1AVSA

X-ray crystallographic study of calcium-saturated n-terminal domain of troponin c
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
81
structure length
81
Chain Sequence
QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TROPONIN C
publication title Structural details of a calcium-induced molecular switch: X-ray crystallographic analysis of the calcium-saturated N-terminal domain of troponin C at 1.75 A resolution.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Muscle contraction
total genus 25
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1avsA00
4YRUA 2JRFA 1QIWA 1OE9B 4PE1A 1PK0D 1J7PA 2KAYA 3GOFA 3IQOA 2FJUB 3A8RA 3NSLA 4F0ZB 1BT6A 2ZNEA 4PE4A 1PVBA 3PALA 2P6BB 2WORA 4OVNF 1GGWA 2JT8A 3A4UB 1M45A 3EVVA 1B9AA 2JZIA 1MR8A 3OX5A 4PHKA 1QX7A 3FS7A 1LA3A 3KHEA 5JOLA 1Y1XA 1YTZC 4N1FA 3RLZA 4FTGA 1JFJA 4AOMA 2K7OA 1B8CA 1J7QA 1SNLA 1ZFSA 4NDDA 4YGDB 3WHUB 1G33A 3KEVA 1A03A 2Y1MA 4WQ3A 3SG4A 2KGBC 3D10A 2EC6C 3TS5B 4HRGA 4AQIA 2O5GA 1S36A 4HRHA 1OZSA 2WCFA 1NUBA 4WRIA 1ALVA 1TN4A 5I2LA 5HYDA 3I5HB 5KTYA 1PALA 2M7NA 1AK8A 2M7LA 2BBMA 2KAXA 2LUCA 1BR4B 1J1EA 2A4JA 2F3ZA 2KGRA 2LC5A 4GGFA 1CFFA 4GPLB 4I5JA 1KFUS 4Q04A 2PASA 1J1DA 1ZACA 2RGIA 1ZOTB 2BCXA 1N65A 1XFVO 2LVIA 3NSKA 1CDNA 3KO0A 2CXJA 1OSAA 2M1UA 1TNWA 1QLSA 5DKNA 1QXPA 4NDCA 3VROA 1J55A 2M97A 3BUXB 2KI4C 2KI6D 1WDCB 1R6PA 2B1UA 4HREE 4PHJA 5B8IB 5IBWA 1JC2A 2JWWA 1FI5A 4YGBB 3LK1A 3PSRA 2K7CA 1TNPA 1EJ3A 4OKHA 5FYXA 1TTXA 2PMYA 1VRKA 2K61A 1J7OA 2LMVA 1DJXA 1DT7B 1KQVA 2E6WA 2ZKMX 2JT0A 4AQJA 2K0JA 1CMGA 2KI6C 2SASA 2Y5IA 3EVUA 1E8AA 2KHNA 1DTLA 2JQ6A 1QX5B 2H61C 3I5IB 2KBIA 3PFVA 1CFCA 4ORAB 5J3XA 4GGNA 2MLEC 1B7TY 3AKBA 4YBHB 4UPGA 2ISDA 1N0YA 3EKHA 2L98A 2L4HA 1SCMC 1RROA 2L2EA 3JTDB 5D69A 1S26D 2LLSA 3BOWA 3IF7A 3F45A 3BQ3A 4DCKA 2QPTA 1JUOA 3O4YA 4GBAA 4CFQA 1UWOA 3EK8A 1PSBA 3NSIA 2L5XB 1JFKA 1RFJA 1XFZO 2LANA 2CNPA 4QJ5B 1SPYA 1EL4A 3SIAA 4D1EA 1OOJA 1JBAA 2FCDA 1ZMZA 5CSNA 1SMGA 2BCBA 2KOTA 1G4YR 1RJVA 3EVRA 2NCPA 4XJKA 3O6BA 3PM8A 1M46A 1K9UA 1CMFA 1DVIA 1K2HA 1CDLA 1IRJA 2LV7A 2NLNA 3NXAA 4MRYA 2K2FA 1YX7A 1XFYO 1CKKA 1DF0A 3HX4A 1KFUL 1C7VA 1BU3A 2EGDA 4U8DA 4JWQA 3PN7C 1KWOC 2G9BA 1YUSA 2JTZA 2JXLA 3CS1A 2Q4UA 4MBEA 1QIVA 2KBMA 4OR9B 5HLOA 1ZUZA 1SR6C 2KSPA 2V53A 2WOSA 1K8UA 1AP4A 4A4CA 4ORBB 3AAKA 5HKWA 4PE7A 3BYAA 3TUYB 3DVKA 3TDZA 3I5FC 5PALA 2WNDA 1FW4A 2HQ8A 2OTGB 1XVJA 4JQ0D 1SW8A 1Y1AA 2LAPA 4GAOA 4M2QA 2AMIA 1LINA 5G08A 1B4CA 1F71A 1MWNA 4YI8A 1SBJA 3BUNB 3M0WA 2EHBA 2O60A 2K8MB 1IJ6A 1UURA 5ER4X 1SCVA 2BL0B 1QS7A 1DMOA 1F8HA 1MXEA 1YR5A 3I5GC 3OP0A 1IG5A 3BOWB 3BUWB 1AVSA 1K96A 1SYMA 3EK4A 1H8BA 3CR4X 1BMOA 5I8NA 1BR1B 1EG4A 2D8NA 1K95A 2LLUA 5AEQA 5JJGA 2ZN9A 2LVVA 2BE4A 2LUXA 1NYAA 5GQQC 1CFDA 3MSEB 2M8UA 1OMDA 1JF0A 2ZRSA 3SIBA 4MEWA 3NSOA 3D0YA 1NX2A 2H61A 1SY9A 2PALA 4XJKB 4DRWA 3AKAA 1NWDA 2MRDA 2PRUA 2BBNA 2WCBA 1F70A 1KK7Z 1KFXS 1J7RA 1WLZA 2ZN8A 1G8IA 1FI6A 1KQMC 2Q91A 1A75A 5ER5A 2QACA 2BKIB 3EKJA 2M3WA 2PVBA 1D1OA 1DF0B 1NCXA 2OS8C 2SCPA 2LP2A 1A29A 3ICBA 2LVJA 5CPVA 1XFXO 2LE9B 5D7FA 3SJSA 2LMTA 2KNEA 4BY4A 1FPWA 1R2UA 2BE6A 1KK7Y 4DIRA 1DJIA 1EXRA 3AAJA 3VRRA 2LLTA 2EC6B 4DS7A 2E30A 2L50A 1DJYA 1TCOB 1HT9A 2DOQA 2FOTA 4GUKA 5AERA 1TRFA 1V1FA 4ZCUA 1PVAA 2LHIA 1TNXA 2ZNDA 1YVLA 2JOJA 1L2OC 4GNKB 4M2OA 1QV0A 1CNPA 2MHHA 5AANA 1HQVA 1TOPA 1KSMA 2F3YA 5BPJA 2MBXA 1WRZA 3SG5A 3O78A 1FBVA 1DJHA 3JVTC 1KK8C 1CLLA 4HSZA 5AFPA 2Y1NA 1B1GA 2JC2A 5KU1A 1DJZA 1SRAA 2HPSA 4N5XA 1F54A 1GGZA 2PSRA 3OB2B 4PALA 1OQPA 1KSOA 2KI4B 1C7WA 3CGAA 4PHMA 1UP5A 1AUIB 3LLEA 1SL9A 1SKTA 1BOCA 1XYDA 2I7AA 4L9MA 1A2XA 2KFGA 4MVFA 1W7JB 1XA5A 1XK4C 2CCMA 2JU0A 4BY5A 2L4IA 4R1EA 2LVKA 1Y6WA 1BG1A 1S5GZ 1MF8B 1MXLC 2ZRTA 5K89A 4PCWA 5CSJA 1BLQA 1U5IA 1CM4A 1PULA 3KPXA 2BCAA 4YGEB 2L51A 3D0YB 1BODA 1YVHA 1YUTA 4M2PA 2IS9A 2JNXA 1S6JA 2COLB 3E3RA 4MZJA 1NX0A 4P5OE 1K9KA 1SL7A 1RWYA 1L7ZA 2OPOA 5DKRA 3WXAA 1YRUB 4OCIA 1XFUO 1WY9A 4MLWA 1S5GY 3CR5X 3DF0A 1A75B 1K90D 1SCMB 2GGMA 1YX8A 4C0JA 4QJ3B 1F4QA 3CZTX 2BKHB 1KFXL 2H2KA 4USLA 3WNXB 2K7DA 1LXFC 4CIDA 4MRXA 2JT3A 2CT9A 3TS5C 2AUCA 1EG3A 2K2AA 1QASA 1CLMA 2F2OA 1CM1A 2F2PA 4JPZB 3TDUA 1LVCD 2M49B 1QATA 2HF5A 3I5HC 4NQGA 1IQ5A 2TN4A 3OX6A 1MQ1A 3FWBA 4DUQA 1SL8A 4ICBA 1XFWO 1WLMA 1UHKA 1DJWA 2CTNA 2MAZA 5KSZA 1DGVA 3SG3A 5F6TA 4I5KA 1Y1UA 3PLFB 4PE0A 3DVJA 2JTTA 2AAOA 3BUOB 3SG6A 3EK7A 2M0RA 3GK2A 1OMRA 1IJ5A 3LL8B 5DKQA 4N1GA 4WQ2A 4C0KA 1M63B 2NCOA 4IL1A 3ZWHA 3QRXA 2VRGA 3DVEA 1CLBA 3C1VA 1IGVA 1WDCC 2Y4QA 4MZLA 4I5LB 2MLFC 1IKUA 3CTNA 1QVIZ 3IQQA 1GQMA 4CPVA 1M39A 3BXKA 1KWOB 3PN7B 5I2QA 1TCFA 3PATA 4YGAA 1SR6B 5CSFA 5TNCA 1C07A 3SG2A 1IWQA 2LCPA 3GK4X 2KDHA 4MSPA 2KFHA 1CTRA 1ALWA 1IQ3A 1EH2A 2LMUA 5CSIA 3I5FB 3GK1A 1QVIY 3CWGA 2F8PA 1MUXA 1U5IB 3SG7A 3TDIA 1NPQA 3I5IC 1Q80A 1OMVA 3CR2A 1NP8A 2JULA 3RM1A 4I5NB 4MZKA 2F33A 1BJFA 1AHRA 2JXCA 1UUSA 2CBLA 3BUMB 1OZOA 3DF0B 3JTDC 1AJ5A 3LCPC 2K7BA 4YI9A 4NDBA 1M31A 1TNQA 2L0PA 3FWCA 3VRPA 3I5GB 1KCYA 1WRKA 1QX2A 1W7IB 1NSHA 1CDMA 2WCEA 4ZCVA 1XK4A 1MHOA 1NIWA 1RTP1 1NCYA 1AJ4A 2NZ0A 3OB1B 2M1KB 1PRWA 3O2PA 3CLNA 1UHJA 1QV1A 2MJWB 1QLKA 1LKJA 1CFPA 2FCEA 2M29A 2BECA 3LK0A 1S1EA 4A4BA 2HQWA 1B7TZ 1S3PA 2KYCA 4GGFC 1ODBA 3TZ1A 1A4PA 2WC8A 1NX3A 2KFFA 1XO5A 1TIZA 4FQOA 4TNCA 3VRNA 2I2RE 1NX1A 1SK6D 1K93D 1UHIA 1GJYA 1YURA 4CFRA 1KQMB 2JNFA 2KQ6A 1CDPA 2M9GA 1H4BA 1UHNA 3ZNIA 4OV2A 2GGZA 4E68A 1DGUA 2HETA 1BF5A 1JSAA 2OS8B 1JWDA 2LP3A 3WHTB 1CB1A 3DVMA 4P2YB 4XYNA 1X02A 4CLNA 1B8LA 1YRTB 4ORCB 3H4SE 5HKYA 2KAVA 2G2BA 1B8RA 4ETOA 3DD4A 4C0LA 2NXQA 1WRLA 2R2IA 3TUYC 1UHHA 1IH0A 1K94A 1PSRA 1L2OB 2KYFA 3HCMA 1QTXA 3OHMB 3VGOA 1YUUA 4YGCB 2I94A 1F55A 4PDZA 3FIAA 2GV5A 2OTGC 5I2OA 1QJTA 1K9PA 2KQYA 1S6CA 2LHLA 1NCZA 4QJ4B 1Y0VH 2ZFDA 3VRQA 2JPTA 3JVTB 1KK8B 5HLVA 1LA0A 1RK9A 4GFTA 3KF9A 1V1GA 5HKZA 1RECA 1DJGA 2LNKA 1FF1A 1N2DA 1F4OA 2BL0C 1S6IA 1B47A 4MN0A 2I18A 2LM5A 1JF2A 3K21A 5AXIA 2MA2A 4PHNA
chains in the Genus database with same CATH superfamily
4YRUA 2JRFA 1QIWA 1OE9B 4PE1A 1PK0D 1OW4A 2WCHA 1J7PA 2KAYA 3GOFA 3CZ2A 3IQOA 2FJUB 3A8RA 3EG5B 3NSLA 4F0ZB 1BT6A 2ZNEA 2GTEA 2ERBA 1PVBA 4PE4A 3PALA 2P6BB 3S0DA 2WORA 4OVNF 1GGWA 2JT8A 2QEOA 3B87A 2K60A 1M45A 3A4UB 3EVVA 1B9AA 3SS4A 3D75A 3V2LA 2JZIA 1MR8A 3OX5A 4PHKA 1QX7A 3FS7A 1LA3A 3KHEA 5JOLA 1Y1XA 1YTZC 4N1FA 2WC6A 3RLZA 4FTGA 1JFJA 2WCKA 3Q8IA 3UO9A 4AOMA 2K7OA 1B8CA 1J7QA 1SNLA 1ZFSA 4NDDA 4YGDB 3WHUB 1G33A 3KEVA 1A03A 2Y1MA 4WQ3A 3SG4A 2KGBC 1QWVA 3D10A 2EC6C 3TS5B 4HRGA 4AQIA 2O5GA 1S36A 4HRHA 2KPHA 1OZSA 2WCFA 1NUBA 4WRIA 1ALVA 1TN4A 3OGNA 5I2LA 5HYDA 1TUZA 3I5HB 5KTYA 1PALA 2M7NA 3BFHA 3S0GA 1AK8A 2M7LA 2BBMA 2KAXA 2LUCA 5DKRA 1BR4B 1J1EA 2A4JA 2F3ZA 2KGRA 2LC5A 4GGFA 1CFFA 4GPLB 4I5JA 1KFUS 4Q04A 2PASA 1J1DA 1OOFA 1ZACA 2RGIA 1ZOTB 2BCXA 1N65A 1XFVO 2LVIA 3NSKA 3B88A 1CDNA 3KO0A 2CXJA 1OSAA 3SS3A 2M1UA 1TNWA 5D3OA 1QLSA 5DKNA 1QXPA 1DELA 4NDCA 3VROA 3WXAA 1J55A 2M97A 3BUXB 2KI4C 2KI6D 1WDCB 1R6PA 2B1UA 4HREE 4PHJA 5B8IB 2QEHA 5IBWA 1JC2A 2JWWA 1FI5A 4YGBB 3LK1A 3S0BA 3PSRA 2K7CA 1TNPA 1EJ3A 4OKHA 5FYXA 1TTXA 2PMYA 1LS8A 1VRKA 2K61A 1J7OA 2LMVA 3CZ0A 1DJXA 1DT7B 1KQVA 2E6WA 2ZKMX 2JT0A 4AQJA 2K0JA 1CMGA 2KI6C 2SASA 2Y5IA 3EVUA 1E8AA 3S0EA 2KHNA 1DTLA 2JQ6A 1QX5B 2H61C 3I5IB 2KBIA 3PFVA 3R72A 1CFCA 2QEVA 4ORAB 3O4XA 5J3XA 4GGNA 2MLEC 1B7TY 3AKBA 4YBHB 4UPGA 2ISDA 1N0YA 3EKHA 2L98A 2L4HA 1SCMC 1RROA 2L2EA 3JTDB 5D69A 1S26D 2LLSA 3BOWA 3IF7A 3F45A 3BQ3A 2P70A 4DCKA 2QPTA 1JUOA 3O4YA 4GBAA 4CFQA 1UWOA 3EK8A 1PSBA 3NSIA 2L5XB 1JFKA 1RFJA 1XFZO 2LANA 2CNPA 4QJ5B 1SPYA 2H8VA 1EL4A 3SIAA 4D1EA 1OOJA 1JBAA 2FCDA 3L47A 1ZMZA 5CSNA 1SMGA 1F55A 2BCBA 2KOTA 5FI6A 1G4YR 1RJVA 3EVRA 2NCPA 4XJKA 3O6BA 3PM8A 1M46A 1K9UA 1CMFA 1DVIA 1K2HA 1CDLA 1IRJA 2LV7A 2NLNA 4KYNA 3NXAA 4MRYA 2K2FA 1YX7A 1XFYO 1CKKA 1DF0A 3HX4A 3NHIA 1KFUL 1C7VA 1BU3A 3CZ1A 2EGDA 3B7AA 3QMEA 1OOGA 4U8DA 4JWQA 3PN7C 3RZSA 1KWOC 2G9BA 1YUSA 2JTZA 2JXLA 3CS1A 2Q4UA 4MBEA 1QIVA 2KBMA 4OR9B 3D73A 5HLOA 3S0FA 1ZUZA 1SR6C 2KSPA 1C3ZA 2V53A 2WOSA 1K8UA 1AP4A 4A4CA 4ORBB 2L5YA 3AAKA 5HKWA 4PE7A 3BYAA 3D76A 5I94A 3TUYB 3DVKA 3TDZA 3I5FC 3IVTA 5PALA 2QDIA 1FW4A 2WNDA 2HQ8A 2OTGB 1XVJA 4JQ0D 1C3YA 1SW8A 3VGOA 1Y1AA 2LAPA 4GAOA 4M2QA 2AMIA 1LINA 5G08A 1B4CA 1F71A 1MWNA 2L2CA 1SBJA 3B86A 3BUNB 4YI8A 3M0WA 2EHBA 2O60A 2K8MB 1IJ6A 1UURA 5ER4X 1SCVA 2BL0B 1QS7A 1DMOA 1F8HA 1MXEA 1YR5A 3I5GC 3OP0A 5FI7A 1IG5A 3BOWB 3BUWB 1AVSA 1K96A 1SYMA 3EK4A 1H8BA 3CR4X 1BMOA 5I8NA 1BR1B 3DXLA 1EG4A 2D8NA 1K95A 2LLUA 3BJHA 5AEQA 2ZN9A 5JJGA 2LVVA 1W9ZA 2BE4A 2LUXA 1NYAA 5GQQC 1CFDA 3MSEB 2M8UA 1OMDA 1JF0A 2ZRSA 3SIBA 4MEWA 4INXA 3NSOA 3D0YA 1NX2A 2H61A 1SY9A 2PALA 4XJKB 4DRWA 3OBVA 3AKAA 1NWDA 2MRDA 2PRUA 2BBNA 2WCBA 1F70A 1KK7Z 3VB1A 1KFXS 1J7RA 1WLZA 2ZN8A 1G8IA 1FI6A 1KQMC 2Q91A 1A75A 5ER5A 2QACA 1SSEB 2BKIB 3EKJA 2M3WA 2PVBA 1D1OA 1DF0B 1NCXA 2OS8C 2SCPA 2LP2A 1A29A 3ICBA 2LVJA 5CPVA 1XFXO 2LE9B 5D7FA 3SJSA 2LMTA 1T14A 2KNEA 4BY4A 1FPWA 1R2UA 2BE6A 1KK7Y 2FJYA 4DIRA 1DJIA 1EXRA 3AAJA 3CYZA 2LLTA 3VRRA 2EC6B 4DS7A 2E30A 2L50A 1DJYA 1TCOB 1HT9A 2DOQA 2FOTA 4GUKA 5AERA 1TRFA 1V1FA 4ZCUA 3R1PA 1PVAA 2LHIA 1TNXA 2BAPA 1YVLA 2JOJA 1L2OC 2ZNDA 4GNKB 4M2OA 1QV0A 1CNPA 2MHHA 5AANA 1HQVA 1TOPA 1KSMA 2F3YA 5BPJA 2MBXA 1WRZA 3FE6A 3SG5A 3O78A 1Z2CB 1FBVA 3NGVA 1DJHA 4PT1A 2P71A 3JVTC 1KK8C 1CLLA 4HSZA 5AFPA 2Y1NA 1B1GA 2JC2A 5KU1A 1DJZA 1SRAA 2HPSA 4JKTA 4N5XA 1F54A 1GGZA 2PSRA 3OB2B 4PALA 1OQPA 1KSOA 2KI4B 4F7FA 1C7WA 2PYQA 3CGAA 4PHMA 1UP5A 4P5OE 1AUIB 2JPOA 3LLEA 1SL9A 1SKTA 1BOCA 1XYDA 2I7AA 4L9MA 1A2XA 2KFGA 4MVFA 1W7JB 1XA5A 1XK4C 2CCMA 2JU0A 3D74A 4BY5A 2L4IA 3DY9A 4R1EA 2LVKA 1Y6WA 1BG1A 1S5GZ 1MF8B 1MXLC 2ZRTA 5K89A 4PCWA 5CSJA 1BLQA 3D77A 1U5IA 3DZTA 1CM4A 1PULA 3KPXA 2BCAA 4YGEB 2L51A 3D0YB 1BODA 1YVHA 1YUTA 4M2PA 2IS9A 2JNXA 1S6JA 2COLB 3E3RA 4MZJA 1NX0A 3CDNA 1K9KA 1SL7A 1RWYA 1L7ZA 2OPOA 2WC5A 3BFBA 1YRUB 4FQTA 1XFUO 4JD9A 4OCIA 1WY9A 4MLWA 1S5GY 3CR5X 3DF0A 3PM2A 1A75B 1K90D 1SCMB 2GGMA 1YX8A 4C0JA 4QJ3B 1F4QA 3CZTX 2BKHB 1DQEA 1KFXL 2H2KA 4USLA 3WNXB 2K7DA 1LXFC 4CIDA 4MRXA 2JT3A 2CT9A 3TS5C 2AUCA 1EG3A 2K2AA 1QASA 1XFRA 3BFAA 1CLMA 2F2OA 1CM1A 3B6XA 2F2PA 4JPZB 3TDUA 1LVCD 2M49B 1QATA 1ORGA 2HF5A 3I5HC 4NQGA 1IQ5A 2TN4A 3OX6A 1MQ1A 3FWBA 4DUQA 1SL8A 4ICBA 1XFWO 1WLMA 1UHKA 1DJWA 2CTNA 2MAZA 5KSZA 1DGVA 3SG3A 1Z4HA 5F6TA 4I5KA 3PJIA 1Y1UA 3PLFB 4PE0A 3DVJA 2JTTA 2AAOA 3BUOB 3SG6A 3EK7A 2M0RA 3FE8A 3GK2A 1OMRA 1IJ5A 3LL8B 4OZDA 4N1GA 4WQ2A 5DKQA 1M63B 2NCOA 4C0KA 4IL1A 1GM0A 3ZWHA 3QRXA 2VRGA 3DVEA 1CLBA 3C1VA 1IGVA 1TWOA 1WDCC 2Y4QA 4MZLA 4I5LB 2MLFC 1IKUA 3CTNA 1QVIZ 3IQQA 1GQMA 4CPVA 1M39A 3BXKA 1KWOB 3PN7B 5I2QA 1TCFA 3PATA 4YGAA 1SR6B 5CSFA 5TNCA 1C07A 3SG2A 1IWQA 2LCPA 3GK4X 2KDHA 4MSPA 2KFHA 1CTRA 1ALWA 3FE9A 1IQ3A 2LMUA 1EH2A 5CSIA 2QEBA 3I5FB 3GK1A 1QVIY 3SS5A 3K1EA 1DEKA 2F8PA 3CWGA 5EL2A 1MUXA 1U5IB 2KLEA 3SG7A 3TDIA 1NPQA 3I5IC 2BNXA 1Q80A 1TUJA 1OMVA 3CR2A 1IIOA 1NP8A 2JULA 3RM1A 4I5NB 4MZKA 2F33A 1BJFA 1AHRA 2JXCA 1UUSA 2CBLA 3BUMB 1OZOA 3DF0B 3JTDC 1AJ5A 3LCPC 2K7BA 4YI9A 4NDBA 1M31A 1TNQA 2L0PA 3FWCA 3VRPA 5HL1A 3I5GB 1KCYA 1WRKA 1QX2A 1W7IB 1NSHA 1CDMA 2WCEA 3S0AA 4ZCVA 1XK4A 1MHOA 1NIWA 1RTP1 1NCYA 1AJ4A 3NHTA 2NZ0A 3OB1B 2M1KB 1PRWA 2WCJA 1P28A 3O2PA 3CLNA 1UHJA 2YGUA 1QV1A 2MJWB 1QLKA 1LKJA 1CFPA 3DYEA 2FCEA 2M29A 2BECA 3LK0A 1S1EA 4A4BA 2HQWA 1B7TZ 1OOIX 1S3PA 2KYCA 4GGFC 1ODBA 3TZ1A 1A4PA 2WC8A 3N7HA 1NX3A 2KFFA 1XO5A 1TIZA 2KLDA 2WCMA 4FQOA 4TNCA 3VRNA 2I2RE 1NX1A 1SK6D 1K93D 1UHIA 1GJYA 1YURA 4CFRA 1KQMB 3L4AA 2JNFA 2KQ6A 1CDPA 2M9GA 1H4BA 1UHNA 3ZNIA 4OV2A 2GGZA 4E68A 1DGUA 2HETA 1BF5A 1JSAA 2OS8B 1JWDA 2LP3A 3WHTB 1CB1A 3DVMA 4P2YB 4XYNA 1X02A 4CLNA 1B8LA 1YRTB 4ORCB 3H4SE 5HKYA 2KAVA 3R1OA 2G2BA 1B8RA 2WCLA 3DD4A 4C0LA 4ETOA 2NXQA 1WRLA 2R2IA 3TUYC 1UHHA 1IH0A 1K94A 1PSRA 1L2OB 2KYFA 3HCMA 1QTXA 3D78A 3L4LA 1YUUA 3OHMB 2I94A 4YGCB 4PDZA 3FIAA 3UNWA 2GV5A 2OTGC 5I2OA 2PQLA 1OOHA 1QJTA 1K9PA 4INWA 2KQYA 5DICA 1S6CA 2LHLA 1NCZA 4QJ4B 1Y0VH 2ZFDA 3VRQA 4IJ7A 2JPTA 3JVTB 1KK8B 5HLVA 1LA0A 1RK9A 4GFTA 3KF9A 3R1VA 1V1GA 1DC1A 5HKZA 1RECA 1DJGA 2LNKA 3CABA 1N2DA 1FF1A 1F4OA 2BL0C 1S6IA 1B47A 5FI2A 4MN0A 2I18A 2LM5A 1JF2A 3K21A 5AXIA 2MA2A 4PHNA
chains in the Genus database with same CATH topology
4YRUA 2JRFA 1QIWA 1OE9B 4PE1A 1PK0D 1J7PA 2KAYA 3GOFA 3IQOA 2FJUB 3A8RA 3NSLA 4F0ZB 1BT6A 2ZNEA 4PE4A 1PVBA 3PALA 2P6BB 2WORA 4OVNF 1GGWA 2JT8A 3A4UB 1M45A 3EVVA 1B9AA 2JZIA 1MR8A 3OX5A 4PHKA 1QX7A 3FS7A 1LA3A 3KHEA 5JOLA 1Y1XA 1YTZC 4N1FA 3RLZA 4FTGA 1JFJA 4AOMA 2K7OA 1B8CA 1J7QA 1SNLA 1ZFSA 4NDDA 4YGDB 3WHUB 1G33A 3KEVA 1A03A 2Y1MA 4WQ3A 3SG4A 2KGBC 3D10A 2EC6C 3TS5B 4HRGA 4AQIA 2O5GA 1S36A 4HRHA 1OZSA 2WCFA 1NUBA 4WRIA 1ALVA 1TN4A 5I2LA 5HYDA 3I5HB 5KTYA 1PALA 2M7NA 1AK8A 2M7LA 2BBMA 2KAXA 2LUCA 1BR4B 1J1EA 2A4JA 2F3ZA 2KGRA 2LC5A 4GGFA 1CFFA 4GPLB 4I5JA 1KFUS 4Q04A 2PASA 1J1DA 1ZACA 2RGIA 1ZOTB 2BCXA 1N65A 1XFVO 2LVIA 3NSKA 1CDNA 3KO0A 2CXJA 1OSAA 2M1UA 1TNWA 1QLSA 5DKNA 1QXPA 4NDCA 3VROA 1J55A 2M97A 3BUXB 2KI4C 2KI6D 1WDCB 1R6PA 2B1UA 4HREE 4PHJA 5B8IB 5IBWA 1JC2A 2JWWA 1FI5A 4YGBB 3LK1A 3PSRA 2K7CA 1TNPA 1EJ3A 4OKHA 5FYXA 1TTXA 2PMYA 1VRKA 2K61A 1J7OA 2LMVA 1DJXA 1DT7B 1KQVA 2E6WA 2ZKMX 2JT0A 4AQJA 2K0JA 1CMGA 2KI6C 2SASA 2Y5IA 3EVUA 1E8AA 2KHNA 1DTLA 2JQ6A 1QX5B 2H61C 3I5IB 2KBIA 3PFVA 1CFCA 4ORAB 5J3XA 4GGNA 2MLEC 1B7TY 3AKBA 4YBHB 4UPGA 2ISDA 1N0YA 3EKHA 2L98A 2L4HA 1SCMC 1RROA 2L2EA 3JTDB 5D69A 1S26D 2LLSA 3BOWA 3IF7A 3F45A 3BQ3A 4DCKA 2QPTA 1JUOA 3O4YA 4GBAA 4CFQA 1UWOA 3EK8A 1PSBA 3NSIA 2L5XB 1JFKA 1RFJA 1XFZO 2LANA 2CNPA 4QJ5B 1SPYA 1EL4A 3SIAA 4D1EA 1OOJA 1JBAA 2FCDA 1ZMZA 5CSNA 1SMGA 2BCBA 2KOTA 1G4YR 1RJVA 3EVRA 2NCPA 4XJKA 3O6BA 3PM8A 1M46A 1K9UA 1CMFA 1DVIA 1K2HA 1CDLA 1IRJA 2LV7A 2NLNA 3NXAA 4MRYA 2K2FA 1YX7A 1XFYO 1CKKA 1DF0A 3HX4A 1KFUL 1C7VA 1BU3A 2EGDA 4U8DA 4JWQA 3PN7C 1KWOC 2G9BA 1YUSA 2JTZA 2JXLA 3CS1A 2Q4UA 4MBEA 1QIVA 2KBMA 4OR9B 5HLOA 1ZUZA 1SR6C 2KSPA 2V53A 2WOSA 1K8UA 1AP4A 4A4CA 4ORBB 3AAKA 5HKWA 4PE7A 3BYAA 3TUYB 3DVKA 3TDZA 3I5FC 5PALA 2WNDA 1FW4A 2HQ8A 2OTGB 1XVJA 4JQ0D 1SW8A 1Y1AA 2LAPA 4GAOA 4M2QA 2AMIA 1LINA 5G08A 1B4CA 1F71A 1MWNA 4YI8A 1SBJA 3BUNB 3M0WA 2EHBA 2O60A 2K8MB 1IJ6A 1UURA 5ER4X 1SCVA 2BL0B 1QS7A 1DMOA 1F8HA 1MXEA 1YR5A 3I5GC 3OP0A 1IG5A 3BOWB 3BUWB 1AVSA 1K96A 1SYMA 3EK4A 1H8BA 3CR4X 1BMOA 5I8NA 1BR1B 1EG4A 2D8NA 1K95A 2LLUA 5AEQA 5JJGA 2ZN9A 2LVVA 2BE4A 2LUXA 1NYAA 5GQQC 1CFDA 3MSEB 2M8UA 1OMDA 1JF0A 2ZRSA 3SIBA 4MEWA 3NSOA 3D0YA 1NX2A 2H61A 1SY9A 2PALA 4XJKB 4DRWA 3AKAA 1NWDA 2MRDA 2PRUA 2BBNA 2WCBA 1F70A 1KK7Z 1KFXS 1J7RA 1WLZA 2ZN8A 1G8IA 1FI6A 1KQMC 2Q91A 1A75A 5ER5A 2QACA 2BKIB 3EKJA 2M3WA 2PVBA 1D1OA 1DF0B 1NCXA 2OS8C 2SCPA 2LP2A 1A29A 3ICBA 2LVJA 5CPVA 1XFXO 2LE9B 5D7FA 3SJSA 2LMTA 2KNEA 4BY4A 1FPWA 1R2UA 2BE6A 1KK7Y 4DIRA 1DJIA 1EXRA 3AAJA 3VRRA 2LLTA 2EC6B 4DS7A 2E30A 2L50A 1DJYA 1TCOB 1HT9A 2DOQA 2FOTA 4GUKA 5AERA 1TRFA 1V1FA 4ZCUA 1PVAA 2LHIA 1TNXA 2ZNDA 1YVLA 2JOJA 1L2OC 4GNKB 4M2OA 1QV0A 1CNPA 2MHHA 5AANA 1HQVA 1TOPA 1KSMA 2F3YA 5BPJA 2MBXA 1WRZA 3SG5A 3O78A 1FBVA 1DJHA 3JVTC 1KK8C 1CLLA 4HSZA 5AFPA 2Y1NA 1B1GA 2JC2A 5KU1A 1DJZA 1SRAA 2HPSA 4N5XA 1F54A 1GGZA 2PSRA 3OB2B 4PALA 1OQPA 1KSOA 2KI4B 1C7WA 3CGAA 4PHMA 1UP5A 1AUIB 3LLEA 1SL9A 1SKTA 1BOCA 1XYDA 2I7AA 4L9MA 1A2XA 2KFGA 4MVFA 1W7JB 1XA5A 1XK4C 2CCMA 2JU0A 4BY5A 2L4IA 4R1EA 2LVKA 1Y6WA 1BG1A 1S5GZ 1MF8B 1MXLC 2ZRTA 5K89A 4PCWA 5CSJA 1BLQA 1U5IA 1CM4A 1PULA 3KPXA 2BCAA 4YGEB 2L51A 3D0YB 1BODA 1YVHA 1YUTA 4M2PA 2IS9A 2JNXA 1S6JA 2COLB 3E3RA 4MZJA 1NX0A 4P5OE 1K9KA 1SL7A 1RWYA 1L7ZA 2OPOA 5DKRA 3WXAA 1YRUB 4OCIA 1XFUO 1WY9A 4MLWA 1S5GY 3CR5X 3DF0A 1A75B 1K90D 1SCMB 2GGMA 1YX8A 4C0JA 4QJ3B 1F4QA 3CZTX 2BKHB 1KFXL 2H2KA 4USLA 3WNXB 2K7DA 1LXFC 4CIDA 4MRXA 2JT3A 2CT9A 3TS5C 2AUCA 1EG3A 2K2AA 1QASA 1CLMA 2F2OA 1CM1A 2F2PA 4JPZB 3TDUA 1LVCD 2M49B 1QATA 2HF5A 3I5HC 4NQGA 1IQ5A 2TN4A 3OX6A 1MQ1A 3FWBA 4DUQA 1SL8A 4ICBA 1XFWO 1WLMA 1UHKA 1DJWA 2CTNA 2MAZA 5KSZA 1DGVA 3SG3A 5F6TA 4I5KA 1Y1UA 3PLFB 4PE0A 3DVJA 2JTTA 2AAOA 3BUOB 3SG6A 3EK7A 2M0RA 3GK2A 1OMRA 1IJ5A 3LL8B 5DKQA 4N1GA 4WQ2A 4C0KA 1M63B 2NCOA 4IL1A 3ZWHA 3QRXA 2VRGA 3DVEA 1CLBA 3C1VA 1IGVA 1WDCC 2Y4QA 4MZLA 4I5LB 2MLFC 1IKUA 3CTNA 1QVIZ 3IQQA 1GQMA 4CPVA 1M39A 3BXKA 1KWOB 3PN7B 5I2QA 1TCFA 3PATA 4YGAA 1SR6B 5CSFA 5TNCA 1C07A 3SG2A 1IWQA 2LCPA 3GK4X 2KDHA 4MSPA 2KFHA 1CTRA 1ALWA 1IQ3A 1EH2A 2LMUA 5CSIA 3I5FB 3GK1A 1QVIY 3CWGA 2F8PA 1MUXA 1U5IB 3SG7A 3TDIA 1NPQA 3I5IC 1Q80A 1OMVA 3CR2A 1NP8A 2JULA 3RM1A 4I5NB 4MZKA 2F33A 1BJFA 1AHRA 2JXCA 1UUSA 2CBLA 3BUMB 1OZOA 3DF0B 3JTDC 1AJ5A 3LCPC 2K7BA 4YI9A 4NDBA 1M31A 1TNQA 2L0PA 3FWCA 3VRPA 3I5GB 1KCYA 1WRKA 1QX2A 1W7IB 1NSHA 1CDMA 2WCEA 4ZCVA 1XK4A 1MHOA 1NIWA 1RTP1 1NCYA 1AJ4A 2NZ0A 3OB1B 2M1KB 1PRWA 3O2PA 3CLNA 1UHJA 1QV1A 2MJWB 1QLKA 1LKJA 1CFPA 2FCEA 2M29A 2BECA 3LK0A 1S1EA 4A4BA 2HQWA 1B7TZ 1S3PA 2KYCA 4GGFC 1ODBA 3TZ1A 1A4PA 2WC8A 1NX3A 2KFFA 1XO5A 1TIZA 4FQOA 4TNCA 3VRNA 2I2RE 1NX1A 1SK6D 1K93D 1UHIA 1GJYA 1YURA 4CFRA 1KQMB 2JNFA 2KQ6A 1CDPA 2M9GA 1H4BA 1UHNA 3ZNIA 4OV2A 2GGZA 4E68A 1DGUA 2HETA 1BF5A 1JSAA 2OS8B 1JWDA 2LP3A 3WHTB 1CB1A 3DVMA 4P2YB 4XYNA 1X02A 4CLNA 1B8LA 1YRTB 4ORCB 3H4SE 5HKYA 2KAVA 2G2BA 1B8RA 4ETOA 3DD4A 4C0LA 2NXQA 1WRLA 2R2IA 3TUYC 1UHHA 1IH0A 1K94A 1PSRA 1L2OB 2KYFA 3HCMA 1QTXA 3OHMB 3VGOA 1YUUA 4YGCB 2I94A 1F55A 4PDZA 3FIAA 2GV5A 2OTGC 5I2OA 1QJTA 1K9PA 2KQYA 1S6CA 2LHLA 1NCZA 4QJ4B 1Y0VH 2ZFDA 3VRQA 2JPTA 3JVTB 1KK8B 5HLVA 1LA0A 1RK9A 4GFTA 3KF9A 1V1GA 5HKZA 1RECA 1DJGA 2LNKA 1FF1A 1N2DA 1F4OA 2BL0C 1S6IA 1B47A 4MN0A 2I18A 2LM5A 1JF2A 3K21A 5AXIA 2MA2A 4PHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YRU A;  2JRF A;  1QIW A;  1OE9 B;  4PE1 A;  1PK0 D;  1J7P A;  2KAY A;  3GOF A;  3IQO A;  2FJU B;  3A8R A;  3NSL A;  4F0Z B;  1BT6 A;  2ZNE A;  4PE4 A;  1PVB A;  3PAL A;  2P6B B;  2WOR A;  4OVN F;  1GGW A;  2JT8 A;  3A4U B;  1M45 A;  3EVV A;  1B9A A;  2JZI A;  1MR8 A;  3OX5 A;  4PHK A;  1QX7 A;  3FS7 A;  1LA3 A;  3KHE A;  5JOL A;  1Y1X A;  1YTZ C;  4N1F A;  3RLZ A;  4FTG A;  1JFJ A;  4AOM A;  2K7O A;  1B8C A;  1J7Q A;  1SNL A;  1ZFS A;  4NDD A;  4YGD B;  3WHU B;  1G33 A;  3KEV A;  1A03 A;  2Y1M A;  4WQ3 A;  3SG4 A;  2KGB C;  3D10 A;  2EC6 C;  3TS5 B;  4HRG A;  4AQI A;  2O5G A;  1S36 A;  4HRH A;  1OZS A;  2WCF A;  1NUB A;  4WRI A;  1ALV A;  1TN4 A;  5I2L A;  5HYD A;  3I5H B;  5KTY A;  1PAL A;  2M7N A;  1AK8 A;  2M7L A;  2BBM A;  2KAX A;  2LUC A;  1BR4 B;  1J1E A;  2A4J A;  2F3Z A;  2KGR A;  2LC5 A;  4GGF A;  1CFF A;  4GPL B;  4I5J A;  1KFU S;  4Q04 A;  2PAS A;  1J1D A;  1ZAC A;  2RGI A;  1ZOT B;  2BCX A;  1N65 A;  1XFV O;  2LVI A;  3NSK A;  1CDN A;  3KO0 A;  2CXJ A;  1OSA A;  2M1U A;  1TNW A;  1QLS A;  5DKN A;  1QXP A;  4NDC A;  3VRO A;  1J55 A;  2M97 A;  3BUX B;  2KI4 C;  2KI6 D;  1WDC B;  1R6P A;  2B1U A;  4HRE E;  4PHJ A;  5B8I B;  5IBW A;  1JC2 A;  2JWW A;  1FI5 A;  4YGB B;  3LK1 A;  3PSR A;  2K7C A;  1TNP A;  1EJ3 A;  4OKH A;  5FYX A;  1TTX A;  2PMY A;  1VRK A;  2K61 A;  1J7O A;  2LMV A;  1DJX A;  1DT7 B;  1KQV A;  2E6W A;  2ZKM X;  2JT0 A;  4AQJ A;  2K0J A;  1CMG A;  2KI6 C;  2SAS A;  2Y5I A;  3EVU A;  1E8A A;  2KHN A;  1DTL A;  2JQ6 A;  1QX5 B;  2H61 C;  3I5I B;  2KBI A;  3PFV A;  1CFC A;  4ORA B;  5J3X A;  4GGN A;  2MLE C;  1B7T Y;  3AKB A;  4YBH B;  4UPG A;  2ISD A;  1N0Y A;  3EKH A;  2L98 A;  2L4H A;  1SCM C;  1RRO A;  2L2E A;  3JTD B;  5D69 A;  1S26 D;  2LLS A;  3BOW A;  3IF7 A;  3F45 A;  3BQ3 A;  4DCK A;  2QPT A;  1JUO A;  3O4Y A;  4GBA A;  4CFQ A;  1UWO A;  3EK8 A;  1PSB A;  3NSI A;  2L5X B;  1JFK A;  1RFJ A;  1XFZ O;  2LAN A;  2CNP A;  4QJ5 B;  1SPY A;  1EL4 A;  3SIA A;  4D1E A;  1OOJ A;  1JBA A;  2FCD A;  1ZMZ A;  5CSN A;  1SMG A;  2BCB A;  2KOT A;  1G4Y R;  1RJV A;  3EVR A;  2NCP A;  4XJK A;  3O6B A;  3PM8 A;  1M46 A;  1K9U A;  1CMF A;  1DVI A;  1K2H A;  1CDL A;  1IRJ A;  2LV7 A;  2NLN A;  3NXA A;  4MRY A;  2K2F A;  1YX7 A;  1XFY O;  1CKK A;  1DF0 A;  3HX4 A;  1KFU L;  1C7V A;  1BU3 A;  2EGD A;  4U8D A;  4JWQ A;  3PN7 C;  1KWO C;  2G9B A;  1YUS A;  2JTZ A;  2JXL A;  3CS1 A;  2Q4U A;  4MBE A;  1QIV A;  2KBM A;  4OR9 B;  5HLO A;  1ZUZ A;  1SR6 C;  2KSP A;  2V53 A;  2WOS A;  1K8U A;  1AP4 A;  4A4C A;  4ORB B;  3AAK A;  5HKW A;  4PE7 A;  3BYA A;  3TUY B;  3DVK A;  3TDZ A;  3I5F C;  5PAL A;  2WND A;  1FW4 A;  2HQ8 A;  2OTG B;  1XVJ A;  4JQ0 D;  1SW8 A;  1Y1A A;  2LAP A;  4GAO A;  4M2Q A;  2AMI A;  1LIN A;  5G08 A;  1B4C A;  1F71 A;  1MWN A;  4YI8 A;  1SBJ A;  3BUN B;  3M0W A;  2EHB A;  2O60 A;  2K8M B;  1IJ6 A;  1UUR A;  5ER4 X;  1SCV A;  2BL0 B;  1QS7 A;  1DMO A;  1F8H A;  1MXE A;  1YR5 A;  3I5G C;  3OP0 A;  1IG5 A;  3BOW B;  3BUW B;  1AVS A;  1K96 A;  1SYM A;  3EK4 A;  1H8B A;  3CR4 X;  1BMO A;  5I8N A;  1BR1 B;  1EG4 A;  2D8N A;  1K95 A;  2LLU A;  5AEQ A;  5JJG A;  2ZN9 A;  2LVV A;  2BE4 A;  2LUX A;  1NYA A;  5GQQ C;  1CFD A;  3MSE B;  2M8U A;  1OMD A;  1JF0 A;  2ZRS A;  3SIB A;  4MEW A;  3NSO A;  3D0Y A;  1NX2 A;  2H61 A;  1SY9 A;  2PAL A;  4XJK B;  4DRW A;  3AKA A;  1NWD A;  2MRD A;  2PRU A;  2BBN A;  2WCB A;  1F70 A;  1KK7 Z;  1KFX S;  1J7R A;  1WLZ A;  2ZN8 A;  1G8I A;  1FI6 A;  1KQM C;  2Q91 A;  1A75 A;  5ER5 A;  2QAC A;  2BKI B;  3EKJ A;  2M3W A;  2PVB A;  1D1O A;  1DF0 B;  1NCX A;  2OS8 C;  2SCP A;  2LP2 A;  1A29 A;  3ICB A;  2LVJ A;  5CPV A;  1XFX O;  2LE9 B;  5D7F A;  3SJS A;  2LMT A;  2KNE A;  4BY4 A;  1FPW A;  1R2U A;  2BE6 A;  1KK7 Y;  4DIR A;  1DJI A;  1EXR A;  3AAJ A;  3VRR A;  2LLT A;  2EC6 B;  4DS7 A;  2E30 A;  2L50 A;  1DJY A;  1TCO B;  1HT9 A;  2DOQ A;  2FOT A;  4GUK A;  5AER A;  1TRF A;  1V1F A;  4ZCU A;  1PVA A;  2LHI A;  1TNX A;  2ZND A;  1YVL A;  2JOJ A;  1L2O C;  4GNK B;  4M2O A;  1QV0 A;  1CNP A;  2MHH A;  5AAN A;  1HQV A;  1TOP A;  1KSM A;  2F3Y A;  5BPJ A;  2MBX A;  1WRZ A;  3SG5 A;  3O78 A;  1FBV A;  1DJH A;  3JVT C;  1KK8 C;  1CLL A;  4HSZ A;  5AFP A;  2Y1N A;  1B1G A;  2JC2 A;  5KU1 A;  1DJZ A;  1SRA A;  2HPS A;  4N5X A;  1F54 A;  1GGZ A;  2PSR A;  3OB2 B;  4PAL A;  1OQP A;  1KSO A;  2KI4 B;  1C7W A;  3CGA A;  4PHM A;  1UP5 A;  1AUI B;  3LLE A;  1SL9 A;  1SKT A;  1BOC A;  1XYD A;  2I7A A;  4L9M A;  1A2X A;  2KFG A;  4MVF A;  1W7J B;  1XA5 A;  1XK4 C;  2CCM A;  2JU0 A;  4BY5 A;  2L4I A;  4R1E A;  2LVK A;  1Y6W A;  1BG1 A;  1S5G Z;  1MF8 B;  1MXL C;  2ZRT A;  5K89 A;  4PCW A;  5CSJ A;  1BLQ A;  1U5I A;  1CM4 A;  1PUL A;  3KPX A;  2BCA A;  4YGE B;  2L51 A;  3D0Y B;  1BOD A;  1YVH A;  1YUT A;  4M2P A;  2IS9 A;  2JNX A;  1S6J A;  2COL B;  3E3R A;  4MZJ A;  1NX0 A;  4P5O E;  1K9K A;  1SL7 A;  1RWY A;  1L7Z A;  2OPO A;  5DKR A;  3WXA A;  1YRU B;  4OCI A;  1XFU O;  1WY9 A;  4MLW A;  1S5G Y;  3CR5 X;  3DF0 A;  1A75 B;  1K90 D;  1SCM B;  2GGM A;  1YX8 A;  4C0J A;  4QJ3 B;  1F4Q A;  3CZT X;  2BKH B;  1KFX L;  2H2K A;  4USL A;  3WNX B;  2K7D A;  1LXF C;  4CID A;  4MRX A;  2JT3 A;  2CT9 A;  3TS5 C;  2AUC A;  1EG3 A;  2K2A A;  1QAS A;  1CLM A;  2F2O A;  1CM1 A;  2F2P A;  4JPZ B;  3TDU A;  1LVC D;  2M49 B;  1QAT A;  2HF5 A;  3I5H C;  4NQG A;  1IQ5 A;  2TN4 A;  3OX6 A;  1MQ1 A;  3FWB A;  4DUQ A;  1SL8 A;  4ICB A;  1XFW O;  1WLM A;  1UHK A;  1DJW A;  2CTN A;  2MAZ A;  5KSZ A;  1DGV A;  3SG3 A;  5F6T A;  4I5K A;  1Y1U A;  3PLF B;  4PE0 A;  3DVJ A;  2JTT A;  2AAO A;  3BUO B;  3SG6 A;  3EK7 A;  2M0R A;  3GK2 A;  1OMR A;  1IJ5 A;  3LL8 B;  5DKQ A;  4N1G A;  4WQ2 A;  4C0K A;  1M63 B;  2NCO A;  4IL1 A;  3ZWH A;  3QRX A;  2VRG A;  3DVE A;  1CLB A;  3C1V A;  1IGV A;  1WDC C;  2Y4Q A;  4MZL A;  4I5L B;  2MLF C;  1IKU A;  3CTN A;  1QVI Z;  3IQQ A;  1GQM A;  4CPV A;  1M39 A;  3BXK A;  1KWO B;  3PN7 B;  5I2Q A;  1TCF A;  3PAT A;  4YGA A;  1SR6 B;  5CSF A;  5TNC A;  1C07 A;  3SG2 A;  1IWQ A;  2LCP A;  3GK4 X;  2KDH A;  4MSP A;  2KFH A;  1CTR A;  1ALW A;  1IQ3 A;  1EH2 A;  2LMU A;  5CSI A;  3I5F B;  3GK1 A;  1QVI Y;  3CWG A;  2F8P A;  1MUX A;  1U5I B;  3SG7 A;  3TDI A;  1NPQ A;  3I5I C;  1Q80 A;  1OMV A;  3CR2 A;  1NP8 A;  2JUL A;  3RM1 A;  4I5N B;  4MZK A;  2F33 A;  1BJF A;  1AHR A;  2JXC A;  1UUS A;  2CBL A;  3BUM B;  1OZO A;  3DF0 B;  3JTD C;  1AJ5 A;  3LCP C;  2K7B A;  4YI9 A;  4NDB A;  1M31 A;  1TNQ A;  2L0P A;  3FWC A;  3VRP A;  3I5G B;  1KCY A;  1WRK A;  1QX2 A;  1W7I B;  1NSH A;  1CDM A;  2WCE A;  4ZCV A;  1XK4 A;  1MHO A;  1NIW A;  1RTP 1;  1NCY A;  1AJ4 A;  2NZ0 A;  3OB1 B;  2M1K B;  1PRW A;  3O2P A;  3CLN A;  1UHJ A;  1QV1 A;  2MJW B;  1QLK A;  1LKJ A;  1CFP A;  2FCE A;  2M29 A;  2BEC A;  3LK0 A;  1S1E A;  4A4B A;  2HQW A;  1B7T Z;  1S3P A;  2KYC A;  4GGF C;  1ODB A;  3TZ1 A;  1A4P A;  2WC8 A;  1NX3 A;  2KFF A;  1XO5 A;  1TIZ A;  4FQO A;  4TNC A;  3VRN A;  2I2R E;  1NX1 A;  1SK6 D;  1K93 D;  1UHI A;  1GJY A;  1YUR A;  4CFR A;  1KQM B;  2JNF A;  2KQ6 A;  1CDP A;  2M9G A;  1H4B A;  1UHN A;  3ZNI A;  4OV2 A;  2GGZ A;  4E68 A;  1DGU A;  2HET A;  1BF5 A;  1JSA A;  2OS8 B;  1JWD A;  2LP3 A;  3WHT B;  1CB1 A;  3DVM A;  4P2Y B;  4XYN A;  1X02 A;  4CLN A;  1B8L A;  1YRT B;  4ORC B;  3H4S E;  5HKY A;  2KAV A;  2G2B A;  1B8R A;  4ETO A;  3DD4 A;  4C0L A;  2NXQ A;  1WRL A;  2R2I A;  3TUY C;  1UHH A;  1IH0 A;  1K94 A;  1PSR A;  1L2O B;  2KYF A;  3HCM A;  1QTX A;  3OHM B;  3VGO A;  1YUU A;  4YGC B;  2I94 A;  1F55 A;  4PDZ A;  3FIA A;  2GV5 A;  2OTG C;  5I2O A;  1QJT A;  1K9P A;  2KQY A;  1S6C A;  2LHL A;  1NCZ A;  4QJ4 B;  1Y0V H;  2ZFD A;  3VRQ A;  2JPT A;  3JVT B;  1KK8 B;  5HLV A;  1LA0 A;  1RK9 A;  4GFT A;  3KF9 A;  1V1G A;  5HKZ A;  1REC A;  1DJG A;  2LNK A;  1FF1 A;  1N2D A;  1F4O A;  2BL0 C;  1S6I A;  1B47 A;  4MN0 A;  2I18 A;  2LM5 A;  1JF2 A;  3K21 A;  5AXI A;  2MA2 A;  4PHN A; 
#chains in the Genus database with same CATH topology
 4YRU A;  2JRF A;  1QIW A;  1OE9 B;  4PE1 A;  1PK0 D;  1OW4 A;  2WCH A;  1J7P A;  2KAY A;  3GOF A;  3CZ2 A;  3IQO A;  2FJU B;  3A8R A;  3EG5 B;  3NSL A;  4F0Z B;  1BT6 A;  2ZNE A;  2GTE A;  2ERB A;  1PVB A;  4PE4 A;  3PAL A;  2P6B B;  3S0D A;  2WOR A;  4OVN F;  1GGW A;  2JT8 A;  2QEO A;  3B87 A;  2K60 A;  1M45 A;  3A4U B;  3EVV A;  1B9A A;  3SS4 A;  3D75 A;  3V2L A;  2JZI A;  1MR8 A;  3OX5 A;  4PHK A;  1QX7 A;  3FS7 A;  1LA3 A;  3KHE A;  5JOL A;  1Y1X A;  1YTZ C;  4N1F A;  2WC6 A;  3RLZ A;  4FTG A;  1JFJ A;  2WCK A;  3Q8I A;  3UO9 A;  4AOM A;  2K7O A;  1B8C A;  1J7Q A;  1SNL A;  1ZFS A;  4NDD A;  4YGD B;  3WHU B;  1G33 A;  3KEV A;  1A03 A;  2Y1M A;  4WQ3 A;  3SG4 A;  2KGB C;  1QWV A;  3D10 A;  2EC6 C;  3TS5 B;  4HRG A;  4AQI A;  2O5G A;  1S36 A;  4HRH A;  2KPH A;  1OZS A;  2WCF A;  1NUB A;  4WRI A;  1ALV A;  1TN4 A;  3OGN A;  5I2L A;  5HYD A;  1TUZ A;  3I5H B;  5KTY A;  1PAL A;  2M7N A;  3BFH A;  3S0G A;  1AK8 A;  2M7L A;  2BBM A;  2KAX A;  2LUC A;  5DKR A;  1BR4 B;  1J1E A;  2A4J A;  2F3Z A;  2KGR A;  2LC5 A;  4GGF A;  1CFF A;  4GPL B;  4I5J A;  1KFU S;  4Q04 A;  2PAS A;  1J1D A;  1OOF A;  1ZAC A;  2RGI A;  1ZOT B;  2BCX A;  1N65 A;  1XFV O;  2LVI A;  3NSK A;  3B88 A;  1CDN A;  3KO0 A;  2CXJ A;  1OSA A;  3SS3 A;  2M1U A;  1TNW A;  5D3O A;  1QLS A;  5DKN A;  1QXP A;  1DEL A;  4NDC A;  3VRO A;  3WXA A;  1J55 A;  2M97 A;  3BUX B;  2KI4 C;  2KI6 D;  1WDC B;  1R6P A;  2B1U A;  4HRE E;  4PHJ A;  5B8I B;  2QEH A;  5IBW A;  1JC2 A;  2JWW A;  1FI5 A;  4YGB B;  3LK1 A;  3S0B A;  3PSR A;  2K7C A;  1TNP A;  1EJ3 A;  4OKH A;  5FYX A;  1TTX A;  2PMY A;  1LS8 A;  1VRK A;  2K61 A;  1J7O A;  2LMV A;  3CZ0 A;  1DJX A;  1DT7 B;  1KQV A;  2E6W A;  2ZKM X;  2JT0 A;  4AQJ A;  2K0J A;  1CMG A;  2KI6 C;  2SAS A;  2Y5I A;  3EVU A;  1E8A A;  3S0E A;  2KHN A;  1DTL A;  2JQ6 A;  1QX5 B;  2H61 C;  3I5I B;  2KBI A;  3PFV A;  3R72 A;  1CFC A;  2QEV A;  4ORA B;  3O4X A;  5J3X A;  4GGN A;  2MLE C;  1B7T Y;  3AKB A;  4YBH B;  4UPG A;  2ISD A;  1N0Y A;  3EKH A;  2L98 A;  2L4H A;  1SCM C;  1RRO A;  2L2E A;  3JTD B;  5D69 A;  1S26 D;  2LLS A;  3BOW A;  3IF7 A;  3F45 A;  3BQ3 A;  2P70 A;  4DCK A;  2QPT A;  1JUO A;  3O4Y A;  4GBA A;  4CFQ A;  1UWO A;  3EK8 A;  1PSB A;  3NSI A;  2L5X B;  1JFK A;  1RFJ A;  1XFZ O;  2LAN A;  2CNP A;  4QJ5 B;  1SPY A;  2H8V A;  1EL4 A;  3SIA A;  4D1E A;  1OOJ A;  1JBA A;  2FCD A;  3L47 A;  1ZMZ A;  5CSN A;  1SMG A;  1F55 A;  2BCB A;  2KOT A;  5FI6 A;  1G4Y R;  1RJV A;  3EVR A;  2NCP A;  4XJK A;  3O6B A;  3PM8 A;  1M46 A;  1K9U A;  1CMF A;  1DVI A;  1K2H A;  1CDL A;  1IRJ A;  2LV7 A;  2NLN A;  4KYN A;  3NXA A;  4MRY A;  2K2F A;  1YX7 A;  1XFY O;  1CKK A;  1DF0 A;  3HX4 A;  3NHI A;  1KFU L;  1C7V A;  1BU3 A;  3CZ1 A;  2EGD A;  3B7A A;  3QME A;  1OOG A;  4U8D A;  4JWQ A;  3PN7 C;  3RZS A;  1KWO C;  2G9B A;  1YUS A;  2JTZ A;  2JXL A;  3CS1 A;  2Q4U A;  4MBE A;  1QIV A;  2KBM A;  4OR9 B;  3D73 A;  5HLO A;  3S0F A;  1ZUZ A;  1SR6 C;  2KSP A;  1C3Z A;  2V53 A;  2WOS A;  1K8U A;  1AP4 A;  4A4C A;  4ORB B;  2L5Y A;  3AAK A;  5HKW A;  4PE7 A;  3BYA A;  3D76 A;  5I94 A;  3TUY B;  3DVK A;  3TDZ A;  3I5F C;  3IVT A;  5PAL A;  2QDI A;  1FW4 A;  2WND A;  2HQ8 A;  2OTG B;  1XVJ A;  4JQ0 D;  1C3Y A;  1SW8 A;  3VGO A;  1Y1A A;  2LAP A;  4GAO A;  4M2Q A;  2AMI A;  1LIN A;  5G08 A;  1B4C A;  1F71 A;  1MWN A;  2L2C A;  1SBJ A;  3B86 A;  3BUN B;  4YI8 A;  3M0W A;  2EHB A;  2O60 A;  2K8M B;  1IJ6 A;  1UUR A;  5ER4 X;  1SCV A;  2BL0 B;  1QS7 A;  1DMO A;  1F8H A;  1MXE A;  1YR5 A;  3I5G C;  3OP0 A;  5FI7 A;  1IG5 A;  3BOW B;  3BUW B;  1AVS A;  1K96 A;  1SYM A;  3EK4 A;  1H8B A;  3CR4 X;  1BMO A;  5I8N A;  1BR1 B;  3DXL A;  1EG4 A;  2D8N A;  1K95 A;  2LLU A;  3BJH A;  5AEQ A;  2ZN9 A;  5JJG A;  2LVV A;  1W9Z A;  2BE4 A;  2LUX A;  1NYA A;  5GQQ C;  1CFD A;  3MSE B;  2M8U A;  1OMD A;  1JF0 A;  2ZRS A;  3SIB A;  4MEW A;  4INX A;  3NSO A;  3D0Y A;  1NX2 A;  2H61 A;  1SY9 A;  2PAL A;  4XJK B;  4DRW A;  3OBV A;  3AKA A;  1NWD A;  2MRD A;  2PRU A;  2BBN A;  2WCB A;  1F70 A;  1KK7 Z;  3VB1 A;  1KFX S;  1J7R A;  1WLZ A;  2ZN8 A;  1G8I A;  1FI6 A;  1KQM C;  2Q91 A;  1A75 A;  5ER5 A;  2QAC A;  1SSE B;  2BKI B;  3EKJ A;  2M3W A;  2PVB A;  1D1O A;  1DF0 B;  1NCX A;  2OS8 C;  2SCP A;  2LP2 A;  1A29 A;  3ICB A;  2LVJ A;  5CPV A;  1XFX O;  2LE9 B;  5D7F A;  3SJS A;  2LMT A;  1T14 A;  2KNE A;  4BY4 A;  1FPW A;  1R2U A;  2BE6 A;  1KK7 Y;  2FJY A;  4DIR A;  1DJI A;  1EXR A;  3AAJ A;  3CYZ A;  2LLT A;  3VRR A;  2EC6 B;  4DS7 A;  2E30 A;  2L50 A;  1DJY A;  1TCO B;  1HT9 A;  2DOQ A;  2FOT A;  4GUK A;  5AER A;  1TRF A;  1V1F A;  4ZCU A;  3R1P A;  1PVA A;  2LHI A;  1TNX A;  2BAP A;  1YVL A;  2JOJ A;  1L2O C;  2ZND A;  4GNK B;  4M2O A;  1QV0 A;  1CNP A;  2MHH A;  5AAN A;  1HQV A;  1TOP A;  1KSM A;  2F3Y A;  5BPJ A;  2MBX A;  1WRZ A;  3FE6 A;  3SG5 A;  3O78 A;  1Z2C B;  1FBV A;  3NGV A;  1DJH A;  4PT1 A;  2P71 A;  3JVT C;  1KK8 C;  1CLL A;  4HSZ A;  5AFP A;  2Y1N A;  1B1G A;  2JC2 A;  5KU1 A;  1DJZ A;  1SRA A;  2HPS A;  4JKT A;  4N5X A;  1F54 A;  1GGZ A;  2PSR A;  3OB2 B;  4PAL A;  1OQP A;  1KSO A;  2KI4 B;  4F7F A;  1C7W A;  2PYQ A;  3CGA A;  4PHM A;  1UP5 A;  4P5O E;  1AUI B;  2JPO A;  3LLE A;  1SL9 A;  1SKT A;  1BOC A;  1XYD A;  2I7A A;  4L9M A;  1A2X A;  2KFG A;  4MVF A;  1W7J B;  1XA5 A;  1XK4 C;  2CCM A;  2JU0 A;  3D74 A;  4BY5 A;  2L4I A;  3DY9 A;  4R1E A;  2LVK A;  1Y6W A;  1BG1 A;  1S5G Z;  1MF8 B;  1MXL C;  2ZRT A;  5K89 A;  4PCW A;  5CSJ A;  1BLQ A;  3D77 A;  1U5I A;  3DZT A;  1CM4 A;  1PUL A;  3KPX A;  2BCA A;  4YGE B;  2L51 A;  3D0Y B;  1BOD A;  1YVH A;  1YUT A;  4M2P A;  2IS9 A;  2JNX A;  1S6J A;  2COL B;  3E3R A;  4MZJ A;  1NX0 A;  3CDN A;  1K9K A;  1SL7 A;  1RWY A;  1L7Z A;  2OPO A;  2WC5 A;  3BFB A;  1YRU B;  4FQT A;  1XFU O;  4JD9 A;  4OCI A;  1WY9 A;  4MLW A;  1S5G Y;  3CR5 X;  3DF0 A;  3PM2 A;  1A75 B;  1K90 D;  1SCM B;  2GGM A;  1YX8 A;  4C0J A;  4QJ3 B;  1F4Q A;  3CZT X;  2BKH B;  1DQE A;  1KFX L;  2H2K A;  4USL A;  3WNX B;  2K7D A;  1LXF C;  4CID A;  4MRX A;  2JT3 A;  2CT9 A;  3TS5 C;  2AUC A;  1EG3 A;  2K2A A;  1QAS A;  1XFR A;  3BFA A;  1CLM A;  2F2O A;  1CM1 A;  3B6X A;  2F2P A;  4JPZ B;  3TDU A;  1LVC D;  2M49 B;  1QAT A;  1ORG A;  2HF5 A;  3I5H C;  4NQG A;  1IQ5 A;  2TN4 A;  3OX6 A;  1MQ1 A;  3FWB A;  4DUQ A;  1SL8 A;  4ICB A;  1XFW O;  1WLM A;  1UHK A;  1DJW A;  2CTN A;  2MAZ A;  5KSZ A;  1DGV A;  3SG3 A;  1Z4H A;  5F6T A;  4I5K A;  3PJI A;  1Y1U A;  3PLF B;  4PE0 A;  3DVJ A;  2JTT A;  2AAO A;  3BUO B;  3SG6 A;  3EK7 A;  2M0R A;  3FE8 A;  3GK2 A;  1OMR A;  1IJ5 A;  3LL8 B;  4OZD A;  4N1G A;  4WQ2 A;  5DKQ A;  1M63 B;  2NCO A;  4C0K A;  4IL1 A;  1GM0 A;  3ZWH A;  3QRX A;  2VRG A;  3DVE A;  1CLB A;  3C1V A;  1IGV A;  1TWO A;  1WDC C;  2Y4Q A;  4MZL A;  4I5L B;  2MLF C;  1IKU A;  3CTN A;  1QVI Z;  3IQQ A;  1GQM A;  4CPV A;  1M39 A;  3BXK A;  1KWO B;  3PN7 B;  5I2Q A;  1TCF A;  3PAT A;  4YGA A;  1SR6 B;  5CSF A;  5TNC A;  1C07 A;  3SG2 A;  1IWQ A;  2LCP A;  3GK4 X;  2KDH A;  4MSP A;  2KFH A;  1CTR A;  1ALW A;  3FE9 A;  1IQ3 A;  2LMU A;  1EH2 A;  5CSI A;  2QEB A;  3I5F B;  3GK1 A;  1QVI Y;  3SS5 A;  3K1E A;  1DEK A;  2F8P A;  3CWG A;  5EL2 A;  1MUX A;  1U5I B;  2KLE A;  3SG7 A;  3TDI A;  1NPQ A;  3I5I C;  2BNX A;  1Q80 A;  1TUJ A;  1OMV A;  3CR2 A;  1IIO A;  1NP8 A;  2JUL A;  3RM1 A;  4I5N B;  4MZK A;  2F33 A;  1BJF A;  1AHR A;  2JXC A;  1UUS A;  2CBL A;  3BUM B;  1OZO A;  3DF0 B;  3JTD C;  1AJ5 A;  3LCP C;  2K7B A;  4YI9 A;  4NDB A;  1M31 A;  1TNQ A;  2L0P A;  3FWC A;  3VRP A;  5HL1 A;  3I5G B;  1KCY A;  1WRK A;  1QX2 A;  1W7I B;  1NSH A;  1CDM A;  2WCE A;  3S0A A;  4ZCV A;  1XK4 A;  1MHO A;  1NIW A;  1RTP 1;  1NCY A;  1AJ4 A;  3NHT A;  2NZ0 A;  3OB1 B;  2M1K B;  1PRW A;  2WCJ A;  1P28 A;  3O2P A;  3CLN A;  1UHJ A;  2YGU A;  1QV1 A;  2MJW B;  1QLK A;  1LKJ A;  1CFP A;  3DYE A;  2FCE A;  2M29 A;  2BEC A;  3LK0 A;  1S1E A;  4A4B A;  2HQW A;  1B7T Z;  1OOI X;  1S3P A;  2KYC A;  4GGF C;  1ODB A;  3TZ1 A;  1A4P A;  2WC8 A;  3N7H A;  1NX3 A;  2KFF A;  1XO5 A;  1TIZ A;  2KLD A;  2WCM A;  4FQO A;  4TNC A;  3VRN A;  2I2R E;  1NX1 A;  1SK6 D;  1K93 D;  1UHI A;  1GJY A;  1YUR A;  4CFR A;  1KQM B;  3L4A A;  2JNF A;  2KQ6 A;  1CDP A;  2M9G A;  1H4B A;  1UHN A;  3ZNI A;  4OV2 A;  2GGZ A;  4E68 A;  1DGU A;  2HET A;  1BF5 A;  1JSA A;  2OS8 B;  1JWD A;  2LP3 A;  3WHT B;  1CB1 A;  3DVM A;  4P2Y B;  4XYN A;  1X02 A;  4CLN A;  1B8L A;  1YRT B;  4ORC B;  3H4S E;  5HKY A;  2KAV A;  3R1O A;  2G2B A;  1B8R A;  2WCL A;  3DD4 A;  4C0L A;  4ETO A;  2NXQ A;  1WRL A;  2R2I A;  3TUY C;  1UHH A;  1IH0 A;  1K94 A;  1PSR A;  1L2O B;  2KYF A;  3HCM A;  1QTX A;  3D78 A;  3L4L A;  1YUU A;  3OHM B;  2I94 A;  4YGC B;  4PDZ A;  3FIA A;  3UNW A;  2GV5 A;  2OTG C;  5I2O A;  2PQL A;  1OOH A;  1QJT A;  1K9P A;  4INW A;  2KQY A;  5DIC A;  1S6C A;  2LHL A;  1NCZ A;  4QJ4 B;  1Y0V H;  2ZFD A;  3VRQ A;  4IJ7 A;  2JPT A;  3JVT B;  1KK8 B;  5HLV A;  1LA0 A;  1RK9 A;  4GFT A;  3KF9 A;  3R1V A;  1V1G A;  1DC1 A;  5HKZ A;  1REC A;  1DJG A;  2LNK A;  3CAB A;  1N2D A;  1FF1 A;  1F4O A;  2BL0 C;  1S6I A;  1B47 A;  5FI2 A;  4MN0 A;  2I18 A;  2LM5 A;  1JF2 A;  3K21 A;  5AXI A;  2MA2 A;  4PHN A; 
#chains in the Genus database with same CATH homology
 4YRU A;  2JRF A;  1QIW A;  1OE9 B;  4PE1 A;  1PK0 D;  1J7P A;  2KAY A;  3GOF A;  3IQO A;  2FJU B;  3A8R A;  3NSL A;  4F0Z B;  1BT6 A;  2ZNE A;  4PE4 A;  1PVB A;  3PAL A;  2P6B B;  2WOR A;  4OVN F;  1GGW A;  2JT8 A;  3A4U B;  1M45 A;  3EVV A;  1B9A A;  2JZI A;  1MR8 A;  3OX5 A;  4PHK A;  1QX7 A;  3FS7 A;  1LA3 A;  3KHE A;  5JOL A;  1Y1X A;  1YTZ C;  4N1F A;  3RLZ A;  4FTG A;  1JFJ A;  4AOM A;  2K7O A;  1B8C A;  1J7Q A;  1SNL A;  1ZFS A;  4NDD A;  4YGD B;  3WHU B;  1G33 A;  3KEV A;  1A03 A;  2Y1M A;  4WQ3 A;  3SG4 A;  2KGB C;  3D10 A;  2EC6 C;  3TS5 B;  4HRG A;  4AQI A;  2O5G A;  1S36 A;  4HRH A;  1OZS A;  2WCF A;  1NUB A;  4WRI A;  1ALV A;  1TN4 A;  5I2L A;  5HYD A;  3I5H B;  5KTY A;  1PAL A;  2M7N A;  1AK8 A;  2M7L A;  2BBM A;  2KAX A;  2LUC A;  1BR4 B;  1J1E A;  2A4J A;  2F3Z A;  2KGR A;  2LC5 A;  4GGF A;  1CFF A;  4GPL B;  4I5J A;  1KFU S;  4Q04 A;  2PAS A;  1J1D A;  1ZAC A;  2RGI A;  1ZOT B;  2BCX A;  1N65 A;  1XFV O;  2LVI A;  3NSK A;  1CDN A;  3KO0 A;  2CXJ A;  1OSA A;  2M1U A;  1TNW A;  1QLS A;  5DKN A;  1QXP A;  4NDC A;  3VRO A;  1J55 A;  2M97 A;  3BUX B;  2KI4 C;  2KI6 D;  1WDC B;  1R6P A;  2B1U A;  4HRE E;  4PHJ A;  5B8I B;  5IBW A;  1JC2 A;  2JWW A;  1FI5 A;  4YGB B;  3LK1 A;  3PSR A;  2K7C A;  1TNP A;  1EJ3 A;  4OKH A;  5FYX A;  1TTX A;  2PMY A;  1VRK A;  2K61 A;  1J7O A;  2LMV A;  1DJX A;  1DT7 B;  1KQV A;  2E6W A;  2ZKM X;  2JT0 A;  4AQJ A;  2K0J A;  1CMG A;  2KI6 C;  2SAS A;  2Y5I A;  3EVU A;  1E8A A;  2KHN A;  1DTL A;  2JQ6 A;  1QX5 B;  2H61 C;  3I5I B;  2KBI A;  3PFV A;  1CFC A;  4ORA B;  5J3X A;  4GGN A;  2MLE C;  1B7T Y;  3AKB A;  4YBH B;  4UPG A;  2ISD A;  1N0Y A;  3EKH A;  2L98 A;  2L4H A;  1SCM C;  1RRO A;  2L2E A;  3JTD B;  5D69 A;  1S26 D;  2LLS A;  3BOW A;  3IF7 A;  3F45 A;  3BQ3 A;  4DCK A;  2QPT A;  1JUO A;  3O4Y A;  4GBA A;  4CFQ A;  1UWO A;  3EK8 A;  1PSB A;  3NSI A;  2L5X B;  1JFK A;  1RFJ A;  1XFZ O;  2LAN A;  2CNP A;  4QJ5 B;  1SPY A;  1EL4 A;  3SIA A;  4D1E A;  1OOJ A;  1JBA A;  2FCD A;  1ZMZ A;  5CSN A;  1SMG A;  2BCB A;  2KOT A;  1G4Y R;  1RJV A;  3EVR A;  2NCP A;  4XJK A;  3O6B A;  3PM8 A;  1M46 A;  1K9U A;  1CMF A;  1DVI A;  1K2H A;  1CDL A;  1IRJ A;  2LV7 A;  2NLN A;  3NXA A;  4MRY A;  2K2F A;  1YX7 A;  1XFY O;  1CKK A;  1DF0 A;  3HX4 A;  1KFU L;  1C7V A;  1BU3 A;  2EGD A;  4U8D A;  4JWQ A;  3PN7 C;  1KWO C;  2G9B A;  1YUS A;  2JTZ A;  2JXL A;  3CS1 A;  2Q4U A;  4MBE A;  1QIV A;  2KBM A;  4OR9 B;  5HLO A;  1ZUZ A;  1SR6 C;  2KSP A;  2V53 A;  2WOS A;  1K8U A;  1AP4 A;  4A4C A;  4ORB B;  3AAK A;  5HKW A;  4PE7 A;  3BYA A;  3TUY B;  3DVK A;  3TDZ A;  3I5F C;  5PAL A;  2WND A;  1FW4 A;  2HQ8 A;  2OTG B;  1XVJ A;  4JQ0 D;  1SW8 A;  1Y1A A;  2LAP A;  4GAO A;  4M2Q A;  2AMI A;  1LIN A;  5G08 A;  1B4C A;  1F71 A;  1MWN A;  4YI8 A;  1SBJ A;  3BUN B;  3M0W A;  2EHB A;  2O60 A;  2K8M B;  1IJ6 A;  1UUR A;  5ER4 X;  1SCV A;  2BL0 B;  1QS7 A;  1DMO A;  1F8H A;  1MXE A;  1YR5 A;  3I5G C;  3OP0 A;  1IG5 A;  3BOW B;  3BUW B;  1AVS A;  1K96 A;  1SYM A;  3EK4 A;  1H8B A;  3CR4 X;  1BMO A;  5I8N A;  1BR1 B;  1EG4 A;  2D8N A;  1K95 A;  2LLU A;  5AEQ A;  5JJG A;  2ZN9 A;  2LVV A;  2BE4 A;  2LUX A;  1NYA A;  5GQQ C;  1CFD A;  3MSE B;  2M8U A;  1OMD A;  1JF0 A;  2ZRS A;  3SIB A;  4MEW A;  3NSO A;  3D0Y A;  1NX2 A;  2H61 A;  1SY9 A;  2PAL A;  4XJK B;  4DRW A;  3AKA A;  1NWD A;  2MRD A;  2PRU A;  2BBN A;  2WCB A;  1F70 A;  1KK7 Z;  1KFX S;  1J7R A;  1WLZ A;  2ZN8 A;  1G8I A;  1FI6 A;  1KQM C;  2Q91 A;  1A75 A;  5ER5 A;  2QAC A;  2BKI B;  3EKJ A;  2M3W A;  2PVB A;  1D1O A;  1DF0 B;  1NCX A;  2OS8 C;  2SCP A;  2LP2 A;  1A29 A;  3ICB A;  2LVJ A;  5CPV A;  1XFX O;  2LE9 B;  5D7F A;  3SJS A;  2LMT A;  2KNE A;  4BY4 A;  1FPW A;  1R2U A;  2BE6 A;  1KK7 Y;  4DIR A;  1DJI A;  1EXR A;  3AAJ A;  3VRR A;  2LLT A;  2EC6 B;  4DS7 A;  2E30 A;  2L50 A;  1DJY A;  1TCO B;  1HT9 A;  2DOQ A;  2FOT A;  4GUK A;  5AER A;  1TRF A;  1V1F A;  4ZCU A;  1PVA A;  2LHI A;  1TNX A;  2ZND A;  1YVL A;  2JOJ A;  1L2O C;  4GNK B;  4M2O A;  1QV0 A;  1CNP A;  2MHH A;  5AAN A;  1HQV A;  1TOP A;  1KSM A;  2F3Y A;  5BPJ A;  2MBX A;  1WRZ A;  3SG5 A;  3O78 A;  1FBV A;  1DJH A;  3JVT C;  1KK8 C;  1CLL A;  4HSZ A;  5AFP A;  2Y1N A;  1B1G A;  2JC2 A;  5KU1 A;  1DJZ A;  1SRA A;  2HPS A;  4N5X A;  1F54 A;  1GGZ A;  2PSR A;  3OB2 B;  4PAL A;  1OQP A;  1KSO A;  2KI4 B;  1C7W A;  3CGA A;  4PHM A;  1UP5 A;  1AUI B;  3LLE A;  1SL9 A;  1SKT A;  1BOC A;  1XYD A;  2I7A A;  4L9M A;  1A2X A;  2KFG A;  4MVF A;  1W7J B;  1XA5 A;  1XK4 C;  2CCM A;  2JU0 A;  4BY5 A;  2L4I A;  4R1E A;  2LVK A;  1Y6W A;  1BG1 A;  1S5G Z;  1MF8 B;  1MXL C;  2ZRT A;  5K89 A;  4PCW A;  5CSJ A;  1BLQ A;  1U5I A;  1CM4 A;  1PUL A;  3KPX A;  2BCA A;  4YGE B;  2L51 A;  3D0Y B;  1BOD A;  1YVH A;  1YUT A;  4M2P A;  2IS9 A;  2JNX A;  1S6J A;  2COL B;  3E3R A;  4MZJ A;  1NX0 A;  4P5O E;  1K9K A;  1SL7 A;  1RWY A;  1L7Z A;  2OPO A;  5DKR A;  3WXA A;  1YRU B;  4OCI A;  1XFU O;  1WY9 A;  4MLW A;  1S5G Y;  3CR5 X;  3DF0 A;  1A75 B;  1K90 D;  1SCM B;  2GGM A;  1YX8 A;  4C0J A;  4QJ3 B;  1F4Q A;  3CZT X;  2BKH B;  1KFX L;  2H2K A;  4USL A;  3WNX B;  2K7D A;  1LXF C;  4CID A;  4MRX A;  2JT3 A;  2CT9 A;  3TS5 C;  2AUC A;  1EG3 A;  2K2A A;  1QAS A;  1CLM A;  2F2O A;  1CM1 A;  2F2P A;  4JPZ B;  3TDU A;  1LVC D;  2M49 B;  1QAT A;  2HF5 A;  3I5H C;  4NQG A;  1IQ5 A;  2TN4 A;  3OX6 A;  1MQ1 A;  3FWB A;  4DUQ A;  1SL8 A;  4ICB A;  1XFW O;  1WLM A;  1UHK A;  1DJW A;  2CTN A;  2MAZ A;  5KSZ A;  1DGV A;  3SG3 A;  5F6T A;  4I5K A;  1Y1U A;  3PLF B;  4PE0 A;  3DVJ A;  2JTT A;  2AAO A;  3BUO B;  3SG6 A;  3EK7 A;  2M0R A;  3GK2 A;  1OMR A;  1IJ5 A;  3LL8 B;  5DKQ A;  4N1G A;  4WQ2 A;  4C0K A;  1M63 B;  2NCO A;  4IL1 A;  3ZWH A;  3QRX A;  2VRG A;  3DVE A;  1CLB A;  3C1V A;  1IGV A;  1WDC C;  2Y4Q A;  4MZL A;  4I5L B;  2MLF C;  1IKU A;  3CTN A;  1QVI Z;  3IQQ A;  1GQM A;  4CPV A;  1M39 A;  3BXK A;  1KWO B;  3PN7 B;  5I2Q A;  1TCF A;  3PAT A;  4YGA A;  1SR6 B;  5CSF A;  5TNC A;  1C07 A;  3SG2 A;  1IWQ A;  2LCP A;  3GK4 X;  2KDH A;  4MSP A;  2KFH A;  1CTR A;  1ALW A;  1IQ3 A;  1EH2 A;  2LMU A;  5CSI A;  3I5F B;  3GK1 A;  1QVI Y;  3CWG A;  2F8P A;  1MUX A;  1U5I B;  3SG7 A;  3TDI A;  1NPQ A;  3I5I C;  1Q80 A;  1OMV A;  3CR2 A;  1NP8 A;  2JUL A;  3RM1 A;  4I5N B;  4MZK A;  2F33 A;  1BJF A;  1AHR A;  2JXC A;  1UUS A;  2CBL A;  3BUM B;  1OZO A;  3DF0 B;  3JTD C;  1AJ5 A;  3LCP C;  2K7B A;  4YI9 A;  4NDB A;  1M31 A;  1TNQ A;  2L0P A;  3FWC A;  3VRP A;  3I5G B;  1KCY A;  1WRK A;  1QX2 A;  1W7I B;  1NSH A;  1CDM A;  2WCE A;  4ZCV A;  1XK4 A;  1MHO A;  1NIW A;  1RTP 1;  1NCY A;  1AJ4 A;  2NZ0 A;  3OB1 B;  2M1K B;  1PRW A;  3O2P A;  3CLN A;  1UHJ A;  1QV1 A;  2MJW B;  1QLK A;  1LKJ A;  1CFP A;  2FCE A;  2M29 A;  2BEC A;  3LK0 A;  1S1E A;  4A4B A;  2HQW A;  1B7T Z;  1S3P A;  2KYC A;  4GGF C;  1ODB A;  3TZ1 A;  1A4P A;  2WC8 A;  1NX3 A;  2KFF A;  1XO5 A;  1TIZ A;  4FQO A;  4TNC A;  3VRN A;  2I2R E;  1NX1 A;  1SK6 D;  1K93 D;  1UHI A;  1GJY A;  1YUR A;  4CFR A;  1KQM B;  2JNF A;  2KQ6 A;  1CDP A;  2M9G A;  1H4B A;  1UHN A;  3ZNI A;  4OV2 A;  2GGZ A;  4E68 A;  1DGU A;  2HET A;  1BF5 A;  1JSA A;  2OS8 B;  1JWD A;  2LP3 A;  3WHT B;  1CB1 A;  3DVM A;  4P2Y B;  4XYN A;  1X02 A;  4CLN A;  1B8L A;  1YRT B;  4ORC B;  3H4S E;  5HKY A;  2KAV A;  2G2B A;  1B8R A;  4ETO A;  3DD4 A;  4C0L A;  2NXQ A;  1WRL A;  2R2I A;  3TUY C;  1UHH A;  1IH0 A;  1K94 A;  1PSR A;  1L2O B;  2KYF A;  3HCM A;  1QTX A;  3OHM B;  3VGO A;  1YUU A;  4YGC B;  2I94 A;  1F55 A;  4PDZ A;  3FIA A;  2GV5 A;  2OTG C;  5I2O A;  1QJT A;  1K9P A;  2KQY A;  1S6C A;  2LHL A;  1NCZ A;  4QJ4 B;  1Y0V H;  2ZFD A;  3VRQ A;  2JPT A;  3JVT B;  1KK8 B;  5HLV A;  1LA0 A;  1RK9 A;  4GFT A;  3KF9 A;  1V1G A;  5HKZ A;  1REC A;  1DJG A;  2LNK A;  1FF1 A;  1N2D A;  1F4O A;  2BL0 C;  1S6I A;  1B47 A;  4MN0 A;  2I18 A;  2LM5 A;  1JF2 A;  3K21 A;  5AXI A;  2MA2 A;  4PHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...