1AVSA

X-ray crystallographic study of calcium-saturated n-terminal domain of troponin c
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
81
structure length
81
Chain Sequence
b'QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TROPONIN C
publication title Structural details of a calcium-induced molecular switch: X-ray crystallographic analysis of the calcium-saturated N-terminal domain of troponin C at 1.75 A resolution.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Muscle contraction
total genus 25
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1avsA00
2VRGA 2LV7A 3CS1A 5DKQA 1B1GA 2M1UA 1JFJA 1K96A 2JNXA 2LMVA 4AQJA 1M46A 1F4OA 1Y6WA 2KFFA 3D10A 1XK4C 4OR9B 1DGVA 4HRGA 1XFYO 2WC8A 5HKWA 3CR4X 3SG3A 2FOTA 1QX2A 2OS8B 4MZKA 1CM4A 2SASA 3LK0A 4YGEB 3VROA 2I2RE 2MJWB 1GJYA 4ETOA 1PVAA 1EG3A 1TNXA 1EG4A 1MHOA 1UUSA 2M8UA 1XFXO 1G33A 2F2OA 3CR5X 3RM1A 2KI6C 4MZLA 2KYFA 3I5HC 3ZWHA 1NX2A 1KFXS 1UHNA 1B8RA 2KDHA 2KQYA 4GAOA 1XA5A 1KFXL 1NX3A 4BY5A 2BE6A 2R2IA 1V1GA 3F45A 2LANA 1JC2A 1K2HA 1CDMA 3C1VA 5AEQA 4OV2A 1JWDA 5J3XA 1NIWA 1U5IB 3NSKA 1BLQA 1SL9A 1K9PA 2JRFA 1WLMA 1W7IB 2JT3A 1IQ5A 2LLUA 2LUCA 5B8IB 4D1EA 4P5OE 1TRFA 3CTNA 1XFVO 2E6WA 2JC2A 1WRZA 2AUCA 1OZOA 1K90D 2WCEA 2ZRSA 2Q4UA 1S6IA 2ZN9A 2LHIA 3D0YA 3PLFB 2CT9A 2BCBA 1DJYA 1M31A 1N0YA 1XFWO 4PDZA 2LP2A 2E30A 2PSRA 3JVTB 1B8CA 3PM8A 2HQ8A 1CFCA 1YVHA 1AK8A 1K9KA 2JXLA 1KSOA 1KK7Y 2OS8C 1DJWA 2LVIA 2MRDA 1NSHA 4TNCA 1LVCD 2I94A 3LLEA 5DKNA 1DVIA 1KWOB 1QTXA 1WRLA 3PFVA 2D8NA 5HKZA 1SCVA 1V1FA 4L9MA 4WQ2A 3AAKA 1S6JA 2PASA 4DRWA 1J7OA 1LKJA 1XK4A 3EK7A 1J7RA 1BR4B 2Y5IA 4GGFC 3GK2A 3WNXB 1XVJA 3BYAA 3WHTB 4N1GA 1SK6D 1UHKA 2I7AA 2L5XB 1UP5A 1JFKA 5CSJA 2HETA 3PSRA 4CFRA 2MLEC 1RFJA 2NCOA 4YGAA 4A4BA 1EJ3A 1AUIB 3OHMB 3EVUA 4Q04A 1KFUS 5CSNA 1CB1A 4PHKA 2FCDA 1KFUL 1XO5A 1QLSA 2JPTA 1JUOA 3A8RA 5PALA 2KFGA 2AMIA 4MVFA 4XJKB 1OMVA 2QACA 3CZTX 4YGCB 1EXRA 4AOMA 5HLOA 2BL0B 2Y1MA 2BECA 5G08A 3TDUA 1A75A 2PMYA 1IH0A 4PHJA 1UURA 1HT9A 2O5GA 2CXJA 5AFPA 1BMOA 4OKHA 2GGMA 3I5FB 3I5GB 3WHUB 4NDDA 1F4QA 4MSPA 2CBLA 5ER5A 1QS7A 3SIAA 2HPSA 3SG5A 5HKYA 3TDIA 1NCXA 2KGBC 3JVTC 1TNPA 1MQ1A 3RLZA 3AAJA 1GQMA 2BE4A 1A4PA 1J7QA 3LL8B 2M7NA 2G9BA 2JQ6A 4NDBA 1RECA 3IQOA 2ZFDA 2KAYA 1PSBA 1BT6A 3CR2A 3NSOA 1YUSA 2L0PA 5KSZA 5BPJA 1BR1B 2EGDA 1KQMB 4MZJA 1CFFA 4CFQA 4PE0A 1JF2A 4I5JA 1XFUO 2LCPA 1WRKA 2F2PA 3NSIA 1S1EA 1KCYA 1M45A 3BQ3A 1BJFA 3OB1B 1YUTA 4BY4A 1S5GZ 2Y1NA 3DVKA 2L4IA 4ORBB 5GQQC 1ZMZA 2WORA 1SPYA 1PVBA 1YURA 2KI6D 1SL7A 1RJVA 1IJ5A 2LAPA 2L50A 3O2PA 1DJXA 3SG2A 4QJ3B 5D69A 1CFPA 2SCPA 2ZKMX 4P2YB 5AANA 4XYNA 4GGFA 3EKHA 1FPWA 1TTXA 4MLWA 2KSPA 1TNWA 3TZ1A 1WDCB 2K7DA 1PK0D 5KU1A 1YUUA 2BL0C 4C0LA 5AXIA 3O4YA 4N5XA 3TDZA 3BUNB 1S26D 3JTDB 1FI5A 3MSEB 2LC5A 1MXEA 2KYCA 1ALVA 1Y0VH 2ZNDA 1OZSA 2M49B 3I5GC 3I5FC 2M7LA 2OTGB 1U5IA 3I5IB 2MHHA 1SMGA 1QJTA 2F33A 2L51A 4DIRA 1B7TY 4PE4A 1DMOA 1NWDA 3NSLA 1SRAA 1ZACA 4HREE 5CSIA 5AERA 2F8PA 3BUXB 1IRJA 2K2FA 2A4JA 1MXLC 2HF5A 4MN0A 1CLLA 1WLZA 1JSAA 1CMGA 2GGZA 3O6BA 4GFTA 1B4CA 1SBJA 1KQMC 2LVJA 2JULA 4MBEA 1J1DA 2KGRA 2MA2A 2CTNA 1AJ4A 4YGBB 2COLB 1S36A 3PN7B 1SCMC 3K21A 1S6CA 1FW4A 1EL4A 1EH2A 1L2OB 3DVJA 2JXCA 2K8MB 2KBMA 1YVLA 2LVKA 1QASA 2ZRTA 3OX5A 2M0RA 1OQPA 3DD4A 2LE9B 2LLTA 3EK8A 3IF7A 1BOCA 1NCZA 1Y1AA 2BKIB 2M3WA 1WDCC 2EHBA 3BOWB 3FIAA 3SG6A 1LXFC 2L4HA 3JTDC 5I2LA 1GGWA 2LLSA 2QPTA 3GK4X 1SW8A 3DF0B 3WXAA 3OX6A 1MF8B 3HCMA 3AKBA 5I2OA 4PE7A 2AAOA 2FJUB 2OTGC 3HX4A 5FYXA 3I5IC 2JNFA 3OP0A 2DOQA 1FBVA 2KAVA 3H4SE 4XJKA 1UHHA 1QLKA 3FWBA 1PULA 2M9GA 2BBNA 4ORCB 3VGOA 1QVIZ 4C0JA 1KK7Z 2H61C 3EK4A 1DF0B 1ZFSA 2WCBA 2LMUA 1YR5A 3ZNIA 4F0ZB 4GGNA 1TNQA 2HQWA 1IKUA 2BKHB 1HQVA 1B8LA 4JPZB 1FI6A 1DT7B 3SJSA 1F54A 5K89A 4CPVA 2ZN8A 1F70A 1M63B 1QXPA 1AJ5A 2KBIA 3PN7C 1S3PA 1JF0A 2M1KB 1SR6B 1L2OC 1A2XA 4QJ5B 2JWWA 1CKKA 1WY9A 2K7CA 3KO0A 1TIZA 4NDCA 1UHJA 5ER4X 2CCMA 2P6BB 1CNPA 4U8DA 1QV0A 3KHEA 1XYDA 3SG4A 2JTTA 2M29A 1QATA 3NXAA 3CWGA 2FCEA 4PHNA 2MAZA 1PRWA 3ICBA 4ICBA 2LMTA 1QV1A 3AKAA 3PALA 1ZOTB 1IGVA 4YI9A 1CM1A 1QIWA 4I5KA 1NX0A 1F55A 4WRIA 1S5GY 1Y1XA 3KEVA 4ORAB 4OVNF 4AQIA 1SCMB 1KQVA 1DJZA 3VRRA 1Y1UA 2MLFC 1TOPA 4GBAA 1ALWA 2ZNEA 2MBXA 1D1OA 1CLBA 5TNCA 3BUWB 3TS5B 1JBAA 5I2QA 2NZ0A 2KOTA 4E68A 2BCAA 2Q91A 4N1FA 3EVRA 2ISDA 2JU0A 2RGIA 1J7PA 1R2UA 4YBHB 1IG5A 5F6TA 1KK8B 1N65A 1DJHA 1ZUZA 1DTLA 1G4YR 4WQ3A 1YTZC 5IBWA 4YGDB 1SR6C 2H61A 1XFZO 2NXQA 1ODBA 1K9UA 3GK1A 4UPGA 3VRQA 1YX7A 2NLNA 1OSAA 1OE9B 4OCIA 3VRNA 3FS7A 1YX8A 1BF5A 2K0JA 1GGZA 2JT8A 1LA3A 1J1EA 1F71A 2OPOA 4FQOA 4R1EA 1IJ6A 2NCPA 1DJIA 1YRUB 3A4UB 4PCWA 3TUYB 4C0KA 1CMFA 3O78A 4MEWA 1DGUA 2BCXA 3KPXA 4DUQA 2WOSA 4M2OA 4I5NB 1CTRA 3VRPA 1SNLA 2B1UA 2K7OA 1KSMA 2PVBA 2K7BA 1CDLA 4ZCUA 1K8UA 1A29A 3BOWA 1B7TZ 1FF1A 2JTZA 3EKJA 3TS5C 1BODA 4DCKA 2JOJA 4JQ0D 1H8BA 2CNPA 3DF0A 2EC6B 1NX1A 3BUMB 3SIBA 4GUKA 2PRUA 1BG1A 1KK8C 1CDPA 2K2AA 4CIDA 4ZCVA 1IWQA 1TCFA 3M0WA 4I5LB 4JWQA 4PE1A 4YRUA 1PSRA 4MRXA 3GOFA 1K94A 1K93D 4A4CA 3E3RA 2WCFA 5HLVA 1QX7A 1DF0A 3OB2B 1AP4A 3PATA 4NQGA 1NYAA 1QVIY 1AHRA 3BUOB 1C7VA 1CLMA 4DS7A 3D0YB 1N2DA 3KF9A 3DVMA 4M2PA 1OOJA 1PALA 3BXKA 2KI4B 2F3YA 1UHIA 1UWOA 1RTP1 1SKTA 2KHNA 2O60A 1IQ3A 1B9AA 1F8HA 1L7ZA 1E8AA 2V53A 3IQQA 5D7FA 3TUYC 1J55A 1VRKA 4GPLB 5I8NA 3SG7A 2K61A 1W7JB 5DKRA 4HRHA 4CLNA 4PALA 1Q80A 1CDNA 1M39A 1TN4A 5JJGA 2IS9A 2H2KA 4MRYA 1RROA 4QJ4B 1MWNA 1QX5B 1SL8A 1A03A 2GV5A 4PHMA 2LUXA 3CLNA 2M97A 1RK9A 2G2BA 2LHLA 2EC6C 4GNKB 3QRXA 1NUBA 2JT0A 3CGAA 1NP8A 1RWYA 2F3ZA 1C07A 4HSZA 1DJGA 2LP3A 5CPVA 4IL1A 2Y4QA 3LCPC 2LVVA 2TN4A 5JOLA 5CSFA 1SY9A 1BU3A 1SYMA 2JZIA 4FTGA 3I5HB 2KFHA 1NPQA 2I18A 1B47A 1R6PA 1LA0A 1A75B 1AVSA 3FWCA 3LK1A 1NCYA 5KTYA 2WNDA 1CFDA 1QIVA 2LNKA 4YI8A 1OMDA 2KI4C 1KWOC 1X02A 1MR8A 1K95A 2KAXA 2PALA 4M2QA 2L98A 3EVVA 1MUXA 4USLA 1LINA 1TCOB 2KQ6A 1C7WA 2L2EA 1OMRA 3DVEA 1H4BA 1G8IA 2LM5A 2KNEA 2BBMA 5HYDA 1YRTB
chains in the Genus database with same CATH superfamily
2VRGA 3B88A 2LV7A 3CS1A 5DKQA 3R1OA 1B1GA 2M1UA 1JFJA 3QMEA 1K96A 2JNXA 2LMVA 4AQJA 1M46A 1F4OA 1Y6WA 2KFFA 3D10A 1XK4C 4OR9B 3DY9A 1DGVA 4HRGA 1XFYO 2WC8A 5HKWA 3CR4X 3SG3A 2FOTA 1QX2A 2OS8B 4MZKA 1QWVA 1CM4A 2SASA 3LK0A 2WCLA 4YGEB 3VROA 2I2RE 2MJWB 1GJYA 4ETOA 1PVAA 1EG3A 1TNXA 1EG4A 1MHOA 1UUSA 2M8UA 1XFXO 1ORGA 1G33A 2F2OA 2GTEA 3CR5X 3RM1A 2KI6C 4MZLA 2KYFA 3I5HC 3L4AA 3ZWHA 1NX2A 1KFXS 1UHNA 1B8RA 2KDHA 2KQYA 4GAOA 1XA5A 1KFXL 1NX3A 4BY5A 2BE6A 2R2IA 1V1GA 3F45A 2LANA 1JC2A 1K2HA 1CDMA 3C1VA 3D76A 5AEQA 4OV2A 1JWDA 5J3XA 1NIWA 1U5IB 3NSKA 1BLQA 1SL9A 1K9PA 2JRFA 1WLMA 1W7IB 2JT3A 1IQ5A 2LLUA 2LUCA 5B8IB 1OOGA 4P5OE 4D1EA 3SS3A 1TRFA 3CTNA 1XFVO 2E6WA 2JC2A 3UO9A 1WRZA 2QEOA 2AUCA 1OZOA 1K90D 2WCEA 5FI6A 2ZRSA 2Q4UA 1S6IA 2ZN9A 2LHIA 3D0YA 3PLFB 2CT9A 2BCBA 1DJYA 1M31A 1N0YA 1XFWO 4PDZA 2LP2A 2E30A 2PSRA 3D78A 3JVTB 1B8CA 3PM8A 2HQ8A 5DICA 1YVHA 1AK8A 1K9KA 2JXLA 1KSOA 1KK7Y 2OS8C 3N7HA 1DJWA 2LVIA 2MRDA 1NSHA 4TNCA 1LVCD 2I94A 3LLEA 5DKNA 1DVIA 1KWOB 1QTXA 1WRLA 2WCKA 2D8NA 3PFVA 5HKZA 1DC1A 1SCVA 1V1FA 4L9MA 4WQ2A 3AAKA 1S6JA 2PASA 4DRWA 1J7OA 1LKJA 1XK4A 3EK7A 1J7RA 1BR4B 2Y5IA 1SSEB 3GK2A 4GGFC 3WNXB 4KYNA 1XVJA 3BYAA 3WHTB 4N1GA 1SK6D 1UHKA 2I7AA 2L5XB 3RZSA 1UP5A 1JFKA 5CSJA 2HETA 3PSRA 4CFRA 2MLEC 1RFJA 2NCOA 4YGAA 4A4BA 1EJ3A 1AUIB 3OHMB 3EVUA 4Q04A 1KFUS 5CSNA 1CB1A 4PHKA 2FCDA 1KFUL 1XO5A 1QLSA 2JPTA 1JUOA 3A8RA 5PALA 2KFGA 2AMIA 4MVFA 4XJKB 1OMVA 2QACA 3CZTX 3O4XA 4JKTA 4YGCB 1EXRA 4AOMA 5HLOA 2BL0B 2Y1MA 2BECA 1LS8A 5G08A 3TDUA 1A75A 2PMYA 1IH0A 4PHJA 1UURA 1T14A 1HT9A 2O5GA 2CXJA 5AFPA 1BMOA 4OKHA 2GGMA 3I5FB 3I5GB 1P28A 3WHUB 4NDDA 1F4QA 4MSPA 2CBLA 5ER5A 1QS7A 3SIAA 2HPSA 3SG5A 5HKYA 3TDIA 1NCXA 2KGBC 3JVTC 1TNPA 1MQ1A 3RLZA 3AAJA 1GQMA 2BE4A 1A4PA 1J7QA 3LL8B 2M7NA 1TUZA 2G9BA 4PT1A 2JQ6A 4NDBA 1RECA 3IQOA 2ZFDA 2KAYA 1PSBA 1BT6A 2QEHA 3CR2A 1YUSA 3NSOA 2L0PA 2WC5A 5KSZA 5BPJA 1BR1B 2EGDA 3CZ1A 3DZTA 1KQMB 4MZJA 1CFFA 4OZDA 4CFQA 4PE0A 1JF2A 1OOFA 2L5YA 4I5JA 1XFUO 2LCPA 1WRKA 2F2PA 3NSIA 1S1EA 1KCYA 1M45A 3BQ3A 1BJFA 3OB1B 1YUTA 3FE6A 4BY4A 1S5GZ 2Y1NA 3DVKA 2L4IA 4ORBB 1DQEA 1ZMZA 2WORA 3FE8A 5GQQC 1SPYA 1PVBA 1YURA 2KI6D 1SL7A 1RJVA 1IJ5A 2LAPA 2L50A 3O2PA 1DJXA 3SG2A 4QJ3B 5D69A 1CFPA 2SCPA 1OOIX 2ZKMX 4P2YB 5AANA 3R1VA 4XYNA 4GGFA 3EKHA 1FPWA 1TTXA 4MLWA 2KSPA 1TNWA 3TZ1A 1WDCB 2K7DA 1PK0D 5KU1A 1YUUA 2BL0C 4C0LA 5AXIA 3O4YA 4N5XA 3TDZA 3BUNB 1S26D 3JTDB 1FI5A 3OBVA 3MSEB 2LC5A 1MXEA 2KYCA 3PJIA 3SS4A 1ALVA 1Y0VH 1OW4A 2ZNDA 1OZSA 2M49B 3I5GC 3I5FC 2M7LA 2OTGB 3PM2A 1U5IA 3I5IB 2MHHA 3V2LA 3NHIA 1SMGA 1QJTA 2F33A 2L51A 4DIRA 1B7TY 4PE4A 2WCHA 1NWDA 3NSLA 1DMOA 1SRAA 1ZACA 4HREE 5CSIA 5AERA 2F8PA 3BUXB 1IRJA 2K2FA 3BFBA 2A4JA 1MXLC 2HF5A 4MN0A 1CLLA 1WLZA 2P70A 3SS5A 1JSAA 1CMGA 2GGZA 3O6BA 4GFTA 1DELA 1B4CA 1SBJA 1KQMC 3UNWA 2LVJA 2JULA 4MBEA 1J1DA 2KGRA 2MA2A 2CTNA 1AJ4A 4YGBB 2COLB 1S36A 3B6XA 3IVTA 3PN7B 1SCMC 3K21A 1S6CA 1FW4A 1EL4A 1EH2A 1L2OB 3DVJA 2JXCA 2K8MB 2KBMA 1YVLA 2LVKA 1QASA 3R72A 2ZRTA 3OX5A 2M0RA 1OQPA 3DD4A 2LE9B 2LLTA 3EK8A 3IF7A 4JD9A 1NCZA 1BOCA 1Y1AA 2BKIB 2M3WA 2QEBA 1WDCC 2EHBA 3BOWB 3FIAA 3SG6A 1LXFC 2L4HA 3JTDC 3DYEA 5I2LA 1GGWA 2LLSA 2QPTA 3GK4X 1SW8A 3DF0B 3WXAA 3OX6A 1MF8B 3HCMA 3AKBA 5I2OA 4PE7A 2AAOA 2FJUB 2OTGC 3HX4A 3EG5B 4INXA 5FYXA 3I5IC 2JNFA 3OP0A 2DOQA 1FBVA 5FI2A 2KAVA 3H4SE 4XJKA 1UHHA 1QLKA 3CZ2A 1PULA 2M9GA 2BBNA 1TWOA 3FWBA 4ORCB 3VGOA 1QVIZ 4C0JA 1KK7Z 2H61C 1DEKA 3EK4A 3BFAA 1DF0B 1ZFSA 2WCBA 1C3ZA 2LMUA 3CYZA 1YR5A 3ZNIA 4F0ZB 4IJ7A 4GGNA 1TNQA 2HQWA 1IKUA 2BKHB 1HQVA 1B8LA 4JPZB 1FI6A 1DT7B 4FQTA 3SJSA 1F54A 5K89A 3S0DA 4CPVA 3DXLA 2ZN8A 1F70A 1M63B 1QXPA 1AJ5A 2KBIA 3R1PA 3PN7C 1S3PA 1JF0A 2M1KB 1SR6B 1L2OC 3D75A 1A2XA 4QJ5B 2JWWA 3S0FA 1CKKA 1WY9A 2K7CA 3KO0A 1TIZA 4NDCA 1UHJA 5ER4X 5FI7A 2CCMA 2P6BB 1CNPA 4U8DA 1QV0A 3KHEA 1C3YA 1XYDA 3SG4A 2BNXA 2JTTA 2M29A 1QATA 3NXAA 5I94A 3CWGA 2FCEA 4PHNA 2MAZA 1PRWA 3D73A 3ICBA 4ICBA 2LMTA 1QV1A 3AKAA 3PALA 1ZOTB 1IGVA 4YI9A 1CM1A 1QIWA 4I5KA 1NX0A 3OGNA 1F55A 4WRIA 1S5GY 1Y1XA 3KEVA 4ORAB 4OVNF 4AQIA 1SCMB 1KQVA 1DJZA 3VRRA 1Y1UA 2MLFC 3S0BA 1TOPA 3B7AA 4GBAA 2FJYA 1ALWA 2ZNEA 2MBXA 1D1OA 1CLBA 2ERBA 5TNCA 3BUWB 3TS5B 1JBAA 5I2QA 2NZ0A 2KOTA 4E68A 1CFCA 1W9ZA 2BCAA 2Q91A 4N1FA 3EVRA 2ISDA 2JU0A 3K1EA 2RGIA 1J7PA 1R2UA 3CABA 1IG5A 4YBHB 5F6TA 2WCJA 1KK8B 1N65A 1DJHA 1ZUZA 3B86A 4F7FA 1DTLA 1G4YR 2QDIA 4WQ3A 1YTZC 1OOHA 5EL2A 5IBWA 4YGDB 1SR6C 2H61A 1XFZO 2NXQA 1ODBA 3B87A 1K9UA 3D77A 3GK1A 4UPGA 3BJHA 3VRQA 1IIOA 1YX7A 2NLNA 1OSAA 1OE9B 3S0AA 4OCIA 3VRNA 2PYQA 3FS7A 1YX8A 1BF5A 2K0JA 1GGZA 3L47A 2JT8A 1LA3A 1J1EA 1F71A 1Z4HA 2OPOA 4FQOA 4R1EA 3S0GA 1IJ6A 2NCPA 1DJIA 1YRUB 3A4UB 4PCWA 3TUYB 4C0KA 1CMFA 3O78A 4MEWA 1DGUA 2BCXA 3KPXA 4DUQA 1GM0A 3NHTA 2WOSA 4M2OA 3FE9A 4I5NB 1CTRA 3VRPA 1SNLA 2KLDA 2B1UA 2K7OA 1KSMA 2PVBA 2K7BA 1CDLA 4ZCUA 1K8UA 3CZ0A 1A29A 3BOWA 4INWA 1B7TZ 1FF1A 2JTZA 3EKJA 3TS5C 1BODA 4DCKA 2JOJA 4JQ0D 1H8BA 2CNPA 3DF0A 2EC6B 1NX1A 3BUMB 1XFRA 3SIBA 4GUKA 2PRUA 1BG1A 1KK8C 1CDPA 2K2AA 2WC6A 4CIDA 4ZCVA 1IWQA 1TCFA 3M0WA 4I5LB 4JWQA 2JPOA 4PE1A 4YRUA 1PSRA 4MRXA 3GOFA 1K94A 1K93D 4A4CA 3E3RA 2K60A 2WCFA 5HLVA 1QX7A 1DF0A 3OB2B 1AP4A 3PATA 4NQGA 1NYAA 1QVIY 1AHRA 3BUOB 1C7VA 1CLMA 4DS7A 3D0YB 1N2DA 3D74A 3KF9A 3DVMA 4M2PA 3VB1A 1OOJA 1PALA 3BXKA 2KI4B 2F3YA 1UHIA 1UWOA 3BFHA 1RTP1 1SKTA 2KHNA 2O60A 1IQ3A 1B9AA 1F8HA 1TUJA 1L7ZA 1E8AA 2V53A 3IQQA 5D7FA 3Q8IA 3TUYC 2BAPA 1J55A 3NGVA 1VRKA 4GPLB 5I8NA 3SG7A 2K61A 1W7JB 5DKRA 2P71A 4HRHA 4CLNA 4PALA 1Q80A 1CDNA 1M39A 1TN4A 5JJGA 2IS9A 2H2KA 2QEVA 1RROA 4MRYA 4QJ4B 1MWNA 1QX5B 1SL8A 2YGUA 1A03A 2GV5A 4PHMA 2LUXA 2PQLA 3CDNA 3CLNA 2M97A 1RK9A 2G2BA 2LHLA 2EC6C 4GNKB 3QRXA 1NUBA 2JT0A 3CGAA 1NP8A 1RWYA 2F3ZA 1C07A 4HSZA 1DJGA 2LP3A 3S0EA 5CPVA 4IL1A 2Y4QA 3LCPC 5HL1A 2LVVA 2TN4A 5D3OA 5JOLA 5CSFA 1SY9A 1BU3A 1SYMA 2JZIA 4FTGA 3I5HB 2KFHA 1NPQA 2I18A 1B47A 1R6PA 1LA0A 1A75B 1AVSA 3FWCA 3LK1A 2KLEA 1NCYA 5KTYA 3L4LA 2WNDA 1CFDA 1QIVA 2H8VA 2LNKA 4YI8A 1OMDA 2KI4C 1KWOC 1X02A 1MR8A 1K95A 2KAXA 2PALA 2WCMA 2L2CA 2L98A 3EVVA 1MUXA 4M2QA 4USLA 1LINA 2KPHA 1Z2CB 1TCOB 2KQ6A 1C7WA 2L2EA 1OMRA 3DVEA 1H4BA 1G8IA 2LM5A 2KNEA 2BBMA 5HYDA 1YRTB
chains in the Genus database with same CATH topology
2VRGA 2LV7A 3CS1A 5DKQA 1B1GA 2M1UA 1JFJA 1K96A 2JNXA 2LMVA 4AQJA 1M46A 1F4OA 1Y6WA 2KFFA 3D10A 1XK4C 4OR9B 1DGVA 4HRGA 1XFYO 2WC8A 5HKWA 3CR4X 3SG3A 2FOTA 1QX2A 2OS8B 4MZKA 1CM4A 2SASA 3LK0A 4YGEB 3VROA 2I2RE 2MJWB 1GJYA 4ETOA 1PVAA 1EG3A 1TNXA 1EG4A 1MHOA 1UUSA 2M8UA 1XFXO 1G33A 2F2OA 3CR5X 3RM1A 2KI6C 4MZLA 2KYFA 3I5HC 3ZWHA 1NX2A 1KFXS 1UHNA 1B8RA 2KDHA 2KQYA 4GAOA 1XA5A 1KFXL 1NX3A 4BY5A 2BE6A 2R2IA 1V1GA 3F45A 2LANA 1JC2A 1K2HA 1CDMA 3C1VA 5AEQA 4OV2A 1JWDA 5J3XA 1NIWA 1U5IB 3NSKA 1BLQA 1SL9A 1K9PA 2JRFA 1WLMA 1W7IB 2JT3A 1IQ5A 2LLUA 2LUCA 5B8IB 4D1EA 4P5OE 1TRFA 3CTNA 1XFVO 2E6WA 2JC2A 1WRZA 2AUCA 1OZOA 1K90D 2WCEA 2ZRSA 2Q4UA 1S6IA 2ZN9A 2LHIA 3D0YA 3PLFB 2CT9A 2BCBA 1DJYA 1M31A 1N0YA 1XFWO 4PDZA 2LP2A 2E30A 2PSRA 3JVTB 1B8CA 3PM8A 2HQ8A 1CFCA 1YVHA 1AK8A 1K9KA 2JXLA 1KSOA 1KK7Y 2OS8C 1DJWA 2LVIA 2MRDA 1NSHA 4TNCA 1LVCD 2I94A 3LLEA 5DKNA 1DVIA 1KWOB 1QTXA 1WRLA 3PFVA 2D8NA 5HKZA 1SCVA 1V1FA 4L9MA 4WQ2A 3AAKA 1S6JA 2PASA 4DRWA 1J7OA 1LKJA 1XK4A 3EK7A 1J7RA 1BR4B 2Y5IA 4GGFC 3GK2A 3WNXB 1XVJA 3BYAA 3WHTB 4N1GA 1SK6D 1UHKA 2I7AA 2L5XB 1UP5A 1JFKA 5CSJA 2HETA 3PSRA 4CFRA 2MLEC 1RFJA 2NCOA 4YGAA 4A4BA 1EJ3A 1AUIB 3OHMB 3EVUA 4Q04A 1KFUS 5CSNA 1CB1A 4PHKA 2FCDA 1KFUL 1XO5A 1QLSA 2JPTA 1JUOA 3A8RA 5PALA 2KFGA 2AMIA 4MVFA 4XJKB 1OMVA 2QACA 3CZTX 4YGCB 1EXRA 4AOMA 5HLOA 2BL0B 2Y1MA 2BECA 5G08A 3TDUA 1A75A 2PMYA 1IH0A 4PHJA 1UURA 1HT9A 2O5GA 2CXJA 5AFPA 1BMOA 4OKHA 2GGMA 3I5FB 3I5GB 3WHUB 4NDDA 1F4QA 4MSPA 2CBLA 5ER5A 1QS7A 3SIAA 2HPSA 3SG5A 5HKYA 3TDIA 1NCXA 2KGBC 3JVTC 1TNPA 1MQ1A 3RLZA 3AAJA 1GQMA 2BE4A 1A4PA 1J7QA 3LL8B 2M7NA 2G9BA 2JQ6A 4NDBA 1RECA 3IQOA 2ZFDA 2KAYA 1PSBA 1BT6A 3CR2A 3NSOA 1YUSA 2L0PA 5KSZA 5BPJA 1BR1B 2EGDA 1KQMB 4MZJA 1CFFA 4CFQA 4PE0A 1JF2A 4I5JA 1XFUO 2LCPA 1WRKA 2F2PA 3NSIA 1S1EA 1KCYA 1M45A 3BQ3A 1BJFA 3OB1B 1YUTA 4BY4A 1S5GZ 2Y1NA 3DVKA 2L4IA 4ORBB 5GQQC 1ZMZA 2WORA 1SPYA 1PVBA 1YURA 2KI6D 1SL7A 1RJVA 1IJ5A 2LAPA 2L50A 3O2PA 1DJXA 3SG2A 4QJ3B 5D69A 1CFPA 2SCPA 2ZKMX 4P2YB 5AANA 4XYNA 4GGFA 3EKHA 1FPWA 1TTXA 4MLWA 2KSPA 1TNWA 3TZ1A 1WDCB 2K7DA 1PK0D 5KU1A 1YUUA 2BL0C 4C0LA 5AXIA 3O4YA 4N5XA 3TDZA 3BUNB 1S26D 3JTDB 1FI5A 3MSEB 2LC5A 1MXEA 2KYCA 1ALVA 1Y0VH 2ZNDA 1OZSA 2M49B 3I5GC 3I5FC 2M7LA 2OTGB 1U5IA 3I5IB 2MHHA 1SMGA 1QJTA 2F33A 2L51A 4DIRA 1B7TY 4PE4A 1DMOA 1NWDA 3NSLA 1SRAA 1ZACA 4HREE 5CSIA 5AERA 2F8PA 3BUXB 1IRJA 2K2FA 2A4JA 1MXLC 2HF5A 4MN0A 1CLLA 1WLZA 1JSAA 1CMGA 2GGZA 3O6BA 4GFTA 1B4CA 1SBJA 1KQMC 2LVJA 2JULA 4MBEA 1J1DA 2KGRA 2MA2A 2CTNA 1AJ4A 4YGBB 2COLB 1S36A 3PN7B 1SCMC 3K21A 1S6CA 1FW4A 1EL4A 1EH2A 1L2OB 3DVJA 2JXCA 2K8MB 2KBMA 1YVLA 2LVKA 1QASA 2ZRTA 3OX5A 2M0RA 1OQPA 3DD4A 2LE9B 2LLTA 3EK8A 3IF7A 1BOCA 1NCZA 1Y1AA 2BKIB 2M3WA 1WDCC 2EHBA 3BOWB 3FIAA 3SG6A 1LXFC 2L4HA 3JTDC 5I2LA 1GGWA 2LLSA 2QPTA 3GK4X 1SW8A 3DF0B 3WXAA 3OX6A 1MF8B 3HCMA 3AKBA 5I2OA 4PE7A 2AAOA 2FJUB 2OTGC 3HX4A 5FYXA 3I5IC 2JNFA 3OP0A 2DOQA 1FBVA 2KAVA 3H4SE 4XJKA 1UHHA 1QLKA 3FWBA 1PULA 2M9GA 2BBNA 4ORCB 3VGOA 1QVIZ 4C0JA 1KK7Z 2H61C 3EK4A 1DF0B 1ZFSA 2WCBA 2LMUA 1YR5A 3ZNIA 4F0ZB 4GGNA 1TNQA 2HQWA 1IKUA 2BKHB 1HQVA 1B8LA 4JPZB 1FI6A 1DT7B 3SJSA 1F54A 5K89A 4CPVA 2ZN8A 1F70A 1M63B 1QXPA 1AJ5A 2KBIA 3PN7C 1S3PA 1JF0A 2M1KB 1SR6B 1L2OC 1A2XA 4QJ5B 2JWWA 1CKKA 1WY9A 2K7CA 3KO0A 1TIZA 4NDCA 1UHJA 5ER4X 2CCMA 2P6BB 1CNPA 4U8DA 1QV0A 3KHEA 1XYDA 3SG4A 2JTTA 2M29A 1QATA 3NXAA 3CWGA 2FCEA 4PHNA 2MAZA 1PRWA 3ICBA 4ICBA 2LMTA 1QV1A 3AKAA 3PALA 1ZOTB 1IGVA 4YI9A 1CM1A 1QIWA 4I5KA 1NX0A 1F55A 4WRIA 1S5GY 1Y1XA 3KEVA 4ORAB 4OVNF 4AQIA 1SCMB 1KQVA 1DJZA 3VRRA 1Y1UA 2MLFC 1TOPA 4GBAA 1ALWA 2ZNEA 2MBXA 1D1OA 1CLBA 5TNCA 3BUWB 3TS5B 1JBAA 5I2QA 2NZ0A 2KOTA 4E68A 2BCAA 2Q91A 4N1FA 3EVRA 2ISDA 2JU0A 2RGIA 1J7PA 1R2UA 4YBHB 1IG5A 5F6TA 1KK8B 1N65A 1DJHA 1ZUZA 1DTLA 1G4YR 4WQ3A 1YTZC 5IBWA 4YGDB 1SR6C 2H61A 1XFZO 2NXQA 1ODBA 1K9UA 3GK1A 4UPGA 3VRQA 1YX7A 2NLNA 1OSAA 1OE9B 4OCIA 3VRNA 3FS7A 1YX8A 1BF5A 2K0JA 1GGZA 2JT8A 1LA3A 1J1EA 1F71A 2OPOA 4FQOA 4R1EA 1IJ6A 2NCPA 1DJIA 1YRUB 3A4UB 4PCWA 3TUYB 4C0KA 1CMFA 3O78A 4MEWA 1DGUA 2BCXA 3KPXA 4DUQA 2WOSA 4M2OA 4I5NB 1CTRA 3VRPA 1SNLA 2B1UA 2K7OA 1KSMA 2PVBA 2K7BA 1CDLA 4ZCUA 1K8UA 1A29A 3BOWA 1B7TZ 1FF1A 2JTZA 3EKJA 3TS5C 1BODA 4DCKA 2JOJA 4JQ0D 1H8BA 2CNPA 3DF0A 2EC6B 1NX1A 3BUMB 3SIBA 4GUKA 2PRUA 1BG1A 1KK8C 1CDPA 2K2AA 4CIDA 4ZCVA 1IWQA 1TCFA 3M0WA 4I5LB 4JWQA 4PE1A 4YRUA 1PSRA 4MRXA 3GOFA 1K94A 1K93D 4A4CA 3E3RA 2WCFA 5HLVA 1QX7A 1DF0A 3OB2B 1AP4A 3PATA 4NQGA 1NYAA 1QVIY 1AHRA 3BUOB 1C7VA 1CLMA 4DS7A 3D0YB 1N2DA 3KF9A 3DVMA 4M2PA 1OOJA 1PALA 3BXKA 2KI4B 2F3YA 1UHIA 1UWOA 1RTP1 1SKTA 2KHNA 2O60A 1IQ3A 1B9AA 1F8HA 1L7ZA 1E8AA 2V53A 3IQQA 5D7FA 3TUYC 1J55A 1VRKA 4GPLB 5I8NA 3SG7A 2K61A 1W7JB 5DKRA 4HRHA 4CLNA 4PALA 1Q80A 1CDNA 1M39A 1TN4A 5JJGA 2IS9A 2H2KA 4MRYA 1RROA 4QJ4B 1MWNA 1QX5B 1SL8A 1A03A 2GV5A 4PHMA 2LUXA 3CLNA 2M97A 1RK9A 2G2BA 2LHLA 2EC6C 4GNKB 3QRXA 1NUBA 2JT0A 3CGAA 1NP8A 1RWYA 2F3ZA 1C07A 4HSZA 1DJGA 2LP3A 5CPVA 4IL1A 2Y4QA 3LCPC 2LVVA 2TN4A 5JOLA 5CSFA 1SY9A 1BU3A 1SYMA 2JZIA 4FTGA 3I5HB 2KFHA 1NPQA 2I18A 1B47A 1R6PA 1LA0A 1A75B 1AVSA 3FWCA 3LK1A 1NCYA 5KTYA 2WNDA 1CFDA 1QIVA 2LNKA 4YI8A 1OMDA 2KI4C 1KWOC 1X02A 1MR8A 1K95A 2KAXA 2PALA 4M2QA 2L98A 3EVVA 1MUXA 4USLA 1LINA 1TCOB 2KQ6A 1C7WA 2L2EA 1OMRA 3DVEA 1H4BA 1G8IA 2LM5A 2KNEA 2BBMA 5HYDA 1YRTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VRG A;  2LV7 A;  3CS1 A;  5DKQ A;  1B1G A;  2M1U A;  1JFJ A;  1K96 A;  2JNX A;  2LMV A;  4AQJ A;  1M46 A;  1F4O A;  1Y6W A;  2KFF A;  3D10 A;  1XK4 C;  4OR9 B;  1DGV A;  4HRG A;  1XFY O;  2WC8 A;  5HKW A;  3CR4 X;  3SG3 A;  2FOT A;  1QX2 A;  2OS8 B;  4MZK A;  1CM4 A;  2SAS A;  3LK0 A;  4YGE B;  3VRO A;  2I2R E;  2MJW B;  1GJY A;  4ETO A;  1PVA A;  1EG3 A;  1TNX A;  1EG4 A;  1MHO A;  1UUS A;  2M8U A;  1XFX O;  1G33 A;  2F2O A;  3CR5 X;  3RM1 A;  2KI6 C;  4MZL A;  2KYF A;  3I5H C;  3ZWH A;  1NX2 A;  1KFX S;  1UHN A;  1B8R A;  2KDH A;  2KQY A;  4GAO A;  1XA5 A;  1KFX L;  1NX3 A;  4BY5 A;  2BE6 A;  2R2I A;  1V1G A;  3F45 A;  2LAN A;  1JC2 A;  1K2H A;  1CDM A;  3C1V A;  5AEQ A;  4OV2 A;  1JWD A;  5J3X A;  1NIW A;  1U5I B;  3NSK A;  1BLQ A;  1SL9 A;  1K9P A;  2JRF A;  1WLM A;  1W7I B;  2JT3 A;  1IQ5 A;  2LLU A;  2LUC A;  5B8I B;  4D1E A;  4P5O E;  1TRF A;  3CTN A;  1XFV O;  2E6W A;  2JC2 A;  1WRZ A;  2AUC A;  1OZO A;  1K90 D;  2WCE A;  2ZRS A;  2Q4U A;  1S6I A;  2ZN9 A;  2LHI A;  3D0Y A;  3PLF B;  2CT9 A;  2BCB A;  1DJY A;  1M31 A;  1N0Y A;  1XFW O;  4PDZ A;  2LP2 A;  2E30 A;  2PSR A;  3JVT B;  1B8C A;  3PM8 A;  2HQ8 A;  1CFC A;  1YVH A;  1AK8 A;  1K9K A;  2JXL A;  1KSO A;  1KK7 Y;  2OS8 C;  1DJW A;  2LVI A;  2MRD A;  1NSH A;  4TNC A;  1LVC D;  2I94 A;  3LLE A;  5DKN A;  1DVI A;  1KWO B;  1QTX A;  1WRL A;  3PFV A;  2D8N A;  5HKZ A;  1SCV A;  1V1F A;  4L9M A;  4WQ2 A;  3AAK A;  1S6J A;  2PAS A;  4DRW A;  1J7O A;  1LKJ A;  1XK4 A;  3EK7 A;  1J7R A;  1BR4 B;  2Y5I A;  4GGF C;  3GK2 A;  3WNX B;  1XVJ A;  3BYA A;  3WHT B;  4N1G A;  1SK6 D;  1UHK A;  2I7A A;  2L5X B;  1UP5 A;  1JFK A;  5CSJ A;  2HET A;  3PSR A;  4CFR A;  2MLE C;  1RFJ A;  2NCO A;  4YGA A;  4A4B A;  1EJ3 A;  1AUI B;  3OHM B;  3EVU A;  4Q04 A;  1KFU S;  5CSN A;  1CB1 A;  4PHK A;  2FCD A;  1KFU L;  1XO5 A;  1QLS A;  2JPT A;  1JUO A;  3A8R A;  5PAL A;  2KFG A;  2AMI A;  4MVF A;  4XJK B;  1OMV A;  2QAC A;  3CZT X;  4YGC B;  1EXR A;  4AOM A;  5HLO A;  2BL0 B;  2Y1M A;  2BEC A;  5G08 A;  3TDU A;  1A75 A;  2PMY A;  1IH0 A;  4PHJ A;  1UUR A;  1HT9 A;  2O5G A;  2CXJ A;  5AFP A;  1BMO A;  4OKH A;  2GGM A;  3I5F B;  3I5G B;  3WHU B;  4NDD A;  1F4Q A;  4MSP A;  2CBL A;  5ER5 A;  1QS7 A;  3SIA A;  2HPS A;  3SG5 A;  5HKY A;  3TDI A;  1NCX A;  2KGB C;  3JVT C;  1TNP A;  1MQ1 A;  3RLZ A;  3AAJ A;  1GQM A;  2BE4 A;  1A4P A;  1J7Q A;  3LL8 B;  2M7N A;  2G9B A;  2JQ6 A;  4NDB A;  1REC A;  3IQO A;  2ZFD A;  2KAY A;  1PSB A;  1BT6 A;  3CR2 A;  3NSO A;  1YUS A;  2L0P A;  5KSZ A;  5BPJ A;  1BR1 B;  2EGD A;  1KQM B;  4MZJ A;  1CFF A;  4CFQ A;  4PE0 A;  1JF2 A;  4I5J A;  1XFU O;  2LCP A;  1WRK A;  2F2P A;  3NSI A;  1S1E A;  1KCY A;  1M45 A;  3BQ3 A;  1BJF A;  3OB1 B;  1YUT A;  4BY4 A;  1S5G Z;  2Y1N A;  3DVK A;  2L4I A;  4ORB B;  5GQQ C;  1ZMZ A;  2WOR A;  1SPY A;  1PVB A;  1YUR A;  2KI6 D;  1SL7 A;  1RJV A;  1IJ5 A;  2LAP A;  2L50 A;  3O2P A;  1DJX A;  3SG2 A;  4QJ3 B;  5D69 A;  1CFP A;  2SCP A;  2ZKM X;  4P2Y B;  5AAN A;  4XYN A;  4GGF A;  3EKH A;  1FPW A;  1TTX A;  4MLW A;  2KSP A;  1TNW A;  3TZ1 A;  1WDC B;  2K7D A;  1PK0 D;  5KU1 A;  1YUU A;  2BL0 C;  4C0L A;  5AXI A;  3O4Y A;  4N5X A;  3TDZ A;  3BUN B;  1S26 D;  3JTD B;  1FI5 A;  3MSE B;  2LC5 A;  1MXE A;  2KYC A;  1ALV A;  1Y0V H;  2ZND A;  1OZS A;  2M49 B;  3I5G C;  3I5F C;  2M7L A;  2OTG B;  1U5I A;  3I5I B;  2MHH A;  1SMG A;  1QJT A;  2F33 A;  2L51 A;  4DIR A;  1B7T Y;  4PE4 A;  1DMO A;  1NWD A;  3NSL A;  1SRA A;  1ZAC A;  4HRE E;  5CSI A;  5AER A;  2F8P A;  3BUX B;  1IRJ A;  2K2F A;  2A4J A;  1MXL C;  2HF5 A;  4MN0 A;  1CLL A;  1WLZ A;  1JSA A;  1CMG A;  2GGZ A;  3O6B A;  4GFT A;  1B4C A;  1SBJ A;  1KQM C;  2LVJ A;  2JUL A;  4MBE A;  1J1D A;  2KGR A;  2MA2 A;  2CTN A;  1AJ4 A;  4YGB B;  2COL B;  1S36 A;  3PN7 B;  1SCM C;  3K21 A;  1S6C A;  1FW4 A;  1EL4 A;  1EH2 A;  1L2O B;  3DVJ A;  2JXC A;  2K8M B;  2KBM A;  1YVL A;  2LVK A;  1QAS A;  2ZRT A;  3OX5 A;  2M0R A;  1OQP A;  3DD4 A;  2LE9 B;  2LLT A;  3EK8 A;  3IF7 A;  1BOC A;  1NCZ A;  1Y1A A;  2BKI B;  2M3W A;  1WDC C;  2EHB A;  3BOW B;  3FIA A;  3SG6 A;  1LXF C;  2L4H A;  3JTD C;  5I2L A;  1GGW A;  2LLS A;  2QPT A;  3GK4 X;  1SW8 A;  3DF0 B;  3WXA A;  3OX6 A;  1MF8 B;  3HCM A;  3AKB A;  5I2O A;  4PE7 A;  2AAO A;  2FJU B;  2OTG C;  3HX4 A;  5FYX A;  3I5I C;  2JNF A;  3OP0 A;  2DOQ A;  1FBV A;  2KAV A;  3H4S E;  4XJK A;  1UHH A;  1QLK A;  3FWB A;  1PUL A;  2M9G A;  2BBN A;  4ORC B;  3VGO A;  1QVI Z;  4C0J A;  1KK7 Z;  2H61 C;  3EK4 A;  1DF0 B;  1ZFS A;  2WCB A;  2LMU A;  1YR5 A;  3ZNI A;  4F0Z B;  4GGN A;  1TNQ A;  2HQW A;  1IKU A;  2BKH B;  1HQV A;  1B8L A;  4JPZ B;  1FI6 A;  1DT7 B;  3SJS A;  1F54 A;  5K89 A;  4CPV A;  2ZN8 A;  1F70 A;  1M63 B;  1QXP A;  1AJ5 A;  2KBI A;  3PN7 C;  1S3P A;  1JF0 A;  2M1K B;  1SR6 B;  1L2O C;  1A2X A;  4QJ5 B;  2JWW A;  1CKK A;  1WY9 A;  2K7C A;  3KO0 A;  1TIZ A;  4NDC A;  1UHJ A;  5ER4 X;  2CCM A;  2P6B B;  1CNP A;  4U8D A;  1QV0 A;  3KHE A;  1XYD A;  3SG4 A;  2JTT A;  2M29 A;  1QAT A;  3NXA A;  3CWG A;  2FCE A;  4PHN A;  2MAZ A;  1PRW A;  3ICB A;  4ICB A;  2LMT A;  1QV1 A;  3AKA A;  3PAL A;  1ZOT B;  1IGV A;  4YI9 A;  1CM1 A;  1QIW A;  4I5K A;  1NX0 A;  1F55 A;  4WRI A;  1S5G Y;  1Y1X A;  3KEV A;  4ORA B;  4OVN F;  4AQI A;  1SCM B;  1KQV A;  1DJZ A;  3VRR A;  1Y1U A;  2MLF C;  1TOP A;  4GBA A;  1ALW A;  2ZNE A;  2MBX A;  1D1O A;  1CLB A;  5TNC A;  3BUW B;  3TS5 B;  1JBA A;  5I2Q A;  2NZ0 A;  2KOT A;  4E68 A;  2BCA A;  2Q91 A;  4N1F A;  3EVR A;  2ISD A;  2JU0 A;  2RGI A;  1J7P A;  1R2U A;  4YBH B;  1IG5 A;  5F6T A;  1KK8 B;  1N65 A;  1DJH A;  1ZUZ A;  1DTL A;  1G4Y R;  4WQ3 A;  1YTZ C;  5IBW A;  4YGD B;  1SR6 C;  2H61 A;  1XFZ O;  2NXQ A;  1ODB A;  1K9U A;  3GK1 A;  4UPG A;  3VRQ A;  1YX7 A;  2NLN A;  1OSA A;  1OE9 B;  4OCI A;  3VRN A;  3FS7 A;  1YX8 A;  1BF5 A;  2K0J A;  1GGZ A;  2JT8 A;  1LA3 A;  1J1E A;  1F71 A;  2OPO A;  4FQO A;  4R1E A;  1IJ6 A;  2NCP A;  1DJI A;  1YRU B;  3A4U B;  4PCW A;  3TUY B;  4C0K A;  1CMF A;  3O78 A;  4MEW A;  1DGU A;  2BCX A;  3KPX A;  4DUQ A;  2WOS A;  4M2O A;  4I5N B;  1CTR A;  3VRP A;  1SNL A;  2B1U A;  2K7O A;  1KSM A;  2PVB A;  2K7B A;  1CDL A;  4ZCU A;  1K8U A;  1A29 A;  3BOW A;  1B7T Z;  1FF1 A;  2JTZ A;  3EKJ A;  3TS5 C;  1BOD A;  4DCK A;  2JOJ A;  4JQ0 D;  1H8B A;  2CNP A;  3DF0 A;  2EC6 B;  1NX1 A;  3BUM B;  3SIB A;  4GUK A;  2PRU A;  1BG1 A;  1KK8 C;  1CDP A;  2K2A A;  4CID A;  4ZCV A;  1IWQ A;  1TCF A;  3M0W A;  4I5L B;  4JWQ A;  4PE1 A;  4YRU A;  1PSR A;  4MRX A;  3GOF A;  1K94 A;  1K93 D;  4A4C A;  3E3R A;  2WCF A;  5HLV A;  1QX7 A;  1DF0 A;  3OB2 B;  1AP4 A;  3PAT A;  4NQG A;  1NYA A;  1QVI Y;  1AHR A;  3BUO B;  1C7V A;  1CLM A;  4DS7 A;  3D0Y B;  1N2D A;  3KF9 A;  3DVM A;  4M2P A;  1OOJ A;  1PAL A;  3BXK A;  2KI4 B;  2F3Y A;  1UHI A;  1UWO A;  1RTP 1;  1SKT A;  2KHN A;  2O60 A;  1IQ3 A;  1B9A A;  1F8H A;  1L7Z A;  1E8A A;  2V53 A;  3IQQ A;  5D7F A;  3TUY C;  1J55 A;  1VRK A;  4GPL B;  5I8N A;  3SG7 A;  2K61 A;  1W7J B;  5DKR A;  4HRH A;  4CLN A;  4PAL A;  1Q80 A;  1CDN A;  1M39 A;  1TN4 A;  5JJG A;  2IS9 A;  2H2K A;  4MRY A;  1RRO A;  4QJ4 B;  1MWN A;  1QX5 B;  1SL8 A;  1A03 A;  2GV5 A;  4PHM A;  2LUX A;  3CLN A;  2M97 A;  1RK9 A;  2G2B A;  2LHL A;  2EC6 C;  4GNK B;  3QRX A;  1NUB A;  2JT0 A;  3CGA A;  1NP8 A;  1RWY A;  2F3Z A;  1C07 A;  4HSZ A;  1DJG A;  2LP3 A;  5CPV A;  4IL1 A;  2Y4Q A;  3LCP C;  2LVV A;  2TN4 A;  5JOL A;  5CSF A;  1SY9 A;  1BU3 A;  1SYM A;  2JZI A;  4FTG A;  3I5H B;  2KFH A;  1NPQ A;  2I18 A;  1B47 A;  1R6P A;  1LA0 A;  1A75 B;  1AVS A;  3FWC A;  3LK1 A;  1NCY A;  5KTY A;  2WND A;  1CFD A;  1QIV A;  2LNK A;  4YI8 A;  1OMD A;  2KI4 C;  1KWO C;  1X02 A;  1MR8 A;  1K95 A;  2KAX A;  2PAL A;  4M2Q A;  2L98 A;  3EVV A;  1MUX A;  4USL A;  1LIN A;  1TCO B;  2KQ6 A;  1C7W A;  2L2E A;  1OMR A;  3DVE A;  1H4B A;  1G8I A;  2LM5 A;  2KNE A;  2BBM A;  5HYD A;  1YRT B; 
#chains in the Genus database with same CATH topology
 2VRG A;  3B88 A;  2LV7 A;  3CS1 A;  5DKQ A;  3R1O A;  1B1G A;  2M1U A;  1JFJ A;  3QME A;  1K96 A;  2JNX A;  2LMV A;  4AQJ A;  1M46 A;  1F4O A;  1Y6W A;  2KFF A;  3D10 A;  1XK4 C;  4OR9 B;  3DY9 A;  1DGV A;  4HRG A;  1XFY O;  2WC8 A;  5HKW A;  3CR4 X;  3SG3 A;  2FOT A;  1QX2 A;  2OS8 B;  4MZK A;  1QWV A;  1CM4 A;  2SAS A;  3LK0 A;  2WCL A;  4YGE B;  3VRO A;  2I2R E;  2MJW B;  1GJY A;  4ETO A;  1PVA A;  1EG3 A;  1TNX A;  1EG4 A;  1MHO A;  1UUS A;  2M8U A;  1XFX O;  1ORG A;  1G33 A;  2F2O A;  2GTE A;  3CR5 X;  3RM1 A;  2KI6 C;  4MZL A;  2KYF A;  3I5H C;  3L4A A;  3ZWH A;  1NX2 A;  1KFX S;  1UHN A;  1B8R A;  2KDH A;  2KQY A;  4GAO A;  1XA5 A;  1KFX L;  1NX3 A;  4BY5 A;  2BE6 A;  2R2I A;  1V1G A;  3F45 A;  2LAN A;  1JC2 A;  1K2H A;  1CDM A;  3C1V A;  3D76 A;  5AEQ A;  4OV2 A;  1JWD A;  5J3X A;  1NIW A;  1U5I B;  3NSK A;  1BLQ A;  1SL9 A;  1K9P A;  2JRF A;  1WLM A;  1W7I B;  2JT3 A;  1IQ5 A;  2LLU A;  2LUC A;  5B8I B;  1OOG A;  4P5O E;  4D1E A;  3SS3 A;  1TRF A;  3CTN A;  1XFV O;  2E6W A;  2JC2 A;  3UO9 A;  1WRZ A;  2QEO A;  2AUC A;  1OZO A;  1K90 D;  2WCE A;  5FI6 A;  2ZRS A;  2Q4U A;  1S6I A;  2ZN9 A;  2LHI A;  3D0Y A;  3PLF B;  2CT9 A;  2BCB A;  1DJY A;  1M31 A;  1N0Y A;  1XFW O;  4PDZ A;  2LP2 A;  2E30 A;  2PSR A;  3D78 A;  3JVT B;  1B8C A;  3PM8 A;  2HQ8 A;  5DIC A;  1YVH A;  1AK8 A;  1K9K A;  2JXL A;  1KSO A;  1KK7 Y;  2OS8 C;  3N7H A;  1DJW A;  2LVI A;  2MRD A;  1NSH A;  4TNC A;  1LVC D;  2I94 A;  3LLE A;  5DKN A;  1DVI A;  1KWO B;  1QTX A;  1WRL A;  2WCK A;  2D8N A;  3PFV A;  5HKZ A;  1DC1 A;  1SCV A;  1V1F A;  4L9M A;  4WQ2 A;  3AAK A;  1S6J A;  2PAS A;  4DRW A;  1J7O A;  1LKJ A;  1XK4 A;  3EK7 A;  1J7R A;  1BR4 B;  2Y5I A;  1SSE B;  3GK2 A;  4GGF C;  3WNX B;  4KYN A;  1XVJ A;  3BYA A;  3WHT B;  4N1G A;  1SK6 D;  1UHK A;  2I7A A;  2L5X B;  3RZS A;  1UP5 A;  1JFK A;  5CSJ A;  2HET A;  3PSR A;  4CFR A;  2MLE C;  1RFJ A;  2NCO A;  4YGA A;  4A4B A;  1EJ3 A;  1AUI B;  3OHM B;  3EVU A;  4Q04 A;  1KFU S;  5CSN A;  1CB1 A;  4PHK A;  2FCD A;  1KFU L;  1XO5 A;  1QLS A;  2JPT A;  1JUO A;  3A8R A;  5PAL A;  2KFG A;  2AMI A;  4MVF A;  4XJK B;  1OMV A;  2QAC A;  3CZT X;  3O4X A;  4JKT A;  4YGC B;  1EXR A;  4AOM A;  5HLO A;  2BL0 B;  2Y1M A;  2BEC A;  1LS8 A;  5G08 A;  3TDU A;  1A75 A;  2PMY A;  1IH0 A;  4PHJ A;  1UUR A;  1T14 A;  1HT9 A;  2O5G A;  2CXJ A;  5AFP A;  1BMO A;  4OKH A;  2GGM A;  3I5F B;  3I5G B;  1P28 A;  3WHU B;  4NDD A;  1F4Q A;  4MSP A;  2CBL A;  5ER5 A;  1QS7 A;  3SIA A;  2HPS A;  3SG5 A;  5HKY A;  3TDI A;  1NCX A;  2KGB C;  3JVT C;  1TNP A;  1MQ1 A;  3RLZ A;  3AAJ A;  1GQM A;  2BE4 A;  1A4P A;  1J7Q A;  3LL8 B;  2M7N A;  1TUZ A;  2G9B A;  4PT1 A;  2JQ6 A;  4NDB A;  1REC A;  3IQO A;  2ZFD A;  2KAY A;  1PSB A;  1BT6 A;  2QEH A;  3CR2 A;  1YUS A;  3NSO A;  2L0P A;  2WC5 A;  5KSZ A;  5BPJ A;  1BR1 B;  2EGD A;  3CZ1 A;  3DZT A;  1KQM B;  4MZJ A;  1CFF A;  4OZD A;  4CFQ A;  4PE0 A;  1JF2 A;  1OOF A;  2L5Y A;  4I5J A;  1XFU O;  2LCP A;  1WRK A;  2F2P A;  3NSI A;  1S1E A;  1KCY A;  1M45 A;  3BQ3 A;  1BJF A;  3OB1 B;  1YUT A;  3FE6 A;  4BY4 A;  1S5G Z;  2Y1N A;  3DVK A;  2L4I A;  4ORB B;  1DQE A;  1ZMZ A;  2WOR A;  3FE8 A;  5GQQ C;  1SPY A;  1PVB A;  1YUR A;  2KI6 D;  1SL7 A;  1RJV A;  1IJ5 A;  2LAP A;  2L50 A;  3O2P A;  1DJX A;  3SG2 A;  4QJ3 B;  5D69 A;  1CFP A;  2SCP A;  1OOI X;  2ZKM X;  4P2Y B;  5AAN A;  3R1V A;  4XYN A;  4GGF A;  3EKH A;  1FPW A;  1TTX A;  4MLW A;  2KSP A;  1TNW A;  3TZ1 A;  1WDC B;  2K7D A;  1PK0 D;  5KU1 A;  1YUU A;  2BL0 C;  4C0L A;  5AXI A;  3O4Y A;  4N5X A;  3TDZ A;  3BUN B;  1S26 D;  3JTD B;  1FI5 A;  3OBV A;  3MSE B;  2LC5 A;  1MXE A;  2KYC A;  3PJI A;  3SS4 A;  1ALV A;  1Y0V H;  1OW4 A;  2ZND A;  1OZS A;  2M49 B;  3I5G C;  3I5F C;  2M7L A;  2OTG B;  3PM2 A;  1U5I A;  3I5I B;  2MHH A;  3V2L A;  3NHI A;  1SMG A;  1QJT A;  2F33 A;  2L51 A;  4DIR A;  1B7T Y;  4PE4 A;  2WCH A;  1NWD A;  3NSL A;  1DMO A;  1SRA A;  1ZAC A;  4HRE E;  5CSI A;  5AER A;  2F8P A;  3BUX B;  1IRJ A;  2K2F A;  3BFB A;  2A4J A;  1MXL C;  2HF5 A;  4MN0 A;  1CLL A;  1WLZ A;  2P70 A;  3SS5 A;  1JSA A;  1CMG A;  2GGZ A;  3O6B A;  4GFT A;  1DEL A;  1B4C A;  1SBJ A;  1KQM C;  3UNW A;  2LVJ A;  2JUL A;  4MBE A;  1J1D A;  2KGR A;  2MA2 A;  2CTN A;  1AJ4 A;  4YGB B;  2COL B;  1S36 A;  3B6X A;  3IVT A;  3PN7 B;  1SCM C;  3K21 A;  1S6C A;  1FW4 A;  1EL4 A;  1EH2 A;  1L2O B;  3DVJ A;  2JXC A;  2K8M B;  2KBM A;  1YVL A;  2LVK A;  1QAS A;  3R72 A;  2ZRT A;  3OX5 A;  2M0R A;  1OQP A;  3DD4 A;  2LE9 B;  2LLT A;  3EK8 A;  3IF7 A;  4JD9 A;  1NCZ A;  1BOC A;  1Y1A A;  2BKI B;  2M3W A;  2QEB A;  1WDC C;  2EHB A;  3BOW B;  3FIA A;  3SG6 A;  1LXF C;  2L4H A;  3JTD C;  3DYE A;  5I2L A;  1GGW A;  2LLS A;  2QPT A;  3GK4 X;  1SW8 A;  3DF0 B;  3WXA A;  3OX6 A;  1MF8 B;  3HCM A;  3AKB A;  5I2O A;  4PE7 A;  2AAO A;  2FJU B;  2OTG C;  3HX4 A;  3EG5 B;  4INX A;  5FYX A;  3I5I C;  2JNF A;  3OP0 A;  2DOQ A;  1FBV A;  5FI2 A;  2KAV A;  3H4S E;  4XJK A;  1UHH A;  1QLK A;  3CZ2 A;  1PUL A;  2M9G A;  2BBN A;  1TWO A;  3FWB A;  4ORC B;  3VGO A;  1QVI Z;  4C0J A;  1KK7 Z;  2H61 C;  1DEK A;  3EK4 A;  3BFA A;  1DF0 B;  1ZFS A;  2WCB A;  1C3Z A;  2LMU A;  3CYZ A;  1YR5 A;  3ZNI A;  4F0Z B;  4IJ7 A;  4GGN A;  1TNQ A;  2HQW A;  1IKU A;  2BKH B;  1HQV A;  1B8L A;  4JPZ B;  1FI6 A;  1DT7 B;  4FQT A;  3SJS A;  1F54 A;  5K89 A;  3S0D A;  4CPV A;  3DXL A;  2ZN8 A;  1F70 A;  1M63 B;  1QXP A;  1AJ5 A;  2KBI A;  3R1P A;  3PN7 C;  1S3P A;  1JF0 A;  2M1K B;  1SR6 B;  1L2O C;  3D75 A;  1A2X A;  4QJ5 B;  2JWW A;  3S0F A;  1CKK A;  1WY9 A;  2K7C A;  3KO0 A;  1TIZ A;  4NDC A;  1UHJ A;  5ER4 X;  5FI7 A;  2CCM A;  2P6B B;  1CNP A;  4U8D A;  1QV0 A;  3KHE A;  1C3Y A;  1XYD A;  3SG4 A;  2BNX A;  2JTT A;  2M29 A;  1QAT A;  3NXA A;  5I94 A;  3CWG A;  2FCE A;  4PHN A;  2MAZ A;  1PRW A;  3D73 A;  3ICB A;  4ICB A;  2LMT A;  1QV1 A;  3AKA A;  3PAL A;  1ZOT B;  1IGV A;  4YI9 A;  1CM1 A;  1QIW A;  4I5K A;  1NX0 A;  3OGN A;  1F55 A;  4WRI A;  1S5G Y;  1Y1X A;  3KEV A;  4ORA B;  4OVN F;  4AQI A;  1SCM B;  1KQV A;  1DJZ A;  3VRR A;  1Y1U A;  2MLF C;  3S0B A;  1TOP A;  3B7A A;  4GBA A;  2FJY A;  1ALW A;  2ZNE A;  2MBX A;  1D1O A;  1CLB A;  2ERB A;  5TNC A;  3BUW B;  3TS5 B;  1JBA A;  5I2Q A;  2NZ0 A;  2KOT A;  4E68 A;  1CFC A;  1W9Z A;  2BCA A;  2Q91 A;  4N1F A;  3EVR A;  2ISD A;  2JU0 A;  3K1E A;  2RGI A;  1J7P A;  1R2U A;  3CAB A;  1IG5 A;  4YBH B;  5F6T A;  2WCJ A;  1KK8 B;  1N65 A;  1DJH A;  1ZUZ A;  3B86 A;  4F7F A;  1DTL A;  1G4Y R;  2QDI A;  4WQ3 A;  1YTZ C;  1OOH A;  5EL2 A;  5IBW A;  4YGD B;  1SR6 C;  2H61 A;  1XFZ O;  2NXQ A;  1ODB A;  3B87 A;  1K9U A;  3D77 A;  3GK1 A;  4UPG A;  3BJH A;  3VRQ A;  1IIO A;  1YX7 A;  2NLN A;  1OSA A;  1OE9 B;  3S0A A;  4OCI A;  3VRN A;  2PYQ A;  3FS7 A;  1YX8 A;  1BF5 A;  2K0J A;  1GGZ A;  3L47 A;  2JT8 A;  1LA3 A;  1J1E A;  1F71 A;  1Z4H A;  2OPO A;  4FQO A;  4R1E A;  3S0G A;  1IJ6 A;  2NCP A;  1DJI A;  1YRU B;  3A4U B;  4PCW A;  3TUY B;  4C0K A;  1CMF A;  3O78 A;  4MEW A;  1DGU A;  2BCX A;  3KPX A;  4DUQ A;  1GM0 A;  3NHT A;  2WOS A;  4M2O A;  3FE9 A;  4I5N B;  1CTR A;  3VRP A;  1SNL A;  2KLD A;  2B1U A;  2K7O A;  1KSM A;  2PVB A;  2K7B A;  1CDL A;  4ZCU A;  1K8U A;  3CZ0 A;  1A29 A;  3BOW A;  4INW A;  1B7T Z;  1FF1 A;  2JTZ A;  3EKJ A;  3TS5 C;  1BOD A;  4DCK A;  2JOJ A;  4JQ0 D;  1H8B A;  2CNP A;  3DF0 A;  2EC6 B;  1NX1 A;  3BUM B;  1XFR A;  3SIB A;  4GUK A;  2PRU A;  1BG1 A;  1KK8 C;  1CDP A;  2K2A A;  2WC6 A;  4CID A;  4ZCV A;  1IWQ A;  1TCF A;  3M0W A;  4I5L B;  4JWQ A;  2JPO A;  4PE1 A;  4YRU A;  1PSR A;  4MRX A;  3GOF A;  1K94 A;  1K93 D;  4A4C A;  3E3R A;  2K60 A;  2WCF A;  5HLV A;  1QX7 A;  1DF0 A;  3OB2 B;  1AP4 A;  3PAT A;  4NQG A;  1NYA A;  1QVI Y;  1AHR A;  3BUO B;  1C7V A;  1CLM A;  4DS7 A;  3D0Y B;  1N2D A;  3D74 A;  3KF9 A;  3DVM A;  4M2P A;  3VB1 A;  1OOJ A;  1PAL A;  3BXK A;  2KI4 B;  2F3Y A;  1UHI A;  1UWO A;  3BFH A;  1RTP 1;  1SKT A;  2KHN A;  2O60 A;  1IQ3 A;  1B9A A;  1F8H A;  1TUJ A;  1L7Z A;  1E8A A;  2V53 A;  3IQQ A;  5D7F A;  3Q8I A;  3TUY C;  2BAP A;  1J55 A;  3NGV A;  1VRK A;  4GPL B;  5I8N A;  3SG7 A;  2K61 A;  1W7J B;  5DKR A;  2P71 A;  4HRH A;  4CLN A;  4PAL A;  1Q80 A;  1CDN A;  1M39 A;  1TN4 A;  5JJG A;  2IS9 A;  2H2K A;  2QEV A;  1RRO A;  4MRY A;  4QJ4 B;  1MWN A;  1QX5 B;  1SL8 A;  2YGU A;  1A03 A;  2GV5 A;  4PHM A;  2LUX A;  2PQL A;  3CDN A;  3CLN A;  2M97 A;  1RK9 A;  2G2B A;  2LHL A;  2EC6 C;  4GNK B;  3QRX A;  1NUB A;  2JT0 A;  3CGA A;  1NP8 A;  1RWY A;  2F3Z A;  1C07 A;  4HSZ A;  1DJG A;  2LP3 A;  3S0E A;  5CPV A;  4IL1 A;  2Y4Q A;  3LCP C;  5HL1 A;  2LVV A;  2TN4 A;  5D3O A;  5JOL A;  5CSF A;  1SY9 A;  1BU3 A;  1SYM A;  2JZI A;  4FTG A;  3I5H B;  2KFH A;  1NPQ A;  2I18 A;  1B47 A;  1R6P A;  1LA0 A;  1A75 B;  1AVS A;  3FWC A;  3LK1 A;  2KLE A;  1NCY A;  5KTY A;  3L4L A;  2WND A;  1CFD A;  1QIV A;  2H8V A;  2LNK A;  4YI8 A;  1OMD A;  2KI4 C;  1KWO C;  1X02 A;  1MR8 A;  1K95 A;  2KAX A;  2PAL A;  2WCM A;  2L2C A;  2L98 A;  3EVV A;  1MUX A;  4M2Q A;  4USL A;  1LIN A;  2KPH A;  1Z2C B;  1TCO B;  2KQ6 A;  1C7W A;  2L2E A;  1OMR A;  3DVE A;  1H4B A;  1G8I A;  2LM5 A;  2KNE A;  2BBM A;  5HYD A;  1YRT B; 
#chains in the Genus database with same CATH homology
 2VRG A;  2LV7 A;  3CS1 A;  5DKQ A;  1B1G A;  2M1U A;  1JFJ A;  1K96 A;  2JNX A;  2LMV A;  4AQJ A;  1M46 A;  1F4O A;  1Y6W A;  2KFF A;  3D10 A;  1XK4 C;  4OR9 B;  1DGV A;  4HRG A;  1XFY O;  2WC8 A;  5HKW A;  3CR4 X;  3SG3 A;  2FOT A;  1QX2 A;  2OS8 B;  4MZK A;  1CM4 A;  2SAS A;  3LK0 A;  4YGE B;  3VRO A;  2I2R E;  2MJW B;  1GJY A;  4ETO A;  1PVA A;  1EG3 A;  1TNX A;  1EG4 A;  1MHO A;  1UUS A;  2M8U A;  1XFX O;  1G33 A;  2F2O A;  3CR5 X;  3RM1 A;  2KI6 C;  4MZL A;  2KYF A;  3I5H C;  3ZWH A;  1NX2 A;  1KFX S;  1UHN A;  1B8R A;  2KDH A;  2KQY A;  4GAO A;  1XA5 A;  1KFX L;  1NX3 A;  4BY5 A;  2BE6 A;  2R2I A;  1V1G A;  3F45 A;  2LAN A;  1JC2 A;  1K2H A;  1CDM A;  3C1V A;  5AEQ A;  4OV2 A;  1JWD A;  5J3X A;  1NIW A;  1U5I B;  3NSK A;  1BLQ A;  1SL9 A;  1K9P A;  2JRF A;  1WLM A;  1W7I B;  2JT3 A;  1IQ5 A;  2LLU A;  2LUC A;  5B8I B;  4D1E A;  4P5O E;  1TRF A;  3CTN A;  1XFV O;  2E6W A;  2JC2 A;  1WRZ A;  2AUC A;  1OZO A;  1K90 D;  2WCE A;  2ZRS A;  2Q4U A;  1S6I A;  2ZN9 A;  2LHI A;  3D0Y A;  3PLF B;  2CT9 A;  2BCB A;  1DJY A;  1M31 A;  1N0Y A;  1XFW O;  4PDZ A;  2LP2 A;  2E30 A;  2PSR A;  3JVT B;  1B8C A;  3PM8 A;  2HQ8 A;  1CFC A;  1YVH A;  1AK8 A;  1K9K A;  2JXL A;  1KSO A;  1KK7 Y;  2OS8 C;  1DJW A;  2LVI A;  2MRD A;  1NSH A;  4TNC A;  1LVC D;  2I94 A;  3LLE A;  5DKN A;  1DVI A;  1KWO B;  1QTX A;  1WRL A;  3PFV A;  2D8N A;  5HKZ A;  1SCV A;  1V1F A;  4L9M A;  4WQ2 A;  3AAK A;  1S6J A;  2PAS A;  4DRW A;  1J7O A;  1LKJ A;  1XK4 A;  3EK7 A;  1J7R A;  1BR4 B;  2Y5I A;  4GGF C;  3GK2 A;  3WNX B;  1XVJ A;  3BYA A;  3WHT B;  4N1G A;  1SK6 D;  1UHK A;  2I7A A;  2L5X B;  1UP5 A;  1JFK A;  5CSJ A;  2HET A;  3PSR A;  4CFR A;  2MLE C;  1RFJ A;  2NCO A;  4YGA A;  4A4B A;  1EJ3 A;  1AUI B;  3OHM B;  3EVU A;  4Q04 A;  1KFU S;  5CSN A;  1CB1 A;  4PHK A;  2FCD A;  1KFU L;  1XO5 A;  1QLS A;  2JPT A;  1JUO A;  3A8R A;  5PAL A;  2KFG A;  2AMI A;  4MVF A;  4XJK B;  1OMV A;  2QAC A;  3CZT X;  4YGC B;  1EXR A;  4AOM A;  5HLO A;  2BL0 B;  2Y1M A;  2BEC A;  5G08 A;  3TDU A;  1A75 A;  2PMY A;  1IH0 A;  4PHJ A;  1UUR A;  1HT9 A;  2O5G A;  2CXJ A;  5AFP A;  1BMO A;  4OKH A;  2GGM A;  3I5F B;  3I5G B;  3WHU B;  4NDD A;  1F4Q A;  4MSP A;  2CBL A;  5ER5 A;  1QS7 A;  3SIA A;  2HPS A;  3SG5 A;  5HKY A;  3TDI A;  1NCX A;  2KGB C;  3JVT C;  1TNP A;  1MQ1 A;  3RLZ A;  3AAJ A;  1GQM A;  2BE4 A;  1A4P A;  1J7Q A;  3LL8 B;  2M7N A;  2G9B A;  2JQ6 A;  4NDB A;  1REC A;  3IQO A;  2ZFD A;  2KAY A;  1PSB A;  1BT6 A;  3CR2 A;  3NSO A;  1YUS A;  2L0P A;  5KSZ A;  5BPJ A;  1BR1 B;  2EGD A;  1KQM B;  4MZJ A;  1CFF A;  4CFQ A;  4PE0 A;  1JF2 A;  4I5J A;  1XFU O;  2LCP A;  1WRK A;  2F2P A;  3NSI A;  1S1E A;  1KCY A;  1M45 A;  3BQ3 A;  1BJF A;  3OB1 B;  1YUT A;  4BY4 A;  1S5G Z;  2Y1N A;  3DVK A;  2L4I A;  4ORB B;  5GQQ C;  1ZMZ A;  2WOR A;  1SPY A;  1PVB A;  1YUR A;  2KI6 D;  1SL7 A;  1RJV A;  1IJ5 A;  2LAP A;  2L50 A;  3O2P A;  1DJX A;  3SG2 A;  4QJ3 B;  5D69 A;  1CFP A;  2SCP A;  2ZKM X;  4P2Y B;  5AAN A;  4XYN A;  4GGF A;  3EKH A;  1FPW A;  1TTX A;  4MLW A;  2KSP A;  1TNW A;  3TZ1 A;  1WDC B;  2K7D A;  1PK0 D;  5KU1 A;  1YUU A;  2BL0 C;  4C0L A;  5AXI A;  3O4Y A;  4N5X A;  3TDZ A;  3BUN B;  1S26 D;  3JTD B;  1FI5 A;  3MSE B;  2LC5 A;  1MXE A;  2KYC A;  1ALV A;  1Y0V H;  2ZND A;  1OZS A;  2M49 B;  3I5G C;  3I5F C;  2M7L A;  2OTG B;  1U5I A;  3I5I B;  2MHH A;  1SMG A;  1QJT A;  2F33 A;  2L51 A;  4DIR A;  1B7T Y;  4PE4 A;  1DMO A;  1NWD A;  3NSL A;  1SRA A;  1ZAC A;  4HRE E;  5CSI A;  5AER A;  2F8P A;  3BUX B;  1IRJ A;  2K2F A;  2A4J A;  1MXL C;  2HF5 A;  4MN0 A;  1CLL A;  1WLZ A;  1JSA A;  1CMG A;  2GGZ A;  3O6B A;  4GFT A;  1B4C A;  1SBJ A;  1KQM C;  2LVJ A;  2JUL A;  4MBE A;  1J1D A;  2KGR A;  2MA2 A;  2CTN A;  1AJ4 A;  4YGB B;  2COL B;  1S36 A;  3PN7 B;  1SCM C;  3K21 A;  1S6C A;  1FW4 A;  1EL4 A;  1EH2 A;  1L2O B;  3DVJ A;  2JXC A;  2K8M B;  2KBM A;  1YVL A;  2LVK A;  1QAS A;  2ZRT A;  3OX5 A;  2M0R A;  1OQP A;  3DD4 A;  2LE9 B;  2LLT A;  3EK8 A;  3IF7 A;  1BOC A;  1NCZ A;  1Y1A A;  2BKI B;  2M3W A;  1WDC C;  2EHB A;  3BOW B;  3FIA A;  3SG6 A;  1LXF C;  2L4H A;  3JTD C;  5I2L A;  1GGW A;  2LLS A;  2QPT A;  3GK4 X;  1SW8 A;  3DF0 B;  3WXA A;  3OX6 A;  1MF8 B;  3HCM A;  3AKB A;  5I2O A;  4PE7 A;  2AAO A;  2FJU B;  2OTG C;  3HX4 A;  5FYX A;  3I5I C;  2JNF A;  3OP0 A;  2DOQ A;  1FBV A;  2KAV A;  3H4S E;  4XJK A;  1UHH A;  1QLK A;  3FWB A;  1PUL A;  2M9G A;  2BBN A;  4ORC B;  3VGO A;  1QVI Z;  4C0J A;  1KK7 Z;  2H61 C;  3EK4 A;  1DF0 B;  1ZFS A;  2WCB A;  2LMU A;  1YR5 A;  3ZNI A;  4F0Z B;  4GGN A;  1TNQ A;  2HQW A;  1IKU A;  2BKH B;  1HQV A;  1B8L A;  4JPZ B;  1FI6 A;  1DT7 B;  3SJS A;  1F54 A;  5K89 A;  4CPV A;  2ZN8 A;  1F70 A;  1M63 B;  1QXP A;  1AJ5 A;  2KBI A;  3PN7 C;  1S3P A;  1JF0 A;  2M1K B;  1SR6 B;  1L2O C;  1A2X A;  4QJ5 B;  2JWW A;  1CKK A;  1WY9 A;  2K7C A;  3KO0 A;  1TIZ A;  4NDC A;  1UHJ A;  5ER4 X;  2CCM A;  2P6B B;  1CNP A;  4U8D A;  1QV0 A;  3KHE A;  1XYD A;  3SG4 A;  2JTT A;  2M29 A;  1QAT A;  3NXA A;  3CWG A;  2FCE A;  4PHN A;  2MAZ A;  1PRW A;  3ICB A;  4ICB A;  2LMT A;  1QV1 A;  3AKA A;  3PAL A;  1ZOT B;  1IGV A;  4YI9 A;  1CM1 A;  1QIW A;  4I5K A;  1NX0 A;  1F55 A;  4WRI A;  1S5G Y;  1Y1X A;  3KEV A;  4ORA B;  4OVN F;  4AQI A;  1SCM B;  1KQV A;  1DJZ A;  3VRR A;  1Y1U A;  2MLF C;  1TOP A;  4GBA A;  1ALW A;  2ZNE A;  2MBX A;  1D1O A;  1CLB A;  5TNC A;  3BUW B;  3TS5 B;  1JBA A;  5I2Q A;  2NZ0 A;  2KOT A;  4E68 A;  2BCA A;  2Q91 A;  4N1F A;  3EVR A;  2ISD A;  2JU0 A;  2RGI A;  1J7P A;  1R2U A;  4YBH B;  1IG5 A;  5F6T A;  1KK8 B;  1N65 A;  1DJH A;  1ZUZ A;  1DTL A;  1G4Y R;  4WQ3 A;  1YTZ C;  5IBW A;  4YGD B;  1SR6 C;  2H61 A;  1XFZ O;  2NXQ A;  1ODB A;  1K9U A;  3GK1 A;  4UPG A;  3VRQ A;  1YX7 A;  2NLN A;  1OSA A;  1OE9 B;  4OCI A;  3VRN A;  3FS7 A;  1YX8 A;  1BF5 A;  2K0J A;  1GGZ A;  2JT8 A;  1LA3 A;  1J1E A;  1F71 A;  2OPO A;  4FQO A;  4R1E A;  1IJ6 A;  2NCP A;  1DJI A;  1YRU B;  3A4U B;  4PCW A;  3TUY B;  4C0K A;  1CMF A;  3O78 A;  4MEW A;  1DGU A;  2BCX A;  3KPX A;  4DUQ A;  2WOS A;  4M2O A;  4I5N B;  1CTR A;  3VRP A;  1SNL A;  2B1U A;  2K7O A;  1KSM A;  2PVB A;  2K7B A;  1CDL A;  4ZCU A;  1K8U A;  1A29 A;  3BOW A;  1B7T Z;  1FF1 A;  2JTZ A;  3EKJ A;  3TS5 C;  1BOD A;  4DCK A;  2JOJ A;  4JQ0 D;  1H8B A;  2CNP A;  3DF0 A;  2EC6 B;  1NX1 A;  3BUM B;  3SIB A;  4GUK A;  2PRU A;  1BG1 A;  1KK8 C;  1CDP A;  2K2A A;  4CID A;  4ZCV A;  1IWQ A;  1TCF A;  3M0W A;  4I5L B;  4JWQ A;  4PE1 A;  4YRU A;  1PSR A;  4MRX A;  3GOF A;  1K94 A;  1K93 D;  4A4C A;  3E3R A;  2WCF A;  5HLV A;  1QX7 A;  1DF0 A;  3OB2 B;  1AP4 A;  3PAT A;  4NQG A;  1NYA A;  1QVI Y;  1AHR A;  3BUO B;  1C7V A;  1CLM A;  4DS7 A;  3D0Y B;  1N2D A;  3KF9 A;  3DVM A;  4M2P A;  1OOJ A;  1PAL A;  3BXK A;  2KI4 B;  2F3Y A;  1UHI A;  1UWO A;  1RTP 1;  1SKT A;  2KHN A;  2O60 A;  1IQ3 A;  1B9A A;  1F8H A;  1L7Z A;  1E8A A;  2V53 A;  3IQQ A;  5D7F A;  3TUY C;  1J55 A;  1VRK A;  4GPL B;  5I8N A;  3SG7 A;  2K61 A;  1W7J B;  5DKR A;  4HRH A;  4CLN A;  4PAL A;  1Q80 A;  1CDN A;  1M39 A;  1TN4 A;  5JJG A;  2IS9 A;  2H2K A;  4MRY A;  1RRO A;  4QJ4 B;  1MWN A;  1QX5 B;  1SL8 A;  1A03 A;  2GV5 A;  4PHM A;  2LUX A;  3CLN A;  2M97 A;  1RK9 A;  2G2B A;  2LHL A;  2EC6 C;  4GNK B;  3QRX A;  1NUB A;  2JT0 A;  3CGA A;  1NP8 A;  1RWY A;  2F3Z A;  1C07 A;  4HSZ A;  1DJG A;  2LP3 A;  5CPV A;  4IL1 A;  2Y4Q A;  3LCP C;  2LVV A;  2TN4 A;  5JOL A;  5CSF A;  1SY9 A;  1BU3 A;  1SYM A;  2JZI A;  4FTG A;  3I5H B;  2KFH A;  1NPQ A;  2I18 A;  1B47 A;  1R6P A;  1LA0 A;  1A75 B;  1AVS A;  3FWC A;  3LK1 A;  1NCY A;  5KTY A;  2WND A;  1CFD A;  1QIV A;  2LNK A;  4YI8 A;  1OMD A;  2KI4 C;  1KWO C;  1X02 A;  1MR8 A;  1K95 A;  2KAX A;  2PAL A;  4M2Q A;  2L98 A;  3EVV A;  1MUX A;  4USL A;  1LIN A;  1TCO B;  2KQ6 A;  1C7W A;  2L2E A;  1OMR A;  3DVE A;  1H4B A;  1G8I A;  2LM5 A;  2KNE A;  2BBM A;  5HYD A;  1YRT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...