2JPOA

Nmr structure of antheraea polyphemus pheromone-binding protein 1 at ph 4.5
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
142
structure length
142
Chain Sequence
b'SPEIMKNLSNNFGKAMDQCKDELSLPDSVVADLYNFWKDDYVMTDRLAGCAINCLATKLDVVDPDGNLHHGNAKDFAMKHGADETMAQQLVDIIHGCEKSAPPNDDKCMKTIDVAMCFKKEIHKLNWVPNMDLVIGEVLAEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone-binding protein
publication title Structural Basis of Ligand Binding and Release in Insect Pheromone-Binding Proteins: NMR Structure of Antheraea polyphemus PBP1 at pH 4.5
pubmed doi rcsb
source organism Antheraea polyphemus
molecule tags Transport protein
total genus 43
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2007-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2jpoA00
2QEBA 2QEHA 5EL2A 3L4LA 3CZ0A 2WCJA 3BFAA 3N7HA 3OGNA 3S0BA 3CZ1A 1OOGA 2WCHA 3V2LA 4JD9A 2GTEA 3NHIA 3CYZA 3FE8A 3FE9A 4FQTA 3S0DA 3B88A 2WC6A 2QEVA 2ERBA 3L4AA 3D73A 3CABA 3PJIA 1OW4A 3FE6A 2QEOA 3Q8IA 2P70A 3R1OA 3D75A 1P28A 3DZTA 3D74A 3S0EA 3R72A 1C3ZA 3NHTA 3S0GA 3BJHA 4OZDA 1XFRA 1T14A 3CDNA 3D78A 3B6XA 3R1PA 3B87A 4F7FA 1TWOA 3RZSA 2KPHA 3CZ2A 3B86A 3R1VA 3D77A 2JPOA 4INXA 2QDIA 3L47A 2WC5A 3K1EA 1TUJA 2L2CA 3DYEA 3QMEA 1DQEA 2P71A 1GM0A 3D76A 1LS8A 2WCMA 2WCKA 3BFHA 1QWVA 3NGVA 4INWA 3S0FA 2FJYA 1OOFA 1OOHA 2PQLA 4PT1A 1ORGA 3VB1A 1C3YA 2WCLA 3DY9A 3BFBA 3B7AA 3S0AA 3DXLA 1OOIX 2H8VA 5DICA
chains in the Genus database with same CATH superfamily
1SCMB 4WRIA 1DGVA 4I5JA 5EL2A 1PSBA 1YR5A 1F54A 3C1VA 1KCYA 2BCAA 4HSZA 2BKHB 2L5XB 5I2QA 1R2UA 1IH0A 3JVTB 1XFZO 2KOTA 2L4IA 1W7JB 4N1GA 2WCJA 3BOWB 1DVIA 2LHIA 3LK1A 1IG5A 2LMVA 2PSRA 3OB2B 1DJGA 2K2FA 2WORA 3I5HB 2G9BA 3HX4A 1J7OA 1IIOA 1YX7A 2ZRSA 4YGCB 1J1EA 5B8IB 3WNXB 3NHIA 1MHOA 2K8MB 1XFXO 1S6CA 1SBJA 3FE9A 2LM5A 2FCEA 1SR6C 3D10A 4JKTA 3VGOA 3B88A 1Z2CB 2BNXA 2KAXA 2TN4A 1SL8A 2ERBA 2RGIA 3L4AA 1C7WA 2LANA 2P6BB 1CB1A 4PE0A 2MA2A 5CSFA 1K93D 2BBMA 1QV1A 2I18A 3CGAA 1RTP1 1F70A 2NCPA 5ER4X 3AAKA 3FE6A 4NDDA 1K90D 1S1EA 2HF5A 1RWYA 1J1DA 1V1FA 2JTZA 3UO9A 4PDZA 3DVEA 3EG5B 3S0EA 4XJKB 1KK8B 2OTGC 3OB1B 2WCFA 2MAZA 3EK4A 3O6BA 1IJ5A 1JF0A 1S5GZ 2ZNEA 3R72A 4JPZB 1XYDA 4N5XA 3EK8A 3S0GA 4C0JA 2G2BA 1XFRA 2NLNA 1XK4C 5JOLA 1ZFSA 1M63B 2PASA 3PN7B 4F0ZB 1NX0A 1AJ5A 3SG4A 3BYAA 3KEVA 1E8AA 1F4QA 2LP2A 2CXJA 2M0RA 2KAVA 5FYXA 4GGFC 1KFXL 1HT9A 3LK0A 5KU1A 1PK0D 1J55A 1JUOA 1AP4A 2JT0A 3EKJA 1QATA 2BCXA 2DOQA 2K60A 2K61A 3DF0A 5CSJA 1B1GA 3IQOA 1K9KA 1OOJA 1RROA 3ICBA 3R1VA 2KFGA 2PMYA 1XA5A 3PALA 1DJHA 3D77A 3IF7A 2ZRTA 1F8HA 1MWNA 4INXA 2LLSA 1KQMC 3VROA 1ZUZA 4WQ2A 5FI6A 5I8NA 2KBMA 3I5FB 1TUJA 4AQJA 1RK9A 1DJZA 1Z4HA 1SCMC 2WCMA 4OKHA 4M2OA 2FCDA 5HLOA 1EG3A 1IGVA 3SIAA 1CFCA 3JVTC 3SG2A 1NUBA 1NP8A 2OS8B 2KI6D 3K21A 4XYNA 1C7VA 1SKTA 2FJYA 3SS5A 1A2XA 1UHHA 3PLFB 1ZACA 3CR2A 3FIAA 2I2RE 2CTNA 2LMUA 3I5HC 4R1EA 1LVCD 1OOHA 2KLEA 2WNDA 4ORBB 2I94A 1K9UA 3GK4X 2WCLA 1YRTB 4P2YB 2AUCA 2CCMA 1DT7B 1YUUA 2CBLA 5J3XA 1N65A 2BBNA 3CR5X 3D0YA 2JWWA 3DD4A 1QV0A 1XFWO 2GGMA 4MRXA 1H4BA 4MSPA 4E68A 1G4YR 1XO5A 1QJTA 2H8VA 3PATA 1L2OC 2HETA 2F2PA 2KGBC 1UHJA 2LP3A 4GFTA 3TZ1A 5D7FA 1NX1A 1KQVA 1AK8A 4CLNA 2BAPA 2MHHA 3I5GB 1RECA 4MZJA 4I5KA 1OSAA 3GK1A 1NCZA 4IJ7A 1QVIY 3WHTB 3MSEB 3S0BA 1IKUA 1OMDA 1PVAA 3BUOB 3WHUB 1A03A 1KK8C 2JQ6A 1ZOTB 5PALA 1DF0A 1R6PA 1QVIZ 1WRKA 1YUTA 1QIWA 1DEKA 1OE9B 2ZKMX 4JD9A 4P5OE 2KBIA 1EH2A 1FF1A 2JXCA 2ZFDA 2SCPA 3TUYB 1FI6A 3SIBA 3PN7C 3FE8A 3RM1A 4FQTA 3S0DA 5HKZA 1B7TY 2MRDA 2F33A 2WC6A 2KNEA 1S26D 1WDCC 2JU0A 5D69A 1MUXA 1SY9A 4HREE 1F55A 3FS7A 4GNKB 4PHMA 1B7TZ 5HL1A 1J7PA 1DMOA 2BL0B 2MLFC 1FI5A 2O60A 1WY9A 3BUWB 3AKBA 1UWOA 1SYMA 2QEOA 3EKHA 4AQIA 3OP0A 5AANA 1M46A 1YVHA 2JRFA 4YGDB 2IS9A 3D75A 5AEQA 1BF5A 2JTTA 3D74A 5TNCA 4NDBA 3I5FC 4MBEA 3NHTA 1NPQA 1H8BA 4A4BA 1DJXA 2COLB 1JWDA 1T14A 1UHKA 2LMTA 1TIZA 1N0YA 2HQ8A 2M97A 1TCFA 1V1GA 3PM2A 4PHJA 5I2OA 3KPXA 2M3WA 3CTNA 2OS8C 1CDLA 2LVVA 3B6XA 3R1PA 1QTXA 1BOCA 3DF0B 4IL1A 2F8PA 3AKAA 1XK4A 2QPTA 1EG4A 2L98A 1KK7Y 4GBAA 2PVBA 1YRUB 3RZSA 3CZ2A 2KSPA 2L51A 3SG3A 3VRPA 1PRWA 1X02A 3B86A 3RLZA 5IBWA 1ALWA 1YX8A 1JFJA 1UURA 4PE1A 1NCYA 2BE4A 1CMGA 2LVKA 2CNPA 3IQQA 2JPOA 4CFRA 2QDIA 2K7OA 1DTLA 1M45A 1JC2A 2WC5A 1DGUA 1KFUS 5CSIA 3I5IB 3QMEA 1DQEA 1Y1UA 2JXLA 3KHEA 3D76A 1B8LA 4GPLB 1GGZA 1EL4A 2LV7A 3O78A 1SK6D 2KHNA 3I5GC 1N2DA 1CDPA 1QASA 1QWVA 1QLKA 3NSIA 2SASA 4FTGA 3KO0A 4ZCUA 3SG7A 1MR8A 3ZNIA 2K7BA 1OOFA 4MLWA 3LLEA 1SSEB 2LHLA 3NSLA 4BY4A 1S6IA 2LC5A 2ZNDA 1Y0VH 4ICBA 2D8NA 1TOPA 4PT1A 1JF2A 2FOTA 1SW8A 1W7IB 2EC6C 3D0YB 3VRNA 2NXQA 1G33A 3TUYC 3B7AA 3SJSA 1SRAA 5DKQA 1NIWA 3S0AA 2BE6A 2M1UA 2B1UA 5G08A 3E3RA 1KWOB 3DXLA 4CPVA 1DELA 4KYNA 1OOIX 1UHIA 3FWBA 2K7DA 2M49B 3TDUA 4PHNA 5DICA 4YGBB 1PULA 2KQYA 2QEBA 4DIRA 1UP5A 1KSOA 2GGZA 2JOJA 2LVIA 3CZ0A 3L4LA 1CFDA 2BL0C 1CDNA 3KF9A 3M0WA 2WCBA 5DKRA 4QJ4B 1DF0B 2BCBA 3PFVA 1FPWA 2KFFA 1CFFA 3BFAA 4PHKA 3OGNA 2H61A 1ODBA 3JTDB 3BQ3A 3CZ1A 1K96A 1OOGA 1IWQA 1DJIA 4U8DA 2WCHA 2NCOA 3V2LA 2WCEA 1OMRA 1U5IB 1KSMA 2GTEA 1SPYA 3H4SE 3CYZA 1OQPA 1CM4A 2LE9B 1S6JA 1TNPA 4OV2A 1TNWA 3BUXB 1CNPA 2L2EA 3OX5A 1D1OA 2HPSA 3SS4A 3D73A 2HQWA 1CKKA 2LUXA 1YUSA 2CT9A 3F45A 1GQMA 4HRHA 5ER5A 1NWDA 3NSKA 3CWGA 4QJ3B 2M29A 1PVBA 1DJWA 2YGUA 1GJYA 2KLDA 3EVRA 2P70A 5GQQC 2ISDA 1JSAA 1A75A 1P28A 4A4CA 1Y1XA 1MXLC 1C3ZA 4DRWA 4C0LA 2OPOA 3LL8B 2E30A 4ORAB 4USLA 2FJUB 1IQ5A 1OMVA 2AAOA 5JJGA 1Y6WA 3CDNA 3DVKA 1BJFA 4F7FA 2Y1MA 1CM1A 1J7RA 2Y1NA 4JWQA 4OR9B 1NX2A 2E6WA 1CLLA 3TS5B 4DCKA 5I94A 2EHBA 2M1KB 1EJ3A 5BPJA 2K7CA 1SCVA 1XVJA 2KQ6A 1ALVA 2ZN8A 5DKNA 1K94A 1IJ6A 2JZIA 1BU3A 3L47A 4GGNA 1KWOC 1K8UA 2JT3A 3K1EA 5AERA 3CLNA 2KI6C 2L2CA 2L5YA 1GM0A 1ZMZA 4AOMA 5FI2A 1A29A 1SL7A 3NSOA 1M31A 2LCPA 2LLUA 2WCKA 1DJYA 1IRJA 5AFPA 2VRGA 4L9MA 3NGVA 1YTZC 1QIVA 2F3ZA 3DVJA 4M2QA 5HYDA 2PALA 2WOSA 2MBXA 2L0PA 1EXRA 1TNQA 4BY5A 1WRZA 3JTDC 3CS1A 1AHRA 2M8UA 1QS7A 1QXPA 2K2AA 3UNWA 1QX5B 3FWCA 1B8CA 4GGFA 4JQ0D 4YGAA 2LAPA 1A4PA 4MZLA 4NDCA 1CTRA 1KK7Z 3DY9A 1B9AA 4PE4A 1B8RA 3GOFA 5CPVA 1C07A 2QACA 3VRQA 1KFUL 4I5LB 1FBVA 1AVSA 3GK2A 1TUZA 1OZOA 1MXEA 2QEHA 4CIDA 1L2OB 3BXKA 2KDHA 2KYCA 5I2LA 3TDIA 1FW4A 1K95A 2KI4B 2MLEC 1WLZA 2AMIA 1W9ZA 4MVFA 1QX2A 3DVMA 1LA3A 2EGDA 4C0KA 1S5GY 3N7HA 1B47A 5KTYA 1B4CA 2KGRA 4GAOA 2R2IA 2I7AA 1LKJA 3CR4X 1BODA 4DUQA 1NSHA 1G8IA 2Y4QA 4TNCA 2JPTA 3BOWA 3BUMB 1NX3A 3TDZA 4NQGA 1S36A 1YVLA 1UHNA 2KYFA 1LXFC 3SG5A 1BG1A 1JFKA 5HLVA 2F2OA 5KSZA 1RFJA 1QX7A 2LNKA 1SL9A 1SNLA 2QEVA 2NZ0A 1IQ3A 1MF8B 3O4XA 4YI8A 1KFXS 3CABA 1UUSA 1WDCB 4ZCVA 2WC8A 3AAJA 3PJIA 1XFYO 4MZKA 2JT8A 3TS5C 1OW4A 1K2HA 3OHMB 3IVTA 1A75B 2PYQA 3EVVA 1PSRA 1S3PA 1VRKA 1TN4A 5HKYA 3Q8IA 4I5NB 3R1OA 2A4JA 2LVJA 2Q91A 1AJ4A 2KAYA 4YGEB 3DZTA 1CMFA 1WLMA 1CLBA 1F4OA 3SG6A 3PM8A 1Y1AA 3BJHA 1J7QA 1CDMA 2GV5A 2LUCA 4MRYA 2MJWB 4OZDA 4PCWA 3OX6A 4WQ3A 4XJKA 1BLQA 3SS3A 1SR6B 3HCMA 4UPGA 3D78A 2ZN9A 3PSRA 3B87A 2BKIB 1L7ZA 2M7NA 4MN0A 1LA0A 2L4HA 3QRXA 1RJVA 1TWOA 4OCIA 2LLTA 1TTXA 1XFVO 2KFHA 3EVUA 2KPHA 4MEWA 4YRUA 1BMOA 1BT6A 3NXAA 1JBAA 1TRFA 3VRRA 4OVNF 3ZWHA 2M7LA 3A4UB 1BR1B 2Q4UA 2Y5IA 5AXIA 1GGWA 2OTGB 4ORCB 3I5IC 4PE7A 1NYAA 2V53A 4YBHB 3DYEA 2P71A 4N1FA 5CSNA 1LS8A 3A8RA 5HKWA 3O2PA 1TNXA 3EK7A 1OZSA 1M39A 2JNFA 2H61C 1LINA 4D1EA 3BFHA 4ETOA 1F71A 2KI4C 1MQ1A 5FI7A 1TCOB 2JNXA 1Q80A 3CZTX 4FQOA 4INWA 5K89A 3S0FA 2H2KA 1DC1A 2JC2A 1AUIB 2O5GA 2PRUA 1HQVA 4M2PA 4Q04A 4DS7A 2BECA 2L50A 2PQLA 2F3YA 3LCPC 3BUNB 1XFUO 4YI9A 1ORGA 1PALA 3VB1A 1C3YA 2JULA 1SMGA 4HRGA 4QJ5B 5D3OA 1WRLA 2EC6B 3BFBA 2K0JA 1CFPA 1QLSA 4GUKA 1BR4B 1KQMB 3O4YA 1NCXA 5F6TA 1U5IA 3WXAA 4PALA 1CLMA 4CFQA 1K9PA 2M9GA 1YURA 3OBVA
chains in the Genus database with same CATH topology
2QEBA 2QEHA 5EL2A 3L4LA 3CZ0A 2WCJA 3BFAA 3N7HA 3OGNA 3S0BA 3CZ1A 1OOGA 2WCHA 3V2LA 4JD9A 2GTEA 3NHIA 3CYZA 3FE8A 3FE9A 4FQTA 3S0DA 3B88A 2WC6A 2QEVA 2ERBA 3L4AA 3D73A 3CABA 3PJIA 1OW4A 3FE6A 2QEOA 3Q8IA 2P70A 3R1OA 3D75A 1P28A 3DZTA 3D74A 3S0EA 3R72A 1C3ZA 3NHTA 3S0GA 3BJHA 4OZDA 1XFRA 1T14A 3CDNA 3D78A 3B6XA 3R1PA 3B87A 4F7FA 1TWOA 3RZSA 2KPHA 3CZ2A 3B86A 3R1VA 3D77A 2JPOA 4INXA 2QDIA 3L47A 2WC5A 3K1EA 1TUJA 2L2CA 3DYEA 3QMEA 1DQEA 2P71A 1GM0A 3D76A 1LS8A 2WCMA 2WCKA 3BFHA 1QWVA 3NGVA 4INWA 3S0FA 2FJYA 1OOFA 1OOHA 2PQLA 4PT1A 1ORGA 3VB1A 1C3YA 2WCLA 3DY9A 3BFBA 3B7AA 3S0AA 3DXLA 1OOIX 2H8VA 5DICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEB A;  2QEH A;  5EL2 A;  3L4L A;  3CZ0 A;  2WCJ A;  3BFA A;  3N7H A;  3OGN A;  3S0B A;  3CZ1 A;  1OOG A;  2WCH A;  3V2L A;  4JD9 A;  2GTE A;  3NHI A;  3CYZ A;  3FE8 A;  3FE9 A;  4FQT A;  3S0D A;  3B88 A;  2WC6 A;  2QEV A;  2ERB A;  3L4A A;  3D73 A;  3CAB A;  3PJI A;  1OW4 A;  3FE6 A;  2QEO A;  3Q8I A;  2P70 A;  3R1O A;  3D75 A;  1P28 A;  3DZT A;  3D74 A;  3S0E A;  3R72 A;  1C3Z A;  3NHT A;  3S0G A;  3BJH A;  4OZD A;  1XFR A;  1T14 A;  3CDN A;  3D78 A;  3B6X A;  3R1P A;  3B87 A;  4F7F A;  1TWO A;  3RZS A;  2KPH A;  3CZ2 A;  3B86 A;  3R1V A;  3D77 A;  2JPO A;  4INX A;  2QDI A;  3L47 A;  2WC5 A;  3K1E A;  1TUJ A;  2L2C A;  3DYE A;  3QME A;  1DQE A;  2P71 A;  1GM0 A;  3D76 A;  1LS8 A;  2WCM A;  2WCK A;  3BFH A;  1QWV A;  3NGV A;  4INW A;  3S0F A;  2FJY A;  1OOF A;  1OOH A;  2PQL A;  4PT1 A;  1ORG A;  3VB1 A;  1C3Y A;  2WCL A;  3DY9 A;  3BFB A;  3B7A A;  3S0A A;  3DXL A;  1OOI X;  2H8V A;  5DIC A; 
#chains in the Genus database with same CATH topology
 1SCM B;  4WRI A;  1DGV A;  4I5J A;  5EL2 A;  1PSB A;  1YR5 A;  1F54 A;  3C1V A;  1KCY A;  2BCA A;  4HSZ A;  2BKH B;  2L5X B;  5I2Q A;  1R2U A;  1IH0 A;  3JVT B;  1XFZ O;  2KOT A;  2L4I A;  1W7J B;  4N1G A;  2WCJ A;  3BOW B;  1DVI A;  2LHI A;  3LK1 A;  1IG5 A;  2LMV A;  2PSR A;  3OB2 B;  1DJG A;  2K2F A;  2WOR A;  3I5H B;  2G9B A;  3HX4 A;  1J7O A;  1IIO A;  1YX7 A;  2ZRS A;  4YGC B;  1J1E A;  5B8I B;  3WNX B;  3NHI A;  1MHO A;  2K8M B;  1XFX O;  1S6C A;  1SBJ A;  3FE9 A;  2LM5 A;  2FCE A;  1SR6 C;  3D10 A;  4JKT A;  3VGO A;  3B88 A;  1Z2C B;  2BNX A;  2KAX A;  2TN4 A;  1SL8 A;  2ERB A;  2RGI A;  3L4A A;  1C7W A;  2LAN A;  2P6B B;  1CB1 A;  4PE0 A;  2MA2 A;  5CSF A;  1K93 D;  2BBM A;  1QV1 A;  2I18 A;  3CGA A;  1RTP 1;  1F70 A;  2NCP A;  5ER4 X;  3AAK A;  3FE6 A;  4NDD A;  1K90 D;  1S1E A;  2HF5 A;  1RWY A;  1J1D A;  1V1F A;  2JTZ A;  3UO9 A;  4PDZ A;  3DVE A;  3EG5 B;  3S0E A;  4XJK B;  1KK8 B;  2OTG C;  3OB1 B;  2WCF A;  2MAZ A;  3EK4 A;  3O6B A;  1IJ5 A;  1JF0 A;  1S5G Z;  2ZNE A;  3R72 A;  4JPZ B;  1XYD A;  4N5X A;  3EK8 A;  3S0G A;  4C0J A;  2G2B A;  1XFR A;  2NLN A;  1XK4 C;  5JOL A;  1ZFS A;  1M63 B;  2PAS A;  3PN7 B;  4F0Z B;  1NX0 A;  1AJ5 A;  3SG4 A;  3BYA A;  3KEV A;  1E8A A;  1F4Q A;  2LP2 A;  2CXJ A;  2M0R A;  2KAV A;  5FYX A;  4GGF C;  1KFX L;  1HT9 A;  3LK0 A;  5KU1 A;  1PK0 D;  1J55 A;  1JUO A;  1AP4 A;  2JT0 A;  3EKJ A;  1QAT A;  2BCX A;  2DOQ A;  2K60 A;  2K61 A;  3DF0 A;  5CSJ A;  1B1G A;  3IQO A;  1K9K A;  1OOJ A;  1RRO A;  3ICB A;  3R1V A;  2KFG A;  2PMY A;  1XA5 A;  3PAL A;  1DJH A;  3D77 A;  3IF7 A;  2ZRT A;  1F8H A;  1MWN A;  4INX A;  2LLS A;  1KQM C;  3VRO A;  1ZUZ A;  4WQ2 A;  5FI6 A;  5I8N A;  2KBM A;  3I5F B;  1TUJ A;  4AQJ A;  1RK9 A;  1DJZ A;  1Z4H A;  1SCM C;  2WCM A;  4OKH A;  4M2O A;  2FCD A;  5HLO A;  1EG3 A;  1IGV A;  3SIA A;  1CFC A;  3JVT C;  3SG2 A;  1NUB A;  1NP8 A;  2OS8 B;  2KI6 D;  3K21 A;  4XYN A;  1C7V A;  1SKT A;  2FJY A;  3SS5 A;  1A2X A;  1UHH A;  3PLF B;  1ZAC A;  3CR2 A;  3FIA A;  2I2R E;  2CTN A;  2LMU A;  3I5H C;  4R1E A;  1LVC D;  1OOH A;  2KLE A;  2WND A;  4ORB B;  2I94 A;  1K9U A;  3GK4 X;  2WCL A;  1YRT B;  4P2Y B;  2AUC A;  2CCM A;  1DT7 B;  1YUU A;  2CBL A;  5J3X A;  1N65 A;  2BBN A;  3CR5 X;  3D0Y A;  2JWW A;  3DD4 A;  1QV0 A;  1XFW O;  2GGM A;  4MRX A;  1H4B A;  4MSP A;  4E68 A;  1G4Y R;  1XO5 A;  1QJT A;  2H8V A;  3PAT A;  1L2O C;  2HET A;  2F2P A;  2KGB C;  1UHJ A;  2LP3 A;  4GFT A;  3TZ1 A;  5D7F A;  1NX1 A;  1KQV A;  1AK8 A;  4CLN A;  2BAP A;  2MHH A;  3I5G B;  1REC A;  4MZJ A;  4I5K A;  1OSA A;  3GK1 A;  1NCZ A;  4IJ7 A;  1QVI Y;  3WHT B;  3MSE B;  3S0B A;  1IKU A;  1OMD A;  1PVA A;  3BUO B;  3WHU B;  1A03 A;  1KK8 C;  2JQ6 A;  1ZOT B;  5PAL A;  1DF0 A;  1R6P A;  1QVI Z;  1WRK A;  1YUT A;  1QIW A;  1DEK A;  1OE9 B;  2ZKM X;  4JD9 A;  4P5O E;  2KBI A;  1EH2 A;  1FF1 A;  2JXC A;  2ZFD A;  2SCP A;  3TUY B;  1FI6 A;  3SIB A;  3PN7 C;  3FE8 A;  3RM1 A;  4FQT A;  3S0D A;  5HKZ A;  1B7T Y;  2MRD A;  2F33 A;  2WC6 A;  2KNE A;  1S26 D;  1WDC C;  2JU0 A;  5D69 A;  1MUX A;  1SY9 A;  4HRE E;  1F55 A;  3FS7 A;  4GNK B;  4PHM A;  1B7T Z;  5HL1 A;  1J7P A;  1DMO A;  2BL0 B;  2MLF C;  1FI5 A;  2O60 A;  1WY9 A;  3BUW B;  3AKB A;  1UWO A;  1SYM A;  2QEO A;  3EKH A;  4AQI A;  3OP0 A;  5AAN A;  1M46 A;  1YVH A;  2JRF A;  4YGD B;  2IS9 A;  3D75 A;  5AEQ A;  1BF5 A;  2JTT A;  3D74 A;  5TNC A;  4NDB A;  3I5F C;  4MBE A;  3NHT A;  1NPQ A;  1H8B A;  4A4B A;  1DJX A;  2COL B;  1JWD A;  1T14 A;  1UHK A;  2LMT A;  1TIZ A;  1N0Y A;  2HQ8 A;  2M97 A;  1TCF A;  1V1G A;  3PM2 A;  4PHJ A;  5I2O A;  3KPX A;  2M3W A;  3CTN A;  2OS8 C;  1CDL A;  2LVV A;  3B6X A;  3R1P A;  1QTX A;  1BOC A;  3DF0 B;  4IL1 A;  2F8P A;  3AKA A;  1XK4 A;  2QPT A;  1EG4 A;  2L98 A;  1KK7 Y;  4GBA A;  2PVB A;  1YRU B;  3RZS A;  3CZ2 A;  2KSP A;  2L51 A;  3SG3 A;  3VRP A;  1PRW A;  1X02 A;  3B86 A;  3RLZ A;  5IBW A;  1ALW A;  1YX8 A;  1JFJ A;  1UUR A;  4PE1 A;  1NCY A;  2BE4 A;  1CMG A;  2LVK A;  2CNP A;  3IQQ A;  2JPO A;  4CFR A;  2QDI A;  2K7O A;  1DTL A;  1M45 A;  1JC2 A;  2WC5 A;  1DGU A;  1KFU S;  5CSI A;  3I5I B;  3QME A;  1DQE A;  1Y1U A;  2JXL A;  3KHE A;  3D76 A;  1B8L A;  4GPL B;  1GGZ A;  1EL4 A;  2LV7 A;  3O78 A;  1SK6 D;  2KHN A;  3I5G C;  1N2D A;  1CDP A;  1QAS A;  1QWV A;  1QLK A;  3NSI A;  2SAS A;  4FTG A;  3KO0 A;  4ZCU A;  3SG7 A;  1MR8 A;  3ZNI A;  2K7B A;  1OOF A;  4MLW A;  3LLE A;  1SSE B;  2LHL A;  3NSL A;  4BY4 A;  1S6I A;  2LC5 A;  2ZND A;  1Y0V H;  4ICB A;  2D8N A;  1TOP A;  4PT1 A;  1JF2 A;  2FOT A;  1SW8 A;  1W7I B;  2EC6 C;  3D0Y B;  3VRN A;  2NXQ A;  1G33 A;  3TUY C;  3B7A A;  3SJS A;  1SRA A;  5DKQ A;  1NIW A;  3S0A A;  2BE6 A;  2M1U A;  2B1U A;  5G08 A;  3E3R A;  1KWO B;  3DXL A;  4CPV A;  1DEL A;  4KYN A;  1OOI X;  1UHI A;  3FWB A;  2K7D A;  2M49 B;  3TDU A;  4PHN A;  5DIC A;  4YGB B;  1PUL A;  2KQY A;  2QEB A;  4DIR A;  1UP5 A;  1KSO A;  2GGZ A;  2JOJ A;  2LVI A;  3CZ0 A;  3L4L A;  1CFD A;  2BL0 C;  1CDN A;  3KF9 A;  3M0W A;  2WCB A;  5DKR A;  4QJ4 B;  1DF0 B;  2BCB A;  3PFV A;  1FPW A;  2KFF A;  1CFF A;  3BFA A;  4PHK A;  3OGN A;  2H61 A;  1ODB A;  3JTD B;  3BQ3 A;  3CZ1 A;  1K96 A;  1OOG A;  1IWQ A;  1DJI A;  4U8D A;  2WCH A;  2NCO A;  3V2L A;  2WCE A;  1OMR A;  1U5I B;  1KSM A;  2GTE A;  1SPY A;  3H4S E;  3CYZ A;  1OQP A;  1CM4 A;  2LE9 B;  1S6J A;  1TNP A;  4OV2 A;  1TNW A;  3BUX B;  1CNP A;  2L2E A;  3OX5 A;  1D1O A;  2HPS A;  3SS4 A;  3D73 A;  2HQW A;  1CKK A;  2LUX A;  1YUS A;  2CT9 A;  3F45 A;  1GQM A;  4HRH A;  5ER5 A;  1NWD A;  3NSK A;  3CWG A;  4QJ3 B;  2M29 A;  1PVB A;  1DJW A;  2YGU A;  1GJY A;  2KLD A;  3EVR A;  2P70 A;  5GQQ C;  2ISD A;  1JSA A;  1A75 A;  1P28 A;  4A4C A;  1Y1X A;  1MXL C;  1C3Z A;  4DRW A;  4C0L A;  2OPO A;  3LL8 B;  2E30 A;  4ORA B;  4USL A;  2FJU B;  1IQ5 A;  1OMV A;  2AAO A;  5JJG A;  1Y6W A;  3CDN A;  3DVK A;  1BJF A;  4F7F A;  2Y1M A;  1CM1 A;  1J7R A;  2Y1N A;  4JWQ A;  4OR9 B;  1NX2 A;  2E6W A;  1CLL A;  3TS5 B;  4DCK A;  5I94 A;  2EHB A;  2M1K B;  1EJ3 A;  5BPJ A;  2K7C A;  1SCV A;  1XVJ A;  2KQ6 A;  1ALV A;  2ZN8 A;  5DKN A;  1K94 A;  1IJ6 A;  2JZI A;  1BU3 A;  3L47 A;  4GGN A;  1KWO C;  1K8U A;  2JT3 A;  3K1E A;  5AER A;  3CLN A;  2KI6 C;  2L2C A;  2L5Y A;  1GM0 A;  1ZMZ A;  4AOM A;  5FI2 A;  1A29 A;  1SL7 A;  3NSO A;  1M31 A;  2LCP A;  2LLU A;  2WCK A;  1DJY A;  1IRJ A;  5AFP A;  2VRG A;  4L9M A;  3NGV A;  1YTZ C;  1QIV A;  2F3Z A;  3DVJ A;  4M2Q A;  5HYD A;  2PAL A;  2WOS A;  2MBX A;  2L0P A;  1EXR A;  1TNQ A;  4BY5 A;  1WRZ A;  3JTD C;  3CS1 A;  1AHR A;  2M8U A;  1QS7 A;  1QXP A;  2K2A A;  3UNW A;  1QX5 B;  3FWC A;  1B8C A;  4GGF A;  4JQ0 D;  4YGA A;  2LAP A;  1A4P A;  4MZL A;  4NDC A;  1CTR A;  1KK7 Z;  3DY9 A;  1B9A A;  4PE4 A;  1B8R A;  3GOF A;  5CPV A;  1C07 A;  2QAC A;  3VRQ A;  1KFU L;  4I5L B;  1FBV A;  1AVS A;  3GK2 A;  1TUZ A;  1OZO A;  1MXE A;  2QEH A;  4CID A;  1L2O B;  3BXK A;  2KDH A;  2KYC A;  5I2L A;  3TDI A;  1FW4 A;  1K95 A;  2KI4 B;  2MLE C;  1WLZ A;  2AMI A;  1W9Z A;  4MVF A;  1QX2 A;  3DVM A;  1LA3 A;  2EGD A;  4C0K A;  1S5G Y;  3N7H A;  1B47 A;  5KTY A;  1B4C A;  2KGR A;  4GAO A;  2R2I A;  2I7A A;  1LKJ A;  3CR4 X;  1BOD A;  4DUQ A;  1NSH A;  1G8I A;  2Y4Q A;  4TNC A;  2JPT A;  3BOW A;  3BUM B;  1NX3 A;  3TDZ A;  4NQG A;  1S36 A;  1YVL A;  1UHN A;  2KYF A;  1LXF C;  3SG5 A;  1BG1 A;  1JFK A;  5HLV A;  2F2O A;  5KSZ A;  1RFJ A;  1QX7 A;  2LNK A;  1SL9 A;  1SNL A;  2QEV A;  2NZ0 A;  1IQ3 A;  1MF8 B;  3O4X A;  4YI8 A;  1KFX S;  3CAB A;  1UUS A;  1WDC B;  4ZCV A;  2WC8 A;  3AAJ A;  3PJI A;  1XFY O;  4MZK A;  2JT8 A;  3TS5 C;  1OW4 A;  1K2H A;  3OHM B;  3IVT A;  1A75 B;  2PYQ A;  3EVV A;  1PSR A;  1S3P A;  1VRK A;  1TN4 A;  5HKY A;  3Q8I A;  4I5N B;  3R1O A;  2A4J A;  2LVJ A;  2Q91 A;  1AJ4 A;  2KAY A;  4YGE B;  3DZT A;  1CMF A;  1WLM A;  1CLB A;  1F4O A;  3SG6 A;  3PM8 A;  1Y1A A;  3BJH A;  1J7Q A;  1CDM A;  2GV5 A;  2LUC A;  4MRY A;  2MJW B;  4OZD A;  4PCW A;  3OX6 A;  4WQ3 A;  4XJK A;  1BLQ A;  3SS3 A;  1SR6 B;  3HCM A;  4UPG A;  3D78 A;  2ZN9 A;  3PSR A;  3B87 A;  2BKI B;  1L7Z A;  2M7N A;  4MN0 A;  1LA0 A;  2L4H A;  3QRX A;  1RJV A;  1TWO A;  4OCI A;  2LLT A;  1TTX A;  1XFV O;  2KFH A;  3EVU A;  2KPH A;  4MEW A;  4YRU A;  1BMO A;  1BT6 A;  3NXA A;  1JBA A;  1TRF A;  3VRR A;  4OVN F;  3ZWH A;  2M7L A;  3A4U B;  1BR1 B;  2Q4U A;  2Y5I A;  5AXI A;  1GGW A;  2OTG B;  4ORC B;  3I5I C;  4PE7 A;  1NYA A;  2V53 A;  4YBH B;  3DYE A;  2P71 A;  4N1F A;  5CSN A;  1LS8 A;  3A8R A;  5HKW A;  3O2P A;  1TNX A;  3EK7 A;  1OZS A;  1M39 A;  2JNF A;  2H61 C;  1LIN A;  4D1E A;  3BFH A;  4ETO A;  1F71 A;  2KI4 C;  1MQ1 A;  5FI7 A;  1TCO B;  2JNX A;  1Q80 A;  3CZT X;  4FQO A;  4INW A;  5K89 A;  3S0F A;  2H2K A;  1DC1 A;  2JC2 A;  1AUI B;  2O5G A;  2PRU A;  1HQV A;  4M2P A;  4Q04 A;  4DS7 A;  2BEC A;  2L50 A;  2PQL A;  2F3Y A;  3LCP C;  3BUN B;  1XFU O;  4YI9 A;  1ORG A;  1PAL A;  3VB1 A;  1C3Y A;  2JUL A;  1SMG A;  4HRG A;  4QJ5 B;  5D3O A;  1WRL A;  2EC6 B;  3BFB A;  2K0J A;  1CFP A;  1QLS A;  4GUK A;  1BR4 B;  1KQM B;  3O4Y A;  1NCX A;  5F6T A;  1U5I A;  3WXA A;  4PAL A;  1CLM A;  4CFQ A;  1K9P A;  2M9G A;  1YUR A;  3OBV A; 
#chains in the Genus database with same CATH homology
 2QEB A;  2QEH A;  5EL2 A;  3L4L A;  3CZ0 A;  2WCJ A;  3BFA A;  3N7H A;  3OGN A;  3S0B A;  3CZ1 A;  1OOG A;  2WCH A;  3V2L A;  4JD9 A;  2GTE A;  3NHI A;  3CYZ A;  3FE8 A;  3FE9 A;  4FQT A;  3S0D A;  3B88 A;  2WC6 A;  2QEV A;  2ERB A;  3L4A A;  3D73 A;  3CAB A;  3PJI A;  1OW4 A;  3FE6 A;  2QEO A;  3Q8I A;  2P70 A;  3R1O A;  3D75 A;  1P28 A;  3DZT A;  3D74 A;  3S0E A;  3R72 A;  1C3Z A;  3NHT A;  3S0G A;  3BJH A;  4OZD A;  1XFR A;  1T14 A;  3CDN A;  3D78 A;  3B6X A;  3R1P A;  3B87 A;  4F7F A;  1TWO A;  3RZS A;  2KPH A;  3CZ2 A;  3B86 A;  3R1V A;  3D77 A;  2JPO A;  4INX A;  2QDI A;  3L47 A;  2WC5 A;  3K1E A;  1TUJ A;  2L2C A;  3DYE A;  3QME A;  1DQE A;  2P71 A;  1GM0 A;  3D76 A;  1LS8 A;  2WCM A;  2WCK A;  3BFH A;  1QWV A;  3NGV A;  4INW A;  3S0F A;  2FJY A;  1OOF A;  1OOH A;  2PQL A;  4PT1 A;  1ORG A;  3VB1 A;  1C3Y A;  2WCL A;  3DY9 A;  3BFB A;  3B7A A;  3S0A A;  3DXL A;  1OOI X;  2H8V A;  5DIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...