS A;  2F8P A;  5BPJ A;  4NDC A;  3PM8 A;  3KF9 A;  1JSA A;  5JJG A;  1B4C A;  2KI6 C;  1B7T Y;  1IG5 A;  3DVM A;  5FYX A;  3LCP C;  1SL9 A;  2M29 A;  3CS1 A;  1RFJ A;  1V1G A;  2K2F A;  2KI6 D;  1S6I A;  1K90 D;  3TZ1 A;  4MVF A;  2KQ6 A;  3I5H C;  2WCF A;  3TUY B;  1K8U A;  3AKA A;  4L9M A;  1KWO B;  1RTP 1;  3OX5 A;  5KU1 A;  1AK8 A;  2M9G A;  4IL1 A;  1BF5 A;  3BUO B;  2AUC A;  3ICB A;  1CFF A;  4CFR A;  2CBL A;  2H61 A;  1MHO A;  1CM1 A;  1NIW A;  2KFH A;  2KQY A;  1F71 A;  1SL7 A;  4OCI A;  2RGI A;  4ORB B;  2OTG B;  1REC A;  4GGF A;  3KEV A;  2JNX A;  2O60 A;  3WHU B;  1A29 A;  2E30 A;  1N2D A;  3WNX B;  1F70 A;  2NLN A;  2ZN8 A;  5CSF A;  1PRW A;  2BE4 A;  2LUC A;  3I5I B;  3NXA A;  1KCY A;  2L0P A;  1FI6 A;  1XFX O;  1BR1 B;  2I94 A;  1KQV A;  2F3Z A;  2JC2 A;  2KAV A;  1EG3 A;  1QV0 A;  2JZI A;  3CLN A;  2EC6 B;  3CR4 X;  3K21 A;  3PAL A;  5I2L A;  4F0Z B;  1M45 A;  1H8B A;  1A4P A;  1Y6W A;  2HQ8 A;  2PMY A;  4WQ3 A;  4C0J A;  2PAL A;  3O2P A;  1W7I B;  2M97 A;  3VGO A;  1C07 A;  1SK6 D;  4XJK A;  1NP8 A;  1ZAC A;  3LK0 A;  2KHN A;  2MRD A;  3D0Y A;  1YX8 A;  1K9U A;  4ETO A;  1CFC A;  1IWQ A;  2JTT A;  2KSP A;  3GK2 A;  3ZNI A;  1TRF A;  1V1F A;  4OVN F;  4C0K A;  1UHJ A;  2R2I A;  5K89 A;  2K2A A;  1QX7 A;  4Q04 A;  5I2Q A;  1N0Y A;  2I2R E;  3SG6 A;  5HKW A;  2L51 A;  1NX3 A;  1YVH A;  3DVK A;  3TDI A;  2KBM A;  3RM1 A;  3TS5 C;  2KDH A;  1LKJ A;  2K61 A;  2SAS A;  2LM5 A;  4CPV A;  3BOW B;  4FTG A;  3LLE A;  2LVK A;  2FOT A;  1DJW A;  3DVE A;  2NZ0 A;  1KK7 Y;  1XK4 C;  1TTX A;  2K7C A;  3EKH A;  2ZRS A;  4AQJ A;  2FCD A;  4HRH A;  1KFX S;  1DJX A;  1F4O A;  1LXF C;  1MXE A;  1KK8 C;  4ZCV A;  4GNK B;  1B47 A;  1SCV A;  2WOR A;  1PVB A;  1JWD A;  2GGM A;  4MSP A;  1CFP A;  3FWC A;  2LAP A;  1JC2 A;  2E6W A;  3JVT C;  1BJF A;  4N5X A;  2SCP A;  3A4U B;  2KGB C;  3DVJ A;  2ZRT A;  3HCM A;  3KPX A;  4HRG A;  1K96 A;  5B8I B;  1FBV A;  1KSO A;  2I7A A;  1MWN A;  2MBX A;  2BEC A;  3VRR A;  2KFG A;  4ORC B;  1S6J A;  2NCO A;  1XYD A;  2L50 A;  4GPL B;  1IQ3 A;  4D1E A;  2A4J A;  1UWO A;  1SRA A;  2GV5 A;  3CR2 A;  2Y1M A;  1DF0 B;  1QV1 A;  1CLL A;  1U5I B;  4AOM A;  2PVB A;  1RWY A;  1NCY A;  2JU0 A;  5DKN A;  3CR5 X;  1SR6 B;  2AMI A;  1B7T Z;  1TCO B;  1YX7 A;  5CSN A;  1PAL A;  1NPQ A;  3A8R A;  2L4H A;  2K7O A;  3PN7 B;  1J55 A;  1SCM C;  2B1U A;  1DJY A;  3O78 A;  3HX4 A;  2QPT A;  1Q80 A;  1XFU O;  2V53 A;  4N1G A;  2JTZ A;  4NDD A;  1TN4 A;  4MRY A;  2WCE A;  3FIA A;  3PAT A;  1M63 B;  4ICB A;  3MSE B;  4YBH B;  3NSK A;  3BUM B;  1YRT B;  2OS8 C;  4AQI A;  1BOC A;  1OMR A;  3FWB A;  1K93 D;  3WHT B;  1GGZ A;  1BLQ A;  1IRJ A;  1G4Y R;  1E8A A;  1LA0 A;  2H61 C;  2NXQ A;  1IGV A;  1WRL A;  2MLF C;  1SKT A;  4YRU A;  1QLK A;  4GGF C;  1RK9 A;  1S26 D;  2KBI A;  1KFU L;  3PLF B;  5TNC A;  3DF0 B;  1XFZ O;  1C7W A;  2D8N A;  2LC5 A;  3NSL A;  2JQ6 A;  2LAN A;  1KQM C;  2VRG A;  4YGA A;  2KI4 B;  4MZJ A;  3LL8 B;  3KHE A;  1KK8 B;  1R6P A;  5JOL A;  1X02 A;  2BL0 B;  3EVU A;  4CLN A;  3GOF A;  2LLU A;  1TOP A;  2BBN A;  4A4B A;  1DT7 B;  1M31 A;  1IQ5 A;  3F45 A;  2IS9 A;  1XO5 A;  3JVT B;  2BCB A;  3RLZ A;  2WC8 A;  1K2H A;  2L2E A;  4PHM A;  5DKR A;  2Y1N A;  1GJY A;  4MBE A;  2QAC A;  3OP0 A;  2BKI B;  1KK7 Z;  2K7D A;  1BG1 A;  1JUO A;  1ZUZ A;  1OMD A;  2JWW A;  2K0J A;  2MJW B;  1PSR A;  1WDC C;  2CTN A;  3VRN A;  1BU3 A;  1YR5 A;  2MHH A;  1MUX A;  3I5F B;  2EHB A;  1XFW O;  1TNX A;  1WRK A;  1JFJ A;  3SG7 A;  1FF1 A;  3PSR A;  1S5G Y;  5DKQ A;  2NCP A;  2JNF A;  3I5G C;  1CDN A;  2ISD A;  3BUX B;  1MQ1 A;  1SCM B;  1CTR A;  1QX2 A;  4YGD B;  4CID A;  1JFK A;  1YTZ C;  1OE9 B;  1A2X A;  1FW4 A;  1HT9 A;  2WND A;  3JTD C;  1AJ5 A;  1XVJ A;  3SG3 A;  1CM4 A;  2G2B A;  2MA2 A;  1OSA A;  4WRI A;  1QIV A;  4I5J A;  1XA5 A;  5KTY A;  1U5I A;  4PE4 A;  3O6B A;  3EVR A;  5F6T A;  2OPO A;  2JXL A;  1B8R A;  1EG4 A;  3QRX A;  4HRE E;  5HLO A;  3OB2 B;  2LHL A;  1CDM A;  3AKB A;  4PAL A;  1YUU A;  3CTN A;  1IJ6 A;  1K94 A;  4MZK A;  5HLV A;  2G9B A;  4DS7 A;  1YUR A;  1SPY A;  1MXL C;  2LMV A;  1QXP A;  3EVV A;  4YI8 A;  1IJ5 A;  4DUQ A;  2Y5I A;  1DGV A;  2CNP A;  5ER5 A;  4PHN A;  1UHI A;  1RRO A;  2LNK A;  3OX6 A;  4MZL A;  3I5H B;  4MEW A;  1QVI Z;  3NSO A;  4ORA B;  1CNP A;  3EK8 A;  1QAT A;  3AAK A;  3VRO A;  1YUT A;  2JXC A;  4OV2 A;  1WLM A;  1D1O A;  2COL B;  1CLB A;  1KWO C;  4GBA A;  2LVI A;  1KFX L;  2BCX A;  1EH2 A;  3CGA A;  1NX1 A;  4XJK B;  4QJ5 B;  1M39 A;  5KSZ A;  2ZND A;  2JOJ A;  3GK4 X;  1MF8 B;  5AFP A;  1C7V A;  1YUS A;  2DOQ A;  4QJ3 B;  1Y1U A;  1B8L A;  2BCA A;  2OTG C;  1PVA A;  2HF5 A;  1WDC B;  1TNW A;  4R1E A;  1PK0 D;  1BR4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...