1AVSA

X-ray crystallographic study of calcium-saturated n-terminal domain of troponin c
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
81
structure length
81
Chain Sequence
QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Muscle contraction
molecule keywords TROPONIN C
publication title Structural details of a calcium-induced molecular switch: X-ray crystallographic analysis of the calcium-saturated N-terminal domain of troponin C at 1.75 A resolution.
pubmed doi rcsb
source organism Gallus gallus
total genus 25
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1avsA00
3LCPC 1U5IB 2HQ8A 4DCKA 3IF7A 2DOQA 2WORA 2JT3A 1AUIB 1YX8A 4MZKA 2KI4C 3NSOA 4XJKB 1PSBA 2LP2A 2OTGC 2BBMA 1C7VA 3PSRA 3LLEA 1LINA 2KAXA 1IRJA 1KCYA 1GGWA 1QV1A 1C7WA 3OB2B 1IQ5A 1FI5A 1NPQA 1ZUZA 5HYDA 1NYAA 3RM1A 5I8NA 2IS9A 3PLFB 1C07A 1OMRA 2L50A 1W7IB 4YGBB 2K8MB 2PRUA 4NDCA 3SG4A 1TN4A 4U8DA 4WQ3A 2JXLA 1HT9A 2BBNA 5CSJA 2KNEA 1SW8A 2Y1MA 4MSPA 2M1KB 4HRGA 2K7CA 1UWOA 1S6IA 1A29A 1K9PA 3TUYB 1UHNA 1JUOA 1IJ6A 3NSKA 1KK8B 4MRXA 1YVLA 2PALA 2M8UA 1DJZA 4OVNF 3FS7A 2KQYA 4AQIA 2NCOA 4MBEA 4UPGA 4MVFA 4ORBB 5CPVA 2O5GA 1VRKA 1F4OA 3I5IC 2G2BA 1CFPA 3I5GB 1NP8A 2CBLA 2KAYA 1J7RA 1OSAA 1SKTA 1SRAA 2KSPA 3NSIA 3ZNIA 4R1EA 4CPVA 1CB1A 1JWDA 4NDDA 1DGVA 5CSNA 1ZOTB 3BQ3A 1K2HA 3AKAA 5CSFA 2MLEC 2KDHA 3E3RA 3SIBA 1KFXS 3HX4A 1XA5A 1DJGA 2MHHA 1NUBA 4C0JA 1CDNA 2LMUA 1SY9A 4PALA 1WRKA 3BUNB 1S26D 2JOJA 1DT7B 2ZNEA 2L5XB 1ZFSA 1DGUA 5F6TA 3PALA 2BKIB 1FPWA 2K2FA 1YUUA 2JPTA 5HKZA 2AMIA 2PSRA 5I2LA 1MXEA 1K96A 1TCFA 3WHTB 1XFYO 3AAJA 2PMYA 3BOWA 4GGNA 1XFZO 1WDCB 2LM5A 2BE6A 2R2IA 3DF0A 4N1GA 1Y1UA 3BUWB 3JVTB 2JTZA 2PVBA 3SG2A 3EVUA 1SL7A 1FI6A 3O6BA 3DD4A 3KO0A 2L4IA 2JQ6A 1V1FA 2MRDA 1A2XA 2NZ0A 1BMOA 1IQ3A 1SNLA 2LANA 2LMVA 4PHMA 1SCVA 1X02A 4BY5A 4GPLB 1DJWA 1S6JA 5IBWA 5AXIA 1A4PA 1U5IA 3MSEB 4QJ5B 2E30A 2ZFDA 4D1EA 1TRFA 1J7OA 2EHBA 1WLZA 3CS1A 4GFTA 1UHKA 3EK8A 3EKJA 4ORCB 1UURA 4XJKA 5D69A 3PN7C 1SCMB 1JC2A 1KQVA 2G9BA 2JT8A 3SJSA 1F54A 4JWQA 1QIWA 4PE7A 2KGBC 1XK4A 2LMTA 1WY9A 3BUOB 3OB1B 2M49B 2KI6C 2NXQA 2QPTA 1PVBA 4QJ4B 4DRWA 4YBHB 1QVIY 2BCXA 3OHMB 1PVAA 4XYNA 3TS5C 1XK4C 1EH2A 1XVJA 1IJ5A 4A4BA 4ZCVA 1S6CA 1KK7Y 4OCIA 1CDLA 2A4JA 2HF5A 2K7BA 1K90D 1B47A 1TOPA 1ODBA 2SCPA 2WOSA 2LNKA 1BF5A 1KK7Z 3KPXA 2JZIA 1B8CA 3TUYC 5DKNA 1S3PA 5FYXA 1A03A 1UHIA 5DKQA 1BG1A 5JOLA 1LVCD 1BLQA 1B8RA 2ZN8A 2F2OA 2Q91A 5KSZA 1UHHA 1RROA 1QV0A 1JFJA 2BL0C 2JWWA 4NDBA 1IGVA 1KSOA 1R6PA 1L2OB 1SK6D 1Y1AA 2KOTA 1EL4A 2BCAA 3TZ1A 2GV5A 1CM4A 3EK4A 4P5OE 5AANA 5D7FA 2KGRA 1ZACA 1OZOA 3KEVA 1OMVA 2JTTA 2COLB 2EC6B 1UHJA 1QLSA 5J3XA 1CM1A 4QJ3B 5G08A 3OP0A 4PHJA 2QACA 1DMOA 4PHNA 3IQOA 1KFXL 3TDZA 1BODA 4JPZB 4DS7A 2GGMA 3CZTX 1MWNA 2JRFA 2JU0A 2KYFA 2MBXA 1MR8A 1J7PA 4I5LB 2LVVA 4PCWA 2V53A 1J7QA 1V1GA 3I5HC 1CNPA 1H8BA 1AP4A 1EG3A 1B7TY 1UP5A 1AJ5A 1JF2A 1MQ1A 1D1OA 4YGAA 4DUQA 2F8PA 3GOFA 4HRHA 5PALA 1CDPA 1B7TZ 3CTNA 2M7LA 1A75B 1K95A 1UUSA 2KFGA 3CWGA 1YRTB 1MHOA 5DKRA 2M29A 2KBMA 1GGZA 2GGZA 4C0LA 3I5FC 1RTP1 4MN0A 1AHRA 2LVIA 2KI4B 1OZSA 2OTGB 2L4HA 5HKWA 1M46A 1Q80A 2VRGA 3D0YB 5BPJA 3WXAA 3JTDB 2K7DA 3A4UB 3HCMA 3O2PA 3PATA 4MZJA 2LLTA 2ZNDA 3KF9A 2LV7A 2Y1NA 4IL1A 4M2PA 1J1EA 2LLSA 1AJ4A 1KWOC 2B1UA 4JQ0D 1K9UA 3TDIA 2KI6D 1B4CA 1SCMC 4YRUA 1DJIA 1K93D 3SIAA 3BUXB 4GUKA 1QS7A 2E6WA 2KHNA 5B8IB 1BOCA 2D8NA 2I18A 5I2QA 2L2EA 2M7NA 3RLZA 2JXCA 3CR5X 2FCDA 2HETA 4YGDB 1DJXA 2KAVA 2NLNA 1BR4B 1NX0A 2FOTA 3CR4X 4N5XA 2L51A 1PALA 2OS8C 3EKHA 1B9AA 4GAOA 3WNXB 1L7ZA 1CMFA 1KSMA 1FW4A 2LE9B 1Y1XA 4AOMA 1AVSA 1RJVA 4I5NB 1G4YR 4FTGA 4M2OA 1M31A 1OOJA 3SG3A 1H4BA 1NX1A 4OKHA 1CDMA 2LLUA 1LA0A 2PASA 1DF0B 4OR9B 1ALWA 2F3ZA 2MJWB 3EVRA 5HKYA 3QRXA 2LHLA 2Y4QA 1W7JB 1SR6B 1JFKA 3VGOA 4ORAB 1K8UA 4PE1A 1NSHA 1S1EA 3OX6A 1JSAA 1YR5A 1N2DA 2LVJA 2L0PA 2M9GA 2JT0A 2M1UA 3CGAA 2CNPA 2WCFA 1BJFA 1ALVA 5HLOA 1NWDA 1YVHA 4HREE 1N65A 1TNXA 2CXJA 2P6BB 2CT9A 1K94A 1OE9B 1QX5B 3AAKA 3FIAA 1TTXA 3VRNA 4AQJA 2H2KA 4PHKA 1YRUB 1CLBA 2HQWA 2K7OA 1BT6A 1QX7A 3AKBA 1SBJA 1KK8C 2I7AA 3DVEA 2NCPA 3OX5A 4WQ2A 4DIRA 2LC5A 2HPSA 1QTXA 1F4QA 3I5GC 4FQOA 1J1DA 5K89A 4Q04A 2Q4UA 1A75A 5AERA 4N1FA 5KU1A 4L9MA 5CSIA 1CFDA 1NX3A 5I2OA 1NCZA 1YURA 2F2PA 1EXRA 4HSZA 1F8HA 1YX7A 4M2QA 2FCEA 1CKKA 3D10A 4CFRA 2LUCA 2MA2A 4WRIA 3PN7B 3D0YA 4GBAA 2KBIA 2OPOA 2EGDA 2KQ6A 2K2AA 1NIWA 4A4CA 1DVIA 1MXLC 1KFUS 1RWYA 4YI8A 3JTDC 2JULA 3TS5B 2I2RE 1QX2A 2LAPA 2LUXA 2ZRTA 3K21A 4I5JA 1SL9A 1DTLA 2O60A 1LXFC 4GGFA 1F71A 1WRZA 1WDCC 3SG6A 3FWBA 3SG5A 3DVKA 2WNDA 3GK2A 3JVTC 4GGFC 1B8LA 4TNCA 3WHUB 4BY4A 5TNCA 2M97A 1YUSA 1KQMB 2KYCA 1EG4A 1QASA 3CR2A 3EVVA 5AFPA 3BUMB 1TCOB 4ZCUA 1RK9A 3NSLA 1XFVO 1SYMA 1ZMZA 1PK0D 2K61A 1FF1A 1QXPA 2BE4A 1Y6WA 1RECA 1M45A 2BL0B 1DF0A 1TNQA 1M39A 1IWQA 1NCXA 1TIZA 3O78A 3LK0A 1XFWO 2MAZA 1SR6C 1RFJA 2JNXA 4YGEB 1CFCA 4ETOA 4USLA 1MF8B 3DVJA 1TNWA 2CCMA 1JBAA 4NQGA 1OMDA 1G33A 3PM8A 1CLMA 2RGIA 4CIDA 4OV2A 1YUTA 1K9KA 4MEWA 2H61A 2ISDA 1EJ3A 3BYAA 4I5KA 2Y5IA 4PDZA 4YI9A 2SASA 2FJUB 2ZN9A 3GK1A 1S5GY 2H61C 3ICBA 1CLLA 1PSRA 2AUCA 3I5HB 3KHEA 4C0KA 1S36A 3I5IB 1NX2A 4ICBA 3LL8B 1F70A 1JF0A 1S5GZ 3PFVA 1LKJA 1MUXA 3ZWHA 1N0YA 1BR1B 1DJYA 5AEQA 1SMGA 2WCBA 3GK4X 1R2UA 2LCPA 1M63B 1XYDA 4P2YB 1G8IA 3VRRA 1E8AA 3F45A 3O4YA 1XO5A 4F0ZB 3I5FB 1CFFA 1L2OC 1PULA 3CLNA 1SPYA 1OQPA 2WC8A 1FBVA 2BCBA 3IQQA 2L98A 2I94A 2ZRSA 3VROA 3VRPA 2JC2A 1CMGA 2F33A 2WCEA 3DVMA 3A8RA 5GQQC 1AK8A 1F55A 1QIVA 4CLNA 2K0JA 4MZLA 3FWCA 5KTYA 3LK1A 5HLVA 2EC6C 1KWOB 2MLFC 2BKHB 1LA3A 2CTNA 4E68A 2LVKA 4MRYA 1BU3A 2ZKMX 3SG7A 1IKUA 2JNFA 5ER4X 1QJTA 1WLMA 3BOWB 1GQMA 2F3YA 2BECA 1NCYA 1CTRA 3EK7A 1DJHA 1SL8A 1XFXO 2LP3A 1IH0A 2M3WA 3H4SE 4PE4A 1B1GA 3DF0B 2M0RA 5ER5A 1HQVA 1PRWA 4CFQA 3BXKA 1QVIZ 4GNKB 1KFUL 1TNPA 1WRLA 1GJYA 1XFUO 2OS8B 4PE0A 1QATA 2KFFA 4MLWA 2TN4A 3M0WA 5JJGA 2KFHA 2LHIA 4YGCB 3TDUA 1J55A 1KQMC 3VRQA 1YTZC 1Y0VH 2AAOA 1IG5A 1QLKA 3C1VA 3NXAA
chains in the Genus database with same CATH superfamily
1QWVA 1U5IB 3LCPC 2HQ8A 4DCKA 2L5YA 3IF7A 2DOQA 1W9ZA 2WORA 2JT3A 1AUIB 1YX8A 4MZKA 2KI4C 3NSOA 4XJKB 1PSBA 2LP2A 2OTGC 2BBMA 1C7VA 3PSRA 1OOGA 3LLEA 5FI7A 1LINA 2KAXA 1LS8A 1IRJA 3S0BA 1KCYA 1GGWA 1QV1A 1C7WA 3OB2B 1IQ5A 1FI5A 1NPQA 1ZUZA 5HYDA 1NYAA 3RM1A 5I8NA 2IS9A 3PLFB 1C07A 1OMRA 2L50A 1W7IB 4YGBB 2K8MB 2PRUA 4IJ7A 4NDCA 3SG4A 1TN4A 4U8DA 3NGVA 2JXLA 4WQ3A 1HT9A 2BBNA 4FQTA 2KNEA 1SW8A 2Y1MA 4MSPA 2M1KB 4HRGA 2K7CA 1DQEA 1UWOA 1S6IA 1A29A 4JD9A 1K9PA 3N7HA 3TUYB 3S0GA 1UHNA 1JUOA 3FE9A 1IJ6A 3NSKA 1KK8B 4MRXA 2WC6A 1YVLA 2PALA 2M8UA 1DJZA 4OVNF 3FS7A 2KQYA 4AQIA 2NCOA 4MBEA 4UPGA 4MVFA 4ORBB 5CPVA 2O5GA 1VRKA 1F4OA 3I5IC 2G2BA 1CFPA 2QEOA 2P70A 3I5GB 1NP8A 2CBLA 2KAYA 1J7RA 1OSAA 1SKTA 1SRAA 2KSPA 3NSIA 3R1PA 4R1EA 3SS3A 5FI6A 3ZNIA 4CPVA 3DYEA 4NDDA 1JWDA 1DGVA 4PT1A 5CSNA 1ZOTB 3BQ3A 3RZSA 1K2HA 3AKAA 5CSFA 2MLEC 2KDHA 2KPHA 3E3RA 1KFXS 3SIBA 5EL2A 3HX4A 1XA5A 1DJGA 2BAPA 1NUBA 2MHHA 4C0JA 1CDNA 2LMUA 1SY9A 4PALA 1WRKA 3IVTA 3R72A 3BUNB 1S26D 2JOJA 1DT7B 2QEBA 3CZ1A 2ZNEA 2L5XB 1ZFSA 1DGUA 3QMEA 5F6TA 1XFRA 3PALA 2BKIB 3CZ2A 2K2FA 1FPWA 1YUUA 2JPTA 1DEKA 1DELA 3L4AA 2AMIA 5HKZA 2PSRA 5I2LA 2ERBA 3FE6A 1MXEA 1K96A 1TCFA 3WHTB 1XFYO 4INWA 3AAJA 2PMYA 3BOWA 4GGNA 1XFZO 1WDCB 2LM5A 2JPOA 2BE6A 1TWOA 5CSJA 2R2IA 3DF0A 4N1GA 1Y1UA 3BUWB 3JVTB 2JTZA 2PVBA 3SG2A 3EVUA 1SL7A 3BFBA 1FI6A 3O6BA 3DD4A 1IIOA 1TUZA 3KO0A 2L4IA 2QEHA 2JQ6A 1V1FA 2MRDA 1A2XA 2NZ0A 1BMOA 1IQ3A 1SNLA 2LANA 2LMVA 4PHMA 1SCVA 3CYZA 1X02A 4BY5A 4GPLB 1DJWA 1S6JA 4KYNA 5AXIA 1A4PA 5IBWA 1U5IA 3MSEB 4QJ5B 2E30A 2ZFDA 4D1EA 1TRFA 1J7OA 2EHBA 1WLZA 3CS1A 4GFTA 1UHKA 3EK8A 3EKJA 4ORCB 1UURA 4XJKA 1TUJA 5D69A 3PN7C 1SCMB 3Q8IA 1JC2A 1KQVA 2G9BA 2JT8A 3SJSA 1F54A 4JWQA 1QIWA 4PE7A 2KGBC 1XK4A 2LMTA 1WY9A 3BUOB 3OB1B 2M49B 2KI6C 2NXQA 2QPTA 1PVBA 4QJ4B 4DRWA 4YBHB 1QVIY 2BCXA 3OHMB 1PVAA 4XYNA 3TS5C 1XK4C 1EH2A 1XVJA 1IJ5A 4A4BA 4ZCVA 1S6CA 2QEVA 3EG5B 1KK7Y 4OCIA 1CDLA 2A4JA 2HF5A 2K7BA 1K90D 1B47A 1TOPA 1ODBA 2SCPA 2WOSA 2LNKA 5I94A 1BF5A 1KK7Z 3KPXA 2JZIA 1B8CA 3TUYC 5DKNA 1S3PA 5FYXA 1A03A 1UHIA 5DKQA 1BG1A 3NHIA 5JOLA 1LVCD 1BLQA 1T14A 1B8RA 2ZN8A 2F2OA 2Q91A 1CB1A 5KSZA 1UHHA 1RROA 1QV0A 1JFJA 2BL0C 2JWWA 3D77A 4NDBA 1IGVA 1KSOA 1R6PA 1L2OB 1SK6D 1Y1AA 2KOTA 3CZ0A 1EL4A 2BCAA 3TZ1A 2GV5A 1CM4A 3EK4A 4P5OE 5AANA 2KLDA 5D7FA 2KGRA 1ZACA 1OZOA 2BNXA 3KEVA 5HL1A 1OMVA 2JTTA 2COLB 2EC6B 1GM0A 1UHJA 1QLSA 5J3XA 1CM1A 4QJ3B 5G08A 3OP0A 4PHJA 3BFAA 2QACA 1DMOA 4PHNA 3IQOA 2FJYA 1KFXL 3TDZA 1BODA 4JPZB 4DS7A 2GGMA 3CZTX 1MWNA 2JRFA 2JU0A 2KYFA 2MBXA 1MR8A 1J7PA 4I5LB 2LVVA 3B6XA 4PCWA 2V53A 1C3YA 1J7QA 1V1GA 3I5HC 1CNPA 1H8BA 1AP4A 1EG3A 1B7TY 1UP5A 1AJ5A 1JF2A 1MQ1A 1D1OA 4YGAA 4DUQA 2WCLA 2F8PA 3GOFA 2PYQA 4HRHA 5PALA 1CDPA 1B7TZ 3CTNA 2M7LA 1A75B 1K95A 1UUSA 2KFGA 3CWGA 1YRTB 1MHOA 1OOFA 2M29A 5DKRA 2KBMA 1GGZA 2GGZA 4C0LA 3I5FC 1ORGA 3D74A 1RTP1 4MN0A 1AHRA 2LVIA 2KI4B 1OZSA 2OTGB 2L4HA 5HKWA 1M46A 1Q80A 2VRGA 3K1EA 3D0YB 5BPJA 3WXAA 3JTDB 2K7DA 3A4UB 3HCMA 3O2PA 3PATA 4MZJA 2LLTA 2ZNDA 3KF9A 2LV7A 2Y1NA 4IL1A 4M2PA 1J1EA 2LLSA 3V2LA 3DZTA 1AJ4A 1KWOC 2B1UA 4JQ0D 1K9UA 2WCMA 3TDIA 2KI6D 1B4CA 1SCMC 4YRUA 1DJIA 1K93D 3SIAA 3BUXB 4GUKA 1QS7A 1OOHA 2E6WA 2KHNA 3NHTA 5B8IB 1BOCA 2D8NA 2I18A 5I2QA 2L2EA 2M7NA 3RLZA 2JXCA 3CR5X 2FCDA 2HETA 4YGDB 1DJXA 2KAVA 2NLNA 1BR4B 1NX0A 2FOTA 3CR4X 4N5XA 2L51A 1Z4HA 1PALA 2OS8C 3EKHA 1B9AA 4GAOA 3WNXB 1L7ZA 1CMFA 1KSMA 1FW4A 2LE9B 1Y1XA 4AOMA 1AVSA 1RJVA 4I5NB 1G4YR 4FTGA 4M2OA 1M31A 1OOJA 3SG3A 1H4BA 1NX1A 3PJIA 4OKHA 1CDMA 2LLUA 1LA0A 2PASA 1DF0B 4OR9B 1ALWA 2F3ZA 2MJWB 3EVRA 5HKYA 3QRXA 2LHLA 2Y4QA 1W7JB 1SR6B 1JFKA 4F7FA 3VGOA 3SS4A 4ORAB 1K8UA 4PE1A 1NSHA 1S1EA 3OX6A 1JSAA 4JKTA 1YR5A 1N2DA 2LVJA 3CABA 2L0PA 2M9GA 3B7AA 2JT0A 2M1UA 3CGAA 2CNPA 2WCFA 1BJFA 1ALVA 5HLOA 1DC1A 3UO9A 1NWDA 1YVHA 3OGNA 4HREE 1N65A 3B86A 1TNXA 2CXJA 2P6BB 3B87A 3S0FA 2CT9A 1K94A 1OE9B 1QX5B 3AAKA 3D76A 3NXAA 3FIAA 1TTXA 5FI2A 3DXLA 3VRNA 4AQJA 2H2KA 4PHKA 1YRUB 3BJHA 1CLBA 2HQWA 2K7OA 1BT6A 1QX7A 3AKBA 1SBJA 1KK8C 2I7AA 2YGUA 3DVEA 2NCPA 3OX5A 4WQ2A 4DIRA 2P71A 2LC5A 2HPSA 1QTXA 1F4QA 3I5GC 4FQOA 1J1DA 5K89A 4Q04A 2Q4UA 1A75A 5AERA 4N1FA 5KU1A 2PQLA 4L9MA 5CSIA 1CFDA 1NX3A 3PM2A 5I2OA 1NCZA 1YURA 2F2PA 1EXRA 4HSZA 1F8HA 1YX7A 4M2QA 2FCEA 1CKKA 3D10A 4CFRA 2LUCA 2MA2A 4WRIA 3PN7B 3D0YA 2GTEA 4GBAA 2WCKA 2KBIA 2OPOA 2EGDA 3OBVA 2KQ6A 2K2AA 1NIWA 4A4CA 3D75A 1DVIA 1MXLC 1KFUS 1RWYA 4YI8A 3JTDC 2JULA 3TS5B 2I2RE 1QX2A 2LAPA 2LUXA 2ZRTA 3K21A 3L47A 4I5JA 1SL9A 1DTLA 2O60A 1LXFC 4GGFA 1F71A 1WRZA 1WDCC 3SS5A 3SG6A 3FWBA 3SG5A 3DVKA 2WNDA 3GK2A 3JVTC 4GGFC 1B8LA 4TNCA 3WHUB 4BY4A 2KLEA 5TNCA 2M97A 1YUSA 1KQMB 2KYCA 2K60A 1EG4A 3BFHA 1QASA 3CR2A 1SSEB 3EVVA 3BUMB 1TCOB 5AFPA 4ZCUA 1RK9A 3NSLA 1XFVO 1P28A 1SYMA 1ZMZA 1PK0D 2K61A 1FF1A 1QXPA 2BE4A 1Y6WA 1OW4A 1RECA 1M45A 2BL0B 1DF0A 1TNQA 1M39A 1IWQA 1NCXA 1TIZA 5D3OA 3O78A 3LK0A 4INXA 1XFWO 2MAZA 1SR6C 1RFJA 2JNXA 4YGEB 1CFCA 3CDNA 3L4LA 4ETOA 4USLA 1MF8B 3DVJA 3R1OA 1TNWA 2CCMA 1JBAA 4NQGA 1OMDA 1G33A 3PM8A 1CLMA 2RGIA 4CIDA 3R1VA 4OV2A 2WCHA 1YUTA 1K9KA 5DICA 4MEWA 2H61A 2ISDA 3S0EA 1Z2CB 1EJ3A 3BYAA 4I5KA 3VB1A 2Y5IA 4PDZA 4YI9A 2SASA 2FJUB 2ZN9A 3GK1A 1S5GY 2H61C 3ICBA 1CLLA 1PSRA 2AUCA 3I5HB 3KHEA 4C0KA 1S36A 3I5IB 1NX2A 4ICBA 3LL8B 1F70A 1JF0A 1S5GZ 1C3ZA 3PFVA 1LKJA 3O4XA 1MUXA 2QDIA 3ZWHA 1N0YA 2WC5A 1BR1B 1DJYA 5AEQA 1SMGA 2WCBA 3GK4X 1R2UA 2LCPA 1M63B 1XYDA 4P2YB 1G8IA 3VRRA 1E8AA 3F45A 3O4YA 1XO5A 4F0ZB 3I5FB 1CFFA 3S0DA 3UNWA 1L2OC 1PULA 3CLNA 1SPYA 1OQPA 2WC8A 1FBVA 2BCBA 3IQQA 2L98A 2I94A 2ZRSA 3VROA 3VRPA 2JC2A 1CMGA 2F33A 2WCEA 3DVMA 3A8RA 5GQQC 1AK8A 1F55A 1QIVA 4CLNA 2K0JA 4MZLA 3D78A 3FWCA 3LK1A 5HLVA 5KTYA 2EC6C 1KWOB 2MLFC 2BKHB 1LA3A 3S0AA 2CTNA 4E68A 2LVKA 4MRYA 1BU3A 3D73A 2L2CA 2ZKMX 3SG7A 1IKUA 2JNFA 5ER4X 1QJTA 1WLMA 3BOWB 2H8VA 1GQMA 2F3YA 2BECA 1NCYA 1CTRA 3EK7A 1DJHA 1SL8A 1XFXO 2LP3A 1IH0A 2M3WA 3H4SE 4PE4A 2WCJA 3DF0B 2M0RA 5ER5A 1B1GA 1HQVA 1PRWA 4CFQA 3BXKA 3FE8A 1QVIZ 4GNKB 4OZDA 1KFUL 1TNPA 1WRLA 1GJYA 3DY9A 1XFUO 2OS8B 4PE0A 1QATA 2KFFA 4MLWA 2TN4A 3M0WA 5JJGA 2KFHA 2LHIA 4YGCB 3TDUA 1J55A 1KQMC 3VRQA 1YTZC 1Y0VH 2AAOA 1IG5A 1QLKA 3C1VA 1OOIX 3B88A
chains in the Genus database with same CATH topology
3LCPC 1U5IB 2HQ8A 4DCKA 3IF7A 2DOQA 2WORA 2JT3A 1AUIB 1YX8A 4MZKA 2KI4C 3NSOA 4XJKB 1PSBA 2LP2A 2OTGC 2BBMA 1C7VA 3PSRA 3LLEA 1LINA 2KAXA 1IRJA 1KCYA 1GGWA 1QV1A 1C7WA 3OB2B 1IQ5A 1FI5A 1NPQA 1ZUZA 5HYDA 1NYAA 3RM1A 5I8NA 2IS9A 3PLFB 1C07A 1OMRA 2L50A 1W7IB 4YGBB 2K8MB 2PRUA 4NDCA 3SG4A 1TN4A 4U8DA 4WQ3A 2JXLA 1HT9A 2BBNA 5CSJA 2KNEA 1SW8A 2Y1MA 4MSPA 2M1KB 4HRGA 2K7CA 1UWOA 1S6IA 1A29A 1K9PA 3TUYB 1UHNA 1JUOA 1IJ6A 3NSKA 1KK8B 4MRXA 1YVLA 2PALA 2M8UA 1DJZA 4OVNF 3FS7A 2KQYA 4AQIA 2NCOA 4MBEA 4UPGA 4MVFA 4ORBB 5CPVA 2O5GA 1VRKA 1F4OA 3I5IC 2G2BA 1CFPA 3I5GB 1NP8A 2CBLA 2KAYA 1J7RA 1OSAA 1SKTA 1SRAA 2KSPA 3NSIA 3ZNIA 4R1EA 4CPVA 1CB1A 1JWDA 4NDDA 1DGVA 5CSNA 1ZOTB 3BQ3A 1K2HA 3AKAA 5CSFA 2MLEC 2KDHA 3E3RA 3SIBA 1KFXS 3HX4A 1XA5A 1DJGA 2MHHA 1NUBA 4C0JA 1CDNA 2LMUA 1SY9A 4PALA 1WRKA 3BUNB 1S26D 2JOJA 1DT7B 2ZNEA 2L5XB 1ZFSA 1DGUA 5F6TA 3PALA 2BKIB 1FPWA 2K2FA 1YUUA 2JPTA 5HKZA 2AMIA 2PSRA 5I2LA 1MXEA 1K96A 1TCFA 3WHTB 1XFYO 3AAJA 2PMYA 3BOWA 4GGNA 1XFZO 1WDCB 2LM5A 2BE6A 2R2IA 3DF0A 4N1GA 1Y1UA 3BUWB 3JVTB 2JTZA 2PVBA 3SG2A 3EVUA 1SL7A 1FI6A 3O6BA 3DD4A 3KO0A 2L4IA 2JQ6A 1V1FA 2MRDA 1A2XA 2NZ0A 1BMOA 1IQ3A 1SNLA 2LANA 2LMVA 4PHMA 1SCVA 1X02A 4BY5A 4GPLB 1DJWA 1S6JA 5IBWA 5AXIA 1A4PA 1U5IA 3MSEB 4QJ5B 2E30A 2ZFDA 4D1EA 1TRFA 1J7OA 2EHBA 1WLZA 3CS1A 4GFTA 1UHKA 3EK8A 3EKJA 4ORCB 1UURA 4XJKA 5D69A 3PN7C 1SCMB 1JC2A 1KQVA 2G9BA 2JT8A 3SJSA 1F54A 4JWQA 1QIWA 4PE7A 2KGBC 1XK4A 2LMTA 1WY9A 3BUOB 3OB1B 2M49B 2KI6C 2NXQA 2QPTA 1PVBA 4QJ4B 4DRWA 4YBHB 1QVIY 2BCXA 3OHMB 1PVAA 4XYNA 3TS5C 1XK4C 1EH2A 1XVJA 1IJ5A 4A4BA 4ZCVA 1S6CA 1KK7Y 4OCIA 1CDLA 2A4JA 2HF5A 2K7BA 1K90D 1B47A 1TOPA 1ODBA 2SCPA 2WOSA 2LNKA 1BF5A 1KK7Z 3KPXA 2JZIA 1B8CA 3TUYC 5DKNA 1S3PA 5FYXA 1A03A 1UHIA 5DKQA 1BG1A 5JOLA 1LVCD 1BLQA 1B8RA 2ZN8A 2F2OA 2Q91A 5KSZA 1UHHA 1RROA 1QV0A 1JFJA 2BL0C 2JWWA 4NDBA 1IGVA 1KSOA 1R6PA 1L2OB 1SK6D 1Y1AA 2KOTA 1EL4A 2BCAA 3TZ1A 2GV5A 1CM4A 3EK4A 4P5OE 5AANA 5D7FA 2KGRA 1ZACA 1OZOA 3KEVA 1OMVA 2JTTA 2COLB 2EC6B 1UHJA 1QLSA 5J3XA 1CM1A 4QJ3B 5G08A 3OP0A 4PHJA 2QACA 1DMOA 4PHNA 3IQOA 1KFXL 3TDZA 1BODA 4JPZB 4DS7A 2GGMA 3CZTX 1MWNA 2JRFA 2JU0A 2KYFA 2MBXA 1MR8A 1J7PA 4I5LB 2LVVA 4PCWA 2V53A 1J7QA 1V1GA 3I5HC 1CNPA 1H8BA 1AP4A 1EG3A 1B7TY 1UP5A 1AJ5A 1JF2A 1MQ1A 1D1OA 4YGAA 4DUQA 2F8PA 3GOFA 4HRHA 5PALA 1CDPA 1B7TZ 3CTNA 2M7LA 1A75B 1K95A 1UUSA 2KFGA 3CWGA 1YRTB 1MHOA 5DKRA 2M29A 2KBMA 1GGZA 2GGZA 4C0LA 3I5FC 1RTP1 4MN0A 1AHRA 2LVIA 2KI4B 1OZSA 2OTGB 2L4HA 5HKWA 1M46A 1Q80A 2VRGA 3D0YB 5BPJA 3WXAA 3JTDB 2K7DA 3A4UB 3HCMA 3O2PA 3PATA 4MZJA 2LLTA 2ZNDA 3KF9A 2LV7A 2Y1NA 4IL1A 4M2PA 1J1EA 2LLSA 1AJ4A 1KWOC 2B1UA 4JQ0D 1K9UA 3TDIA 2KI6D 1B4CA 1SCMC 4YRUA 1DJIA 1K93D 3SIAA 3BUXB 4GUKA 1QS7A 2E6WA 2KHNA 5B8IB 1BOCA 2D8NA 2I18A 5I2QA 2L2EA 2M7NA 3RLZA 2JXCA 3CR5X 2FCDA 2HETA 4YGDB 1DJXA 2KAVA 2NLNA 1BR4B 1NX0A 2FOTA 3CR4X 4N5XA 2L51A 1PALA 2OS8C 3EKHA 1B9AA 4GAOA 3WNXB 1L7ZA 1CMFA 1KSMA 1FW4A 2LE9B 1Y1XA 4AOMA 1AVSA 1RJVA 4I5NB 1G4YR 4FTGA 4M2OA 1M31A 1OOJA 3SG3A 1H4BA 1NX1A 4OKHA 1CDMA 2LLUA 1LA0A 2PASA 1DF0B 4OR9B 1ALWA 2F3ZA 2MJWB 3EVRA 5HKYA 3QRXA 2LHLA 2Y4QA 1W7JB 1SR6B 1JFKA 3VGOA 4ORAB 1K8UA 4PE1A 1NSHA 1S1EA 3OX6A 1JSAA 1YR5A 1N2DA 2LVJA 2L0PA 2M9GA 2JT0A 2M1UA 3CGAA 2CNPA 2WCFA 1BJFA 1ALVA 5HLOA 1NWDA 1YVHA 4HREE 1N65A 1TNXA 2CXJA 2P6BB 2CT9A 1K94A 1OE9B 1QX5B 3AAKA 3FIAA 1TTXA 3VRNA 4AQJA 2H2KA 4PHKA 1YRUB 1CLBA 2HQWA 2K7OA 1BT6A 1QX7A 3AKBA 1SBJA 1KK8C 2I7AA 3DVEA 2NCPA 3OX5A 4WQ2A 4DIRA 2LC5A 2HPSA 1QTXA 1F4QA 3I5GC 4FQOA 1J1DA 5K89A 4Q04A 2Q4UA 1A75A 5AERA 4N1FA 5KU1A 4L9MA 5CSIA 1CFDA 1NX3A 5I2OA 1NCZA 1YURA 2F2PA 1EXRA 4HSZA 1F8HA 1YX7A 4M2QA 2FCEA 1CKKA 3D10A 4CFRA 2LUCA 2MA2A 4WRIA 3PN7B 3D0YA 4GBAA 2KBIA 2OPOA 2EGDA 2KQ6A 2K2AA 1NIWA 4A4CA 1DVIA 1MXLC 1KFUS 1RWYA 4YI8A 3JTDC 2JULA 3TS5B 2I2RE 1QX2A 2LAPA 2LUXA 2ZRTA 3K21A 4I5JA 1SL9A 1DTLA 2O60A 1LXFC 4GGFA 1F71A 1WRZA 1WDCC 3SG6A 3FWBA 3SG5A 3DVKA 2WNDA 3GK2A 3JVTC 4GGFC 1B8LA 4TNCA 3WHUB 4BY4A 5TNCA 2M97A 1YUSA 1KQMB 2KYCA 1EG4A 1QASA 3CR2A 3EVVA 5AFPA 3BUMB 1TCOB 4ZCUA 1RK9A 3NSLA 1XFVO 1SYMA 1ZMZA 1PK0D 2K61A 1FF1A 1QXPA 2BE4A 1Y6WA 1RECA 1M45A 2BL0B 1DF0A 1TNQA 1M39A 1IWQA 1NCXA 1TIZA 3O78A 3LK0A 1XFWO 2MAZA 1SR6C 1RFJA 2JNXA 4YGEB 1CFCA 4ETOA 4USLA 1MF8B 3DVJA 1TNWA 2CCMA 1JBAA 4NQGA 1OMDA 1G33A 3PM8A 1CLMA 2RGIA 4CIDA 4OV2A 1YUTA 1K9KA 4MEWA 2H61A 2ISDA 1EJ3A 3BYAA 4I5KA 2Y5IA 4PDZA 4YI9A 2SASA 2FJUB 2ZN9A 3GK1A 1S5GY 2H61C 3ICBA 1CLLA 1PSRA 2AUCA 3I5HB 3KHEA 4C0KA 1S36A 3I5IB 1NX2A 4ICBA 3LL8B 1F70A 1JF0A 1S5GZ 3PFVA 1LKJA 1MUXA 3ZWHA 1N0YA 1BR1B 1DJYA 5AEQA 1SMGA 2WCBA 3GK4X 1R2UA 2LCPA 1M63B 1XYDA 4P2YB 1G8IA 3VRRA 1E8AA 3F45A 3O4YA 1XO5A 4F0ZB 3I5FB 1CFFA 1L2OC 1PULA 3CLNA 1SPYA 1OQPA 2WC8A 1FBVA 2BCBA 3IQQA 2L98A 2I94A 2ZRSA 3VROA 3VRPA 2JC2A 1CMGA 2F33A 2WCEA 3DVMA 3A8RA 5GQQC 1AK8A 1F55A 1QIVA 4CLNA 2K0JA 4MZLA 3FWCA 5KTYA 3LK1A 5HLVA 2EC6C 1KWOB 2MLFC 2BKHB 1LA3A 2CTNA 4E68A 2LVKA 4MRYA 1BU3A 2ZKMX 3SG7A 1IKUA 2JNFA 5ER4X 1QJTA 1WLMA 3BOWB 1GQMA 2F3YA 2BECA 1NCYA 1CTRA 3EK7A 1DJHA 1SL8A 1XFXO 2LP3A 1IH0A 2M3WA 3H4SE 4PE4A 1B1GA 3DF0B 2M0RA 5ER5A 1HQVA 1PRWA 4CFQA 3BXKA 1QVIZ 4GNKB 1KFUL 1TNPA 1WRLA 1GJYA 1XFUO 2OS8B 4PE0A 1QATA 2KFFA 4MLWA 2TN4A 3M0WA 5JJGA 2KFHA 2LHIA 4YGCB 3TDUA 1J55A 1KQMC 3VRQA 1YTZC 1Y0VH 2AAOA 1IG5A 1QLKA 3C1VA 3NXAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LCP C;  1U5I B;  2HQ8 A;  4DCK A;  3IF7 A;  2DOQ A;  2WOR A;  2JT3 A;  1AUI B;  1YX8 A;  4MZK A;  2KI4 C;  3NSO A;  4XJK B;  1PSB A;  2LP2 A;  2OTG C;  2BBM A;  1C7V A;  3PSR A;  3LLE A;  1LIN A;  2KAX A;  1IRJ A;  1KCY A;  1GGW A;  1QV1 A;  1C7W A;  3OB2 B;  1IQ5 A;  1FI5 A;  1NPQ A;  1ZUZ A;  5HYD A;  1NYA A;  3RM1 A;  5I8N A;  2IS9 A;  3PLF B;  1C07 A;  1OMR A;  2L50 A;  1W7I B;  4YGB B;  2K8M B;  2PRU A;  4NDC A;  3SG4 A;  1TN4 A;  4U8D A;  4WQ3 A;  2JXL A;  1HT9 A;  2BBN A;  5CSJ A;  2KNE A;  1SW8 A;  2Y1M A;  4MSP A;  2M1K B;  4HRG A;  2K7C A;  1UWO A;  1S6I A;  1A29 A;  1K9P A;  3TUY B;  1UHN A;  1JUO A;  1IJ6 A;  3NSK A;  1KK8 B;  4MRX A;  1YVL A;  2PAL A;  2M8U A;  1DJZ A;  4OVN F;  3FS7 A;  2KQY A;  4AQI A;  2NCO A;  4MBE A;  4UPG A;  4MVF A;  4ORB B;  5CPV A;  2O5G A;  1VRK A;  1F4O A;  3I5I C;  2G2B A;  1CFP A;  3I5G B;  1NP8 A;  2CBL A;  2KAY A;  1J7R A;  1OSA A;  1SKT A;  1SRA A;  2KSP A;  3NSI A;  3ZNI A;  4R1E A;  4CPV A;  1CB1 A;  1JWD A;  4NDD A;  1DGV A;  5CSN A;  1ZOT B;  3BQ3 A;  1K2H A;  3AKA A;  5CSF A;  2MLE C;  2KDH A;  3E3R A;  3SIB A;  1KFX S;  3HX4 A;  1XA5 A;  1DJG A;  2MHH A;  1NUB A;  4C0J A;  1CDN A;  2LMU A;  1SY9 A;  4PAL A;  1WRK A;  3BUN B;  1S26 D;  2JOJ A;  1DT7 B;  2ZNE A;  2L5X B;  1ZFS A;  1DGU A;  5F6T A;  3PAL A;  2BKI B;  1FPW A;  2K2F A;  1YUU A;  2JPT A;  5HKZ A;  2AMI A;  2PSR A;  5I2L A;  1MXE A;  1K96 A;  1TCF A;  3WHT B;  1XFY O;  3AAJ A;  2PMY A;  3BOW A;  4GGN A;  1XFZ O;  1WDC B;  2LM5 A;  2BE6 A;  2R2I A;  3DF0 A;  4N1G A;  1Y1U A;  3BUW B;  3JVT B;  2JTZ A;  2PVB A;  3SG2 A;  3EVU A;  1SL7 A;  1FI6 A;  3O6B A;  3DD4 A;  3KO0 A;  2L4I A;  2JQ6 A;  1V1F A;  2MRD A;  1A2X A;  2NZ0 A;  1BMO A;  1IQ3 A;  1SNL A;  2LAN A;  2LMV A;  4PHM A;  1SCV A;  1X02 A;  4BY5 A;  4GPL B;  1DJW A;  1S6J A;  5IBW A;  5AXI A;  1A4P A;  1U5I A;  3MSE B;  4QJ5 B;  2E30 A;  2ZFD A;  4D1E A;  1TRF A;  1J7O A;  2EHB A;  1WLZ A;  3CS1 A;  4GFT A;  1UHK A;  3EK8 A;  3EKJ A;  4ORC B;  1UUR A;  4XJK A;  5D69 A;  3PN7 C;  1SCM B;  1JC2 A;  1KQV A;  2G9B A;  2JT8 A;  3SJS A;  1F54 A;  4JWQ A;  1QIW A;  4PE7 A;  2KGB C;  1XK4 A;  2LMT A;  1WY9 A;  3BUO B;  3OB1 B;  2M49 B;  2KI6 C;  2NXQ A;  2QPT A;  1PVB A;  4QJ4 B;  4DRW A;  4YBH B;  1QVI Y;  2BCX A;  3OHM B;  1PVA A;  4XYN A;  3TS5 C;  1XK4 C;  1EH2 A;  1XVJ A;  1IJ5 A;  4A4B A;  4ZCV A;  1S6C A;  1KK7 Y;  4OCI A;  1CDL A;  2A4J A;  2HF5 A;  2K7B A;  1K90 D;  1B47 A;  1TOP A;  1ODB A;  2SCP A;  2WOS A;  2LNK A;  1BF5 A;  1KK7 Z;  3KPX A;  2JZI A;  1B8C A;  3TUY C;  5DKN A;  1S3P A;  5FYX A;  1A03 A;  1UHI A;  5DKQ A;  1BG1 A;  5JOL A;  1LVC D;  1BLQ A;  1B8R A;  2ZN8 A;  2F2O A;  2Q91 A;  5KSZ A;  1UHH A;  1RRO A;  1QV0 A;  1JFJ A;  2BL0 C;  2JWW A;  4NDB A;  1IGV A;  1KSO A;  1R6P A;  1L2O B;  1SK6 D;  1Y1A A;  2KOT A;  1EL4 A;  2BCA A;  3TZ1 A;  2GV5 A;  1CM4 A;  3EK4 A;  4P5O E;  5AAN A;  5D7F A;  2KGR A;  1ZAC A;  1OZO A;  3KEV A;  1OMV A;  2JTT A;  2COL B;  2EC6 B;  1UHJ A;  1QLS A;  5J3X A;  1CM1 A;  4QJ3 B;  5G08 A;  3OP0 A;  4PHJ A;  2QAC A;  1DMO A;  4PHN A;  3IQO A;  1KFX L;  3TDZ A;  1BOD A;  4JPZ B;  4DS7 A;  2GGM A;  3CZT X;  1MWN A;  2JRF A;  2JU0 A;  2KYF A;  2MBX A;  1MR8 A;  1J7P A;  4I5L B;  2LVV A;  4PCW A;  2V53 A;  1J7Q A;  1V1G A;  3I5H C;  1CNP A;  1H8B A;  1AP4 A;  1EG3 A;  1B7T Y;  1UP5 A;  1AJ5 A;  1JF2 A;  1MQ1 A;  1D1O A;  4YGA A;  4DUQ A;  2F8P A;  3GOF A;  4HRH A;  5PAL A;  1CDP A;  1B7T Z;  3CTN A;  2M7L A;  1A75 B;  1K95 A;  1UUS A;  2KFG A;  3CWG A;  1YRT B;  1MHO A;  5DKR A;  2M29 A;  2KBM A;  1GGZ A;  2GGZ A;  4C0L A;  3I5F C;  1RTP 1;  4MN0 A;  1AHR A;  2LVI A;  2KI4 B;  1OZS A;  2OTG B;  2L4H A;  5HKW A;  1M46 A;  1Q80 A;  2VRG A;  3D0Y B;  5BPJ A;  3WXA A;  3JTD B;  2K7D A;  3A4U B;  3HCM A;  3O2P A;  3PAT A;  4MZJ A;  2LLT A;  2ZND A;  3KF9 A;  2LV7 A;  2Y1N A;  4IL1 A;  4M2P A;  1J1E A;  2LLS A;  1AJ4 A;  1KWO C;  2B1U A;  4JQ0 D;  1K9U A;  3TDI A;  2KI6 D;  1B4C A;  1SCM C;  4YRU A;  1DJI A;  1K93 D;  3SIA A;  3BUX B;  4GUK A;  1QS7 A;  2E6W A;  2KHN A;  5B8I B;  1BOC A;  2D8N A;  2I18 A;  5I2Q A;  2L2E A;  2M7N A;  3RLZ A;  2JXC A;  3CR5 X;  2FCD A;  2HET A;  4YGD B;  1DJX A;  2KAV A;  2NLN A;  1BR4 B;  1NX0 A;  2FOT A;  3CR4 X;  4N5X A;  2L51 A;  1PAL A;  2OS8 C;  3EKH A;  1B9A A;  4GAO A;  3WNX B;  1L7Z A;  1CMF A;  1KSM A;  1FW4 A;  2LE9 B;  1Y1X A;  4AOM A;  1AVS A;  1RJV A;  4I5N B;  1G4Y R;  4FTG A;  4M2O A;  1M31 A;  1OOJ A;  3SG3 A;  1H4B A;  1NX1 A;  4OKH A;  1CDM A;  2LLU A;  1LA0 A;  2PAS A;  1DF0 B;  4OR9 B;  1ALW A;  2F3Z A;  2MJW B;  3EVR A;  5HKY A;  3QRX A;  2LHL A;  2Y4Q A;  1W7J B;  1SR6 B;  1JFK A;  3VGO A;  4ORA B;  1K8U A;  4PE1 A;  1NSH A;  1S1E A;  3OX6 A;  1JSA A;  1YR5 A;  1N2D A;  2LVJ A;  2L0P A;  2M9G A;  2JT0 A;  2M1U A;  3CGA A;  2CNP A;  2WCF A;  1BJF A;  1ALV A;  5HLO A;  1NWD A;  1YVH A;  4HRE E;  1N65 A;  1TNX A;  2CXJ A;  2P6B B;  2CT9 A;  1K94 A;  1OE9 B;  1QX5 B;  3AAK A;  3FIA A;  1TTX A;  3VRN A;  4AQJ A;  2H2K A;  4PHK A;  1YRU B;  1CLB A;  2HQW A;  2K7O A;  1BT6 A;  1QX7 A;  3AKB A;  1SBJ A;  1KK8 C;  2I7A A;  3DVE A;  2NCP A;  3OX5 A;  4WQ2 A;  4DIR A;  2LC5 A;  2HPS A;  1QTX A;  1F4Q A;  3I5G C;  4FQO A;  1J1D A;  5K89 A;  4Q04 A;  2Q4U A;  1A75 A;  5AER A;  4N1F A;  5KU1 A;  4L9M A;  5CSI A;  1CFD A;  1NX3 A;  5I2O A;  1NCZ A;  1YUR A;  2F2P A;  1EXR A;  4HSZ A;  1F8H A;  1YX7 A;  4M2Q A;  2FCE A;  1CKK A;  3D10 A;  4CFR A;  2LUC A;  2MA2 A;  4WRI A;  3PN7 B;  3D0Y A;  4GBA A;  2KBI A;  2OPO A;  2EGD A;  2KQ6 A;  2K2A A;  1NIW A;  4A4C A;  1DVI A;  1MXL C;  1KFU S;  1RWY A;  4YI8 A;  3JTD C;  2JUL A;  3TS5 B;  2I2R E;  1QX2 A;  2LAP A;  2LUX A;  2ZRT A;  3K21 A;  4I5J A;  1SL9 A;  1DTL A;  2O60 A;  1LXF C;  4GGF A;  1F71 A;  1WRZ A;  1WDC C;  3SG6 A;  3FWB A;  3SG5 A;  3DVK A;  2WND A;  3GK2 A;  3JVT C;  4GGF C;  1B8L A;  4TNC A;  3WHU B;  4BY4 A;  5TNC A;  2M97 A;  1YUS A;  1KQM B;  2KYC A;  1EG4 A;  1QAS A;  3CR2 A;  3EVV A;  5AFP A;  3BUM B;  1TCO B;  4ZCU A;  1RK9 A;  3NSL A;  1XFV O;  1SYM A;  1ZMZ A;  1PK0 D;  2K61 A;  1FF1 A;  1QXP A;  2BE4 A;  1Y6W A;  1REC A;  1M45 A;  2BL0 B;  1DF0 A;  1TNQ A;  1M39 A;  1IWQ A;  1NCX A;  1TIZ A;  3O78 A;  3LK0 A;  1XFW O;  2MAZ A;  1SR6 C;  1RFJ A;  2JNX A;  4YGE B;  1CFC A;  4ETO A;  4USL A;  1MF8 B;  3DVJ A;  1TNW A;  2CCM A;  1JBA A;  4NQG A;  1OMD A;  1G33 A;  3PM8 A;  1CLM A;  2RGI A;  4CID A;  4OV2 A;  1YUT A;  1K9K A;  4MEW A;  2H61 A;  2ISD A;  1EJ3 A;  3BYA A;  4I5K A;  2Y5I A;  4PDZ A;  4YI9 A;  2SAS A;  2FJU B;  2ZN9 A;  3GK1 A;  1S5G Y;  2H61 C;  3ICB A;  1CLL A;  1PSR A;  2AUC A;  3I5H B;  3KHE A;  4C0K A;  1S36 A;  3I5I B;  1NX2 A;  4ICB A;  3LL8 B;  1F70 A;  1JF0 A;  1S5G Z;  3PFV A;  1LKJ A;  1MUX A;  3ZWH A;  1N0Y A;  1BR1 B;  1DJY A;  5AEQ A;  1SMG A;  2WCB A;  3GK4 X;  1R2U A;  2LCP A;  1M63 B;  1XYD A;  4P2Y B;  1G8I A;  3VRR A;  1E8A A;  3F45 A;  3O4Y A;  1XO5 A;  4F0Z B;  3I5F B;  1CFF A;  1L2O C;  1PUL A;  3CLN A;  1SPY A;  1OQP A;  2WC8 A;  1FBV A;  2BCB A;  3IQQ A;  2L98 A;  2I94 A;  2ZRS A;  3VRO A;  3VRP A;  2JC2 A;  1CMG A;  2F33 A;  2WCE A;  3DVM A;  3A8R A;  5GQQ C;  1AK8 A;  1F55 A;  1QIV A;  4CLN A;  2K0J A;  4MZL A;  3FWC A;  5KTY A;  3LK1 A;  5HLV A;  2EC6 C;  1KWO B;  2MLF C;  2BKH B;  1LA3 A;  2CTN A;  4E68 A;  2LVK A;  4MRY A;  1BU3 A;  2ZKM X;  3SG7 A;  1IKU A;  2JNF A;  5ER4 X;  1QJT A;  1WLM A;  3BOW B;  1GQM A;  2F3Y A;  2BEC A;  1NCY A;  1CTR A;  3EK7 A;  1DJH A;  1SL8 A;  1XFX O;  2LP3 A;  1IH0 A;  2M3W A;  3H4S E;  4PE4 A;  1B1G A;  3DF0 B;  2M0R A;  5ER5 A;  1HQV A;  1PRW A;  4CFQ A;  3BXK A;  1QVI Z;  4GNK B;  1KFU L;  1TNP A;  1WRL A;  1GJY A;  1XFU O;  2OS8 B;  4PE0 A;  1QAT A;  2KFF A;  4MLW A;  2TN4 A;  3M0W A;  5JJG A;  2KFH A;  2LHI A;  4YGC B;  3TDU A;  1J55 A;  1KQM C;  3VRQ A;  1YTZ C;  1Y0V H;  2AAO A;  1IG5 A;  1QLK A;  3C1V A;  3NXA A; 
#chains in the Genus database with same CATH topology
 1QWV A;  1U5I B;  3LCP C;  2HQ8 A;  4DCK A;  2L5Y A;  3IF7 A;  2DOQ A;  1W9Z A;  2WOR A;  2JT3 A;  1AUI B;  1YX8 A;  4MZK A;  2KI4 C;  3NSO A;  4XJK B;  1PSB A;  2LP2 A;  2OTG C;  2BBM A;  1C7V A;  3PSR A;  1OOG A;  3LLE A;  5FI7 A;  1LIN A;  2KAX A;  1LS8 A;  1IRJ A;  3S0B A;  1KCY A;  1GGW A;  1QV1 A;  1C7W A;  3OB2 B;  1IQ5 A;  1FI5 A;  1NPQ A;  1ZUZ A;  5HYD A;  1NYA A;  3RM1 A;  5I8N A;  2IS9 A;  3PLF B;  1C07 A;  1OMR A;  2L50 A;  1W7I B;  4YGB B;  2K8M B;  2PRU A;  4IJ7 A;  4NDC A;  3SG4 A;  1TN4 A;  4U8D A;  3NGV A;  2JXL A;  4WQ3 A;  1HT9 A;  2BBN A;  4FQT A;  2KNE A;  1SW8 A;  2Y1M A;  4MSP A;  2M1K B;  4HRG A;  2K7C A;  1DQE A;  1UWO A;  1S6I A;  1A29 A;  4JD9 A;  1K9P A;  3N7H A;  3TUY B;  3S0G A;  1UHN A;  1JUO A;  3FE9 A;  1IJ6 A;  3NSK A;  1KK8 B;  4MRX A;  2WC6 A;  1YVL A;  2PAL A;  2M8U A;  1DJZ A;  4OVN F;  3FS7 A;  2KQY A;  4AQI A;  2NCO A;  4MBE A;  4UPG A;  4MVF A;  4ORB B;  5CPV A;  2O5G A;  1VRK A;  1F4O A;  3I5I C;  2G2B A;  1CFP A;  2QEO A;  2P70 A;  3I5G B;  1NP8 A;  2CBL A;  2KAY A;  1J7R A;  1OSA A;  1SKT A;  1SRA A;  2KSP A;  3NSI A;  3R1P A;  4R1E A;  3SS3 A;  5FI6 A;  3ZNI A;  4CPV A;  3DYE A;  4NDD A;  1JWD A;  1DGV A;  4PT1 A;  5CSN A;  1ZOT B;  3BQ3 A;  3RZS A;  1K2H A;  3AKA A;  5CSF A;  2MLE C;  2KDH A;  2KPH A;  3E3R A;  1KFX S;  3SIB A;  5EL2 A;  3HX4 A;  1XA5 A;  1DJG A;  2BAP A;  1NUB A;  2MHH A;  4C0J A;  1CDN A;  2LMU A;  1SY9 A;  4PAL A;  1WRK A;  3IVT A;  3R72 A;  3BUN B;  1S26 D;  2JOJ A;  1DT7 B;  2QEB A;  3CZ1 A;  2ZNE A;  2L5X B;  1ZFS A;  1DGU A;  3QME A;  5F6T A;  1XFR A;  3PAL A;  2BKI B;  3CZ2 A;  2K2F A;  1FPW A;  1YUU A;  2JPT A;  1DEK A;  1DEL A;  3L4A A;  2AMI A;  5HKZ A;  2PSR A;  5I2L A;  2ERB A;  3FE6 A;  1MXE A;  1K96 A;  1TCF A;  3WHT B;  1XFY O;  4INW A;  3AAJ A;  2PMY A;  3BOW A;  4GGN A;  1XFZ O;  1WDC B;  2LM5 A;  2JPO A;  2BE6 A;  1TWO A;  5CSJ A;  2R2I A;  3DF0 A;  4N1G A;  1Y1U A;  3BUW B;  3JVT B;  2JTZ A;  2PVB A;  3SG2 A;  3EVU A;  1SL7 A;  3BFB A;  1FI6 A;  3O6B A;  3DD4 A;  1IIO A;  1TUZ A;  3KO0 A;  2L4I A;  2QEH A;  2JQ6 A;  1V1F A;  2MRD A;  1A2X A;  2NZ0 A;  1BMO A;  1IQ3 A;  1SNL A;  2LAN A;  2LMV A;  4PHM A;  1SCV A;  3CYZ A;  1X02 A;  4BY5 A;  4GPL B;  1DJW A;  1S6J A;  4KYN A;  5AXI A;  1A4P A;  5IBW A;  1U5I A;  3MSE B;  4QJ5 B;  2E30 A;  2ZFD A;  4D1E A;  1TRF A;  1J7O A;  2EHB A;  1WLZ A;  3CS1 A;  4GFT A;  1UHK A;  3EK8 A;  3EKJ A;  4ORC B;  1UUR A;  4XJK A;  1TUJ A;  5D69 A;  3PN7 C;  1SCM B;  3Q8I A;  1JC2 A;  1KQV A;  2G9B A;  2JT8 A;  3SJS A;  1F54 A;  4JWQ A;  1QIW A;  4PE7 A;  2KGB C;  1XK4 A;  2LMT A;  1WY9 A;  3BUO B;  3OB1 B;  2M49 B;  2KI6 C;  2NXQ A;  2QPT A;  1PVB A;  4QJ4 B;  4DRW A;  4YBH B;  1QVI Y;  2BCX A;  3OHM B;  1PVA A;  4XYN A;  3TS5 C;  1XK4 C;  1EH2 A;  1XVJ A;  1IJ5 A;  4A4B A;  4ZCV A;  1S6C A;  2QEV A;  3EG5 B;  1KK7 Y;  4OCI A;  1CDL A;  2A4J A;  2HF5 A;  2K7B A;  1K90 D;  1B47 A;  1TOP A;  1ODB A;  2SCP A;  2WOS A;  2LNK A;  5I94 A;  1BF5 A;  1KK7 Z;  3KPX A;  2JZI A;  1B8C A;  3TUY C;  5DKN A;  1S3P A;  5FYX A;  1A03 A;  1UHI A;  5DKQ A;  1BG1 A;  3NHI A;  5JOL A;  1LVC D;  1BLQ A;  1T14 A;  1B8R A;  2ZN8 A;  2F2O A;  2Q91 A;  1CB1 A;  5KSZ A;  1UHH A;  1RRO A;  1QV0 A;  1JFJ A;  2BL0 C;  2JWW A;  3D77 A;  4NDB A;  1IGV A;  1KSO A;  1R6P A;  1L2O B;  1SK6 D;  1Y1A A;  2KOT A;  3CZ0 A;  1EL4 A;  2BCA A;  3TZ1 A;  2GV5 A;  1CM4 A;  3EK4 A;  4P5O E;  5AAN A;  2KLD A;  5D7F A;  2KGR A;  1ZAC A;  1OZO A;  2BNX A;  3KEV A;  5HL1 A;  1OMV A;  2JTT A;  2COL B;  2EC6 B;  1GM0 A;  1UHJ A;  1QLS A;  5J3X A;  1CM1 A;  4QJ3 B;  5G08 A;  3OP0 A;  4PHJ A;  3BFA A;  2QAC A;  1DMO A;  4PHN A;  3IQO A;  2FJY A;  1KFX L;  3TDZ A;  1BOD A;  4JPZ B;  4DS7 A;  2GGM A;  3CZT X;  1MWN A;  2JRF A;  2JU0 A;  2KYF A;  2MBX A;  1MR8 A;  1J7P A;  4I5L B;  2LVV A;  3B6X A;  4PCW A;  2V53 A;  1C3Y A;  1J7Q A;  1V1G A;  3I5H C;  1CNP A;  1H8B A;  1AP4 A;  1EG3 A;  1B7T Y;  1UP5 A;  1AJ5 A;  1JF2 A;  1MQ1 A;  1D1O A;  4YGA A;  4DUQ A;  2WCL A;  2F8P A;  3GOF A;  2PYQ A;  4HRH A;  5PAL A;  1CDP A;  1B7T Z;  3CTN A;  2M7L A;  1A75 B;  1K95 A;  1UUS A;  2KFG A;  3CWG A;  1YRT B;  1MHO A;  1OOF A;  2M29 A;  5DKR A;  2KBM A;  1GGZ A;  2GGZ A;  4C0L A;  3I5F C;  1ORG A;  3D74 A;  1RTP 1;  4MN0 A;  1AHR A;  2LVI A;  2KI4 B;  1OZS A;  2OTG B;  2L4H A;  5HKW A;  1M46 A;  1Q80 A;  2VRG A;  3K1E A;  3D0Y B;  5BPJ A;  3WXA A;  3JTD B;  2K7D A;  3A4U B;  3HCM A;  3O2P A;  3PAT A;  4MZJ A;  2LLT A;  2ZND A;  3KF9 A;  2LV7 A;  2Y1N A;  4IL1 A;  4M2P A;  1J1E A;  2LLS A;  3V2L A;  3DZT A;  1AJ4 A;  1KWO C;  2B1U A;  4JQ0 D;  1K9U A;  2WCM A;  3TDI A;  2KI6 D;  1B4C A;  1SCM C;  4YRU A;  1DJI A;  1K93 D;  3SIA A;  3BUX B;  4GUK A;  1QS7 A;  1OOH A;  2E6W A;  2KHN A;  3NHT A;  5B8I B;  1BOC A;  2D8N A;  2I18 A;  5I2Q A;  2L2E A;  2M7N A;  3RLZ A;  2JXC A;  3CR5 X;  2FCD A;  2HET A;  4YGD B;  1DJX A;  2KAV A;  2NLN A;  1BR4 B;  1NX0 A;  2FOT A;  3CR4 X;  4N5X A;  2L51 A;  1Z4H A;  1PAL A;  2OS8 C;  3EKH A;  1B9A A;  4GAO A;  3WNX B;  1L7Z A;  1CMF A;  1KSM A;  1FW4 A;  2LE9 B;  1Y1X A;  4AOM A;  1AVS A;  1RJV A;  4I5N B;  1G4Y R;  4FTG A;  4M2O A;  1M31 A;  1OOJ A;  3SG3 A;  1H4B A;  1NX1 A;  3PJI A;  4OKH A;  1CDM A;  2LLU A;  1LA0 A;  2PAS A;  1DF0 B;  4OR9 B;  1ALW A;  2F3Z A;  2MJW B;  3EVR A;  5HKY A;  3QRX A;  2LHL A;  2Y4Q A;  1W7J B;  1SR6 B;  1JFK A;  4F7F A;  3VGO A;  3SS4 A;  4ORA B;  1K8U A;  4PE1 A;  1NSH A;  1S1E A;  3OX6 A;  1JSA A;  4JKT A;  1YR5 A;  1N2D A;  2LVJ A;  3CAB A;  2L0P A;  2M9G A;  3B7A A;  2JT0 A;  2M1U A;  3CGA A;  2CNP A;  2WCF A;  1BJF A;  1ALV A;  5HLO A;  1DC1 A;  3UO9 A;  1NWD A;  1YVH A;  3OGN A;  4HRE E;  1N65 A;  3B86 A;  1TNX A;  2CXJ A;  2P6B B;  3B87 A;  3S0F A;  2CT9 A;  1K94 A;  1OE9 B;  1QX5 B;  3AAK A;  3D76 A;  3NXA A;  3FIA A;  1TTX A;  5FI2 A;  3DXL A;  3VRN A;  4AQJ A;  2H2K A;  4PHK A;  1YRU B;  3BJH A;  1CLB A;  2HQW A;  2K7O A;  1BT6 A;  1QX7 A;  3AKB A;  1SBJ A;  1KK8 C;  2I7A A;  2YGU A;  3DVE A;  2NCP A;  3OX5 A;  4WQ2 A;  4DIR A;  2P71 A;  2LC5 A;  2HPS A;  1QTX A;  1F4Q A;  3I5G C;  4FQO A;  1J1D A;  5K89 A;  4Q04 A;  2Q4U A;  1A75 A;  5AER A;  4N1F A;  5KU1 A;  2PQL A;  4L9M A;  5CSI A;  1CFD A;  1NX3 A;  3PM2 A;  5I2O A;  1NCZ A;  1YUR A;  2F2P A;  1EXR A;  4HSZ A;  1F8H A;  1YX7 A;  4M2Q A;  2FCE A;  1CKK A;  3D10 A;  4CFR A;  2LUC A;  2MA2 A;  4WRI A;  3PN7 B;  3D0Y A;  2GTE A;  4GBA A;  2WCK A;  2KBI A;  2OPO A;  2EGD A;  3OBV A;  2KQ6 A;  2K2A A;  1NIW A;  4A4C A;  3D75 A;  1DVI A;  1MXL C;  1KFU S;  1RWY A;  4YI8 A;  3JTD C;  2JUL A;  3TS5 B;  2I2R E;  1QX2 A;  2LAP A;  2LUX A;  2ZRT A;  3K21 A;  3L47 A;  4I5J A;  1SL9 A;  1DTL A;  2O60 A;  1LXF C;  4GGF A;  1F71 A;  1WRZ A;  1WDC C;  3SS5 A;  3SG6 A;  3FWB A;  3SG5 A;  3DVK A;  2WND A;  3GK2 A;  3JVT C;  4GGF C;  1B8L A;  4TNC A;  3WHU B;  4BY4 A;  2KLE A;  5TNC A;  2M97 A;  1YUS A;  1KQM B;  2KYC A;  2K60 A;  1EG4 A;  3BFH A;  1QAS A;  3CR2 A;  1SSE B;  3EVV A;  3BUM B;  1TCO B;  5AFP A;  4ZCU A;  1RK9 A;  3NSL A;  1XFV O;  1P28 A;  1SYM A;  1ZMZ A;  1PK0 D;  2K61 A;  1FF1 A;  1QXP A;  2BE4 A;  1Y6W A;  1OW4 A;  1REC A;  1M45 A;  2BL0 B;  1DF0 A;  1TNQ A;  1M39 A;  1IWQ A;  1NCX A;  1TIZ A;  5D3O A;  3O78 A;  3LK0 A;  4INX A;  1XFW O;  2MAZ A;  1SR6 C;  1RFJ A;  2JNX A;  4YGE B;  1CFC A;  3CDN A;  3L4L A;  4ETO A;  4USL A;  1MF8 B;  3DVJ A;  3R1O A;  1TNW A;  2CCM A;  1JBA A;  4NQG A;  1OMD A;  1G33 A;  3PM8 A;  1CLM A;  2RGI A;  4CID A;  3R1V A;  4OV2 A;  2WCH A;  1YUT A;  1K9K A;  5DIC A;  4MEW A;  2H61 A;  2ISD A;  3S0E A;  1Z2C B;  1EJ3 A;  3BYA A;  4I5K A;  3VB1 A;  2Y5I A;  4PDZ A;  4YI9 A;  2SAS A;  2FJU B;  2ZN9 A;  3GK1 A;  1S5G Y;  2H61 C;  3ICB A;  1CLL A;  1PSR A;  2AUC A;  3I5H B;  3KHE A;  4C0K A;  1S36 A;  3I5I B;  1NX2 A;  4ICB A;  3LL8 B;  1F70 A;  1JF0 A;  1S5G Z;  1C3Z A;  3PFV A;  1LKJ A;  3O4X A;  1MUX A;  2QDI A;  3ZWH A;  1N0Y A;  2WC5 A;  1BR1 B;  1DJY A;  5AEQ A;  1SMG A;  2WCB A;  3GK4 X;  1R2U A;  2LCP A;  1M63 B;  1XYD A;  4P2Y B;  1G8I A;  3VRR A;  1E8A A;  3F45 A;  3O4Y A;  1XO5 A;  4F0Z B;  3I5F B;  1CFF A;  3S0D A;  3UNW A;  1L2O C;  1PUL A;  3CLN A;  1SPY A;  1OQP A;  2WC8 A;  1FBV A;  2BCB A;  3IQQ A;  2L98 A;  2I94 A;  2ZRS A;  3VRO A;  3VRP A;  2JC2 A;  1CMG A;  2F33 A;  2WCE A;  3DVM A;  3A8R A;  5GQQ C;  1AK8 A;  1F55 A;  1QIV A;  4CLN A;  2K0J A;  4MZL A;  3D78 A;  3FWC A;  3LK1 A;  5HLV A;  5KTY A;  2EC6 C;  1KWO B;  2MLF C;  2BKH B;  1LA3 A;  3S0A A;  2CTN A;  4E68 A;  2LVK A;  4MRY A;  1BU3 A;  3D73 A;  2L2C A;  2ZKM X;  3SG7 A;  1IKU A;  2JNF A;  5ER4 X;  1QJT A;  1WLM A;  3BOW B;  2H8V A;  1GQM A;  2F3Y A;  2BEC A;  1NCY A;  1CTR A;  3EK7 A;  1DJH A;  1SL8 A;  1XFX O;  2LP3 A;  1IH0 A;  2M3W A;  3H4S E;  4PE4 A;  2WCJ A;  3DF0 B;  2M0R A;  5ER5 A;  1B1G A;  1HQV A;  1PRW A;  4CFQ A;  3BXK A;  3FE8 A;  1QVI Z;  4GNK B;  4OZD A;  1KFU L;  1TNP A;  1WRL A;  1GJY A;  3DY9 A;  1XFU O;  2OS8 B;  4PE0 A;  1QAT A;  2KFF A;  4MLW A;  2TN4 A;  3M0W A;  5JJG A;  2KFH A;  2LHI A;  4YGC B;  3TDU A;  1J55 A;  1KQM C;  3VRQ A;  1YTZ C;  1Y0V H;  2AAO A;  1IG5 A;  1QLK A;  3C1V A;  1OOI X;  3B88 A; 
#chains in the Genus database with same CATH homology
 3LCP C;  1U5I B;  2HQ8 A;  4DCK A;  3IF7 A;  2DOQ A;  2WOR A;  2JT3 A;  1AUI B;  1YX8 A;  4MZK A;  2KI4 C;  3NSO A;  4XJK B;  1PSB A;  2LP2 A;  2OTG C;  2BBM A;  1C7V A;  3PSR A;  3LLE A;  1LIN A;  2KAX A;  1IRJ A;  1KCY A;  1GGW A;  1QV1 A;  1C7W A;  3OB2 B;  1IQ5 A;  1FI5 A;  1NPQ A;  1ZUZ A;  5HYD A;  1NYA A;  3RM1 A;  5I8N A;  2IS9 A;  3PLF B;  1C07 A;  1OMR A;  2L50 A;  1W7I B;  4YGB B;  2K8M B;  2PRU A;  4NDC A;  3SG4 A;  1TN4 A;  4U8D A;  4WQ3 A;  2JXL A;  1HT9 A;  2BBN A;  5CSJ A;  2KNE A;  1SW8 A;  2Y1M A;  4MSP A;  2M1K B;  4HRG A;  2K7C A;  1UWO A;  1S6I A;  1A29 A;  1K9P A;  3TUY B;  1UHN A;  1JUO A;  1IJ6 A;  3NSK A;  1KK8 B;  4MRX A;  1YVL A;  2PAL A;  2M8U A;  1DJZ A;  4OVN F;  3FS7 A;  2KQY A;  4AQI A;  2NCO A;  4MBE A;  4UPG A;  4MVF A;  4ORB B;  5CPV A;  2O5G A;  1VRK A;  1F4O A;  3I5I C;  2G2B A;  1CFP A;  3I5G B;  1NP8 A;  2CBL A;  2KAY A;  1J7R A;  1OSA A;  1SKT A;  1SRA A;  2KSP A;  3NSI A;  3ZNI A;  4R1E A;  4CPV A;  1CB1 A;  1JWD A;  4NDD A;  1DGV A;  5CSN A;  1ZOT B;  3BQ3 A;  1K2H A;  3AKA A;  5CSF A;  2MLE C;  2KDH A;  3E3R A;  3SIB A;  1KFX S;  3HX4 A;  1XA5 A;  1DJG A;  2MHH A;  1NUB A;  4C0J A;  1CDN A;  2LMU A;  1SY9 A;  4PAL A;  1WRK A;  3BUN B;  1S26 D;  2JOJ A;  1DT7 B;  2ZNE A;  2L5X B;  1ZFS A;  1DGU A;  5F6T A;  3PAL A;  2BKI B;  1FPW A;  2K2F A;  1YUU A;  2JPT A;  5HKZ A;  2AMI A;  2PSR A;  5I2L A;  1MXE A;  1K96 A;  1TCF A;  3WHT B;  1XFY O;  3AAJ A;  2PMY A;  3BOW A;  4GGN A;  1XFZ O;  1WDC B;  2LM5 A;  2BE6 A;  2R2I A;  3DF0 A;  4N1G A;  1Y1U A;  3BUW B;  3JVT B;  2JTZ A;  2PVB A;  3SG2 A;  3EVU A;  1SL7 A;  1FI6 A;  3O6B A;  3DD4 A;  3KO0 A;  2L4I A;  2JQ6 A;  1V1F A;  2MRD A;  1A2X A;  2NZ0 A;  1BMO A;  1IQ3 A;  1SNL A;  2LAN A;  2LMV A;  4PHM A;  1SCV A;  1X02 A;  4BY5 A;  4GPL B;  1DJW A;  1S6J A;  5IBW A;  5AXI A;  1A4P A;  1U5I A;  3MSE B;  4QJ5 B;  2E30 A;  2ZFD A;  4D1E A;  1TRF A;  1J7O A;  2EHB A;  1WLZ A;  3CS1 A;  4GFT A;  1UHK A;  3EK8 A;  3EKJ A;  4ORC B;  1UUR A;  4XJK A;  5D69 A;  3PN7 C;  1SCM B;  1JC2 A;  1KQV A;  2G9B A;  2JT8 A;  3SJS A;  1F54 A;  4JWQ A;  1QIW A;  4PE7 A;  2KGB C;  1XK4 A;  2LMT A;  1WY9 A;  3BUO B;  3OB1 B;  2M49 B;  2KI6 C;  2NXQ A;  2QPT A;  1PVB A;  4QJ4 B;  4DRW A;  4YBH B;  1QVI Y;  2BCX A;  3OHM B;  1PVA A;  4XYN A;  3TS5 C;  1XK4 C;  1EH2 A;  1XVJ A;  1IJ5 A;  4A4B A;  4ZCV A;  1S6C A;  1KK7 Y;  4OCI A;  1CDL A;  2A4J A;  2HF5 A;  2K7B A;  1K90 D;  1B47 A;  1TOP A;  1ODB A;  2SCP A;  2WOS A;  2LNK A;  1BF5 A;  1KK7 Z;  3KPX A;  2JZI A;  1B8C A;  3TUY C;  5DKN A;  1S3P A;  5FYX A;  1A03 A;  1UHI A;  5DKQ A;  1BG1 A;  5JOL A;  1LVC D;  1BLQ A;  1B8R A;  2ZN8 A;  2F2O A;  2Q91 A;  5KSZ A;  1UHH A;  1RRO A;  1QV0 A;  1JFJ A;  2BL0 C;  2JWW A;  4NDB A;  1IGV A;  1KSO A;  1R6P A;  1L2O B;  1SK6 D;  1Y1A A;  2KOT A;  1EL4 A;  2BCA A;  3TZ1 A;  2GV5 A;  1CM4 A;  3EK4 A;  4P5O E;  5AAN A;  5D7F A;  2KGR A;  1ZAC A;  1OZO A;  3KEV A;  1OMV A;  2JTT A;  2COL B;  2EC6 B;  1UHJ A;  1QLS A;  5J3X A;  1CM1 A;  4QJ3 B;  5G08 A;  3OP0 A;  4PHJ A;  2QAC A;  1DMO A;  4PHN A;  3IQO A;  1KFX L;  3TDZ A;  1BOD A;  4JPZ B;  4DS7 A;  2GGM A;  3CZT X;  1MWN A;  2JRF A;  2JU0 A;  2KYF A;  2MBX A;  1MR8 A;  1J7P A;  4I5L B;  2LVV A;  4PCW A;  2V53 A;  1J7Q A;  1V1G A;  3I5H C;  1CNP A;  1H8B A;  1AP4 A;  1EG3 A;  1B7T Y;  1UP5 A;  1AJ5 A;  1JF2 A;  1MQ1 A;  1D1O A;  4YGA A;  4DUQ A;  2F8P A;  3GOF A;  4HRH A;  5PAL A;  1CDP A;  1B7T Z;  3CTN A;  2M7L A;  1A75 B;  1K95 A;  1UUS A;  2KFG A;  3CWG A;  1YRT B;  1MHO A;  5DKR A;  2M29 A;  2KBM A;  1GGZ A;  2GGZ A;  4C0L A;  3I5F C;  1RTP 1;  4MN0 A;  1AHR A;  2LVI A;  2KI4 B;  1OZS A;  2OTG B;  2L4H A;  5HKW A;  1M46 A;  1Q80 A;  2VRG A;  3D0Y B;  5BPJ A;  3WXA A;  3JTD B;  2K7D A;  3A4U B;  3HCM A;  3O2P A;  3PAT A;  4MZJ A;  2LLT A;  2ZND A;  3KF9 A;  2LV7 A;  2Y1N A;  4IL1 A;  4M2P A;  1J1E A;  2LLS A;  1AJ4 A;  1KWO C;  2B1U A;  4JQ0 D;  1K9U A;  3TDI A;  2KI6 D;  1B4C A;  1SCM C;  4YRU A;  1DJI A;  1K93 D;  3SIA A;  3BUX B;  4GUK A;  1QS7 A;  2E6W A;  2KHN A;  5B8I B;  1BOC A;  2D8N A;  2I18 A;  5I2Q A;  2L2E A;  2M7N A;  3RLZ A;  2JXC A;  3CR5 X;  2FCD A;  2HET A;  4YGD B;  1DJX A;  2KAV A;  2NLN A;  1BR4 B;  1NX0 A;  2FOT A;  3CR4 X;  4N5X A;  2L51 A;  1PAL A;  2OS8 C;  3EKH A;  1B9A A;  4GAO A;  3WNX B;  1L7Z A;  1CMF A;  1KSM A;  1FW4 A;  2LE9 B;  1Y1X A;  4AOM A;  1AVS A;  1RJV A;  4I5N B;  1G4Y R;  4FTG A;  4M2O A;  1M31 A;  1OOJ A;  3SG3 A;  1H4B A;  1NX1 A;  4OKH A;  1CDM A;  2LLU A;  1LA0 A;  2PAS A;  1DF0 B;  4OR9 B;  1ALW A;  2F3Z A;  2MJW B;  3EVR A;  5HKY A;  3QRX A;  2LHL A;  2Y4Q A;  1W7J B;  1SR6 B;  1JFK A;  3VGO A;  4ORA B;  1K8U A;  4PE1 A;  1NSH A;  1S1E A;  3OX6 A;  1JSA A;  1YR5 A;  1N2D A;  2LVJ A;  2L0P A;  2M9G A;  2JT0 A;  2M1U A;  3CGA A;  2CNP A;  2WCF A;  1BJF A;  1ALV A;  5HLO A;  1NWD A;  1YVH A;  4HRE E;  1N65 A;  1TNX A;  2CXJ A;  2P6B B;  2CT9 A;  1K94 A;  1OE9 B;  1QX5 B;  3AAK A;  3FIA A;  1TTX A;  3VRN A;  4AQJ A;  2H2K A;  4PHK A;  1YRU B;  1CLB A;  2HQW A;  2K7O A;  1BT6 A;  1QX7 A;  3AKB A;  1SBJ A;  1KK8 C;  2I7A A;  3DVE A;  2NCP A;  3OX5 A;  4WQ2 A;  4DIR A;  2LC5 A;  2HPS A;  1QTX A;  1F4Q A;  3I5G C;  4FQO A;  1J1D A;  5K89 A;  4Q04 A;  2Q4U A;  1A75 A;  5AER A;  4N1F A;  5KU1 A;  4L9M A;  5CSI A;  1CFD A;  1NX3 A;  5I2O A;  1NCZ A;  1YUR A;  2F2P A;  1EXR A;  4HSZ A;  1F8H A;  1YX7 A;  4M2Q A;  2FCE A;  1CKK A;  3D10 A;  4CFR A;  2LUC A;  2MA2 A;  4WRI A;  3PN7 B;  3D0Y A;  4GBA A;  2KBI A;  2OPO A;  2EGD A;  2KQ6 A;  2K2A A;  1NIW A;  4A4C A;  1DVI A;  1MXL C;  1KFU S;  1RWY A;  4YI8 A;  3JTD C;  2JUL A;  3TS5 B;  2I2R E;  1QX2 A;  2LAP A;  2LUX A;  2ZRT A;  3K21 A;  4I5J A;  1SL9 A;  1DTL A;  2O60 A;  1LXF C;  4GGF A;  1F71 A;  1WRZ A;  1WDC C;  3SG6 A;  3FWB A;  3SG5 A;  3DVK A;  2WND A;  3GK2 A;  3JVT C;  4GGF C;  1B8L A;  4TNC A;  3WHU B;  4BY4 A;  5TNC A;  2M97 A;  1YUS A;  1KQM B;  2KYC A;  1EG4 A;  1QAS A;  3CR2 A;  3EVV A;  5AFP A;  3BUM B;  1TCO B;  4ZCU A;  1RK9 A;  3NSL A;  1XFV O;  1SYM A;  1ZMZ A;  1PK0 D;  2K61 A;  1FF1 A;  1QXP A;  2BE4 A;  1Y6W A;  1REC A;  1M45 A;  2BL0 B;  1DF0 A;  1TNQ A;  1M39 A;  1IWQ A;  1NCX A;  1TIZ A;  3O78 A;  3LK0 A;  1XFW O;  2MAZ A;  1SR6 C;  1RFJ A;  2JNX A;  4YGE B;  1CFC A;  4ETO A;  4USL A;  1MF8 B;  3DVJ A;  1TNW A;  2CCM A;  1JBA A;  4NQG A;  1OMD A;  1G33 A;  3PM8 A;  1CLM A;  2RGI A;  4CID A;  4OV2 A;  1YUT A;  1K9K A;  4MEW A;  2H61 A;  2ISD A;  1EJ3 A;  3BYA A;  4I5K A;  2Y5I A;  4PDZ A;  4YI9 A;  2SAS A;  2FJU B;  2ZN9 A;  3GK1 A;  1S5G Y;  2H61 C;  3ICB A;  1CLL A;  1PSR A;  2AUC A;  3I5H B;  3KHE A;  4C0K A;  1S36 A;  3I5I B;  1NX2 A;  4ICB A;  3LL8 B;  1F70 A;  1JF0 A;  1S5G Z;  3PFV A;  1LKJ A;  1MUX A;  3ZWH A;  1N0Y A;  1BR1 B;  1DJY A;  5AEQ A;  1SMG A;  2WCB A;  3GK4 X;  1R2U A;  2LCP A;  1M63 B;  1XYD A;  4P2Y B;  1G8I A;  3VRR A;  1E8A A;  3F45 A;  3O4Y A;  1XO5 A;  4F0Z B;  3I5F B;  1CFF A;  1L2O C;  1PUL A;  3CLN A;  1SPY A;  1OQP A;  2WC8 A;  1FBV A;  2BCB A;  3IQQ A;  2L98 A;  2I94 A;  2ZRS A;  3VRO A;  3VRP A;  2JC2 A;  1CMG A;  2F33 A;  2WCE A;  3DVM A;  3A8R A;  5GQQ C;  1AK8 A;  1F55 A;  1QIV A;  4CLN A;  2K0J A;  4MZL A;  3FWC A;  5KTY A;  3LK1 A;  5HLV A;  2EC6 C;  1KWO B;  2MLF C;  2BKH B;  1LA3 A;  2CTN A;  4E68 A;  2LVK A;  4MRY A;  1BU3 A;  2ZKM X;  3SG7 A;  1IKU A;  2JNF A;  5ER4 X;  1QJT A;  1WLM A;  3BOW B;  1GQM A;  2F3Y A;  2BEC A;  1NCY A;  1CTR A;  3EK7 A;  1DJH A;  1SL8 A;  1XFX O;  2LP3 A;  1IH0 A;  2M3W A;  3H4S E;  4PE4 A;  1B1G A;  3DF0 B;  2M0R A;  5ER5 A;  1HQV A;  1PRW A;  4CFQ A;  3BXK A;  1QVI Z;  4GNK B;  1KFU L;  1TNP A;  1WRL A;  1GJY A;  1XFU O;  2OS8 B;  4PE0 A;  1QAT A;  2KFF A;  4MLW A;  2TN4 A;  3M0W A;  5JJG A;  2KFH A;  2LHI A;  4YGC B;  3TDU A;  1J55 A;  1KQM C;  3VRQ A;  1YTZ C;  1Y0V H;  2AAO A;  1IG5 A;  1QLK A;  3C1V A;  3NXA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...