2JPOA

Nmr structure of antheraea polyphemus pheromone-binding protein 1 at ph 4.5
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
142
structure length
142
Chain Sequence
SPEIMKNLSNNFGKAMDQCKDELSLPDSVVADLYNFWKDDYVMTDRLAGCAINCLATKLDVVDPDGNLHHGNAKDFAMKHGADETMAQQLVDIIHGCEKSAPPNDDKCMKTIDVAMCFKKEIHKLNWVPNMDLVIGEVLAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone-binding protein
publication title Structural Basis of Ligand Binding and Release in Insect Pheromone-Binding Proteins: NMR Structure of Antheraea polyphemus PBP1 at pH 4.5
pubmed doi rcsb
source organism Antheraea polyphemus
molecule tags Transport protein
total genus 43
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2007-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2jpoA00
1DQEA 3N7HA 2JPOA 3CZ2A 1GM0A 2H8VA 2QEBA 2FJYA 5DICA 3DY9A 1XFRA 1TWOA 3CZ1A 3V2LA 2PQLA 3B6XA 1QWVA 3D77A 3L4LA 4JD9A 1T14A 3PJIA 3B86A 4INWA 3BJHA 1TUJA 3B7AA 2KPHA 2WC6A 3QMEA 4OZDA 3BFAA 1LS8A 5EL2A 3D78A 2WCJA 3FE9A 3FE6A 2WCMA 2QDIA 3NHIA 3B87A 3S0GA 1OOIX 3CYZA 3D76A 2P71A 2WCKA 3R1VA 4FQTA 3D74A 2ERBA 3DZTA 1OOGA 3OGNA 3S0BA 3R72A 1C3YA 3Q8IA 2WC5A 1P28A 3L4AA 3VB1A 3FE8A 2L2CA 3D75A 3RZSA 3DYEA 4PT1A 3CZ0A 3S0DA 1C3ZA 3CDNA 3DXLA 3S0AA 1OW4A 3NGVA 1OOHA 2WCHA 3R1OA 3S0FA 3NHTA 2WCLA 2QEVA 3B88A 3D73A 2P70A 4F7FA 3CABA 3S0EA 3R1PA 1ORGA 3K1EA 4INXA 3BFBA 2QEHA 2GTEA 2QEOA 3BFHA 3L47A 1OOFA
chains in the Genus database with same CATH superfamily
2MJWB 5K89A 1MWNA 3N7HA 1UHIA 3PM2A 3BOWA 3NSIA 2OPOA 1SSEB 2H61C 4QJ3B 2FJYA 1NSHA 2LMTA 1KQVA 2WOSA 1SL8A 1CDLA 4USLA 4D1EA 5I8NA 2YGUA 4PHKA 3B6XA 1BF5A 2BL0C 1M45A 2BKIB 3TDZA 1JC2A 2CCMA 1SMGA 1UURA 1IJ5A 1DGVA 1J1EA 2LMVA 1B8LA 1SPYA 1YX8A 3D77A 3MSEB 2JNXA 4JD9A 2QPTA 2HPSA 4YGBB 2HF5A 3CTNA 4PALA 4MRYA 1IRJA 3LL8B 3SIBA 1JBAA 2K7DA 2LVIA 1TNXA 2PASA 3WXAA 1Y1XA 2CNPA 1S36A 4HRGA 3WNXB 5JJGA 1DGUA 3ICBA 1B7TY 2KQ6A 2I2RE 1XK4A 4PE0A 1BMOA 5KTYA 1J1DA 4PHMA 2VRGA 2ZKMX 2ZNEA 4XJKA 3PLFB 1FI6A 4OV2A 4U8DA 1SK6D 2QDIA 5FYXA 2GGZA 1UHNA 4A4BA 2Y4QA 1DJWA 1KK7Z 3B87A 3EG5B 3S0GA 3CYZA 1C7VA 4JQ0D 4NDCA 1BOCA 1BODA 2DOQA 1KCYA 3M0WA 1KWOC 2JQ6A 4MSPA 1CDPA 1L2OC 1YUUA 4MZJA 1RECA 3R1VA 3RLZA 1K93D 1SBJA 3PFVA 5GQQC 5AFPA 3O2PA 5ER4X 2F3ZA 3DF0B 4P5OE 1OOGA 1XK4C 3AKBA 4E68A 2BCBA 5DKQA 1IG5A 4UPGA 3R72A 1B4CA 2KLDA 1C3YA 1QX5B 2FOTA 2L2EA 1Z2CB 2F8PA 4N1GA 4CPVA 3SS5A 1CDMA 1BJFA 3VB1A 1E8AA 2ZN8A 1RWYA 2L2CA 2KLEA 1PK0D 2LP2A 3BUOB 3D75A 3EK8A 2WCEA 4IL1A 4OVNF 2GV5A 3DVKA 1S6CA 3I5HB 3DYEA 3WHTB 1IIOA 1W7IB 1M31A 1AP4A 1F71A 2BCXA 1S6JA 1FBVA 2Q91A 1DF0A 1XA5A 1LA0A 2BKHB 4I5NB 1C3ZA 3TS5C 1XVJA 1F4OA 2KOTA 3ZWHA 1OQPA 3OP0A 4ZCVA 1V1FA 2F2OA 2KI4C 3S0AA 2O60A 1U5IB 1TNQA 1SKTA 1SYMA 5J3XA 2ISDA 2KAYA 2JOJA 1SCMC 3BYAA 2CT9A 1QLKA 4GUKA 2G9BA 2I7AA 1TUZA 5AERA 1NUBA 2L98A 2HETA 2WCLA 3LCPC 3PSRA 3HCMA 2KAVA 1A4PA 2L4HA 1MQ1A 2M7NA 2P70A 1J7RA 1KSOA 1YUSA 3EVVA 1QV0A 2WORA 1SRAA 3JVTB 3R1PA 2MAZA 2R2IA 3K1EA 2KHNA 4INXA 5DKNA 3S0EA 5KSZA 4YGAA 1KK7Y 1WRZA 4PE4A 4OKHA 4CIDA 1YR5A 4AOMA 1DT7B 1WDCB 2PALA 2JXCA 4DCKA 5HYDA 1KSMA 1V1GA 1G4YR 3JTDB 4GGNA 4C0LA 3L47A 2EC6B 2B1UA 2JRFA 2E6WA 1DQEA 4M2OA 1B7TZ 2LHLA 1F8HA 1XYDA 1LKJA 2K7OA 1ZACA 3BUXB 4R1EA 2F2PA 2L5XB 2BBMA 2K0JA 4ORBB 1DTLA 4A4CA 1YVHA 2O5GA 2BE4A 2KBMA 1ODBA 3EKJA 5I94A 1TWOA 3CZ1A 2L0PA 3SS4A 1J7PA 1KFUS 1ZMZA 4YBHB 1QWVA 1KFXL 1TCOB 4MRXA 4AQJA 3L4LA 2OS8B 4PHNA 2KSPA 2JWWA 1A75A 1ALWA 3CGAA 2SASA 3BXKA 4INWA 3DVEA 3BJHA 2K2AA 2WC8A 1AHRA 2LLUA 3VRPA 1MF8B 1DVIA 2K7CA 1LINA 2FCDA 1MXEA 1QIVA 2WC6A 1IKUA 2M9GA 1LS8A 4CLNA 3BQ3A 1W9ZA 3WHUB 5HKWA 2L51A 1B1GA 1KK8B 1G8IA 1M39A 3D78A 1J55A 3NSLA 2WCMA 3CWGA 2ZRTA 3D0YA 3NHIA 1UP5A 1SW8A 5AXIA 2LLSA 4MN0A 1DJYA 1YVLA 1S5GY 2KDHA 2SCPA 1NP8A 2PSRA 1DJXA 1OE9B 5F6TA 1IGVA 2M0RA 2JXLA 1K94A 1EXRA 3E3RA 4GGFA 3KPXA 4GAOA 3D74A 2ERBA 4NDBA 3CLNA 2BECA 5FI2A 1PRWA 2M1KB 5CSFA 1NCYA 1H4BA 1S1EA 4IJ7A 3PM8A 1QV1A 2K60A 4PCWA 2PVBA 5FI7A 3SG5A 1FPWA 1QIWA 1GGZA 3AAKA 1CTRA 3K21A 3O6BA 5BPJA 5D69A 3SJSA 4BY5A 1TCFA 3UO9A 2AUCA 2RGIA 1W7JB 1NYAA 2I18A 3FWBA 1AVSA 5I2OA 1C07A 3SG4A 1TNPA 4GGFC 3CZ0A 3EK7A 3EKHA 2BNXA 1CFFA 3CDNA 1ZUZA 3NSKA 1QTXA 2K7BA 2KFGA 1UHKA 3PN7B 1OW4A 1ZFSA 1SNLA 3PATA 4N1FA 4OR9B 2MHHA 2BBNA 3TUYB 2AMIA 1N2DA 1JF2A 1UUSA 1YTZC 1SY9A 2JT8A 3I5GB 3NHTA 3D73A 4M2PA 1CNPA 1CMFA 2M8UA 1UHJA 1NCXA 4Q04A 1F54A 2JPTA 3JTDC 1K96A 2M29A 4F7FA 1NCZA 1PVAA 3I5IC 1XFVO 3SG7A 1R2UA 1PSBA 1EJ3A 5CPVA 1CM1A 2F33A 3BFBA 3VRRA 3AAJA 4YI9A 2WCBA 3EK4A 1WRKA 1BLQA 2GTEA 3OBVA 2QEOA 1F4QA 1RJVA 4DIRA 3BFHA 3CR4X 2JZIA 2MRDA 1RFJA 3LK1A 2BL0B 4I5JA 2BE6A 2M3WA 2LM5A 2V53A 4YGDB 2Y1NA 4ICBA 4JWQA 1JFKA 5PALA 2L4IA 1G33A 2JPOA 1CFPA 2OTGC 3CZ2A 4KYNA 1FI5A 1GM0A 2JT0A 2L50A 5HL1A 2H8VA 2QEBA 1TNWA 2HQWA 1YRUB 1LVCD 4DUQA 5DICA 4CFRA 4MBEA 2QACA 4DRWA 1AUIB 1SR6C 3BOWB 5B8IB 2LNKA 3V2LA 1GQMA 1DELA 1S5GZ 4YRUA 1QX2A 1CMGA 3GK1A 4ORAB 1B9AA 1X02A 3PJIA 1IH0A 3OX5A 3B86A 1QATA 1N0YA 1QJTA 1RROA 3HX4A 3ZNIA 4F0ZB 1SCVA 4YI8A 1SL7A 1LA3A 1TUJA 1PALA 2NCPA 1BT6A 1XO5A 1MUXA 1K8UA 2EGDA 2KPHA 4OZDA 3VGOA 1DC1A 1M63B 1Y0VH 4PE7A 5EL2A 3BUWB 1R6PA 1S3PA 5HKYA 4ZCUA 3FE6A 4NDDA 1F70A 3IVTA 1KFUL 2NZ0A 4MZLA 1OOIX 2JNFA 4OCIA 1LXFC 4XJKB 3DF0A 2HQ8A 3CR2A 2KYCA 1K9UA 1ZOTB 2L5YA 3CS1A 3QRXA 5ER5A 1WY9A 1JUOA 4P2YB 1FF1A 4FQTA 3IQOA 5HLOA 1A29A 2ZFDA 1JWDA 3UNWA 2FJUB 3CR5X 2P6BB 3O4YA 1YRTB 5CSNA 1NIWA 3OGNA 3S0BA 2LVJA 2EHBA 1CFCA 4JKTA 1CM4A 1VRKA 2WC5A 3RM1A 1S26D 1MXLC 1NX2A 1YX7A 2Q4UA 1QX7A 4BY4A 1P28A 2KI4B 3F45A 3L4AA 1M46A 1NX0A 3A8RA 3D10A 2JU0A 3RZSA 1SCMB 3SG3A 3NXAA 4NQGA 2JULA 3SS3A 2KI6C 3GK2A 3LLEA 2WCFA 1XFYO 2LC5A 1NX3A 3I5FB 4WQ2A 1HT9A 3S0DA 1OZOA 2JC2A 2M97A 4N5XA 1CLMA 2G2BA 4WRIA 3BUMB 3GOFA 3LK0A 1Q80A 1TOPA 3NGVA 1DF0B 1OOHA 3CZTX 1UWOA 1B8RA 5I2LA 3TDIA 3I5HC 1OMVA 2KGRA 3EVUA 1TRFA 2E30A 2F3YA 2H2KA 2NLNA 2ZN9A 2QEVA 3B88A 3SG6A 1CLLA 1QASA 1AK8A 1FW4A 1Y1AA 1EG3A 1KQMB 3SIAA 2K2FA 2LLTA 3VRNA 1Z4HA 4QJ5B 1D1OA 1WRLA 2KNEA 3IQQA 1BG1A 2KQYA 1RK9A 5HLVA 3OHMB 1XFUO 5D3OA 2M49B 1JF0A 1OMRA 1PSRA 1B8CA 1B47A 4MVFA 1WLMA 4XYNA 3FWCA 3PALA 3R1OA 1GGWA 1NX1A 1K95A 2D8NA 2LAPA 3JVTC 3C1VA 1H8BA 1QLSA 1QVIZ 2TN4A 5FI6A 1AJ4A 1CFDA 4M2QA 3TZ1A 1K9KA 1NWDA 2ZNDA 1WDCC 5AANA 1DJGA 2KYFA 4I5KA 3DY9A 1XFRA 1WLZA 2PQLA 4FTGA 1CB1A 2EC6C 1PULA 2MLEC 3NSOA 2JTZA 2LHIA 1EH2A 1DJHA 2KGBC 2LUXA 2FCEA 1TTXA 1T14A 3AKAA 3DVJA 1N65A 1YUTA 5HKZA 1OOJA 3VROA 1BR4B 1C7WA 2IS9A 4HSZA 1XFXO 2LUCA 2KFHA 3EVRA 3B7AA 1ALVA 1A75B 4I5LB 4HREE 4YGEB 1K2HA 4L9MA 4C0KA 3SG2A 3QMEA 3BFAA 1EG4A 2LE9B 5D7FA 2OS8C 1F55A 2KI6D 1YURA 2LVKA 2WCJA 3FE9A 3KO0A 4WQ3A 1IJ6A 1NPQA 4FQOA 1Y6WA 1DMOA 2JT3A 4TNCA 2M1UA 3D76A 2P71A 3TDUA 3OB2B 1A2XA 1SL9A 1CKKA 3GK4X 4GBAA 3D0YB 2NCOA 2WCKA 1XFWO 1JFJA 3KF9A 4QJ4B 1DEKA 4C0JA 2COLB 2JTTA 2CBLA 2PMYA 3OX6A 5AEQA 2CTNA 1KK8C 3DZTA 4AQIA 2BCAA 2MA2A 3DD4A 3IF7A 1KWOB 1RTP1 1MR8A 1QS7A 1OMDA 1L2OB 3Q8IA 2LP3A 3I5FC 1QVIY 5DKRA 3A4UB 3O4XA 4ORCB 5G08A 1CLBA 4HRHA 2MBXA 3FE8A 4YGCB 2A4JA 1IWQA 2LVVA 3KEVA 3DVMA 4PHJA 1TN4A 1L7ZA 1Y1UA 2ZRSA 4GFTA 5CSJA 2AAOA 1A03A 4GNKB 1GJYA 5I2QA 4CFQA 1BR1B 4PT1A 1OSAA 1JSAA 4GPLB 1TIZA 2LANA 2MLFC 1IQ3A 2LCPA 2KBIA 2Y5IA 3I5IB 4PDZA 3KHEA 1EL4A 3DXLA 2M7LA 4JPZB 1K90D 1MHOA 2LV7A 1KQMC 2BAPA 4ETOA 2KAXA 2NXQA 5IBWA 2WCHA 1DJZA 2I94A 3O78A 3S0FA 1UHHA 3FIAA 2KFFA 1XFZO 3TS5B 1QXPA 3VRQA 3BUNB 2H61A 2K61A 2Y1MA 5CSIA 4PE1A 2WNDA 3CABA 3FS7A 1CDNA 3H4SE 1OZSA 1ORGA 2OTGB 1AJ5A 1HQVA 4MLWA 1S6IA 3PN7C 2PYQA 3OB1B 5TNCA 1J7OA 1J7QA 1IQ5A 2LMUA 2CXJA 2QEHA 1KFXS 1DJIA 2PRUA 4DS7A 3TUYC 2K8MB 5KU1A 1U5IA 1K9PA 1SR6B 3I5GC 2GGMA 1BU3A 5JOLA 1OOFA 4MZKA 1PVBA 4MEWA
chains in the Genus database with same CATH topology
1DQEA 3N7HA 2JPOA 3CZ2A 1GM0A 2H8VA 2QEBA 2FJYA 5DICA 3DY9A 1XFRA 1TWOA 3CZ1A 3V2LA 2PQLA 3B6XA 1QWVA 3D77A 3L4LA 4JD9A 1T14A 3PJIA 3B86A 4INWA 3BJHA 1TUJA 3B7AA 2KPHA 2WC6A 3QMEA 4OZDA 3BFAA 1LS8A 5EL2A 3D78A 2WCJA 3FE9A 3FE6A 2WCMA 2QDIA 3NHIA 3B87A 3S0GA 1OOIX 3CYZA 3D76A 2P71A 2WCKA 3R1VA 4FQTA 3D74A 2ERBA 3DZTA 1OOGA 3OGNA 3S0BA 3R72A 1C3YA 3Q8IA 2WC5A 1P28A 3L4AA 3VB1A 3FE8A 2L2CA 3D75A 3RZSA 3DYEA 4PT1A 3CZ0A 3S0DA 1C3ZA 3CDNA 3DXLA 3S0AA 1OW4A 3NGVA 1OOHA 2WCHA 3R1OA 3S0FA 3NHTA 2WCLA 2QEVA 3B88A 3D73A 2P70A 4F7FA 3CABA 3S0EA 3R1PA 1ORGA 3K1EA 4INXA 3BFBA 2QEHA 2GTEA 2QEOA 3BFHA 3L47A 1OOFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DQE A;  3N7H A;  2JPO A;  3CZ2 A;  1GM0 A;  2H8V A;  2QEB A;  2FJY A;  5DIC A;  3DY9 A;  1XFR A;  1TWO A;  3CZ1 A;  3V2L A;  2PQL A;  3B6X A;  1QWV A;  3D77 A;  3L4L A;  4JD9 A;  1T14 A;  3PJI A;  3B86 A;  4INW A;  3BJH A;  1TUJ A;  3B7A A;  2KPH A;  2WC6 A;  3QME A;  4OZD A;  3BFA A;  1LS8 A;  5EL2 A;  3D78 A;  2WCJ A;  3FE9 A;  3FE6 A;  2WCM A;  2QDI A;  3NHI A;  3B87 A;  3S0G A;  1OOI X;  3CYZ A;  3D76 A;  2P71 A;  2WCK A;  3R1V A;  4FQT A;  3D74 A;  2ERB A;  3DZT A;  1OOG A;  3OGN A;  3S0B A;  3R72 A;  1C3Y A;  3Q8I A;  2WC5 A;  1P28 A;  3L4A A;  3VB1 A;  3FE8 A;  2L2C A;  3D75 A;  3RZS A;  3DYE A;  4PT1 A;  3CZ0 A;  3S0D A;  1C3Z A;  3CDN A;  3DXL A;  3S0A A;  1OW4 A;  3NGV A;  1OOH A;  2WCH A;  3R1O A;  3S0F A;  3NHT A;  2WCL A;  2QEV A;  3B88 A;  3D73 A;  2P70 A;  4F7F A;  3CAB A;  3S0E A;  3R1P A;  1ORG A;  3K1E A;  4INX A;  3BFB A;  2QEH A;  2GTE A;  2QEO A;  3BFH A;  3L47 A;  1OOF A; 
#chains in the Genus database with same CATH topology
 2MJW B;  5K89 A;  1MWN A;  3N7H A;  1UHI A;  3PM2 A;  3BOW A;  3NSI A;  2OPO A;  1SSE B;  2H61 C;  4QJ3 B;  2FJY A;  1NSH A;  2LMT A;  1KQV A;  2WOS A;  1SL8 A;  1CDL A;  4USL A;  4D1E A;  5I8N A;  2YGU A;  4PHK A;  3B6X A;  1BF5 A;  2BL0 C;  1M45 A;  2BKI B;  3TDZ A;  1JC2 A;  2CCM A;  1SMG A;  1UUR A;  1IJ5 A;  1DGV A;  1J1E A;  2LMV A;  1B8L A;  1SPY A;  1YX8 A;  3D77 A;  3MSE B;  2JNX A;  4JD9 A;  2QPT A;  2HPS A;  4YGB B;  2HF5 A;  3CTN A;  4PAL A;  4MRY A;  1IRJ A;  3LL8 B;  3SIB A;  1JBA A;  2K7D A;  2LVI A;  1TNX A;  2PAS A;  3WXA A;  1Y1X A;  2CNP A;  1S36 A;  4HRG A;  3WNX B;  5JJG A;  1DGU A;  3ICB A;  1B7T Y;  2KQ6 A;  2I2R E;  1XK4 A;  4PE0 A;  1BMO A;  5KTY A;  1J1D A;  4PHM A;  2VRG A;  2ZKM X;  2ZNE A;  4XJK A;  3PLF B;  1FI6 A;  4OV2 A;  4U8D A;  1SK6 D;  2QDI A;  5FYX A;  2GGZ A;  1UHN A;  4A4B A;  2Y4Q A;  1DJW A;  1KK7 Z;  3B87 A;  3EG5 B;  3S0G A;  3CYZ A;  1C7V A;  4JQ0 D;  4NDC A;  1BOC A;  1BOD A;  2DOQ A;  1KCY A;  3M0W A;  1KWO C;  2JQ6 A;  4MSP A;  1CDP A;  1L2O C;  1YUU A;  4MZJ A;  1REC A;  3R1V A;  3RLZ A;  1K93 D;  1SBJ A;  3PFV A;  5GQQ C;  5AFP A;  3O2P A;  5ER4 X;  2F3Z A;  3DF0 B;  4P5O E;  1OOG A;  1XK4 C;  3AKB A;  4E68 A;  2BCB A;  5DKQ A;  1IG5 A;  4UPG A;  3R72 A;  1B4C A;  2KLD A;  1C3Y A;  1QX5 B;  2FOT A;  2L2E A;  1Z2C B;  2F8P A;  4N1G A;  4CPV A;  3SS5 A;  1CDM A;  1BJF A;  3VB1 A;  1E8A A;  2ZN8 A;  1RWY A;  2L2C A;  2KLE A;  1PK0 D;  2LP2 A;  3BUO B;  3D75 A;  3EK8 A;  2WCE A;  4IL1 A;  4OVN F;  2GV5 A;  3DVK A;  1S6C A;  3I5H B;  3DYE A;  3WHT B;  1IIO A;  1W7I B;  1M31 A;  1AP4 A;  1F71 A;  2BCX A;  1S6J A;  1FBV A;  2Q91 A;  1DF0 A;  1XA5 A;  1LA0 A;  2BKH B;  4I5N B;  1C3Z A;  3TS5 C;  1XVJ A;  1F4O A;  2KOT A;  3ZWH A;  1OQP A;  3OP0 A;  4ZCV A;  1V1F A;  2F2O A;  2KI4 C;  3S0A A;  2O60 A;  1U5I B;  1TNQ A;  1SKT A;  1SYM A;  5J3X A;  2ISD A;  2KAY A;  2JOJ A;  1SCM C;  3BYA A;  2CT9 A;  1QLK A;  4GUK A;  2G9B A;  2I7A A;  1TUZ A;  5AER A;  1NUB A;  2L98 A;  2HET A;  2WCL A;  3LCP C;  3PSR A;  3HCM A;  2KAV A;  1A4P A;  2L4H A;  1MQ1 A;  2M7N A;  2P70 A;  1J7R A;  1KSO A;  1YUS A;  3EVV A;  1QV0 A;  2WOR A;  1SRA A;  3JVT B;  3R1P A;  2MAZ A;  2R2I A;  3K1E A;  2KHN A;  4INX A;  5DKN A;  3S0E A;  5KSZ A;  4YGA A;  1KK7 Y;  1WRZ A;  4PE4 A;  4OKH A;  4CID A;  1YR5 A;  4AOM A;  1DT7 B;  1WDC B;  2PAL A;  2JXC A;  4DCK A;  5HYD A;  1KSM A;  1V1G A;  1G4Y R;  3JTD B;  4GGN A;  4C0L A;  3L47 A;  2EC6 B;  2B1U A;  2JRF A;  2E6W A;  1DQE A;  4M2O A;  1B7T Z;  2LHL A;  1F8H A;  1XYD A;  1LKJ A;  2K7O A;  1ZAC A;  3BUX B;  4R1E A;  2F2P A;  2L5X B;  2BBM A;  2K0J A;  4ORB B;  1DTL A;  4A4C A;  1YVH A;  2O5G A;  2BE4 A;  2KBM A;  1ODB A;  3EKJ A;  5I94 A;  1TWO A;  3CZ1 A;  2L0P A;  3SS4 A;  1J7P A;  1KFU S;  1ZMZ A;  4YBH B;  1QWV A;  1KFX L;  1TCO B;  4MRX A;  4AQJ A;  3L4L A;  2OS8 B;  4PHN A;  2KSP A;  2JWW A;  1A75 A;  1ALW A;  3CGA A;  2SAS A;  3BXK A;  4INW A;  3DVE A;  3BJH A;  2K2A A;  2WC8 A;  1AHR A;  2LLU A;  3VRP A;  1MF8 B;  1DVI A;  2K7C A;  1LIN A;  2FCD A;  1MXE A;  1QIV A;  2WC6 A;  1IKU A;  2M9G A;  1LS8 A;  4CLN A;  3BQ3 A;  1W9Z A;  3WHU B;  5HKW A;  2L51 A;  1B1G A;  1KK8 B;  1G8I A;  1M39 A;  3D78 A;  1J55 A;  3NSL A;  2WCM A;  3CWG A;  2ZRT A;  3D0Y A;  3NHI A;  1UP5 A;  1SW8 A;  5AXI A;  2LLS A;  4MN0 A;  1DJY A;  1YVL A;  1S5G Y;  2KDH A;  2SCP A;  1NP8 A;  2PSR A;  1DJX A;  1OE9 B;  5F6T A;  1IGV A;  2M0R A;  2JXL A;  1K94 A;  1EXR A;  3E3R A;  4GGF A;  3KPX A;  4GAO A;  3D74 A;  2ERB A;  4NDB A;  3CLN A;  2BEC A;  5FI2 A;  1PRW A;  2M1K B;  5CSF A;  1NCY A;  1H4B A;  1S1E A;  4IJ7 A;  3PM8 A;  1QV1 A;  2K60 A;  4PCW A;  2PVB A;  5FI7 A;  3SG5 A;  1FPW A;  1QIW A;  1GGZ A;  3AAK A;  1CTR A;  3K21 A;  3O6B A;  5BPJ A;  5D69 A;  3SJS A;  4BY5 A;  1TCF A;  3UO9 A;  2AUC A;  2RGI A;  1W7J B;  1NYA A;  2I18 A;  3FWB A;  1AVS A;  5I2O A;  1C07 A;  3SG4 A;  1TNP A;  4GGF C;  3CZ0 A;  3EK7 A;  3EKH A;  2BNX A;  1CFF A;  3CDN A;  1ZUZ A;  3NSK A;  1QTX A;  2K7B A;  2KFG A;  1UHK A;  3PN7 B;  1OW4 A;  1ZFS A;  1SNL A;  3PAT A;  4N1F A;  4OR9 B;  2MHH A;  2BBN A;  3TUY B;  2AMI A;  1N2D A;  1JF2 A;  1UUS A;  1YTZ C;  1SY9 A;  2JT8 A;  3I5G B;  3NHT A;  3D73 A;  4M2P A;  1CNP A;  1CMF A;  2M8U A;  1UHJ A;  1NCX A;  4Q04 A;  1F54 A;  2JPT A;  3JTD C;  1K96 A;  2M29 A;  4F7F A;  1NCZ A;  1PVA A;  3I5I C;  1XFV O;  3SG7 A;  1R2U A;  1PSB A;  1EJ3 A;  5CPV A;  1CM1 A;  2F33 A;  3BFB A;  3VRR A;  3AAJ A;  4YI9 A;  2WCB A;  3EK4 A;  1WRK A;  1BLQ A;  2GTE A;  3OBV A;  2QEO A;  1F4Q A;  1RJV A;  4DIR A;  3BFH A;  3CR4 X;  2JZI A;  2MRD A;  1RFJ A;  3LK1 A;  2BL0 B;  4I5J A;  2BE6 A;  2M3W A;  2LM5 A;  2V53 A;  4YGD B;  2Y1N A;  4ICB A;  4JWQ A;  1JFK A;  5PAL A;  2L4I A;  1G33 A;  2JPO A;  1CFP A;  2OTG C;  3CZ2 A;  4KYN A;  1FI5 A;  1GM0 A;  2JT0 A;  2L50 A;  5HL1 A;  2H8V A;  2QEB A;  1TNW A;  2HQW A;  1YRU B;  1LVC D;  4DUQ A;  5DIC A;  4CFR A;  4MBE A;  2QAC A;  4DRW A;  1AUI B;  1SR6 C;  3BOW B;  5B8I B;  2LNK A;  3V2L A;  1GQM A;  1DEL A;  1S5G Z;  4YRU A;  1QX2 A;  1CMG A;  3GK1 A;  4ORA B;  1B9A A;  1X02 A;  3PJI A;  1IH0 A;  3OX5 A;  3B86 A;  1QAT A;  1N0Y A;  1QJT A;  1RRO A;  3HX4 A;  3ZNI A;  4F0Z B;  1SCV A;  4YI8 A;  1SL7 A;  1LA3 A;  1TUJ A;  1PAL A;  2NCP A;  1BT6 A;  1XO5 A;  1MUX A;  1K8U A;  2EGD A;  2KPH A;  4OZD A;  3VGO A;  1DC1 A;  1M63 B;  1Y0V H;  4PE7 A;  5EL2 A;  3BUW B;  1R6P A;  1S3P A;  5HKY A;  4ZCU A;  3FE6 A;  4NDD A;  1F70 A;  3IVT A;  1KFU L;  2NZ0 A;  4MZL A;  1OOI X;  2JNF A;  4OCI A;  1LXF C;  4XJK B;  3DF0 A;  2HQ8 A;  3CR2 A;  2KYC A;  1K9U A;  1ZOT B;  2L5Y A;  3CS1 A;  3QRX A;  5ER5 A;  1WY9 A;  1JUO A;  4P2Y B;  1FF1 A;  4FQT A;  3IQO A;  5HLO A;  1A29 A;  2ZFD A;  1JWD A;  3UNW A;  2FJU B;  3CR5 X;  2P6B B;  3O4Y A;  1YRT B;  5CSN A;  1NIW A;  3OGN A;  3S0B A;  2LVJ A;  2EHB A;  1CFC A;  4JKT A;  1CM4 A;  1VRK A;  2WC5 A;  3RM1 A;  1S26 D;  1MXL C;  1NX2 A;  1YX7 A;  2Q4U A;  1QX7 A;  4BY4 A;  1P28 A;  2KI4 B;  3F45 A;  3L4A A;  1M46 A;  1NX0 A;  3A8R A;  3D10 A;  2JU0 A;  3RZS A;  1SCM B;  3SG3 A;  3NXA A;  4NQG A;  2JUL A;  3SS3 A;  2KI6 C;  3GK2 A;  3LLE A;  2WCF A;  1XFY O;  2LC5 A;  1NX3 A;  3I5F B;  4WQ2 A;  1HT9 A;  3S0D A;  1OZO A;  2JC2 A;  2M97 A;  4N5X A;  1CLM A;  2G2B A;  4WRI A;  3BUM B;  3GOF A;  3LK0 A;  1Q80 A;  1TOP A;  3NGV A;  1DF0 B;  1OOH A;  3CZT X;  1UWO A;  1B8R A;  5I2L A;  3TDI A;  3I5H C;  1OMV A;  2KGR A;  3EVU A;  1TRF A;  2E30 A;  2F3Y A;  2H2K A;  2NLN A;  2ZN9 A;  2QEV A;  3B88 A;  3SG6 A;  1CLL A;  1QAS A;  1AK8 A;  1FW4 A;  1Y1A A;  1EG3 A;  1KQM B;  3SIA A;  2K2F A;  2LLT A;  3VRN A;  1Z4H A;  4QJ5 B;  1D1O A;  1WRL A;  2KNE A;  3IQQ A;  1BG1 A;  2KQY A;  1RK9 A;  5HLV A;  3OHM B;  1XFU O;  5D3O A;  2M49 B;  1JF0 A;  1OMR A;  1PSR A;  1B8C A;  1B47 A;  4MVF A;  1WLM A;  4XYN A;  3FWC A;  3PAL A;  3R1O A;  1GGW A;  1NX1 A;  1K95 A;  2D8N A;  2LAP A;  3JVT C;  3C1V A;  1H8B A;  1QLS A;  1QVI Z;  2TN4 A;  5FI6 A;  1AJ4 A;  1CFD A;  4M2Q A;  3TZ1 A;  1K9K A;  1NWD A;  2ZND A;  1WDC C;  5AAN A;  1DJG A;  2KYF A;  4I5K A;  3DY9 A;  1XFR A;  1WLZ A;  2PQL A;  4FTG A;  1CB1 A;  2EC6 C;  1PUL A;  2MLE C;  3NSO A;  2JTZ A;  2LHI A;  1EH2 A;  1DJH A;  2KGB C;  2LUX A;  2FCE A;  1TTX A;  1T14 A;  3AKA A;  3DVJ A;  1N65 A;  1YUT A;  5HKZ A;  1OOJ A;  3VRO A;  1BR4 B;  1C7W A;  2IS9 A;  4HSZ A;  1XFX O;  2LUC A;  2KFH A;  3EVR A;  3B7A A;  1ALV A;  1A75 B;  4I5L B;  4HRE E;  4YGE B;  1K2H A;  4L9M A;  4C0K A;  3SG2 A;  3QME A;  3BFA A;  1EG4 A;  2LE9 B;  5D7F A;  2OS8 C;  1F55 A;  2KI6 D;  1YUR A;  2LVK A;  2WCJ A;  3FE9 A;  3KO0 A;  4WQ3 A;  1IJ6 A;  1NPQ A;  4FQO A;  1Y6W A;  1DMO A;  2JT3 A;  4TNC A;  2M1U A;  3D76 A;  2P71 A;  3TDU A;  3OB2 B;  1A2X A;  1SL9 A;  1CKK A;  3GK4 X;  4GBA A;  3D0Y B;  2NCO A;  2WCK A;  1XFW O;  1JFJ A;  3KF9 A;  4QJ4 B;  1DEK A;  4C0J A;  2COL B;  2JTT A;  2CBL A;  2PMY A;  3OX6 A;  5AEQ A;  2CTN A;  1KK8 C;  3DZT A;  4AQI A;  2BCA A;  2MA2 A;  3DD4 A;  3IF7 A;  1KWO B;  1RTP 1;  1MR8 A;  1QS7 A;  1OMD A;  1L2O B;  3Q8I A;  2LP3 A;  3I5F C;  1QVI Y;  5DKR A;  3A4U B;  3O4X A;  4ORC B;  5G08 A;  1CLB A;  4HRH A;  2MBX A;  3FE8 A;  4YGC B;  2A4J A;  1IWQ A;  2LVV A;  3KEV A;  3DVM A;  4PHJ A;  1TN4 A;  1L7Z A;  1Y1U A;  2ZRS A;  4GFT A;  5CSJ A;  2AAO A;  1A03 A;  4GNK B;  1GJY A;  5I2Q A;  4CFQ A;  1BR1 B;  4PT1 A;  1OSA A;  1JSA A;  4GPL B;  1TIZ A;  2LAN A;  2MLF C;  1IQ3 A;  2LCP A;  2KBI A;  2Y5I A;  3I5I B;  4PDZ A;  3KHE A;  1EL4 A;  3DXL A;  2M7L A;  4JPZ B;  1K90 D;  1MHO A;  2LV7 A;  1KQM C;  2BAP A;  4ETO A;  2KAX A;  2NXQ A;  5IBW A;  2WCH A;  1DJZ A;  2I94 A;  3O78 A;  3S0F A;  1UHH A;  3FIA A;  2KFF A;  1XFZ O;  3TS5 B;  1QXP A;  3VRQ A;  3BUN B;  2H61 A;  2K61 A;  2Y1M A;  5CSI A;  4PE1 A;  2WND A;  3CAB A;  3FS7 A;  1CDN A;  3H4S E;  1OZS A;  1ORG A;  2OTG B;  1AJ5 A;  1HQV A;  4MLW A;  1S6I A;  3PN7 C;  2PYQ A;  3OB1 B;  5TNC A;  1J7O A;  1J7Q A;  1IQ5 A;  2LMU A;  2CXJ A;  2QEH A;  1KFX S;  1DJI A;  2PRU A;  4DS7 A;  3TUY C;  2K8M B;  5KU1 A;  1U5I A;  1K9P A;  1SR6 B;  3I5G C;  2GGM A;  1BU3 A;  5JOL A;  1OOF A;  4MZK A;  1PVB A;  4MEW A; 
#chains in the Genus database with same CATH homology
 1DQE A;  3N7H A;  2JPO A;  3CZ2 A;  1GM0 A;  2H8V A;  2QEB A;  2FJY A;  5DIC A;  3DY9 A;  1XFR A;  1TWO A;  3CZ1 A;  3V2L A;  2PQL A;  3B6X A;  1QWV A;  3D77 A;  3L4L A;  4JD9 A;  1T14 A;  3PJI A;  3B86 A;  4INW A;  3BJH A;  1TUJ A;  3B7A A;  2KPH A;  2WC6 A;  3QME A;  4OZD A;  3BFA A;  1LS8 A;  5EL2 A;  3D78 A;  2WCJ A;  3FE9 A;  3FE6 A;  2WCM A;  2QDI A;  3NHI A;  3B87 A;  3S0G A;  1OOI X;  3CYZ A;  3D76 A;  2P71 A;  2WCK A;  3R1V A;  4FQT A;  3D74 A;  2ERB A;  3DZT A;  1OOG A;  3OGN A;  3S0B A;  3R72 A;  1C3Y A;  3Q8I A;  2WC5 A;  1P28 A;  3L4A A;  3VB1 A;  3FE8 A;  2L2C A;  3D75 A;  3RZS A;  3DYE A;  4PT1 A;  3CZ0 A;  3S0D A;  1C3Z A;  3CDN A;  3DXL A;  3S0A A;  1OW4 A;  3NGV A;  1OOH A;  2WCH A;  3R1O A;  3S0F A;  3NHT A;  2WCL A;  2QEV A;  3B88 A;  3D73 A;  2P70 A;  4F7F A;  3CAB A;  3S0E A;  3R1P A;  1ORG A;  3K1E A;  4INX A;  3BFB A;  2QEH A;  2GTE A;  2QEO A;  3BFH A;  3L47 A;  1OOF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...