1AVSA

X-ray crystallographic study of calcium-saturated n-terminal domain of troponin c
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
81
structure length
81
Chain Sequence
QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TROPONIN C
publication title Structural details of a calcium-induced molecular switch: X-ray crystallographic analysis of the calcium-saturated N-terminal domain of troponin C at 1.75 A resolution.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Muscle contraction
total genus 25
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1avsA00
3WHUB 3VRQA 4YI9A 1NCXA 1SPYA 1S6JA 1M31A 1UWOA 2D8NA 3PATA 5J3XA 4A4CA 1SBJA 1FBVA 2JTZA 1DJYA 2LP3A 1CDLA 3EKJA 4IL1A 3LLEA 2LVKA 3GK1A 3A4UB 5I8NA 3PFVA 1DTLA 1SCVA 4NDBA 1CFDA 4PALA 1KQVA 2Y4QA 5CSJA 1K95A 1QVIY 1SL7A 2I2RE 2MRDA 5HYDA 3VRNA 2JT8A 4PHJA 5JJGA 1C7VA 1IJ5A 5F6TA 1ZFSA 1V1GA 1CKKA 1NX3A 5G08A 3SG7A 4ZCVA 1MWNA 3C1VA 1IH0A 2A4JA 4MZJA 5AXIA 1K2HA 2KFFA 3OX5A 5BPJA 1TCFA 1XFZO 1S26D 3IQOA 3H4SE 3IQQA 1H8BA 1WLZA 2K7OA 4CPVA 2ZN8A 1SCMC 4GPLB 3ZNIA 2OS8B 3CGAA 3LL8B 2CT9A 1J1EA 3OP0A 1AUIB 2KAVA 1CMGA 2BKHB 4ETOA 2M8UA 4ORAB 1KK8B 1JFKA 3M0WA 2LNKA 2HETA 2FOTA 1B8CA 2JT3A 4P2YB 1OMDA 3OB2B 4AQJA 1DJHA 2K0JA 1W7IB 5AERA 2BL0B 4YRUA 3TS5B 1NWDA 3BUMB 1F71A 2JULA 3NSOA 3I5FC 2O60A 2BE4A 2ZFDA 1DJXA 1QX5B 4GGFC 2LM5A 4ICBA 4PDZA 2NXQA 4NDCA 2PMYA 1IQ5A 2MHHA 1AJ4A 2I18A 4MZLA 1RK9A 2H61C 4PHKA 3I5HB 2KYFA 2KAXA 3DF0B 1NPQA 2JOJA 1M46A 2LMUA 1YRTB 2LV7A 1WLMA 1WY9A 3WHTB 2ZNDA 1GGWA 2JQ6A 3BXKA 1PK0D 1KFXL 1XFXO 3BQ3A 4YI8A 3NXAA 1YUSA 1SYMA 5K89A 2Y5IA 1TNQA 5DKQA 1X02A 4C0JA 1BR4B 2GGMA 3JVTB 5HLVA 4JWQA 3VROA 2M49B 1XFUO 1DJGA 1MR8A 5HKZA 1PSRA 2AMIA 3BOWA 2E30A 1F4QA 2OS8C 1M39A 3D0YA 1CTRA 1MXLC 1C07A 1KK8C 2MBXA 3BUNB 1DMOA 1DVIA 1F8HA 3A8RA 2FJUB 5D7FA 5CSNA 3BUXB 1YR5A 2ISDA 3TS5C 1OZSA 1A29A 1BG1A 1TOPA 1IQ3A 2FCDA 2R2IA 3AAKA 2JZIA 1GGZA 2MJWB 4HSZA 1B4CA 1U5IB 1B7TZ 1SR6B 1M63B 4XYNA 2PVBA 3I5HC 2PASA 3F45A 4QJ5B 1NP8A 4N1FA 2JPTA 3TUYB 1RJVA 1CLBA 2LVVA 3OX6A 1AHRA 1E8AA 2B1UA 1WDCC 2V53A 1QJTA 5I2LA 2WORA 4XJKA 1S6CA 1CFPA 1NSHA 1IRJA 1L7ZA 1KFUL 3TZ1A 1K9KA 1K93D 3BYAA 1Y1UA 2Y1MA 2Q91A 1CMFA 1B9AA 1BJFA 1WRKA 4CIDA 2SASA 2EC6B 3I5IC 1EJ3A 1KWOC 4YGBB 4ZCUA 3NSLA 1K8UA 1G8IA 1OOJA 4WQ2A 3PSRA 1Y0VH 3PM8A 3JTDC 3FIAA 2LHLA 5CPVA 4DIRA 1EH2A 1Q80A 2GV5A 2PRUA 1YX8A 2DOQA 2L0PA 2M1UA 4E68A 1SMGA 2PSRA 2KQ6A 1J7PA 1F70A 4UPGA 1TIZA 4CFQA 2LP2A 3EK8A 3AKBA 1KQMB 2KFGA 1A2XA 1PALA 1B47A 2KFHA 4ORCB 1PVAA 1QV0A 1YUTA 2KGBC 1LA3A 1NX1A 1V1FA 2F3YA 2K2AA 2RGIA 2JXCA 4DRWA 5I2QA 2CNPA 2PALA 1LVCD 1TRFA 2AAOA 5HKWA 1RECA 1MXEA 4WRIA 1DJWA 4C0KA 2OPOA 1WRZA 3CR5X 5KTYA 5PALA 1IKUA 1J7RA 2F8PA 1F4OA 5D69A 1QLSA 5GQQC 4GGFA 3DVMA 4PE4A 2KSPA 1IGVA 2H2KA 1DF0A 2CBLA 2EC6C 2H61A 2LMVA 2GGZA 4OV2A 2LC5A 1S5GZ 2EGDA 2ZNEA 3O2PA 4DUQA 2KAYA 2KI6D 1MHOA 3NSKA 1K96A 1IG5A 1KK7Y 2ZN9A 3SG6A 3SG3A 4MRYA 1ZOTB 2LANA 1K9PA 3KHEA 3I5GB 1NX0A 4Q04A 1EG3A 1JWDA 1TN4A 1JC2A 1XK4A 2G2BA 2LMTA 4M2OA 2K2FA 2KYCA 2MLEC 2KOTA 1UHJA 1MF8B 1N2DA 1OQPA 2BECA 1KQMC 2JRFA 2F2OA 3EVUA 3RLZA 2EHBA 1HQVA 1B8RA 4YGAA 2I7AA 1J55A 2KDHA 2WCBA 1KSMA 5KU1A 1J7OA 3GOFA 1IWQA 2LHIA 5ER5A 4PE7A 2K61A 2WCFA 3TDIA 3OB1B 1XA5A 1FF1A 5AANA 4MVFA 3EK7A 4GUKA 4FTGA 3CLNA 5B8IB 4GGNA 3SIAA 3SG2A 4MZKA 1JF0A 2LVIA 2KBIA 4U8DA 2L4HA 1QATA 4OCIA 2ZRTA 2M7NA 1YUUA 2Q4UA 2QACA 4PHNA 4AQIA 4C0LA 1XFYO 4YBHB 1LXFC 2F3ZA 2M9GA 1D1OA 3RM1A 1EL4A 2ZRSA 2G9BA 2WOSA 1L2OB 3SG4A 1XFVO 2WCEA 1AVSA 4ORBB 1N0YA 1EXRA 3BOWB 1UHKA 1SL9A 4I5JA 2KI4B 3PN7B 3WXAA 4DS7A 3D0YB 3CR2A 5IBWA 1TNWA 2CXJA 1UURA 3DD4A 4QJ3B 1WRLA 3ZWHA 1AK8A 2AUCA 2BL0C 1SNLA 2HPSA 1N65A 1M45A 2KHNA 2KNEA 4HRHA 1FW4A 4PCWA 1K90D 2JU0A 1JUOA 4MSPA 2CCMA 3VGOA 1Y6WA 2BCBA 1VRKA 3SJSA 4A4BA 4N1GA 4P5OE 4GBAA 1H4BA 1NYAA 2M29A 5CSFA 3TDZA 3LK0A 1A75A 1CLMA 1DGVA 1EG4A 2F33A 4CLNA 2BCAA 3MSEB 3LCPC 1XVJA 3CTNA 1Y1AA 4I5NB 3EKHA 4XJKB 2NZ0A 4PE0A 3KF9A 1IJ6A 2I94A 1RWYA 2BBMA 2CTNA 1YX7A 2P6BB 1NCYA 1J7QA 4MLWA 5HLOA 1KFXS 3JVTC 1JF2A 1F54A 2BCXA 2F2PA 1B1GA 3CZTX 1QV1A 2LUXA 2K7BA 2M97A 1RFJA 2KI4C 2SCPA 3BUWB 4AOMA 4OVNF 3DVEA 4GAOA 3TDUA 4USLA 5ER4X 2HQWA 1LINA 1QTXA 1QS7A 2BBNA 2LLTA 2O5GA 3CWGA 1A03A 3K21A 3CR4X 2IS9A 1TNXA 2HF5A 1J1DA 4FQOA 3PALA 2WC8A 1SR6C 1CM4A 3FWCA 1SCMB 1TCOB 3FWBA 3TUYC 2LLUA 3ICBA 1YVHA 1HT9A 3FS7A 4OR9B 2K8MB 3KPXA 1CLLA 3KO0A 2K7CA 3VRPA 1JFJA 3O4YA 1SL8A 1JSAA 4MN0A 4NQGA 1A4PA 5AFPA 1C7WA 1Y1XA 5KSZA 4M2QA 1OMVA 1UHHA 2LLSA 1S6IA 1GJYA 1QX7A 4YGEB 2WNDA 3I5FB 1BMOA 1ALVA 1OMRA 1UHIA 1DJZA 1SY9A 1AP4A 1KFUS 2JNXA 1ALWA 1DF0B 4I5LB 3CS1A 2TN4A 2L2EA 1SKTA 1W7JB 1JBAA 3GK4X 1OZOA 2MA2A 1TNPA 4MRXA 1BU3A 2COLB 4HRGA 4QJ4B 1PSBA 2KBMA 1CDNA 3O6BA 1B7TY 1ODBA 1YTZC 1R2UA 1RTP1 2JC2A 5TNCA 4JQ0D 3HCMA 1UUSA 1YRUB 2E6WA 4YGCB 1KCYA 1QIVA 2MLFC 1FI6A 2L5XB 1QX2A 1UHNA 3BUOB 1G4YR 1ZACA 5HKYA 1BT6A 4R1EA 1ZUZA 1XFWO 1S3PA 2JWWA 1OSAA 1AJ5A 3EVRA 4I5KA 4WQ3A 3WNXB 1MQ1A 3SG5A 3PLFB 4JPZB 1CFFA 5DKRA 1DJIA 2LCPA 5CSIA 4DCKA 1K9UA 4MBEA 2NLNA 2JXLA 1SW8A 2KQYA 2M7LA 1BF5A 1YVLA 1PVBA 1CDMA 3DF0A 4N5XA 4OKHA 4GNKB 2LUCA 2ZKMX 3E3RA 3AAJA 2L50A 5DKNA 1SK6D 3QRXA 1DT7B 1UP5A 4MEWA 1SRAA 3D10A 4BY5A 1CNPA 1FPWA 2M3WA 3DVKA 1ZMZA 1S36A 1WDCB 3I5GC 2NCOA 2NCPA 3DVJA 3IF7A 2M1KB 1KSOA 4TNCA 1QIWA 3KEVA 3O78A 2OTGB 1XK4C 4M2PA 1QVIZ 1CFCA 2JTTA 4PE1A 1LKJA 1TTXA 3HX4A 2Y1NA 1PULA 2BE6A 1KWOB 3I5IB 1LA0A 2K7DA 4L9MA 1S1EA 1XYDA 2LVJA 3GK2A 4YGDB 2L98A 1NUBA 1GQMA 4F0ZB 3JTDB 5I2OA 3AKAA 1NCZA 3OHMB 4HREE 1CB1A 1G33A 1A75B 4CFRA 3VRRA 1S5GY 3LK1A 2JT0A 1XO5A 4BY4A 1KK7Z 1R6PA 2HQ8A 2MAZA 4NDDA 1BOCA 1K94A 1U5IA 2M0RA 2VRGA 1MUXA 1CM1A 3NSIA 1B8LA 1BODA 1F55A 1QLKA 2KGRA 1L2OC 5AEQA 5JOLA 1QASA 1DGUA 1CDPA 2QPTA 1OE9B 3PN7C 3SIBA 2FCEA 4PHMA 3EK4A 1BR1B 2BKIB 3EVVA 2L51A 2KI6C 2LAPA 2OTGC 1BLQA 5FYXA 1QXPA 4GFTA 1YURA 1FI5A 1PRWA 2L4IA 1RROA 2LE9B 2JNFA 1NIWA 4D1EA 1NX2A
chains in the Genus database with same CATH superfamily
3WHUB 3L47A 3R1PA 3VRQA 4YI9A 3CZ2A 1NCXA 1SPYA 1S6JA 1M31A 1UWOA 2D8NA 3PATA 5J3XA 4A4CA 3S0EA 1SBJA 3BFBA 1FBVA 2JTZA 1DJYA 2LP3A 1CDLA 3EKJA 4IL1A 3LLEA 3UO9A 2LVKA 3B86A 3D73A 3GK1A 3A4UB 3CYZA 5I8NA 3NGVA 2QEVA 3PFVA 1DTLA 1SCVA 4NDBA 1CFDA 4PALA 1KQVA 2Y4QA 5CSJA 1K95A 1QVIY 4F7FA 2JPOA 3CABA 1SL7A 2I2RE 2MRDA 5HYDA 3VRNA 2JT8A 4PHJA 5JJGA 1C7VA 1IJ5A 5F6TA 1ZFSA 1V1GA 3B7AA 1CKKA 1NX3A 2QEBA 5G08A 3SG7A 4ZCVA 1MWNA 3C1VA 1IH0A 2A4JA 4MZJA 5AXIA 1K2HA 2KFFA 3OX5A 5BPJA 1TCFA 1XFZO 1S26D 3IQOA 1Z2CB 3BFAA 3H4SE 3IQQA 1H8BA 1WLZA 2K7OA 4CPVA 5EL2A 2ZN8A 1SCMC 4GPLB 3ZNIA 2OS8B 3CGAA 3L4LA 3LL8B 3S0BA 2CT9A 1J1EA 3OP0A 1AUIB 2KAVA 1CMGA 2BKHB 4ETOA 2M8UA 4ORAB 1KK8B 1JFKA 3M0WA 2LNKA 2HETA 2FOTA 1B8CA 2JT3A 3FE9A 4P2YB 1OMDA 3OB2B 2FJYA 1DJHA 4AQJA 2K0JA 1W7IB 5AERA 2BL0B 4YRUA 3PJIA 3TS5B 1NWDA 3BUMB 1F71A 2JULA 3NSOA 3I5FC 2O60A 2BE4A 2ZFDA 1C3YA 1DJXA 1QX5B 4GGFC 2LM5A 2WCKA 4ICBA 2NXQA 4NDCA 2PMYA 4PDZA 1IQ5A 2MHHA 1AJ4A 2I18A 4MZLA 1RK9A 2H61C 4PHKA 3I5HB 2KYFA 2KAXA 3DF0B 1NPQA 2JOJA 1M46A 2LMUA 1YRTB 2LV7A 3DYEA 1WLMA 1WY9A 3WHTB 2ZNDA 1GGWA 3CZ0A 2JQ6A 3BXKA 1PK0D 1KFXL 3R72A 3SS5A 5HL1A 1XFXO 3BQ3A 4YI8A 3NXAA 1YUSA 1SYMA 3DXLA 5K89A 1C3ZA 2Y5IA 1TNQA 5DKQA 1X02A 4C0JA 1BR4B 2GGMA 3JVTB 5HLVA 4JWQA 3VROA 2M49B 1XFUO 1DJGA 1MR8A 5HKZA 1PSRA 2AMIA 3BOWA 2E30A 1F4QA 2OS8C 3L4AA 1M39A 3D0YA 1CTRA 1MXLC 1C07A 1KK8C 2MBXA 3BUNB 1DMOA 1DVIA 1F8HA 3A8RA 3NHIA 2FJUB 5D7FA 5CSNA 3BUXB 1YR5A 2ISDA 3TS5C 1OZSA 1A29A 1BG1A 1TOPA 3D75A 2FCDA 2R2IA 1IQ3A 3AAKA 2JZIA 1GGZA 2MJWB 4HSZA 1B4CA 1U5IB 1B7TZ 1SR6B 1M63B 4XYNA 2PVBA 3I5HC 2PASA 3F45A 4QJ5B 1NP8A 3OGNA 2JPTA 2KLEA 1RJVA 4N1FA 3TUYB 1CLBA 2LVVA 3OX6A 1AHRA 1E8AA 2B1UA 1WDCC 2V53A 1QJTA 5I2LA 3UNWA 2WORA 4XJKA 1S6CA 3S0AA 1CFPA 1NSHA 3B87A 1IRJA 1L7ZA 1KFUL 3D76A 3TZ1A 1K9KA 1K93D 1TUJA 3BYAA 3D78A 1Y1UA 4JKTA 2Y1MA 2Q91A 1CMFA 1B9AA 1QWVA 1BJFA 1P28A 1WRKA 2WCJA 4CIDA 2SASA 2EC6B 2P70A 3D74A 3I5IC 1EJ3A 1KWOC 3S0DA 4YGBB 4ZCUA 3NSLA 1K8UA 3B88A 1G8IA 1OOJA 4WQ2A 3PSRA 1Y0VH 3PM8A 3JTDC 3FIAA 2LHLA 5CPVA 4DIRA 1EH2A 1Q80A 2GV5A 2PRUA 1YX8A 2PYQA 1SSEB 2DOQA 2L0PA 2M1UA 5I94A 4E68A 1SMGA 2PSRA 2KQ6A 2WC6A 1J7PA 4UPGA 1F70A 1TIZA 4CFQA 2LP2A 3EK8A 1GM0A 3AKBA 1KQMB 2KFGA 1A2XA 1PALA 1B47A 3OBVA 2KFHA 4ORCB 1PVAA 3CDNA 1QV0A 1YUTA 1DC1A 2KGBC 4FQTA 1LA3A 1NX1A 1TWOA 1V1FA 2F3YA 2K2AA 2JXCA 2RGIA 3D77A 4DRWA 5I2QA 2CNPA 2PALA 3S0FA 1LVCD 1TRFA 2AAOA 5HKWA 3BFHA 1RECA 1MXEA 4WRIA 1DJWA 2GTEA 4C0KA 2OPOA 1WRZA 3CR5X 5KTYA 5PALA 1IKUA 1J7RA 2F8PA 1IIOA 1F4OA 5D69A 1QLSA 5GQQC 3IVTA 4GGFA 3DVMA 4PE4A 2KSPA 1IGVA 2H2KA 1DF0A 2CBLA 2EC6C 2H61A 2LMVA 2GGZA 4OV2A 2LC5A 1S5GZ 2EGDA 2ZNEA 3DY9A 3O2PA 2KAYA 4DUQA 2KI6D 1MHOA 3NSKA 1K96A 1IG5A 1KK7Y 2ZN9A 3SG6A 3SG3A 4PT1A 4MRYA 1ZOTB 2LANA 3K1EA 2PQLA 1T14A 1K9PA 3KHEA 3I5GB 1NX0A 4Q04A 1EG3A 1JWDA 1TN4A 1JC2A 1XK4A 2G2BA 2LMTA 4M2OA 2K2FA 2KYCA 2MLEC 2KOTA 1UHJA 1MF8B 1N2DA 1OQPA 2BECA 1KQMC 2JRFA 2F2OA 3EVUA 3RLZA 2EHBA 1HQVA 1B8RA 1OW4A 3DZTA 2WCLA 4YGAA 2I7AA 1J55A 2KDHA 2WCBA 1DELA 1OOIX 1KSMA 5KU1A 1J7OA 1OOGA 1OOFA 3GOFA 1IWQA 2LHIA 5ER5A 4PE7A 2K61A 2WCFA 3TDIA 3OB1B 2P71A 1XA5A 1FF1A 2KPHA 4MVFA 3EK7A 5AANA 4GUKA 3O4XA 4FTGA 3CLNA 5B8IB 4GGNA 4KYNA 3SIAA 3SG2A 4MZKA 1JF0A 2LVIA 2KBIA 4U8DA 2L4HA 1QATA 4OCIA 2ZRTA 2M7NA 1YUUA 2Q4UA 2QACA 4PHNA 4AQIA 4C0LA 1XFYO 4YBHB 1LXFC 2F3ZA 2M9GA 1D1OA 3RM1A 1EL4A 2WCHA 2ZRSA 2G9BA 2WOSA 1L2OB 3SG4A 1XFVO 2WCEA 1AVSA 4ORBB 1N0YA 1EXRA 3BOWB 1UHKA 1SL9A 4I5JA 2KI4B 3PN7B 3WXAA 4DS7A 3D0YB 3CR2A 5IBWA 1TNWA 2CXJA 1UURA 3DD4A 4QJ3B 2L2CA 1WRLA 1Z4HA 3ZWHA 1AK8A 2ERBA 2AUCA 2BL0C 1SNLA 2HPSA 1N65A 2WC5A 1M45A 2KHNA 2KNEA 1ORGA 4HRHA 1FW4A 4PCWA 1K90D 2JU0A 1JUOA 3Q8IA 4MSPA 2CCMA 2KLDA 1Y6WA 2BCBA 1VRKA 1W9ZA 3SJSA 3VGOA 3S0GA 1LS8A 5FI6A 4A4BA 4N1GA 4P5OE 3V2LA 4GBAA 1H4BA 1NYAA 2M29A 5CSFA 3TDZA 3LK0A 1A75A 1CLMA 1DGVA 1EG4A 2F33A 3QMEA 4CLNA 2BCAA 3MSEB 3LCPC 4INWA 1XVJA 3CTNA 5DICA 1Y1AA 4I5NB 3EKHA 4XJKB 2NZ0A 4PE0A 3KF9A 1IJ6A 2I94A 1RWYA 2BBMA 2CTNA 1YX7A 2P6BB 1NCYA 1J7QA 4MLWA 5HLOA 1KFXS 3JVTC 3R1VA 3PM2A 1JF2A 1F54A 2BCXA 2F2PA 1B1GA 3CZTX 1QV1A 2LUXA 2K7BA 2M97A 1RFJA 2KI4C 2SCPA 3BUWB 4AOMA 4OVNF 3DVEA 4GAOA 3TDUA 4USLA 5ER4X 2HQWA 1LINA 5FI7A 1QTXA 1QS7A 2BBNA 2LLTA 2O5GA 3CWGA 1A03A 3K21A 3CR4X 2IS9A 1TNXA 2HF5A 1J1DA 4FQOA 3PALA 2WC8A 1SR6C 3VB1A 1CM4A 3FWCA 1SCMB 1TCOB 3FWBA 3TUYC 2LLUA 3FE6A 3ICBA 1YVHA 1HT9A 3FS7A 4OR9B 2K8MB 3KPXA 1CLLA 3KO0A 2K7CA 3VRPA 1JFJA 3O4YA 1SL8A 1JSAA 4MN0A 4NQGA 1A4PA 5AFPA 1C7WA 1Y1XA 3BJHA 5KSZA 4M2QA 1OMVA 1UHHA 2LLSA 1S6IA 1GJYA 1QX7A 4YGEB 2WNDA 3I5FB 1BMOA 1ALVA 1OMRA 1XFRA 3RZSA 1UHIA 1DJZA 1OOHA 1SY9A 1AP4A 1KFUS 2JNXA 1ALWA 1DF0B 4I5LB 3CS1A 2TN4A 2L2EA 1SKTA 1W7JB 1JBAA 3R1OA 3GK4X 5FI2A 1OZOA 2MA2A 3CZ1A 1TNPA 4MRXA 1BU3A 2COLB 4HRGA 4QJ4B 1PSBA 3NHTA 2KBMA 3N7HA 1CDNA 3O6BA 1B7TY 1ODBA 1YTZC 4OZDA 1R2UA 1RTP1 2JC2A 5TNCA 4JQ0D 3HCMA 1UUSA 1DQEA 1YRUB 2E6WA 4YGCB 1KCYA 1QIVA 2MLFC 2YGUA 2QEHA 1FI6A 2L5XB 1QX2A 1UHNA 3BUOB 1G4YR 1ZACA 5HKYA 5D3OA 1BT6A 4R1EA 3SS3A 1ZUZA 1XFWO 1S3PA 2K60A 2JWWA 1OSAA 1AJ5A 2QDIA 3EVRA 4I5KA 4WQ3A 1DEKA 3WNXB 1MQ1A 2BAPA 3SG5A 3PLFB 2H8VA 4JPZB 1CFFA 5DKRA 1DJIA 2LCPA 5CSIA 4DCKA 1K9UA 4MBEA 2NLNA 2JXLA 1SW8A 2KQYA 2M7LA 2L5YA 1BF5A 1YVLA 1PVBA 1CDMA 3DF0A 4N5XA 4OKHA 4GNKB 2LUCA 2ZKMX 3E3RA 3AAJA 2L50A 5DKNA 1SK6D 3QRXA 1TUZA 1UP5A 4MEWA 1SRAA 3D10A 4BY5A 1DT7B 2WCMA 1CNPA 1FPWA 2M3WA 3DVKA 1ZMZA 1S36A 1WDCB 3I5GC 2NCOA 2NCPA 3B6XA 3DVJA 3IF7A 2M1KB 1KSOA 4TNCA 1QIWA 3KEVA 3O78A 2OTGB 1XK4C 4JD9A 4M2PA 1QVIZ 3EG5B 1CFCA 2JTTA 4PE1A 1LKJA 1TTXA 3HX4A 2Y1NA 2QEOA 1PULA 2BE6A 1KWOB 3I5IB 1LA0A 2K7DA 4L9MA 1S1EA 1XYDA 2LVJA 3GK2A 4YGDB 2L98A 1NUBA 1GQMA 4F0ZB 3JTDB 5I2OA 4IJ7A 3AKAA 1NCZA 3OHMB 4HREE 1CB1A 1G33A 1A75B 4CFRA 3VRRA 1S5GY 3LK1A 2JT0A 1XO5A 3FE8A 4BY4A 1KK7Z 1R6PA 2HQ8A 2MAZA 4NDDA 1BOCA 1K94A 1U5IA 2M0RA 2VRGA 1MUXA 4INXA 1CM1A 3NSIA 1B8LA 1BODA 1F55A 1QLKA 2KGRA 1L2OC 5AEQA 5JOLA 1QASA 1DGUA 1CDPA 2QPTA 1OE9B 3PN7C 3SIBA 2FCEA 4PHMA 3EK4A 4D1EA 1BR1B 2BKIB 2BNXA 3EVVA 2L51A 2KI6C 2LAPA 2OTGC 1BLQA 5FYXA 1QXPA 4GFTA 1YURA 1FI5A 1PRWA 2L4IA 1RROA 2LE9B 2JNFA 1NIWA 3SS4A 1NX2A
chains in the Genus database with same CATH topology
3WHUB 3VRQA 4YI9A 1NCXA 1SPYA 1S6JA 1M31A 1UWOA 2D8NA 3PATA 5J3XA 4A4CA 1SBJA 1FBVA 2JTZA 1DJYA 2LP3A 1CDLA 3EKJA 4IL1A 3LLEA 2LVKA 3GK1A 3A4UB 5I8NA 3PFVA 1DTLA 1SCVA 4NDBA 1CFDA 4PALA 1KQVA 2Y4QA 5CSJA 1K95A 1QVIY 1SL7A 2I2RE 2MRDA 5HYDA 3VRNA 2JT8A 4PHJA 5JJGA 1C7VA 1IJ5A 5F6TA 1ZFSA 1V1GA 1CKKA 1NX3A 5G08A 3SG7A 4ZCVA 1MWNA 3C1VA 1IH0A 2A4JA 4MZJA 5AXIA 1K2HA 2KFFA 3OX5A 5BPJA 1TCFA 1XFZO 1S26D 3IQOA 3H4SE 3IQQA 1H8BA 1WLZA 2K7OA 4CPVA 2ZN8A 1SCMC 4GPLB 3ZNIA 2OS8B 3CGAA 3LL8B 2CT9A 1J1EA 3OP0A 1AUIB 2KAVA 1CMGA 2BKHB 4ETOA 2M8UA 4ORAB 1KK8B 1JFKA 3M0WA 2LNKA 2HETA 2FOTA 1B8CA 2JT3A 4P2YB 1OMDA 3OB2B 4AQJA 1DJHA 2K0JA 1W7IB 5AERA 2BL0B 4YRUA 3TS5B 1NWDA 3BUMB 1F71A 2JULA 3NSOA 3I5FC 2O60A 2BE4A 2ZFDA 1DJXA 1QX5B 4GGFC 2LM5A 4ICBA 4PDZA 2NXQA 4NDCA 2PMYA 1IQ5A 2MHHA 1AJ4A 2I18A 4MZLA 1RK9A 2H61C 4PHKA 3I5HB 2KYFA 2KAXA 3DF0B 1NPQA 2JOJA 1M46A 2LMUA 1YRTB 2LV7A 1WLMA 1WY9A 3WHTB 2ZNDA 1GGWA 2JQ6A 3BXKA 1PK0D 1KFXL 1XFXO 3BQ3A 4YI8A 3NXAA 1YUSA 1SYMA 5K89A 2Y5IA 1TNQA 5DKQA 1X02A 4C0JA 1BR4B 2GGMA 3JVTB 5HLVA 4JWQA 3VROA 2M49B 1XFUO 1DJGA 1MR8A 5HKZA 1PSRA 2AMIA 3BOWA 2E30A 1F4QA 2OS8C 1M39A 3D0YA 1CTRA 1MXLC 1C07A 1KK8C 2MBXA 3BUNB 1DMOA 1DVIA 1F8HA 3A8RA 2FJUB 5D7FA 5CSNA 3BUXB 1YR5A 2ISDA 3TS5C 1OZSA 1A29A 1BG1A 1TOPA 1IQ3A 2FCDA 2R2IA 3AAKA 2JZIA 1GGZA 2MJWB 4HSZA 1B4CA 1U5IB 1B7TZ 1SR6B 1M63B 4XYNA 2PVBA 3I5HC 2PASA 3F45A 4QJ5B 1NP8A 4N1FA 2JPTA 3TUYB 1RJVA 1CLBA 2LVVA 3OX6A 1AHRA 1E8AA 2B1UA 1WDCC 2V53A 1QJTA 5I2LA 2WORA 4XJKA 1S6CA 1CFPA 1NSHA 1IRJA 1L7ZA 1KFUL 3TZ1A 1K9KA 1K93D 3BYAA 1Y1UA 2Y1MA 2Q91A 1CMFA 1B9AA 1BJFA 1WRKA 4CIDA 2SASA 2EC6B 3I5IC 1EJ3A 1KWOC 4YGBB 4ZCUA 3NSLA 1K8UA 1G8IA 1OOJA 4WQ2A 3PSRA 1Y0VH 3PM8A 3JTDC 3FIAA 2LHLA 5CPVA 4DIRA 1EH2A 1Q80A 2GV5A 2PRUA 1YX8A 2DOQA 2L0PA 2M1UA 4E68A 1SMGA 2PSRA 2KQ6A 1J7PA 1F70A 4UPGA 1TIZA 4CFQA 2LP2A 3EK8A 3AKBA 1KQMB 2KFGA 1A2XA 1PALA 1B47A 2KFHA 4ORCB 1PVAA 1QV0A 1YUTA 2KGBC 1LA3A 1NX1A 1V1FA 2F3YA 2K2AA 2RGIA 2JXCA 4DRWA 5I2QA 2CNPA 2PALA 1LVCD 1TRFA 2AAOA 5HKWA 1RECA 1MXEA 4WRIA 1DJWA 4C0KA 2OPOA 1WRZA 3CR5X 5KTYA 5PALA 1IKUA 1J7RA 2F8PA 1F4OA 5D69A 1QLSA 5GQQC 4GGFA 3DVMA 4PE4A 2KSPA 1IGVA 2H2KA 1DF0A 2CBLA 2EC6C 2H61A 2LMVA 2GGZA 4OV2A 2LC5A 1S5GZ 2EGDA 2ZNEA 3O2PA 4DUQA 2KAYA 2KI6D 1MHOA 3NSKA 1K96A 1IG5A 1KK7Y 2ZN9A 3SG6A 3SG3A 4MRYA 1ZOTB 2LANA 1K9PA 3KHEA 3I5GB 1NX0A 4Q04A 1EG3A 1JWDA 1TN4A 1JC2A 1XK4A 2G2BA 2LMTA 4M2OA 2K2FA 2KYCA 2MLEC 2KOTA 1UHJA 1MF8B 1N2DA 1OQPA 2BECA 1KQMC 2JRFA 2F2OA 3EVUA 3RLZA 2EHBA 1HQVA 1B8RA 4YGAA 2I7AA 1J55A 2KDHA 2WCBA 1KSMA 5KU1A 1J7OA 3GOFA 1IWQA 2LHIA 5ER5A 4PE7A 2K61A 2WCFA 3TDIA 3OB1B 1XA5A 1FF1A 5AANA 4MVFA 3EK7A 4GUKA 4FTGA 3CLNA 5B8IB 4GGNA 3SIAA 3SG2A 4MZKA 1JF0A 2LVIA 2KBIA 4U8DA 2L4HA 1QATA 4OCIA 2ZRTA 2M7NA 1YUUA 2Q4UA 2QACA 4PHNA 4AQIA 4C0LA 1XFYO 4YBHB 1LXFC 2F3ZA 2M9GA 1D1OA 3RM1A 1EL4A 2ZRSA 2G9BA 2WOSA 1L2OB 3SG4A 1XFVO 2WCEA 1AVSA 4ORBB 1N0YA 1EXRA 3BOWB 1UHKA 1SL9A 4I5JA 2KI4B 3PN7B 3WXAA 4DS7A 3D0YB 3CR2A 5IBWA 1TNWA 2CXJA 1UURA 3DD4A 4QJ3B 1WRLA 3ZWHA 1AK8A 2AUCA 2BL0C 1SNLA 2HPSA 1N65A 1M45A 2KHNA 2KNEA 4HRHA 1FW4A 4PCWA 1K90D 2JU0A 1JUOA 4MSPA 2CCMA 3VGOA 1Y6WA 2BCBA 1VRKA 3SJSA 4A4BA 4N1GA 4P5OE 4GBAA 1H4BA 1NYAA 2M29A 5CSFA 3TDZA 3LK0A 1A75A 1CLMA 1DGVA 1EG4A 2F33A 4CLNA 2BCAA 3MSEB 3LCPC 1XVJA 3CTNA 1Y1AA 4I5NB 3EKHA 4XJKB 2NZ0A 4PE0A 3KF9A 1IJ6A 2I94A 1RWYA 2BBMA 2CTNA 1YX7A 2P6BB 1NCYA 1J7QA 4MLWA 5HLOA 1KFXS 3JVTC 1JF2A 1F54A 2BCXA 2F2PA 1B1GA 3CZTX 1QV1A 2LUXA 2K7BA 2M97A 1RFJA 2KI4C 2SCPA 3BUWB 4AOMA 4OVNF 3DVEA 4GAOA 3TDUA 4USLA 5ER4X 2HQWA 1LINA 1QTXA 1QS7A 2BBNA 2LLTA 2O5GA 3CWGA 1A03A 3K21A 3CR4X 2IS9A 1TNXA 2HF5A 1J1DA 4FQOA 3PALA 2WC8A 1SR6C 1CM4A 3FWCA 1SCMB 1TCOB 3FWBA 3TUYC 2LLUA 3ICBA 1YVHA 1HT9A 3FS7A 4OR9B 2K8MB 3KPXA 1CLLA 3KO0A 2K7CA 3VRPA 1JFJA 3O4YA 1SL8A 1JSAA 4MN0A 4NQGA 1A4PA 5AFPA 1C7WA 1Y1XA 5KSZA 4M2QA 1OMVA 1UHHA 2LLSA 1S6IA 1GJYA 1QX7A 4YGEB 2WNDA 3I5FB 1BMOA 1ALVA 1OMRA 1UHIA 1DJZA 1SY9A 1AP4A 1KFUS 2JNXA 1ALWA 1DF0B 4I5LB 3CS1A 2TN4A 2L2EA 1SKTA 1W7JB 1JBAA 3GK4X 1OZOA 2MA2A 1TNPA 4MRXA 1BU3A 2COLB 4HRGA 4QJ4B 1PSBA 2KBMA 1CDNA 3O6BA 1B7TY 1ODBA 1YTZC 1R2UA 1RTP1 2JC2A 5TNCA 4JQ0D 3HCMA 1UUSA 1YRUB 2E6WA 4YGCB 1KCYA 1QIVA 2MLFC 1FI6A 2L5XB 1QX2A 1UHNA 3BUOB 1G4YR 1ZACA 5HKYA 1BT6A 4R1EA 1ZUZA 1XFWO 1S3PA 2JWWA 1OSAA 1AJ5A 3EVRA 4I5KA 4WQ3A 3WNXB 1MQ1A 3SG5A 3PLFB 4JPZB 1CFFA 5DKRA 1DJIA 2LCPA 5CSIA 4DCKA 1K9UA 4MBEA 2NLNA 2JXLA 1SW8A 2KQYA 2M7LA 1BF5A 1YVLA 1PVBA 1CDMA 3DF0A 4N5XA 4OKHA 4GNKB 2LUCA 2ZKMX 3E3RA 3AAJA 2L50A 5DKNA 1SK6D 3QRXA 1DT7B 1UP5A 4MEWA 1SRAA 3D10A 4BY5A 1CNPA 1FPWA 2M3WA 3DVKA 1ZMZA 1S36A 1WDCB 3I5GC 2NCOA 2NCPA 3DVJA 3IF7A 2M1KB 1KSOA 4TNCA 1QIWA 3KEVA 3O78A 2OTGB 1XK4C 4M2PA 1QVIZ 1CFCA 2JTTA 4PE1A 1LKJA 1TTXA 3HX4A 2Y1NA 1PULA 2BE6A 1KWOB 3I5IB 1LA0A 2K7DA 4L9MA 1S1EA 1XYDA 2LVJA 3GK2A 4YGDB 2L98A 1NUBA 1GQMA 4F0ZB 3JTDB 5I2OA 3AKAA 1NCZA 3OHMB 4HREE 1CB1A 1G33A 1A75B 4CFRA 3VRRA 1S5GY 3LK1A 2JT0A 1XO5A 4BY4A 1KK7Z 1R6PA 2HQ8A 2MAZA 4NDDA 1BOCA 1K94A 1U5IA 2M0RA 2VRGA 1MUXA 1CM1A 3NSIA 1B8LA 1BODA 1F55A 1QLKA 2KGRA 1L2OC 5AEQA 5JOLA 1QASA 1DGUA 1CDPA 2QPTA 1OE9B 3PN7C 3SIBA 2FCEA 4PHMA 3EK4A 1BR1B 2BKIB 3EVVA 2L51A 2KI6C 2LAPA 2OTGC 1BLQA 5FYXA 1QXPA 4GFTA 1YURA 1FI5A 1PRWA 2L4IA 1RROA 2LE9B 2JNFA 1NIWA 4D1EA 1NX2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WHU B;  3VRQ A;  4YI9 A;  1NCX A;  1SPY A;  1S6J A;  1M31 A;  1UWO A;  2D8N A;  3PAT A;  5J3X A;  4A4C A;  1SBJ A;  1FBV A;  2JTZ A;  1DJY A;  2LP3 A;  1CDL A;  3EKJ A;  4IL1 A;  3LLE A;  2LVK A;  3GK1 A;  3A4U B;  5I8N A;  3PFV A;  1DTL A;  1SCV A;  4NDB A;  1CFD A;  4PAL A;  1KQV A;  2Y4Q A;  5CSJ A;  1K95 A;  1QVI Y;  1SL7 A;  2I2R E;  2MRD A;  5HYD A;  3VRN A;  2JT8 A;  4PHJ A;  5JJG A;  1C7V A;  1IJ5 A;  5F6T A;  1ZFS A;  1V1G A;  1CKK A;  1NX3 A;  5G08 A;  3SG7 A;  4ZCV A;  1MWN A;  3C1V A;  1IH0 A;  2A4J A;  4MZJ A;  5AXI A;  1K2H A;  2KFF A;  3OX5 A;  5BPJ A;  1TCF A;  1XFZ O;  1S26 D;  3IQO A;  3H4S E;  3IQQ A;  1H8B A;  1WLZ A;  2K7O A;  4CPV A;  2ZN8 A;  1SCM C;  4GPL B;  3ZNI A;  2OS8 B;  3CGA A;  3LL8 B;  2CT9 A;  1J1E A;  3OP0 A;  1AUI B;  2KAV A;  1CMG A;  2BKH B;  4ETO A;  2M8U A;  4ORA B;  1KK8 B;  1JFK A;  3M0W A;  2LNK A;  2HET A;  2FOT A;  1B8C A;  2JT3 A;  4P2Y B;  1OMD A;  3OB2 B;  4AQJ A;  1DJH A;  2K0J A;  1W7I B;  5AER A;  2BL0 B;  4YRU A;  3TS5 B;  1NWD A;  3BUM B;  1F71 A;  2JUL A;  3NSO A;  3I5F C;  2O60 A;  2BE4 A;  2ZFD A;  1DJX A;  1QX5 B;  4GGF C;  2LM5 A;  4ICB A;  4PDZ A;  2NXQ A;  4NDC A;  2PMY A;  1IQ5 A;  2MHH A;  1AJ4 A;  2I18 A;  4MZL A;  1RK9 A;  2H61 C;  4PHK A;  3I5H B;  2KYF A;  2KAX A;  3DF0 B;  1NPQ A;  2JOJ A;  1M46 A;  2LMU A;  1YRT B;  2LV7 A;  1WLM A;  1WY9 A;  3WHT B;  2ZND A;  1GGW A;  2JQ6 A;  3BXK A;  1PK0 D;  1KFX L;  1XFX O;  3BQ3 A;  4YI8 A;  3NXA A;  1YUS A;  1SYM A;  5K89 A;  2Y5I A;  1TNQ A;  5DKQ A;  1X02 A;  4C0J A;  1BR4 B;  2GGM A;  3JVT B;  5HLV A;  4JWQ A;  3VRO A;  2M49 B;  1XFU O;  1DJG A;  1MR8 A;  5HKZ A;  1PSR A;  2AMI A;  3BOW A;  2E30 A;  1F4Q A;  2OS8 C;  1M39 A;  3D0Y A;  1CTR A;  1MXL C;  1C07 A;  1KK8 C;  2MBX A;  3BUN B;  1DMO A;  1DVI A;  1F8H A;  3A8R A;  2FJU B;  5D7F A;  5CSN A;  3BUX B;  1YR5 A;  2ISD A;  3TS5 C;  1OZS A;  1A29 A;  1BG1 A;  1TOP A;  1IQ3 A;  2FCD A;  2R2I A;  3AAK A;  2JZI A;  1GGZ A;  2MJW B;  4HSZ A;  1B4C A;  1U5I B;  1B7T Z;  1SR6 B;  1M63 B;  4XYN A;  2PVB A;  3I5H C;  2PAS A;  3F45 A;  4QJ5 B;  1NP8 A;  4N1F A;  2JPT A;  3TUY B;  1RJV A;  1CLB A;  2LVV A;  3OX6 A;  1AHR A;  1E8A A;  2B1U A;  1WDC C;  2V53 A;  1QJT A;  5I2L A;  2WOR A;  4XJK A;  1S6C A;  1CFP A;  1NSH A;  1IRJ A;  1L7Z A;  1KFU L;  3TZ1 A;  1K9K A;  1K93 D;  3BYA A;  1Y1U A;  2Y1M A;  2Q91 A;  1CMF A;  1B9A A;  1BJF A;  1WRK A;  4CID A;  2SAS A;  2EC6 B;  3I5I C;  1EJ3 A;  1KWO C;  4YGB B;  4ZCU A;  3NSL A;  1K8U A;  1G8I A;  1OOJ A;  4WQ2 A;  3PSR A;  1Y0V H;  3PM8 A;  3JTD C;  3FIA A;  2LHL A;  5CPV A;  4DIR A;  1EH2 A;  1Q80 A;  2GV5 A;  2PRU A;  1YX8 A;  2DOQ A;  2L0P A;  2M1U A;  4E68 A;  1SMG A;  2PSR A;  2KQ6 A;  1J7P A;  1F70 A;  4UPG A;  1TIZ A;  4CFQ A;  2LP2 A;  3EK8 A;  3AKB A;  1KQM B;  2KFG A;  1A2X A;  1PAL A;  1B47 A;  2KFH A;  4ORC B;  1PVA A;  1QV0 A;  1YUT A;  2KGB C;  1LA3 A;  1NX1 A;  1V1F A;  2F3Y A;  2K2A A;  2RGI A;  2JXC A;  4DRW A;  5I2Q A;  2CNP A;  2PAL A;  1LVC D;  1TRF A;  2AAO A;  5HKW A;  1REC A;  1MXE A;  4WRI A;  1DJW A;  4C0K A;  2OPO A;  1WRZ A;  3CR5 X;  5KTY A;  5PAL A;  1IKU A;  1J7R A;  2F8P A;  1F4O A;  5D69 A;  1QLS A;  5GQQ C;  4GGF A;  3DVM A;  4PE4 A;  2KSP A;  1IGV A;  2H2K A;  1DF0 A;  2CBL A;  2EC6 C;  2H61 A;  2LMV A;  2GGZ A;  4OV2 A;  2LC5 A;  1S5G Z;  2EGD A;  2ZNE A;  3O2P A;  4DUQ A;  2KAY A;  2KI6 D;  1MHO A;  3NSK A;  1K96 A;  1IG5 A;  1KK7 Y;  2ZN9 A;  3SG6 A;  3SG3 A;  4MRY A;  1ZOT B;  2LAN A;  1K9P A;  3KHE A;  3I5G B;  1NX0 A;  4Q04 A;  1EG3 A;  1JWD A;  1TN4 A;  1JC2 A;  1XK4 A;  2G2B A;  2LMT A;  4M2O A;  2K2F A;  2KYC A;  2MLE C;  2KOT A;  1UHJ A;  1MF8 B;  1N2D A;  1OQP A;  2BEC A;  1KQM C;  2JRF A;  2F2O A;  3EVU A;  3RLZ A;  2EHB A;  1HQV A;  1B8R A;  4YGA A;  2I7A A;  1J55 A;  2KDH A;  2WCB A;  1KSM A;  5KU1 A;  1J7O A;  3GOF A;  1IWQ A;  2LHI A;  5ER5 A;  4PE7 A;  2K61 A;  2WCF A;  3TDI A;  3OB1 B;  1XA5 A;  1FF1 A;  5AAN A;  4MVF A;  3EK7 A;  4GUK A;  4FTG A;  3CLN A;  5B8I B;  4GGN A;  3SIA A;  3SG2 A;  4MZK A;  1JF0 A;  2LVI A;  2KBI A;  4U8D A;  2L4H A;  1QAT A;  4OCI A;  2ZRT A;  2M7N A;  1YUU A;  2Q4U A;  2QAC A;  4PHN A;  4AQI A;  4C0L A;  1XFY O;  4YBH B;  1LXF C;  2F3Z A;  2M9G A;  1D1O A;  3RM1 A;  1EL4 A;  2ZRS A;  2G9B A;  2WOS A;  1L2O B;  3SG4 A;  1XFV O;  2WCE A;  1AVS A;  4ORB B;  1N0Y A;  1EXR A;  3BOW B;  1UHK A;  1SL9 A;  4I5J A;  2KI4 B;  3PN7 B;  3WXA A;  4DS7 A;  3D0Y B;  3CR2 A;  5IBW A;  1TNW A;  2CXJ A;  1UUR A;  3DD4 A;  4QJ3 B;  1WRL A;  3ZWH A;  1AK8 A;  2AUC A;  2BL0 C;  1SNL A;  2HPS A;  1N65 A;  1M45 A;  2KHN A;  2KNE A;  4HRH A;  1FW4 A;  4PCW A;  1K90 D;  2JU0 A;  1JUO A;  4MSP A;  2CCM A;  3VGO A;  1Y6W A;  2BCB A;  1VRK A;  3SJS A;  4A4B A;  4N1G A;  4P5O E;  4GBA A;  1H4B A;  1NYA A;  2M29 A;  5CSF A;  3TDZ A;  3LK0 A;  1A75 A;  1CLM A;  1DGV A;  1EG4 A;  2F33 A;  4CLN A;  2BCA A;  3MSE B;  3LCP C;  1XVJ A;  3CTN A;  1Y1A A;  4I5N B;  3EKH A;  4XJK B;  2NZ0 A;  4PE0 A;  3KF9 A;  1IJ6 A;  2I94 A;  1RWY A;  2BBM A;  2CTN A;  1YX7 A;  2P6B B;  1NCY A;  1J7Q A;  4MLW A;  5HLO A;  1KFX S;  3JVT C;  1JF2 A;  1F54 A;  2BCX A;  2F2P A;  1B1G A;  3CZT X;  1QV1 A;  2LUX A;  2K7B A;  2M97 A;  1RFJ A;  2KI4 C;  2SCP A;  3BUW B;  4AOM A;  4OVN F;  3DVE A;  4GAO A;  3TDU A;  4USL A;  5ER4 X;  2HQW A;  1LIN A;  1QTX A;  1QS7 A;  2BBN A;  2LLT A;  2O5G A;  3CWG A;  1A03 A;  3K21 A;  3CR4 X;  2IS9 A;  1TNX A;  2HF5 A;  1J1D A;  4FQO A;  3PAL A;  2WC8 A;  1SR6 C;  1CM4 A;  3FWC A;  1SCM B;  1TCO B;  3FWB A;  3TUY C;  2LLU A;  3ICB A;  1YVH A;  1HT9 A;  3FS7 A;  4OR9 B;  2K8M B;  3KPX A;  1CLL A;  3KO0 A;  2K7C A;  3VRP A;  1JFJ A;  3O4Y A;  1SL8 A;  1JSA A;  4MN0 A;  4NQG A;  1A4P A;  5AFP A;  1C7W A;  1Y1X A;  5KSZ A;  4M2Q A;  1OMV A;  1UHH A;  2LLS A;  1S6I A;  1GJY A;  1QX7 A;  4YGE B;  2WND A;  3I5F B;  1BMO A;  1ALV A;  1OMR A;  1UHI A;  1DJZ A;  1SY9 A;  1AP4 A;  1KFU S;  2JNX A;  1ALW A;  1DF0 B;  4I5L B;  3CS1 A;  2TN4 A;  2L2E A;  1SKT A;  1W7J B;  1JBA A;  3GK4 X;  1OZO A;  2MA2 A;  1TNP A;  4MRX A;  1BU3 A;  2COL B;  4HRG A;  4QJ4 B;  1PSB A;  2KBM A;  1CDN A;  3O6B A;  1B7T Y;  1ODB A;  1YTZ C;  1R2U A;  1RTP 1;  2JC2 A;  5TNC A;  4JQ0 D;  3HCM A;  1UUS A;  1YRU B;  2E6W A;  4YGC B;  1KCY A;  1QIV A;  2MLF C;  1FI6 A;  2L5X B;  1QX2 A;  1UHN A;  3BUO B;  1G4Y R;  1ZAC A;  5HKY A;  1BT6 A;  4R1E A;  1ZUZ A;  1XFW O;  1S3P A;  2JWW A;  1OSA A;  1AJ5 A;  3EVR A;  4I5K A;  4WQ3 A;  3WNX B;  1MQ1 A;  3SG5 A;  3PLF B;  4JPZ B;  1CFF A;  5DKR A;  1DJI A;  2LCP A;  5CSI A;  4DCK A;  1K9U A;  4MBE A;  2NLN A;  2JXL A;  1SW8 A;  2KQY A;  2M7L A;  1BF5 A;  1YVL A;  1PVB A;  1CDM A;  3DF0 A;  4N5X A;  4OKH A;  4GNK B;  2LUC A;  2ZKM X;  3E3R A;  3AAJ A;  2L50 A;  5DKN A;  1SK6 D;  3QRX A;  1DT7 B;  1UP5 A;  4MEW A;  1SRA A;  3D10 A;  4BY5 A;  1CNP A;  1FPW A;  2M3W A;  3DVK A;  1ZMZ A;  1S36 A;  1WDC B;  3I5G C;  2NCO A;  2NCP A;  3DVJ A;  3IF7 A;  2M1K B;  1KSO A;  4TNC A;  1QIW A;  3KEV A;  3O78 A;  2OTG B;  1XK4 C;  4M2P A;  1QVI Z;  1CFC A;  2JTT A;  4PE1 A;  1LKJ A;  1TTX A;  3HX4 A;  2Y1N A;  1PUL A;  2BE6 A;  1KWO B;  3I5I B;  1LA0 A;  2K7D A;  4L9M A;  1S1E A;  1XYD A;  2LVJ A;  3GK2 A;  4YGD B;  2L98 A;  1NUB A;  1GQM A;  4F0Z B;  3JTD B;  5I2O A;  3AKA A;  1NCZ A;  3OHM B;  4HRE E;  1CB1 A;  1G33 A;  1A75 B;  4CFR A;  3VRR A;  1S5G Y;  3LK1 A;  2JT0 A;  1XO5 A;  4BY4 A;  1KK7 Z;  1R6P A;  2HQ8 A;  2MAZ A;  4NDD A;  1BOC A;  1K94 A;  1U5I A;  2M0R A;  2VRG A;  1MUX A;  1CM1 A;  3NSI A;  1B8L A;  1BOD A;  1F55 A;  1QLK A;  2KGR A;  1L2O C;  5AEQ A;  5JOL A;  1QAS A;  1DGU A;  1CDP A;  2QPT A;  1OE9 B;  3PN7 C;  3SIB A;  2FCE A;  4PHM A;  3EK4 A;  1BR1 B;  2BKI B;  3EVV A;  2L51 A;  2KI6 C;  2LAP A;  2OTG C;  1BLQ A;  5FYX A;  1QXP A;  4GFT A;  1YUR A;  1FI5 A;  1PRW A;  2L4I A;  1RRO A;  2LE9 B;  2JNF A;  1NIW A;  4D1E A;  1NX2 A; 
#chains in the Genus database with same CATH topology
 3WHU B;  3L47 A;  3R1P A;  3VRQ A;  4YI9 A;  3CZ2 A;  1NCX A;  1SPY A;  1S6J A;  1M31 A;  1UWO A;  2D8N A;  3PAT A;  5J3X A;  4A4C A;  3S0E A;  1SBJ A;  3BFB A;  1FBV A;  2JTZ A;  1DJY A;  2LP3 A;  1CDL A;  3EKJ A;  4IL1 A;  3LLE A;  3UO9 A;  2LVK A;  3B86 A;  3D73 A;  3GK1 A;  3A4U B;  3CYZ A;  5I8N A;  3NGV A;  2QEV A;  3PFV A;  1DTL A;  1SCV A;  4NDB A;  1CFD A;  4PAL A;  1KQV A;  2Y4Q A;  5CSJ A;  1K95 A;  1QVI Y;  4F7F A;  2JPO A;  3CAB A;  1SL7 A;  2I2R E;  2MRD A;  5HYD A;  3VRN A;  2JT8 A;  4PHJ A;  5JJG A;  1C7V A;  1IJ5 A;  5F6T A;  1ZFS A;  1V1G A;  3B7A A;  1CKK A;  1NX3 A;  2QEB A;  5G08 A;  3SG7 A;  4ZCV A;  1MWN A;  3C1V A;  1IH0 A;  2A4J A;  4MZJ A;  5AXI A;  1K2H A;  2KFF A;  3OX5 A;  5BPJ A;  1TCF A;  1XFZ O;  1S26 D;  3IQO A;  1Z2C B;  3BFA A;  3H4S E;  3IQQ A;  1H8B A;  1WLZ A;  2K7O A;  4CPV A;  5EL2 A;  2ZN8 A;  1SCM C;  4GPL B;  3ZNI A;  2OS8 B;  3CGA A;  3L4L A;  3LL8 B;  3S0B A;  2CT9 A;  1J1E A;  3OP0 A;  1AUI B;  2KAV A;  1CMG A;  2BKH B;  4ETO A;  2M8U A;  4ORA B;  1KK8 B;  1JFK A;  3M0W A;  2LNK A;  2HET A;  2FOT A;  1B8C A;  2JT3 A;  3FE9 A;  4P2Y B;  1OMD A;  3OB2 B;  2FJY A;  1DJH A;  4AQJ A;  2K0J A;  1W7I B;  5AER A;  2BL0 B;  4YRU A;  3PJI A;  3TS5 B;  1NWD A;  3BUM B;  1F71 A;  2JUL A;  3NSO A;  3I5F C;  2O60 A;  2BE4 A;  2ZFD A;  1C3Y A;  1DJX A;  1QX5 B;  4GGF C;  2LM5 A;  2WCK A;  4ICB A;  2NXQ A;  4NDC A;  2PMY A;  4PDZ A;  1IQ5 A;  2MHH A;  1AJ4 A;  2I18 A;  4MZL A;  1RK9 A;  2H61 C;  4PHK A;  3I5H B;  2KYF A;  2KAX A;  3DF0 B;  1NPQ A;  2JOJ A;  1M46 A;  2LMU A;  1YRT B;  2LV7 A;  3DYE A;  1WLM A;  1WY9 A;  3WHT B;  2ZND A;  1GGW A;  3CZ0 A;  2JQ6 A;  3BXK A;  1PK0 D;  1KFX L;  3R72 A;  3SS5 A;  5HL1 A;  1XFX O;  3BQ3 A;  4YI8 A;  3NXA A;  1YUS A;  1SYM A;  3DXL A;  5K89 A;  1C3Z A;  2Y5I A;  1TNQ A;  5DKQ A;  1X02 A;  4C0J A;  1BR4 B;  2GGM A;  3JVT B;  5HLV A;  4JWQ A;  3VRO A;  2M49 B;  1XFU O;  1DJG A;  1MR8 A;  5HKZ A;  1PSR A;  2AMI A;  3BOW A;  2E30 A;  1F4Q A;  2OS8 C;  3L4A A;  1M39 A;  3D0Y A;  1CTR A;  1MXL C;  1C07 A;  1KK8 C;  2MBX A;  3BUN B;  1DMO A;  1DVI A;  1F8H A;  3A8R A;  3NHI A;  2FJU B;  5D7F A;  5CSN A;  3BUX B;  1YR5 A;  2ISD A;  3TS5 C;  1OZS A;  1A29 A;  1BG1 A;  1TOP A;  3D75 A;  2FCD A;  2R2I A;  1IQ3 A;  3AAK A;  2JZI A;  1GGZ A;  2MJW B;  4HSZ A;  1B4C A;  1U5I B;  1B7T Z;  1SR6 B;  1M63 B;  4XYN A;  2PVB A;  3I5H C;  2PAS A;  3F45 A;  4QJ5 B;  1NP8 A;  3OGN A;  2JPT A;  2KLE A;  1RJV A;  4N1F A;  3TUY B;  1CLB A;  2LVV A;  3OX6 A;  1AHR A;  1E8A A;  2B1U A;  1WDC C;  2V53 A;  1QJT A;  5I2L A;  3UNW A;  2WOR A;  4XJK A;  1S6C A;  3S0A A;  1CFP A;  1NSH A;  3B87 A;  1IRJ A;  1L7Z A;  1KFU L;  3D76 A;  3TZ1 A;  1K9K A;  1K93 D;  1TUJ A;  3BYA A;  3D78 A;  1Y1U A;  4JKT A;  2Y1M A;  2Q91 A;  1CMF A;  1B9A A;  1QWV A;  1BJF A;  1P28 A;  1WRK A;  2WCJ A;  4CID A;  2SAS A;  2EC6 B;  2P70 A;  3D74 A;  3I5I C;  1EJ3 A;  1KWO C;  3S0D A;  4YGB B;  4ZCU A;  3NSL A;  1K8U A;  3B88 A;  1G8I A;  1OOJ A;  4WQ2 A;  3PSR A;  1Y0V H;  3PM8 A;  3JTD C;  3FIA A;  2LHL A;  5CPV A;  4DIR A;  1EH2 A;  1Q80 A;  2GV5 A;  2PRU A;  1YX8 A;  2PYQ A;  1SSE B;  2DOQ A;  2L0P A;  2M1U A;  5I94 A;  4E68 A;  1SMG A;  2PSR A;  2KQ6 A;  2WC6 A;  1J7P A;  4UPG A;  1F70 A;  1TIZ A;  4CFQ A;  2LP2 A;  3EK8 A;  1GM0 A;  3AKB A;  1KQM B;  2KFG A;  1A2X A;  1PAL A;  1B47 A;  3OBV A;  2KFH A;  4ORC B;  1PVA A;  3CDN A;  1QV0 A;  1YUT A;  1DC1 A;  2KGB C;  4FQT A;  1LA3 A;  1NX1 A;  1TWO A;  1V1F A;  2F3Y A;  2K2A A;  2JXC A;  2RGI A;  3D77 A;  4DRW A;  5I2Q A;  2CNP A;  2PAL A;  3S0F A;  1LVC D;  1TRF A;  2AAO A;  5HKW A;  3BFH A;  1REC A;  1MXE A;  4WRI A;  1DJW A;  2GTE A;  4C0K A;  2OPO A;  1WRZ A;  3CR5 X;  5KTY A;  5PAL A;  1IKU A;  1J7R A;  2F8P A;  1IIO A;  1F4O A;  5D69 A;  1QLS A;  5GQQ C;  3IVT A;  4GGF A;  3DVM A;  4PE4 A;  2KSP A;  1IGV A;  2H2K A;  1DF0 A;  2CBL A;  2EC6 C;  2H61 A;  2LMV A;  2GGZ A;  4OV2 A;  2LC5 A;  1S5G Z;  2EGD A;  2ZNE A;  3DY9 A;  3O2P A;  2KAY A;  4DUQ A;  2KI6 D;  1MHO A;  3NSK A;  1K96 A;  1IG5 A;  1KK7 Y;  2ZN9 A;  3SG6 A;  3SG3 A;  4PT1 A;  4MRY A;  1ZOT B;  2LAN A;  3K1E A;  2PQL A;  1T14 A;  1K9P A;  3KHE A;  3I5G B;  1NX0 A;  4Q04 A;  1EG3 A;  1JWD A;  1TN4 A;  1JC2 A;  1XK4 A;  2G2B A;  2LMT A;  4M2O A;  2K2F A;  2KYC A;  2MLE C;  2KOT A;  1UHJ A;  1MF8 B;  1N2D A;  1OQP A;  2BEC A;  1KQM C;  2JRF A;  2F2O A;  3EVU A;  3RLZ A;  2EHB A;  1HQV A;  1B8R A;  1OW4 A;  3DZT A;  2WCL A;  4YGA A;  2I7A A;  1J55 A;  2KDH A;  2WCB A;  1DEL A;  1OOI X;  1KSM A;  5KU1 A;  1J7O A;  1OOG A;  1OOF A;  3GOF A;  1IWQ A;  2LHI A;  5ER5 A;  4PE7 A;  2K61 A;  2WCF A;  3TDI A;  3OB1 B;  2P71 A;  1XA5 A;  1FF1 A;  2KPH A;  4MVF A;  3EK7 A;  5AAN A;  4GUK A;  3O4X A;  4FTG A;  3CLN A;  5B8I B;  4GGN A;  4KYN A;  3SIA A;  3SG2 A;  4MZK A;  1JF0 A;  2LVI A;  2KBI A;  4U8D A;  2L4H A;  1QAT A;  4OCI A;  2ZRT A;  2M7N A;  1YUU A;  2Q4U A;  2QAC A;  4PHN A;  4AQI A;  4C0L A;  1XFY O;  4YBH B;  1LXF C;  2F3Z A;  2M9G A;  1D1O A;  3RM1 A;  1EL4 A;  2WCH A;  2ZRS A;  2G9B A;  2WOS A;  1L2O B;  3SG4 A;  1XFV O;  2WCE A;  1AVS A;  4ORB B;  1N0Y A;  1EXR A;  3BOW B;  1UHK A;  1SL9 A;  4I5J A;  2KI4 B;  3PN7 B;  3WXA A;  4DS7 A;  3D0Y B;  3CR2 A;  5IBW A;  1TNW A;  2CXJ A;  1UUR A;  3DD4 A;  4QJ3 B;  2L2C A;  1WRL A;  1Z4H A;  3ZWH A;  1AK8 A;  2ERB A;  2AUC A;  2BL0 C;  1SNL A;  2HPS A;  1N65 A;  2WC5 A;  1M45 A;  2KHN A;  2KNE A;  1ORG A;  4HRH A;  1FW4 A;  4PCW A;  1K90 D;  2JU0 A;  1JUO A;  3Q8I A;  4MSP A;  2CCM A;  2KLD A;  1Y6W A;  2BCB A;  1VRK A;  1W9Z A;  3SJS A;  3VGO A;  3S0G A;  1LS8 A;  5FI6 A;  4A4B A;  4N1G A;  4P5O E;  3V2L A;  4GBA A;  1H4B A;  1NYA A;  2M29 A;  5CSF A;  3TDZ A;  3LK0 A;  1A75 A;  1CLM A;  1DGV A;  1EG4 A;  2F33 A;  3QME A;  4CLN A;  2BCA A;  3MSE B;  3LCP C;  4INW A;  1XVJ A;  3CTN A;  5DIC A;  1Y1A A;  4I5N B;  3EKH A;  4XJK B;  2NZ0 A;  4PE0 A;  3KF9 A;  1IJ6 A;  2I94 A;  1RWY A;  2BBM A;  2CTN A;  1YX7 A;  2P6B B;  1NCY A;  1J7Q A;  4MLW A;  5HLO A;  1KFX S;  3JVT C;  3R1V A;  3PM2 A;  1JF2 A;  1F54 A;  2BCX A;  2F2P A;  1B1G A;  3CZT X;  1QV1 A;  2LUX A;  2K7B A;  2M97 A;  1RFJ A;  2KI4 C;  2SCP A;  3BUW B;  4AOM A;  4OVN F;  3DVE A;  4GAO A;  3TDU A;  4USL A;  5ER4 X;  2HQW A;  1LIN A;  5FI7 A;  1QTX A;  1QS7 A;  2BBN A;  2LLT A;  2O5G A;  3CWG A;  1A03 A;  3K21 A;  3CR4 X;  2IS9 A;  1TNX A;  2HF5 A;  1J1D A;  4FQO A;  3PAL A;  2WC8 A;  1SR6 C;  3VB1 A;  1CM4 A;  3FWC A;  1SCM B;  1TCO B;  3FWB A;  3TUY C;  2LLU A;  3FE6 A;  3ICB A;  1YVH A;  1HT9 A;  3FS7 A;  4OR9 B;  2K8M B;  3KPX A;  1CLL A;  3KO0 A;  2K7C A;  3VRP A;  1JFJ A;  3O4Y A;  1SL8 A;  1JSA A;  4MN0 A;  4NQG A;  1A4P A;  5AFP A;  1C7W A;  1Y1X A;  3BJH A;  5KSZ A;  4M2Q A;  1OMV A;  1UHH A;  2LLS A;  1S6I A;  1GJY A;  1QX7 A;  4YGE B;  2WND A;  3I5F B;  1BMO A;  1ALV A;  1OMR A;  1XFR A;  3RZS A;  1UHI A;  1DJZ A;  1OOH A;  1SY9 A;  1AP4 A;  1KFU S;  2JNX A;  1ALW A;  1DF0 B;  4I5L B;  3CS1 A;  2TN4 A;  2L2E A;  1SKT A;  1W7J B;  1JBA A;  3R1O A;  3GK4 X;  5FI2 A;  1OZO A;  2MA2 A;  3CZ1 A;  1TNP A;  4MRX A;  1BU3 A;  2COL B;  4HRG A;  4QJ4 B;  1PSB A;  3NHT A;  2KBM A;  3N7H A;  1CDN A;  3O6B A;  1B7T Y;  1ODB A;  1YTZ C;  4OZD A;  1R2U A;  1RTP 1;  2JC2 A;  5TNC A;  4JQ0 D;  3HCM A;  1UUS A;  1DQE A;  1YRU B;  2E6W A;  4YGC B;  1KCY A;  1QIV A;  2MLF C;  2YGU A;  2QEH A;  1FI6 A;  2L5X B;  1QX2 A;  1UHN A;  3BUO B;  1G4Y R;  1ZAC A;  5HKY A;  5D3O A;  1BT6 A;  4R1E A;  3SS3 A;  1ZUZ A;  1XFW O;  1S3P A;  2K60 A;  2JWW A;  1OSA A;  1AJ5 A;  2QDI A;  3EVR A;  4I5K A;  4WQ3 A;  1DEK A;  3WNX B;  1MQ1 A;  2BAP A;  3SG5 A;  3PLF B;  2H8V A;  4JPZ B;  1CFF A;  5DKR A;  1DJI A;  2LCP A;  5CSI A;  4DCK A;  1K9U A;  4MBE A;  2NLN A;  2JXL A;  1SW8 A;  2KQY A;  2M7L A;  2L5Y A;  1BF5 A;  1YVL A;  1PVB A;  1CDM A;  3DF0 A;  4N5X A;  4OKH A;  4GNK B;  2LUC A;  2ZKM X;  3E3R A;  3AAJ A;  2L50 A;  5DKN A;  1SK6 D;  3QRX A;  1TUZ A;  1UP5 A;  4MEW A;  1SRA A;  3D10 A;  4BY5 A;  1DT7 B;  2WCM A;  1CNP A;  1FPW A;  2M3W A;  3DVK A;  1ZMZ A;  1S36 A;  1WDC B;  3I5G C;  2NCO A;  2NCP A;  3B6X A;  3DVJ A;  3IF7 A;  2M1K B;  1KSO A;  4TNC A;  1QIW A;  3KEV A;  3O78 A;  2OTG B;  1XK4 C;  4JD9 A;  4M2P A;  1QVI Z;  3EG5 B;  1CFC A;  2JTT A;  4PE1 A;  1LKJ A;  1TTX A;  3HX4 A;  2Y1N A;  2QEO A;  1PUL A;  2BE6 A;  1KWO B;  3I5I B;  1LA0 A;  2K7D A;  4L9M A;  1S1E A;  1XYD A;  2LVJ A;  3GK2 A;  4YGD B;  2L98 A;  1NUB A;  1GQM A;  4F0Z B;  3JTD B;  5I2O A;  4IJ7 A;  3AKA A;  1NCZ A;  3OHM B;  4HRE E;  1CB1 A;  1G33 A;  1A75 B;  4CFR A;  3VRR A;  1S5G Y;  3LK1 A;  2JT0 A;  1XO5 A;  3FE8 A;  4BY4 A;  1KK7 Z;  1R6P A;  2HQ8 A;  2MAZ A;  4NDD A;  1BOC A;  1K94 A;  1U5I A;  2M0R A;  2VRG A;  1MUX A;  4INX A;  1CM1 A;  3NSI A;  1B8L A;  1BOD A;  1F55 A;  1QLK A;  2KGR A;  1L2O C;  5AEQ A;  5JOL A;  1QAS A;  1DGU A;  1CDP A;  2QPT A;  1OE9 B;  3PN7 C;  3SIB A;  2FCE A;  4PHM A;  3EK4 A;  4D1E A;  1BR1 B;  2BKI B;  2BNX A;  3EVV A;  2L51 A;  2KI6 C;  2LAP A;  2OTG C;  1BLQ A;  5FYX A;  1QXP A;  4GFT A;  1YUR A;  1FI5 A;  1PRW A;  2L4I A;  1RRO A;  2LE9 B;  2JNF A;  1NIW A;  3SS4 A;  1NX2 A; 
#chains in the Genus database with same CATH homology
 3WHU B;  3VRQ A;  4YI9 A;  1NCX A;  1SPY A;  1S6J A;  1M31 A;  1UWO A;  2D8N A;  3PAT A;  5J3X A;  4A4C A;  1SBJ A;  1FBV A;  2JTZ A;  1DJY A;  2LP3 A;  1CDL A;  3EKJ A;  4IL1 A;  3LLE A;  2LVK A;  3GK1 A;  3A4U B;  5I8N A;  3PFV A;  1DTL A;  1SCV A;  4NDB A;  1CFD A;  4PAL A;  1KQV A;  2Y4Q A;  5CSJ A;  1K95 A;  1QVI Y;  1SL7 A;  2I2R E;  2MRD A;  5HYD A;  3VRN A;  2JT8 A;  4PHJ A;  5JJG A;  1C7V A;  1IJ5 A;  5F6T A;  1ZFS A;  1V1G A;  1CKK A;  1NX3 A;  5G08 A;  3SG7 A;  4ZCV A;  1MWN A;  3C1V A;  1IH0 A;  2A4J A;  4MZJ A;  5AXI A;  1K2H A;  2KFF A;  3OX5 A;  5BPJ A;  1TCF A;  1XFZ O;  1S26 D;  3IQO A;  3H4S E;  3IQQ A;  1H8B A;  1WLZ A;  2K7O A;  4CPV A;  2ZN8 A;  1SCM C;  4GPL B;  3ZNI A;  2OS8 B;  3CGA A;  3LL8 B;  2CT9 A;  1J1E A;  3OP0 A;  1AUI B;  2KAV A;  1CMG A;  2BKH B;  4ETO A;  2M8U A;  4ORA B;  1KK8 B;  1JFK A;  3M0W A;  2LNK A;  2HET A;  2FOT A;  1B8C A;  2JT3 A;  4P2Y B;  1OMD A;  3OB2 B;  4AQJ A;  1DJH A;  2K0J A;  1W7I B;  5AER A;  2BL0 B;  4YRU A;  3TS5 B;  1NWD A;  3BUM B;  1F71 A;  2JUL A;  3NSO A;  3I5F C;  2O60 A;  2BE4 A;  2ZFD A;  1DJX A;  1QX5 B;  4GGF C;  2LM5 A;  4ICB A;  4PDZ A;  2NXQ A;  4NDC A;  2PMY A;  1IQ5 A;  2MHH A;  1AJ4 A;  2I18 A;  4MZL A;  1RK9 A;  2H61 C;  4PHK A;  3I5H B;  2KYF A;  2KAX A;  3DF0 B;  1NPQ A;  2JOJ A;  1M46 A;  2LMU A;  1YRT B;  2LV7 A;  1WLM A;  1WY9 A;  3WHT B;  2ZND A;  1GGW A;  2JQ6 A;  3BXK A;  1PK0 D;  1KFX L;  1XFX O;  3BQ3 A;  4YI8 A;  3NXA A;  1YUS A;  1SYM A;  5K89 A;  2Y5I A;  1TNQ A;  5DKQ A;  1X02 A;  4C0J A;  1BR4 B;  2GGM A;  3JVT B;  5HLV A;  4JWQ A;  3VRO A;  2M49 B;  1XFU O;  1DJG A;  1MR8 A;  5HKZ A;  1PSR A;  2AMI A;  3BOW A;  2E30 A;  1F4Q A;  2OS8 C;  1M39 A;  3D0Y A;  1CTR A;  1MXL C;  1C07 A;  1KK8 C;  2MBX A;  3BUN B;  1DMO A;  1DVI A;  1F8H A;  3A8R A;  2FJU B;  5D7F A;  5CSN A;  3BUX B;  1YR5 A;  2ISD A;  3TS5 C;  1OZS A;  1A29 A;  1BG1 A;  1TOP A;  1IQ3 A;  2FCD A;  2R2I A;  3AAK A;  2JZI A;  1GGZ A;  2MJW B;  4HSZ A;  1B4C A;  1U5I B;  1B7T Z;  1SR6 B;  1M63 B;  4XYN A;  2PVB A;  3I5H C;  2PAS A;  3F45 A;  4QJ5 B;  1NP8 A;  4N1F A;  2JPT A;  3TUY B;  1RJV A;  1CLB A;  2LVV A;  3OX6 A;  1AHR A;  1E8A A;  2B1U A;  1WDC C;  2V53 A;  1QJT A;  5I2L A;  2WOR A;  4XJK A;  1S6C A;  1CFP A;  1NSH A;  1IRJ A;  1L7Z A;  1KFU L;  3TZ1 A;  1K9K A;  1K93 D;  3BYA A;  1Y1U A;  2Y1M A;  2Q91 A;  1CMF A;  1B9A A;  1BJF A;  1WRK A;  4CID A;  2SAS A;  2EC6 B;  3I5I C;  1EJ3 A;  1KWO C;  4YGB B;  4ZCU A;  3NSL A;  1K8U A;  1G8I A;  1OOJ A;  4WQ2 A;  3PSR A;  1Y0V H;  3PM8 A;  3JTD C;  3FIA A;  2LHL A;  5CPV A;  4DIR A;  1EH2 A;  1Q80 A;  2GV5 A;  2PRU A;  1YX8 A;  2DOQ A;  2L0P A;  2M1U A;  4E68 A;  1SMG A;  2PSR A;  2KQ6 A;  1J7P A;  1F70 A;  4UPG A;  1TIZ A;  4CFQ A;  2LP2 A;  3EK8 A;  3AKB A;  1KQM B;  2KFG A;  1A2X A;  1PAL A;  1B47 A;  2KFH A;  4ORC B;  1PVA A;  1QV0 A;  1YUT A;  2KGB C;  1LA3 A;  1NX1 A;  1V1F A;  2F3Y A;  2K2A A;  2RGI A;  2JXC A;  4DRW A;  5I2Q A;  2CNP A;  2PAL A;  1LVC D;  1TRF A;  2AAO A;  5HKW A;  1REC A;  1MXE A;  4WRI A;  1DJW A;  4C0K A;  2OPO A;  1WRZ A;  3CR5 X;  5KTY A;  5PAL A;  1IKU A;  1J7R A;  2F8P A;  1F4O A;  5D69 A;  1QLS A;  5GQQ C;  4GGF A;  3DVM A;  4PE4 A;  2KSP A;  1IGV A;  2H2K A;  1DF0 A;  2CBL A;  2EC6 C;  2H61 A;  2LMV A;  2GGZ A;  4OV2 A;  2LC5 A;  1S5G Z;  2EGD A;  2ZNE A;  3O2P A;  4DUQ A;  2KAY A;  2KI6 D;  1MHO A;  3NSK A;  1K96 A;  1IG5 A;  1KK7 Y;  2ZN9 A;  3SG6 A;  3SG3 A;  4MRY A;  1ZOT B;  2LAN A;  1K9P A;  3KHE A;  3I5G B;  1NX0 A;  4Q04 A;  1EG3 A;  1JWD A;  1TN4 A;  1JC2 A;  1XK4 A;  2G2B A;  2LMT A;  4M2O A;  2K2F A;  2KYC A;  2MLE C;  2KOT A;  1UHJ A;  1MF8 B;  1N2D A;  1OQP A;  2BEC A;  1KQM C;  2JRF A;  2F2O A;  3EVU A;  3RLZ A;  2EHB A;  1HQV A;  1B8R A;  4YGA A;  2I7A A;  1J55 A;  2KDH A;  2WCB A;  1KSM A;  5KU1 A;  1J7O A;  3GOF A;  1IWQ A;  2LHI A;  5ER5 A;  4PE7 A;  2K61 A;  2WCF A;  3TDI A;  3OB1 B;  1XA5 A;  1FF1 A;  5AAN A;  4MVF A;  3EK7 A;  4GUK A;  4FTG A;  3CLN A;  5B8I B;  4GGN A;  3SIA A;  3SG2 A;  4MZK A;  1JF0 A;  2LVI A;  2KBI A;  4U8D A;  2L4H A;  1QAT A;  4OCI A;  2ZRT A;  2M7N A;  1YUU A;  2Q4U A;  2QAC A;  4PHN A;  4AQI A;  4C0L A;  1XFY O;  4YBH B;  1LXF C;  2F3Z A;  2M9G A;  1D1O A;  3RM1 A;  1EL4 A;  2ZRS A;  2G9B A;  2WOS A;  1L2O B;  3SG4 A;  1XFV O;  2WCE A;  1AVS A;  4ORB B;  1N0Y A;  1EXR A;  3BOW B;  1UHK A;  1SL9 A;  4I5J A;  2KI4 B;  3PN7 B;  3WXA A;  4DS7 A;  3D0Y B;  3CR2 A;  5IBW A;  1TNW A;  2CXJ A;  1UUR A;  3DD4 A;  4QJ3 B;  1WRL A;  3ZWH A;  1AK8 A;  2AUC A;  2BL0 C;  1SNL A;  2HPS A;  1N65 A;  1M45 A;  2KHN A;  2KNE A;  4HRH A;  1FW4 A;  4PCW A;  1K90 D;  2JU0 A;  1JUO A;  4MSP A;  2CCM A;  3VGO A;  1Y6W A;  2BCB A;  1VRK A;  3SJS A;  4A4B A;  4N1G A;  4P5O E;  4GBA A;  1H4B A;  1NYA A;  2M29 A;  5CSF A;  3TDZ A;  3LK0 A;  1A75 A;  1CLM A;  1DGV A;  1EG4 A;  2F33 A;  4CLN A;  2BCA A;  3MSE B;  3LCP C;  1XVJ A;  3CTN A;  1Y1A A;  4I5N B;  3EKH A;  4XJK B;  2NZ0 A;  4PE0 A;  3KF9 A;  1IJ6 A;  2I94 A;  1RWY A;  2BBM A;  2CTN A;  1YX7 A;  2P6B B;  1NCY A;  1J7Q A;  4MLW A;  5HLO A;  1KFX S;  3JVT C;  1JF2 A;  1F54 A;  2BCX A;  2F2P A;  1B1G A;  3CZT X;  1QV1 A;  2LUX A;  2K7B A;  2M97 A;  1RFJ A;  2KI4 C;  2SCP A;  3BUW B;  4AOM A;  4OVN F;  3DVE A;  4GAO A;  3TDU A;  4USL A;  5ER4 X;  2HQW A;  1LIN A;  1QTX A;  1QS7 A;  2BBN A;  2LLT A;  2O5G A;  3CWG A;  1A03 A;  3K21 A;  3CR4 X;  2IS9 A;  1TNX A;  2HF5 A;  1J1D A;  4FQO A;  3PAL A;  2WC8 A;  1SR6 C;  1CM4 A;  3FWC A;  1SCM B;  1TCO B;  3FWB A;  3TUY C;  2LLU A;  3ICB A;  1YVH A;  1HT9 A;  3FS7 A;  4OR9 B;  2K8M B;  3KPX A;  1CLL A;  3KO0 A;  2K7C A;  3VRP A;  1JFJ A;  3O4Y A;  1SL8 A;  1JSA A;  4MN0 A;  4NQG A;  1A4P A;  5AFP A;  1C7W A;  1Y1X A;  5KSZ A;  4M2Q A;  1OMV A;  1UHH A;  2LLS A;  1S6I A;  1GJY A;  1QX7 A;  4YGE B;  2WND A;  3I5F B;  1BMO A;  1ALV A;  1OMR A;  1UHI A;  1DJZ A;  1SY9 A;  1AP4 A;  1KFU S;  2JNX A;  1ALW A;  1DF0 B;  4I5L B;  3CS1 A;  2TN4 A;  2L2E A;  1SKT A;  1W7J B;  1JBA A;  3GK4 X;  1OZO A;  2MA2 A;  1TNP A;  4MRX A;  1BU3 A;  2COL B;  4HRG A;  4QJ4 B;  1PSB A;  2KBM A;  1CDN A;  3O6B A;  1B7T Y;  1ODB A;  1YTZ C;  1R2U A;  1RTP 1;  2JC2 A;  5TNC A;  4JQ0 D;  3HCM A;  1UUS A;  1YRU B;  2E6W A;  4YGC B;  1KCY A;  1QIV A;  2MLF C;  1FI6 A;  2L5X B;  1QX2 A;  1UHN A;  3BUO B;  1G4Y R;  1ZAC A;  5HKY A;  1BT6 A;  4R1E A;  1ZUZ A;  1XFW O;  1S3P A;  2JWW A;  1OSA A;  1AJ5 A;  3EVR A;  4I5K A;  4WQ3 A;  3WNX B;  1MQ1 A;  3SG5 A;  3PLF B;  4JPZ B;  1CFF A;  5DKR A;  1DJI A;  2LCP A;  5CSI A;  4DCK A;  1K9U A;  4MBE A;  2NLN A;  2JXL A;  1SW8 A;  2KQY A;  2M7L A;  1BF5 A;  1YVL A;  1PVB A;  1CDM A;  3DF0 A;  4N5X A;  4OKH A;  4GNK B;  2LUC A;  2ZKM X;  3E3R A;  3AAJ A;  2L50 A;  5DKN A;  1SK6 D;  3QRX A;  1DT7 B;  1UP5 A;  4MEW A;  1SRA A;  3D10 A;  4BY5 A;  1CNP A;  1FPW A;  2M3W A;  3DVK A;  1ZMZ A;  1S36 A;  1WDC B;  3I5G C;  2NCO A;  2NCP A;  3DVJ A;  3IF7 A;  2M1K B;  1KSO A;  4TNC A;  1QIW A;  3KEV A;  3O78 A;  2OTG B;  1XK4 C;  4M2P A;  1QVI Z;  1CFC A;  2JTT A;  4PE1 A;  1LKJ A;  1TTX A;  3HX4 A;  2Y1N A;  1PUL A;  2BE6 A;  1KWO B;  3I5I B;  1LA0 A;  2K7D A;  4L9M A;  1S1E A;  1XYD A;  2LVJ A;  3GK2 A;  4YGD B;  2L98 A;  1NUB A;  1GQM A;  4F0Z B;  3JTD B;  5I2O A;  3AKA A;  1NCZ A;  3OHM B;  4HRE E;  1CB1 A;  1G33 A;  1A75 B;  4CFR A;  3VRR A;  1S5G Y;  3LK1 A;  2JT0 A;  1XO5 A;  4BY4 A;  1KK7 Z;  1R6P A;  2HQ8 A;  2MAZ A;  4NDD A;  1BOC A;  1K94 A;  1U5I A;  2M0R A;  2VRG A;  1MUX A;  1CM1 A;  3NSI A;  1B8L A;  1BOD A;  1F55 A;  1QLK A;  2KGR A;  1L2O C;  5AEQ A;  5JOL A;  1QAS A;  1DGU A;  1CDP A;  2QPT A;  1OE9 B;  3PN7 C;  3SIB A;  2FCE A;  4PHM A;  3EK4 A;  1BR1 B;  2BKI B;  3EVV A;  2L51 A;  2KI6 C;  2LAP A;  2OTG C;  1BLQ A;  5FYX A;  1QXP A;  4GFT A;  1YUR A;  1FI5 A;  1PRW A;  2L4I A;  1RRO A;  2LE9 B;  2JNF A;  1NIW A;  4D1E A;  1NX2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...