2JPOA

Nmr structure of antheraea polyphemus pheromone-binding protein 1 at ph 4.5
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
142
structure length
142
Chain Sequence
SPEIMKNLSNNFGKAMDQCKDELSLPDSVVADLYNFWKDDYVMTDRLAGCAINCLATKLDVVDPDGNLHHGNAKDFAMKHGADETMAQQLVDIIHGCEKSAPPNDDKCMKTIDVAMCFKKEIHKLNWVPNMDLVIGEVLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Pheromone-binding protein
publication title Structural Basis of Ligand Binding and Release in Insect Pheromone-Binding Proteins: NMR Structure of Antheraea polyphemus PBP1 at pH 4.5
pubmed doi rcsb
source organism Antheraea polyphemus
total genus 43
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2007-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2jpoA00
2WCHA 1C3YA 3B87A 4F7FA 3QMEA 3S0AA 3CZ1A 3D77A 3DY9A 3FE8A 2QEOA 1OOFA 1TWOA 2ERBA 3R1VA 3CDNA 5DICA 2WCJA 2P70A 1TUJA 3Q8IA 2WCMA 1LS8A 2WC6A 3DZTA 4OZDA 3DYEA 3D76A 3R1PA 3CABA 1QWVA 3B88A 3NHTA 3CZ0A 3FE9A 2KPHA 3B6XA 2P71A 2WC5A 1OW4A 2QDIA 1GM0A 3R72A 3VB1A 4INXA 3S0GA 3BJHA 3L47A 3OGNA 4INWA 3S0DA 5EL2A 3D78A 3FE6A 3NHIA 3RZSA 1ORGA 1P28A 1OOIX 1OOHA 3S0EA 3N7HA 3V2LA 3PJIA 3K1EA 3D74A 2JPOA 3BFBA 1XFRA 1T14A 2PQLA 4JD9A 3DXLA 3R1OA 2QEHA 3B86A 1DQEA 2WCKA 2WCLA 2FJYA 3S0FA 3L4AA 3D73A 3D75A 2QEVA 3S0BA 3BFAA 2H8VA 4FQTA 4PT1A 2GTEA 2L2CA 3CZ2A 3L4LA 2QEBA 3B7AA 1C3ZA 3NGVA 3CYZA 1OOGA 3BFHA
chains in the Genus database with same CATH superfamily
2LLUA 2WCHA 1YX7A 1M63B 1IJ6A 4C0JA 2L98A 2JOJA 3PN7C 4HRGA 4M2OA 1SPYA 2KLDA 3KF9A 5FI7A 2VRGA 4MBEA 5D69A 4F7FA 5BPJA 1M45A 1CDMA 2NLNA 1B47A 3I5FC 4M2PA 1LXFC 3F45A 1DVIA 1B7TZ 2LHLA 3DVKA 3OX6A 1SCVA 3D77A 3I5HB 1V1GA 1SYMA 2JPTA 2M97A 5I2LA 1JBAA 1UURA 1B7TY 1J7OA 1B9AA 1QX7A 1WY9A 3O4YA 2A4JA 1DGUA 1IQ3A 2AMIA 1N65A 2M8UA 2WCFA 1TRFA 3TZ1A 4HREE 1IH0A 2WCJA 3JVTB 3EVUA 1TUJA 1LS8A 1KWOB 3EVVA 2WC6A 3DZTA 4JQ0D 1SW8A 2CXJA 5CSFA 2KSPA 1J1EA 3WHUB 1ZOTB 1XVJA 1TNPA 3BQ3A 3PALA 2JT3A 4GFTA 1AVSA 1QWVA 3NHTA 4GUKA 2JU0A 1FBVA 5KSZA 2L50A 1OZSA 1TCFA 1Y1AA 3B6XA 2AUCA 3VRQA 1FI6A 1KSMA 1KQMC 1B1GA 4GGNA 1L2OC 3TDUA 1FW4A 1L7ZA 3K21A 3ZNIA 4CFQA 1OMDA 2K0JA 2PVBA 4QJ5B 2JWWA 1IWQA 1YVHA 4YBHB 2LMTA 3S0GA 1SCMB 3O78A 3CZTX 2BL0B 5DKNA 1UUSA 1Z2CB 1G33A 1J7PA 4P5OE 2BE6A 1EH2A 1OMVA 1X02A 1FI5A 1NIWA 2M29A 5HYDA 2KI4B 1S6CA 4I5LB 3DVMA 3VRRA 1RFJA 3D78A 4MZLA 1GGZA 3LCPC 3NHIA 3D10A 1OMRA 1TN4A 3SG5A 1OOIX 2HPSA 2KGBC 2I94A 3V2LA 3ICBA 2JULA 3TUYB 1BF5A 5AFPA 1BODA 2K7OA 2JPOA 2MBXA 1AHRA 2JTTA 4M2QA 1XFRA 4WRIA 2BKHB 3DD4A 5I2OA 2ZN9A 4I5NB 5AERA 2GGZA 3O6BA 4ZCUA 5B8IB 3GK1A 4DIRA 3DXLA 3R1OA 1BLQA 1GJYA 2QEHA 3I5IB 1JWDA 1DQEA 2WCKA 4NDDA 1IIOA 3S0FA 4TNCA 1NCYA 3CS1A 1SKTA 2I18A 2KYFA 2LNKA 2QEVA 2LVKA 1PRWA 2KI6D 2I7AA 3D75A 2H8VA 2HQWA 1TUZA 4USLA 1BU3A 2L2CA 3CLNA 3CZ2A 1CM4A 3D0YB 3I5FB 4ORBB 3B7AA 1KK8C 3A8RA 5CSNA 1NP8A 1JFKA 4PHMA 3SIAA 2G9BA 1OOGA 3DF0B 5DICA 2Y5IA 2KQ6A 4YGBB 4CFRA 2Y1MA 4NDBA 3TS5C 1C3YA 4DCKA 1JFJA 3AKAA 4PE0A 5JOLA 2KYCA 4YI9A 1C07A 4QJ4B 4MSPA 5AEQA 3PM8A 3S0AA 4OR9B 1NUBA 3SG3A 1RTP1 3IVTA 2JRFA 3EKJA 3KO0A 3H4SE 2LP3A 2FJUB 3DY9A 2EC6C 1UHKA 1QV0A 4MEWA 4GAOA 1QATA 3OB2B 2SASA 3JTDB 3LK0A 2LUCA 1BMOA 1EG3A 4P2YB 3MSEB 1NWDA 1UP5A 3C1VA 1UHJA 3IQQA 4YGEB 1DTLA 1IRJA 1Y1UA 1S26D 1RROA 3R1VA 1QIWA 5D7FA 2L2EA 4MZKA 1C7WA 2L5XB 2M49B 1J1DA 3CDNA 1RK9A 4D1EA 1CLBA 1SR6B 2BCAA 2M7LA 1WDCC 4ZCVA 2H61C 3RLZA 1NSHA 2ISDA 2JT8A 2WCMA 3PATA 2LLTA 4U8DA 2KAXA 1DEKA 2LLSA 3HCMA 1CFCA 2BAPA 2MLFC 1DGVA 4C0KA 3BUNB 2ZRTA 2KNEA 4DRWA 3CZ0A 5CSJA 3FE9A 3EK8A 3OB1B 2MAZA 1HT9A 2OTGB 4PALA 1MF8B 2HQ8A 4I5JA 2GV5A 2Y4QA 1NX3A 4KYNA 2M1KB 1PULA 3GK2A 3SG4A 1QLKA 1BOCA 1CKKA 3CGAA 1GM0A 1B8LA 3VB1A 2RGIA 1CFDA 4AQIA 1QV1A 3GK4X 4FQOA 5DKQA 3RM1A 2CTNA 1J7RA 1XFUO 1QTXA 1JSAA 4GBAA 1WLZA 3L47A 1SL8A 5CSIA 5FI2A 5HLVA 4PHKA 3FS7A 1CLLA 3SJSA 4PE7A 1ALVA 2WORA 2WOSA 3IQOA 2LE9B 4JWQA 2TN4A 2EGDA 4YRUA 3SS5A 2BCXA 2IS9A 5EL2A 1YUUA 2KBMA 3FE6A 1K9KA 2F8PA 4FTGA 1K93D 3I5GB 1MUXA 1G8IA 2PMYA 2COLB 2JXCA 3PJIA 2CCMA 3OX5A 5PALA 1KK7Z 1WRZA 2P6BB 4XJKB 3EVRA 4BY5A 4JPZB 1ALWA 1W9ZA 5FI6A 1CFPA 2M7NA 3KPXA 2PQLA 2F33A 1RWYA 4JD9A 1KK7Y 1BR1B 1TNQA 1CFFA 2JZIA 1DJHA 1IJ5A 2LHIA 2WCLA 2FJYA 1DC1A 2K7DA 1S6IA 2M9GA 3TDZA 1CDPA 1CB1A 4HSZA 1IGVA 1PVAA 1QIVA 1QS7A 2H2KA 4PCWA 1C7VA 1CDNA 2PSRA 1NX1A 2M3WA 2QEBA 1GGWA 4UPGA 1C3ZA 1Y1XA 5CPVA 1M31A 5AXIA 3I5HC 3NSLA 1DMOA 4XYNA 2JT0A 5HKYA 2LV7A 4DS7A 1K2HA 4MVFA 5G08A 2K2AA 1DF0B 3CTNA 2LANA 3B87A 5D3OA 2JNFA 2HETA 2LVVA 1YUSA 4JKTA 4MLWA 1NPQA 2BCBA 2Y1NA 3QMEA 1XFWO 3O4XA 4YGAA 4CLNA 1H4BA 1AJ5A 3A4UB 5FYXA 2KAYA 3CZ1A 1DJIA 1ZMZA 1VRKA 3FE8A 2OS8B 2QEOA 4N5XA 3JVTC 4IL1A 3CR4X 1WDCB 3EK4A 5KU1A 3PN7B 1K9PA 1TWOA 2E30A 1SL9A 3D0YA 4E68A 4Q04A 1S36A 1QX2A 2Q91A 1QLSA 1AUIB 1U5IB 1Y0VH 3BUWB 4OCIA 5AANA 2KI6C 3E3RA 1M46A 1CNPA 3DF0A 1W7IB 2JXLA 4MN0A 2L4HA 1AJ4A 4QJ3B 1TCOB 3OBVA 3NSIA 3FIAA 2P70A 3Q8IA 1MHOA 2LVIA 2PRUA 4PDZA 1CLMA 4ORCB 1BT6A 1R6PA 2NCOA 4OZDA 3SG7A 4DUQA 1Z4HA 1QJTA 1YRUB 1ODBA 1UHIA 1SBJA 1K90D 3CABA 5IBWA 1S1EA 1PALA 4YGCB 2LMVA 5I94A 3B88A 4AQJA 1AP4A 1BG1A 1PSRA 2O60A 1A29A 3ZWHA 2KPHA 2K61A 1NCZA 1XFVO 2ZRSA 3AAKA 4HRHA 2KFHA 2O5GA 2R2IA 3FWBA 3M0WA 5JJGA 5I2QA 3BOWB 2CBLA 3BXKA 2E6WA 4N1FA 3NSOA 1OW4A 1SSEB 2KI4C 1RECA 2QDIA 3EKHA 1G4YR 3AAJA 1DJXA 3BJHA 1F4QA 4C0LA 1LINA 1OSAA 3TUYC 1KQMB 1YVLA 2F2OA 3DVEA 4YGDB 1LA3A 1L2OB 2KOTA 3AKBA 1TTXA 4INWA 3VRNA 4CIDA 1TNXA 2M1UA 3PM2A 1F55A 4MZJA 1EJ3A 2JQ6A 2WCEA 2BNXA 2KGRA 2JTZA 1N2DA 2KAVA 3O2PA 1CMGA 2MA2A 2NZ0A 1ORGA 1PVBA 3I5IC 5DKRA 1FPWA 2LM5A 1IQ5A 1LKJA 1OOHA 4GGFA 5TNCA 3N7HA 1DJYA 1MR8A 2OPOA 1PK0D 2BBNA 2AAOA 2BKIB 4L9MA 3BFBA 2K7CA 1K8UA 1KCYA 1K94A 1F4OA 3LLEA 2ZN8A 2B1UA 3BUMB 4MRYA 1DJWA 1EL4A 5ER5A 2ZNDA 1S5GZ 3BYAA 2WNDA 3B86A 1QX5B 2L51A 3KHEA 1SL7A 1TOPA 1CMFA 4ETOA 1DT7B 3CR2A 3L4AA 3D73A 1ZFSA 1V1FA 1NYAA 1PSBA 1KQVA 1XA5A 1S5GY 1J55A 3BFAA 1IKUA 4FQTA 4NDCA 2K7BA 3L4LA 1LA0A 1NCXA 2ZFDA 1F70A 3VROA 4F0ZB 2PALA 1DJZA 3NXAA 1WRKA 1OOJA 1XFZO 3WHTB 3JTDC 4CPVA 4XJKA 4WQ3A 4NQGA 3TDIA 1JF0A 1RJVA 4R1EA 1XFYO 1CDLA 2HF5A 2L5YA 4ORAB 3PFVA 1A4PA 1OE9B 1XFXO 2V53A 5I8NA 1XO5A 1B4CA 1KK8B 1B8CA 2KFFA 3HX4A 2K2FA 5HLOA 1MXEA 1SMGA 1SK6D 1SR6C 3OHMB 1J7QA 3OP0A 4N1GA 1K9UA 1OOFA 1YX8A 3EG5B 3TS5B 2JNXA 2PYQA 1F8HA 1YRTB 2G2BA 1AK8A 2ERBA 1UWOA 2PASA 2KBIA 2K8MB 1FF1A 2DOQA 3WXAA 1XK4A 3FWCA 1ZACA 3KEVA 2F2PA 5HL1A 1BJFA 1DF0A 1KFXL 1K96A 2EC6B 2KFGA 3VRPA 2KDHA 2LCPA 4PE1A 3SG2A 1S3PA 2OTGC 2YGUA 1SRAA 1KFXS 4YI8A 2D8NA 2MLEC 1YTZC 4A4BA 2EHBA 4GGFC 3BUXB 3DYEA 2NXQA 3D76A 3R1PA 1M39A 3LK1A 2KQYA 3CWGA 3NSKA 4OKHA 4GPLB 2F3YA 1QASA 3DVJA 1WRLA 2H61A 1A03A 2FCDA 3QRXA 1SNLA 2K60A 1KWOC 1JC2A 2MRDA 1NX0A 1U5IA 2P71A 2KHNA 3SIBA 1GQMA 1YURA 2WC5A 3SS4A 1EG4A 1KSOA 1UHHA 1YR5A 4PHNA 4WQ2A 1A75A 4BY4A 4MRXA 1QXPA 3BUOB 1S6JA 5ER4X 1A75B 3PLFB 4OVNF 1F71A 3R72A 1IG5A 2L0PA 1TNWA 2Q4UA 1DJGA 3I5GC 5HKZA 1TIZA 1KFUL 1A2XA 4INXA 2QPTA 1YUTA 2I2RE 2CT9A 2FCEA 1KFUS 1JUOA 1OZOA 3OGNA 3WNXB 4GNKB 1K95A 2GGMA 4ICBA 4OV2A 1D1OA 2NCPA 3GOFA 1EXRA 3LL8B 3VGOA 1MWNA 2L4IA 1BR4B 1NX2A 3S0DA 5F6TA 1OQPA 1MQ1A 1HQVA 2FOTA 2KLEA 2MHHA 1CTRA 3CR5X 3RZSA 1SCMC 1F54A 2CNPA 4IJ7A 4PE4A 1Y6WA 2BBMA 2BL0C 2LUXA 1P28A 5GQQC 1N0YA 3BOWA 2BE4A 4AOMA 3S0EA 1H8BA 4PHJA 5K89A 5HKWA 1DELA 3K1EA 3D74A 3UNWA 2SCPA 2F3ZA 3IF7A 1E8AA 1W7JB 2ZNEA 3EK7A 4I5KA 4A4CA 1Q80A 1T14A 1QVIZ 2LAPA 2LC5A 1CM1A 1R2UA 2MJWB 5J3XA 2LP2A 1SY9A 3UO9A 1XK4C 3SS3A 1B8RA 2QACA 1QVIY 3SG6A 2WC8A 2JC2A 3S0BA 1WLMA 2BECA 4PT1A 3PSRA 2GTEA 2LVJA 2WCBA 1LVCD 2ZKMX 3NGVA 2M0RA 1XYDA 1MXLC 1UHNA 5KTYA 1ZUZA 2LMUA 3CYZA 1JF2A 2OS8C 3BFHA
chains in the Genus database with same CATH topology
2WCHA 1C3YA 3B87A 4F7FA 3QMEA 3S0AA 3CZ1A 3D77A 3DY9A 3FE8A 2QEOA 1OOFA 1TWOA 2ERBA 3R1VA 3CDNA 5DICA 2WCJA 2P70A 1TUJA 3Q8IA 2WCMA 1LS8A 2WC6A 3DZTA 4OZDA 3DYEA 3D76A 3R1PA 3CABA 1QWVA 3B88A 3NHTA 3CZ0A 3FE9A 2KPHA 3B6XA 2P71A 2WC5A 1OW4A 2QDIA 1GM0A 3R72A 3VB1A 4INXA 3S0GA 3BJHA 3L47A 3OGNA 4INWA 3S0DA 5EL2A 3D78A 3FE6A 3NHIA 3RZSA 1ORGA 1P28A 1OOIX 1OOHA 3S0EA 3N7HA 3V2LA 3PJIA 3K1EA 3D74A 2JPOA 3BFBA 1XFRA 1T14A 2PQLA 4JD9A 3DXLA 3R1OA 2QEHA 3B86A 1DQEA 2WCKA 2WCLA 2FJYA 3S0FA 3L4AA 3D73A 3D75A 2QEVA 3S0BA 3BFAA 2H8VA 4FQTA 4PT1A 2GTEA 2L2CA 3CZ2A 3L4LA 2QEBA 3B7AA 1C3ZA 3NGVA 3CYZA 1OOGA 3BFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WCH A;  1C3Y A;  3B87 A;  4F7F A;  3QME A;  3S0A A;  3CZ1 A;  3D77 A;  3DY9 A;  3FE8 A;  2QEO A;  1OOF A;  1TWO A;  2ERB A;  3R1V A;  3CDN A;  5DIC A;  2WCJ A;  2P70 A;  1TUJ A;  3Q8I A;  2WCM A;  1LS8 A;  2WC6 A;  3DZT A;  4OZD A;  3DYE A;  3D76 A;  3R1P A;  3CAB A;  1QWV A;  3B88 A;  3NHT A;  3CZ0 A;  3FE9 A;  2KPH A;  3B6X A;  2P71 A;  2WC5 A;  1OW4 A;  2QDI A;  1GM0 A;  3R72 A;  3VB1 A;  4INX A;  3S0G A;  3BJH A;  3L47 A;  3OGN A;  4INW A;  3S0D A;  5EL2 A;  3D78 A;  3FE6 A;  3NHI A;  3RZS A;  1ORG A;  1P28 A;  1OOI X;  1OOH A;  3S0E A;  3N7H A;  3V2L A;  3PJI A;  3K1E A;  3D74 A;  2JPO A;  3BFB A;  1XFR A;  1T14 A;  2PQL A;  4JD9 A;  3DXL A;  3R1O A;  2QEH A;  3B86 A;  1DQE A;  2WCK A;  2WCL A;  2FJY A;  3S0F A;  3L4A A;  3D73 A;  3D75 A;  2QEV A;  3S0B A;  3BFA A;  2H8V A;  4FQT A;  4PT1 A;  2GTE A;  2L2C A;  3CZ2 A;  3L4L A;  2QEB A;  3B7A A;  1C3Z A;  3NGV A;  3CYZ A;  1OOG A;  3BFH A; 
#chains in the Genus database with same CATH topology
 2LLU A;  2WCH A;  1YX7 A;  1M63 B;  1IJ6 A;  4C0J A;  2L98 A;  2JOJ A;  3PN7 C;  4HRG A;  4M2O A;  1SPY A;  2KLD A;  3KF9 A;  5FI7 A;  2VRG A;  4MBE A;  5D69 A;  4F7F A;  5BPJ A;  1M45 A;  1CDM A;  2NLN A;  1B47 A;  3I5F C;  4M2P A;  1LXF C;  3F45 A;  1DVI A;  1B7T Z;  2LHL A;  3DVK A;  3OX6 A;  1SCV A;  3D77 A;  3I5H B;  1V1G A;  1SYM A;  2JPT A;  2M97 A;  5I2L A;  1JBA A;  1UUR A;  1B7T Y;  1J7O A;  1B9A A;  1QX7 A;  1WY9 A;  3O4Y A;  2A4J A;  1DGU A;  1IQ3 A;  2AMI A;  1N65 A;  2M8U A;  2WCF A;  1TRF A;  3TZ1 A;  4HRE E;  1IH0 A;  2WCJ A;  3JVT B;  3EVU A;  1TUJ A;  1LS8 A;  1KWO B;  3EVV A;  2WC6 A;  3DZT A;  4JQ0 D;  1SW8 A;  2CXJ A;  5CSF A;  2KSP A;  1J1E A;  3WHU B;  1ZOT B;  1XVJ A;  1TNP A;  3BQ3 A;  3PAL A;  2JT3 A;  4GFT A;  1AVS A;  1QWV A;  3NHT A;  4GUK A;  2JU0 A;  1FBV A;  5KSZ A;  2L50 A;  1OZS A;  1TCF A;  1Y1A A;  3B6X A;  2AUC A;  3VRQ A;  1FI6 A;  1KSM A;  1KQM C;  1B1G A;  4GGN A;  1L2O C;  3TDU A;  1FW4 A;  1L7Z A;  3K21 A;  3ZNI A;  4CFQ A;  1OMD A;  2K0J A;  2PVB A;  4QJ5 B;  2JWW A;  1IWQ A;  1YVH A;  4YBH B;  2LMT A;  3S0G A;  1SCM B;  3O78 A;  3CZT X;  2BL0 B;  5DKN A;  1UUS A;  1Z2C B;  1G33 A;  1J7P A;  4P5O E;  2BE6 A;  1EH2 A;  1OMV A;  1X02 A;  1FI5 A;  1NIW A;  2M29 A;  5HYD A;  2KI4 B;  1S6C A;  4I5L B;  3DVM A;  3VRR A;  1RFJ A;  3D78 A;  4MZL A;  1GGZ A;  3LCP C;  3NHI A;  3D10 A;  1OMR A;  1TN4 A;  3SG5 A;  1OOI X;  2HPS A;  2KGB C;  2I94 A;  3V2L A;  3ICB A;  2JUL A;  3TUY B;  1BF5 A;  5AFP A;  1BOD A;  2K7O A;  2JPO A;  2MBX A;  1AHR A;  2JTT A;  4M2Q A;  1XFR A;  4WRI A;  2BKH B;  3DD4 A;  5I2O A;  2ZN9 A;  4I5N B;  5AER A;  2GGZ A;  3O6B A;  4ZCU A;  5B8I B;  3GK1 A;  4DIR A;  3DXL A;  3R1O A;  1BLQ A;  1GJY A;  2QEH A;  3I5I B;  1JWD A;  1DQE A;  2WCK A;  4NDD A;  1IIO A;  3S0F A;  4TNC A;  1NCY A;  3CS1 A;  1SKT A;  2I18 A;  2KYF A;  2LNK A;  2QEV A;  2LVK A;  1PRW A;  2KI6 D;  2I7A A;  3D75 A;  2H8V A;  2HQW A;  1TUZ A;  4USL A;  1BU3 A;  2L2C A;  3CLN A;  3CZ2 A;  1CM4 A;  3D0Y B;  3I5F B;  4ORB B;  3B7A A;  1KK8 C;  3A8R A;  5CSN A;  1NP8 A;  1JFK A;  4PHM A;  3SIA A;  2G9B A;  1OOG A;  3DF0 B;  5DIC A;  2Y5I A;  2KQ6 A;  4YGB B;  4CFR A;  2Y1M A;  4NDB A;  3TS5 C;  1C3Y A;  4DCK A;  1JFJ A;  3AKA A;  4PE0 A;  5JOL A;  2KYC A;  4YI9 A;  1C07 A;  4QJ4 B;  4MSP A;  5AEQ A;  3PM8 A;  3S0A A;  4OR9 B;  1NUB A;  3SG3 A;  1RTP 1;  3IVT A;  2JRF A;  3EKJ A;  3KO0 A;  3H4S E;  2LP3 A;  2FJU B;  3DY9 A;  2EC6 C;  1UHK A;  1QV0 A;  4MEW A;  4GAO A;  1QAT A;  3OB2 B;  2SAS A;  3JTD B;  3LK0 A;  2LUC A;  1BMO A;  1EG3 A;  4P2Y B;  3MSE B;  1NWD A;  1UP5 A;  3C1V A;  1UHJ A;  3IQQ A;  4YGE B;  1DTL A;  1IRJ A;  1Y1U A;  1S26 D;  1RRO A;  3R1V A;  1QIW A;  5D7F A;  2L2E A;  4MZK A;  1C7W A;  2L5X B;  2M49 B;  1J1D A;  3CDN A;  1RK9 A;  4D1E A;  1CLB A;  1SR6 B;  2BCA A;  2M7L A;  1WDC C;  4ZCV A;  2H61 C;  3RLZ A;  1NSH A;  2ISD A;  2JT8 A;  2WCM A;  3PAT A;  2LLT A;  4U8D A;  2KAX A;  1DEK A;  2LLS A;  3HCM A;  1CFC A;  2BAP A;  2MLF C;  1DGV A;  4C0K A;  3BUN B;  2ZRT A;  2KNE A;  4DRW A;  3CZ0 A;  5CSJ A;  3FE9 A;  3EK8 A;  3OB1 B;  2MAZ A;  1HT9 A;  2OTG B;  4PAL A;  1MF8 B;  2HQ8 A;  4I5J A;  2GV5 A;  2Y4Q A;  1NX3 A;  4KYN A;  2M1K B;  1PUL A;  3GK2 A;  3SG4 A;  1QLK A;  1BOC A;  1CKK A;  3CGA A;  1GM0 A;  1B8L A;  3VB1 A;  2RGI A;  1CFD A;  4AQI A;  1QV1 A;  3GK4 X;  4FQO A;  5DKQ A;  3RM1 A;  2CTN A;  1J7R A;  1XFU O;  1QTX A;  1JSA A;  4GBA A;  1WLZ A;  3L47 A;  1SL8 A;  5CSI A;  5FI2 A;  5HLV A;  4PHK A;  3FS7 A;  1CLL A;  3SJS A;  4PE7 A;  1ALV A;  2WOR A;  2WOS A;  3IQO A;  2LE9 B;  4JWQ A;  2TN4 A;  2EGD A;  4YRU A;  3SS5 A;  2BCX A;  2IS9 A;  5EL2 A;  1YUU A;  2KBM A;  3FE6 A;  1K9K A;  2F8P A;  4FTG A;  1K93 D;  3I5G B;  1MUX A;  1G8I A;  2PMY A;  2COL B;  2JXC A;  3PJI A;  2CCM A;  3OX5 A;  5PAL A;  1KK7 Z;  1WRZ A;  2P6B B;  4XJK B;  3EVR A;  4BY5 A;  4JPZ B;  1ALW A;  1W9Z A;  5FI6 A;  1CFP A;  2M7N A;  3KPX A;  2PQL A;  2F33 A;  1RWY A;  4JD9 A;  1KK7 Y;  1BR1 B;  1TNQ A;  1CFF A;  2JZI A;  1DJH A;  1IJ5 A;  2LHI A;  2WCL A;  2FJY A;  1DC1 A;  2K7D A;  1S6I A;  2M9G A;  3TDZ A;  1CDP A;  1CB1 A;  4HSZ A;  1IGV A;  1PVA A;  1QIV A;  1QS7 A;  2H2K A;  4PCW A;  1C7V A;  1CDN A;  2PSR A;  1NX1 A;  2M3W A;  2QEB A;  1GGW A;  4UPG A;  1C3Z A;  1Y1X A;  5CPV A;  1M31 A;  5AXI A;  3I5H C;  3NSL A;  1DMO A;  4XYN A;  2JT0 A;  5HKY A;  2LV7 A;  4DS7 A;  1K2H A;  4MVF A;  5G08 A;  2K2A A;  1DF0 B;  3CTN A;  2LAN A;  3B87 A;  5D3O A;  2JNF A;  2HET A;  2LVV A;  1YUS A;  4JKT A;  4MLW A;  1NPQ A;  2BCB A;  2Y1N A;  3QME A;  1XFW O;  3O4X A;  4YGA A;  4CLN A;  1H4B A;  1AJ5 A;  3A4U B;  5FYX A;  2KAY A;  3CZ1 A;  1DJI A;  1ZMZ A;  1VRK A;  3FE8 A;  2OS8 B;  2QEO A;  4N5X A;  3JVT C;  4IL1 A;  3CR4 X;  1WDC B;  3EK4 A;  5KU1 A;  3PN7 B;  1K9P A;  1TWO A;  2E30 A;  1SL9 A;  3D0Y A;  4E68 A;  4Q04 A;  1S36 A;  1QX2 A;  2Q91 A;  1QLS A;  1AUI B;  1U5I B;  1Y0V H;  3BUW B;  4OCI A;  5AAN A;  2KI6 C;  3E3R A;  1M46 A;  1CNP A;  3DF0 A;  1W7I B;  2JXL A;  4MN0 A;  2L4H A;  1AJ4 A;  4QJ3 B;  1TCO B;  3OBV A;  3NSI A;  3FIA A;  2P70 A;  3Q8I A;  1MHO A;  2LVI A;  2PRU A;  4PDZ A;  1CLM A;  4ORC B;  1BT6 A;  1R6P A;  2NCO A;  4OZD A;  3SG7 A;  4DUQ A;  1Z4H A;  1QJT A;  1YRU B;  1ODB A;  1UHI A;  1SBJ A;  1K90 D;  3CAB A;  5IBW A;  1S1E A;  1PAL A;  4YGC B;  2LMV A;  5I94 A;  3B88 A;  4AQJ A;  1AP4 A;  1BG1 A;  1PSR A;  2O60 A;  1A29 A;  3ZWH A;  2KPH A;  2K61 A;  1NCZ A;  1XFV O;  2ZRS A;  3AAK A;  4HRH A;  2KFH A;  2O5G A;  2R2I A;  3FWB A;  3M0W A;  5JJG A;  5I2Q A;  3BOW B;  2CBL A;  3BXK A;  2E6W A;  4N1F A;  3NSO A;  1OW4 A;  1SSE B;  2KI4 C;  1REC A;  2QDI A;  3EKH A;  1G4Y R;  3AAJ A;  1DJX A;  3BJH A;  1F4Q A;  4C0L A;  1LIN A;  1OSA A;  3TUY C;  1KQM B;  1YVL A;  2F2O A;  3DVE A;  4YGD B;  1LA3 A;  1L2O B;  2KOT A;  3AKB A;  1TTX A;  4INW A;  3VRN A;  4CID A;  1TNX A;  2M1U A;  3PM2 A;  1F55 A;  4MZJ A;  1EJ3 A;  2JQ6 A;  2WCE A;  2BNX A;  2KGR A;  2JTZ A;  1N2D A;  2KAV A;  3O2P A;  1CMG A;  2MA2 A;  2NZ0 A;  1ORG A;  1PVB A;  3I5I C;  5DKR A;  1FPW A;  2LM5 A;  1IQ5 A;  1LKJ A;  1OOH A;  4GGF A;  5TNC A;  3N7H A;  1DJY A;  1MR8 A;  2OPO A;  1PK0 D;  2BBN A;  2AAO A;  2BKI B;  4L9M A;  3BFB A;  2K7C A;  1K8U A;  1KCY A;  1K94 A;  1F4O A;  3LLE A;  2ZN8 A;  2B1U A;  3BUM B;  4MRY A;  1DJW A;  1EL4 A;  5ER5 A;  2ZND A;  1S5G Z;  3BYA A;  2WND A;  3B86 A;  1QX5 B;  2L51 A;  3KHE A;  1SL7 A;  1TOP A;  1CMF A;  4ETO A;  1DT7 B;  3CR2 A;  3L4A A;  3D73 A;  1ZFS A;  1V1F A;  1NYA A;  1PSB A;  1KQV A;  1XA5 A;  1S5G Y;  1J55 A;  3BFA A;  1IKU A;  4FQT A;  4NDC A;  2K7B A;  3L4L A;  1LA0 A;  1NCX A;  2ZFD A;  1F70 A;  3VRO A;  4F0Z B;  2PAL A;  1DJZ A;  3NXA A;  1WRK A;  1OOJ A;  1XFZ O;  3WHT B;  3JTD C;  4CPV A;  4XJK A;  4WQ3 A;  4NQG A;  3TDI A;  1JF0 A;  1RJV A;  4R1E A;  1XFY O;  1CDL A;  2HF5 A;  2L5Y A;  4ORA B;  3PFV A;  1A4P A;  1OE9 B;  1XFX O;  2V53 A;  5I8N A;  1XO5 A;  1B4C A;  1KK8 B;  1B8C A;  2KFF A;  3HX4 A;  2K2F A;  5HLO A;  1MXE A;  1SMG A;  1SK6 D;  1SR6 C;  3OHM B;  1J7Q A;  3OP0 A;  4N1G A;  1K9U A;  1OOF A;  1YX8 A;  3EG5 B;  3TS5 B;  2JNX A;  2PYQ A;  1F8H A;  1YRT B;  2G2B A;  1AK8 A;  2ERB A;  1UWO A;  2PAS A;  2KBI A;  2K8M B;  1FF1 A;  2DOQ A;  3WXA A;  1XK4 A;  3FWC A;  1ZAC A;  3KEV A;  2F2P A;  5HL1 A;  1BJF A;  1DF0 A;  1KFX L;  1K96 A;  2EC6 B;  2KFG A;  3VRP A;  2KDH A;  2LCP A;  4PE1 A;  3SG2 A;  1S3P A;  2OTG C;  2YGU A;  1SRA A;  1KFX S;  4YI8 A;  2D8N A;  2MLE C;  1YTZ C;  4A4B A;  2EHB A;  4GGF C;  3BUX B;  3DYE A;  2NXQ A;  3D76 A;  3R1P A;  1M39 A;  3LK1 A;  2KQY A;  3CWG A;  3NSK A;  4OKH A;  4GPL B;  2F3Y A;  1QAS A;  3DVJ A;  1WRL A;  2H61 A;  1A03 A;  2FCD A;  3QRX A;  1SNL A;  2K60 A;  1KWO C;  1JC2 A;  2MRD A;  1NX0 A;  1U5I A;  2P71 A;  2KHN A;  3SIB A;  1GQM A;  1YUR A;  2WC5 A;  3SS4 A;  1EG4 A;  1KSO A;  1UHH A;  1YR5 A;  4PHN A;  4WQ2 A;  1A75 A;  4BY4 A;  4MRX A;  1QXP A;  3BUO B;  1S6J A;  5ER4 X;  1A75 B;  3PLF B;  4OVN F;  1F71 A;  3R72 A;  1IG5 A;  2L0P A;  1TNW A;  2Q4U A;  1DJG A;  3I5G C;  5HKZ A;  1TIZ A;  1KFU L;  1A2X A;  4INX A;  2QPT A;  1YUT A;  2I2R E;  2CT9 A;  2FCE A;  1KFU S;  1JUO A;  1OZO A;  3OGN A;  3WNX B;  4GNK B;  1K95 A;  2GGM A;  4ICB A;  4OV2 A;  1D1O A;  2NCP A;  3GOF A;  1EXR A;  3LL8 B;  3VGO A;  1MWN A;  2L4I A;  1BR4 B;  1NX2 A;  3S0D A;  5F6T A;  1OQP A;  1MQ1 A;  1HQV A;  2FOT A;  2KLE A;  2MHH A;  1CTR A;  3CR5 X;  3RZS A;  1SCM C;  1F54 A;  2CNP A;  4IJ7 A;  4PE4 A;  1Y6W A;  2BBM A;  2BL0 C;  2LUX A;  1P28 A;  5GQQ C;  1N0Y A;  3BOW A;  2BE4 A;  4AOM A;  3S0E A;  1H8B A;  4PHJ A;  5K89 A;  5HKW A;  1DEL A;  3K1E A;  3D74 A;  3UNW A;  2SCP A;  2F3Z A;  3IF7 A;  1E8A A;  1W7J B;  2ZNE A;  3EK7 A;  4I5K A;  4A4C A;  1Q80 A;  1T14 A;  1QVI Z;  2LAP A;  2LC5 A;  1CM1 A;  1R2U A;  2MJW B;  5J3X A;  2LP2 A;  1SY9 A;  3UO9 A;  1XK4 C;  3SS3 A;  1B8R A;  2QAC A;  1QVI Y;  3SG6 A;  2WC8 A;  2JC2 A;  3S0B A;  1WLM A;  2BEC A;  4PT1 A;  3PSR A;  2GTE A;  2LVJ A;  2WCB A;  1LVC D;  2ZKM X;  3NGV A;  2M0R A;  1XYD A;  1MXL C;  1UHN A;  5KTY A;  1ZUZ A;  2LMU A;  3CYZ A;  1JF2 A;  2OS8 C;  3BFH A; 
#chains in the Genus database with same CATH homology
 2WCH A;  1C3Y A;  3B87 A;  4F7F A;  3QME A;  3S0A A;  3CZ1 A;  3D77 A;  3DY9 A;  3FE8 A;  2QEO A;  1OOF A;  1TWO A;  2ERB A;  3R1V A;  3CDN A;  5DIC A;  2WCJ A;  2P70 A;  1TUJ A;  3Q8I A;  2WCM A;  1LS8 A;  2WC6 A;  3DZT A;  4OZD A;  3DYE A;  3D76 A;  3R1P A;  3CAB A;  1QWV A;  3B88 A;  3NHT A;  3CZ0 A;  3FE9 A;  2KPH A;  3B6X A;  2P71 A;  2WC5 A;  1OW4 A;  2QDI A;  1GM0 A;  3R72 A;  3VB1 A;  4INX A;  3S0G A;  3BJH A;  3L47 A;  3OGN A;  4INW A;  3S0D A;  5EL2 A;  3D78 A;  3FE6 A;  3NHI A;  3RZS A;  1ORG A;  1P28 A;  1OOI X;  1OOH A;  3S0E A;  3N7H A;  3V2L A;  3PJI A;  3K1E A;  3D74 A;  2JPO A;  3BFB A;  1XFR A;  1T14 A;  2PQL A;  4JD9 A;  3DXL A;  3R1O A;  2QEH A;  3B86 A;  1DQE A;  2WCK A;  2WCL A;  2FJY A;  3S0F A;  3L4A A;  3D73 A;  3D75 A;  2QEV A;  3S0B A;  3BFA A;  2H8V A;  4FQT A;  4PT1 A;  2GTE A;  2L2C A;  3CZ2 A;  3L4L A;  2QEB A;  3B7A A;  1C3Z A;  3NGV A;  3CYZ A;  1OOG A;  3BFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...