2QEHA

Crystal structure of anopheles gambiae d7r4-serotonin complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
145
structure length
145
Chain Sequence
METVQDCENKLPPSLKSRLCEIRRYEIIEGPEMDKHIHCVMRALDFVYEDGRGDYHKLYDPLNIIELDKRHDVNLEKCIGECVQVPTSERAHVFYKCLLKSTTGRTFKKVFDLMELKKAGKVPQHQRYTAEFVQIMKDYDKALNC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D7R4 Protein
publication title The Crystal Structure of D7r4, a Salivary Biogenic Amine-binding Protein from the Malaria Mosquito Anopheles gambiae
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Ligand binding protein
total genus 54
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2007-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2qehA00
3S0EA 4OZDA 3CDNA 3D73A 2QDIA 2QEOA 3DYEA 1OW4A 3D77A 3N7HA 3OGNA 2GTEA 3R1VA 3L4LA 3B88A 3CYZA 3S0BA 3D74A 1C3YA 2L2CA 4FQTA 3CABA 3K1EA 2WC6A 2P71A 2WCMA 3B6XA 2WCLA 1LS8A 2WC5A 3BFBA 2WCJA 3BFAA 2KPHA 4F7FA 4JD9A 3BJHA 2H8VA 3B86A 1TWOA 2WCKA 3CZ1A 2JPOA 1ORGA 3CZ0A 3L4AA 5DICA 1QWVA 1TUJA 3FE8A 3DZTA 1GM0A 1OOHA 5EL2A 1P28A 3S0FA 3D78A 2ERBA 1OOFA 3S0DA 3PJIA 1OOIX 3VB1A 2QEHA 2PQLA 2P70A 3D76A 4PT1A 3Q8IA 3CZ2A 3S0GA 3R72A 3R1OA 3S0AA 3B87A 3NHTA 3RZSA 1DQEA 3BFHA 3FE6A 4INWA 3FE9A 3DXLA 1T14A 3D75A 1XFRA 2QEBA 1C3ZA 3L47A 3NHIA 3B7AA 3NGVA 2WCHA 3R1PA 4INXA 2FJYA 3V2LA 3QMEA 3DY9A 1OOGA 2QEVA
chains in the Genus database with same CATH superfamily
1NIWA 4NDCA 1JFKA 2EC6C 4PDZA 2M1KB 1BG1A 1F71A 1NX3A 1YTZC 2QDIA 2QEOA 2L51A 1S6CA 4OKHA 4D1EA 3DYEA 3ICBA 1OW4A 1MQ1A 1PSBA 3SG6A 3DVJA 3HCMA 4JQ0D 3O2PA 5F6TA 5AXIA 4IJ7A 4N1GA 4FTGA 1CDNA 3IF7A 1SCMC 2GTEA 3D0YA 4PCWA 1PK0D 2BAPA 1DJGA 2LNKA 3R1VA 2JZIA 2JTTA 1KWOC 3VRPA 5I8NA 4A4BA 2EC6B 2F3ZA 4YGEB 2LHLA 2KI6C 1CKKA 3LL8B 2F2PA 1NP8A 1C3YA 1HQVA 1F55A 1XFUO 3GK4X 2M0RA 4MZKA 3NSKA 3TUYB 1GJYA 1RWYA 2L2CA 3FS7A 3I5IB 3SIBA 4PE4A 3IVTA 2NZ0A 1KWOB 5I2QA 1NX1A 4GBAA 2KHNA 1B8LA 3ZWHA 4GFTA 5TNCA 3B6XA 3EK7A 4YI9A 1CM4A 1OMRA 1OSAA 3EG5B 3RZSA 1LS8A 1XFVO 2JC2A 2JT8A 4N1FA 4PHMA 1N65A 3JVTC 1M46A 1XVJA 1R2UA 3O6BA 2LLTA 2KQ6A 3M0WA 1Y1XA 1CLBA 1MF8B 1H4BA 3E3RA 2KPHA 1TUZA 3UO9A 2BE4A 1W7IB 2KBMA 1DJWA 4JD9A 1K9UA 2O5GA 1DELA 2M7LA 2WCEA 1TCFA 2O60A 2ZNEA 1CDLA 1G4YR 2KAVA 1QWVA 2MHHA 2M29A 2AUCA 1SK6D 2CBLA 1IRJA 1TCOB 1P28A 4HREE 2F2OA 4WRIA 4JWQA 2KYCA 1S26D 1D1OA 2JTZA 2OS8B 4M2OA 2LAPA 2CCMA 4YRUA 1FI6A 2H61C 2PSRA 1DC1A 3BUNB 2HQ8A 2LMVA 4PE7A 1DGVA 4DUQA 4QJ4B 5G08A 1JBAA 1OOIX 3RLZA 1DEKA 2PQLA 3KHEA 4DS7A 3H4SE 1BOCA 1QLSA 4NDDA 1OQPA 4YGBB 1A75B 1EH2A 1V1FA 2M3WA 1S6JA 3BYAA 5D3OA 2ISDA 2HPSA 3SIAA 2K0JA 2WCFA 1SY9A 2K61A 1RECA 4XYNA 3S0AA 1L2OB 1C07A 4U8DA 4GGNA 3BUOB 2KI4C 1SYMA 3NHTA 3SG7A 3SG4A 1NSHA 1AHRA 2JQ6A 2M7NA 3EVVA 1E8AA 2LMUA 2HQWA 4CIDA 4AOMA 4P5OE 2BKIB 2K7BA 4MRYA 4ORAB 5AANA 1YX8A 3DF0B 3EK4A 1XFRA 5IBWA 2QEBA 4OR9B 5DKNA 4UPGA 1A75A 1NWDA 2L2EA 1XFYO 3A4UB 2KSPA 3KF9A 3FWBA 3JTDB 1IGVA 1N0YA 2PRUA 2H61A 3QRXA 2RGIA 1J7OA 4C0LA 3CDNA 3KPXA 1KSMA 2LVJA 1JUOA 5ER4X 2L98A 5ER5A 1W9ZA 3D77A 3BUMB 1B1GA 1CFDA 3N7HA 2L5XB 3DF0A 5FI7A 3CZTX 1KFXL 3SG5A 1Y1AA 1XFXO 4DRWA 1K96A 4QJ3B 2Q4UA 3L4LA 3AKAA 1NYAA 2B1UA 3B88A 2SASA 3EK8A 3HX4A 4ORCB 1TNPA 2LC5A 1LINA 1FF1A 1FW4A 4PALA 4AQJA 4PHNA 1B7TZ 1RTP1 2NXQA 2ZN8A 1LA3A 2LUXA 1OOJA 1QV0A 1K90D 1RROA 3TS5C 4FQTA 1K95A 1SRAA 3I5HB 3IQOA 2FJUB 3K1EA 1EXRA 1JSAA 2BL0C 3LCPC 2E6WA 5AFPA 1DJIA 1XK4C 1NPQA 3NSIA 4TNCA 1M31A 2KI6D 2WC5A 1CLMA 2PMYA 1IJ6A 3CLNA 2LANA 1Z2CB 1WDCC 3GK2A 3A8RA 1TTXA 3BFBA 2BE6A 3NSOA 1BR4B 1M45A 2WCJA 3PM8A 1WRKA 4I5LB 2BCAA 3OB2B 3TS5B 1W7JB 1R6PA 1CLLA 2NLNA 3K21A 4AQIA 1NCZA 4PHJA 3BJHA 2H8VA 1J1EA 3I5GC 4OV2A 3PFVA 2BL0B 3NSLA 2L0PA 3AKBA 4OVNF 4YGAA 1EL4A 2K8MB 3BQ3A 1KCYA 1WLMA 2JNXA 5DICA 1CDPA 4DIRA 5FYXA 1SKTA 1SCMB 2M49B 3DZTA 1NCYA 4MRXA 2NCPA 4GAOA 1GM0A 1QTXA 1A03A 4GNKB 2JU0A 1QS7A 1DGUA 3DVMA 4HSZA 1K93D 3EVRA 3I5GB 4I5NB 3PLFB 2OPOA 1JF2A 3OP0A 1J7QA 1XK4A 2Y5IA 1OMVA 1ZUZA 2G2BA 1SL7A 2PYQA 2JXLA 3DD4A 3D76A 4MVFA 2K2AA 3EVUA 1IIOA 1KFXS 3PALA 4P2YB 3NXAA 3R72A 5FI2A 2CTNA 1BMOA 1ZMZA 2HF5A 2WOSA 3JVTB 3LLEA 1BODA 3KO0A 3TDIA 4NDBA 1PSRA 1BLQA 1AK8A 2LP2A 3DVKA 3BFHA 4GPLB 4M2QA 3O4YA 1FBVA 1QLKA 2EGDA 1KQMC 3OX6A 2CT9A 5HLVA 2BCBA 2I18A 2L5YA 3SS4A 4I5JA 3MSEB 5J3XA 3SS3A 1BU3A 2LLSA 1K9PA 1QV1A 1A2XA 1GQMA 2NCOA 5KTYA 3B7AA 2BKHB 3NGVA 4INXA 4PHKA 2FJYA 1IKUA 3QMEA 4ICBA 3DY9A 2PALA 2JOJA 3PATA 1UWOA 1DVIA 1YUSA 2E30A 1NX2A 4XJKB 1S5GZ 2FCDA 2GGZA 3D73A 4N5XA 4BY4A 1CM1A 2I94A 1KQMB 1NUBA 1S5GY 2Q91A 2KDHA 2ZN9A 3RM1A 2Y1MA 1DJXA 1J7RA 3OGNA 3D10A 3CGAA 2KAYA 1BF5A 1SNLA 3F45A 1AVSA 1MXLC 2LVIA 1GGWA 1A4PA 2M97A 1CB1A 1IG5A 1WRLA 2K2FA 1PALA 3CYZA 2MRDA 5D69A 4XJKA 2LUCA 1TRFA 2PASA 2QPTA 1XFZO 3D74A 4YGDB 1WRZA 2LVVA 1QIWA 2LCPA 1S36A 2I7AA 2M8UA 3ZNIA 2KI4B 1UUSA 2F8PA 1KK7Z 1SL9A 3EKJA 5K89A 3CABA 1RFJA 2WC6A 2JWWA 4CLNA 5JJGA 2P71A 4YI8A 5KU1A 1TNQA 1YVHA 1PULA 1N2DA 2JNFA 1B8CA 2KQYA 2WCLA 3TDZA 2OTGC 2MA2A 4WQ3A 4MZLA 2M1UA 2WORA 1DTLA 5HKWA 2M9GA 1LKJA 2MBXA 1UHIA 1K94A 4PE0A 4JKTA 2PVBA 1CNPA 3CS1A 2KFHA 1CFPA 2WNDA 1NCXA 1SR6C 5JOLA 1XO5A 1SW8A 4MEWA 4MSPA 2K7DA 3PN7C 3DVEA 1TWOA 1U5IB 1UHJA 2JPOA 2KAXA 2MLFC 2WCKA 1QVIZ 3CZ1A 4PE1A 1CFCA 2OTGB 1RJVA 1AP4A 5HKYA 4NQGA 4HRGA 1B7TY 1QVIY 4JPZB 1BT6A 1KK8C 3CWGA 1H8BA 3FE8A 1F54A 3VRQA 2FCEA 1ZACA 1F4QA 1AJ5A 2CXJA 1EG3A 3CR2A 3SJSA 1QX5B 1CMFA 2KGRA 2FOTA 2H2KA 2YGUA 3S0FA 1SR6B 3OB1B 1YRUB 3TDUA 1UURA 3PN7B 3D78A 1ZOTB 5CSNA 1F8HA 1J7PA 1U5IA 4YGCB 2BBMA 1AJ4A 4GUKA 4Q04A 5I2LA 3WHUB 2K7CA 2L4HA 2G9BA 2VRGA 3WHTB 2KGBC 1PVBA 2I2RE 3PJIA 2JRFA 4F0ZB 1OMDA 4C0JA 2QEHA 1DMOA 1EJ3A 1UHNA 2P70A 1F4OA 4A4CA 1SPYA 1V1GA 1XYDA 1B4CA 2GV5A 1YUUA 2K60A 3CZ2A 4OCIA 3S0GA 1OZSA 4MZJA 1DJYA 1LA0A 3SG2A 1QJTA 3SG3A 5KSZA 1WDCB 3R1OA 4MN0A 5CPVA 3FIAA 3VROA 3TUYC 2KNEA 2ZFDA 3CR5X 1YURA 3I5IC 1DF0A 3FE6A 1Y6WA 4CPVA 1MXEA 1K2HA 2L50A 5BPJA 5AEQA 1BR1B 1SBJA 5DKRA 1CMGA 2MAZA 5AERA 1F70A 1VRKA 1C3ZA 2CNPA 3L47A 1Q80A 3CTNA 1DT7B 1J1DA 3R1PA 1IWQA 1QX2A 1S6IA 4ORBB 5HLOA 3O78A 1L7ZA 2QACA 2QEVA 2WCBA 3S0EA 1IJ5A 4QJ5B 4OZDA 3SS5A 2KLDA 2KOTA 3LK0A 1QASA 1EG4A 1Z4HA 2KBIA 2LMTA 3VGOA 2ZRSA 2DOQA 5I2OA 1KQVA 1TIZA 1CTRA 3EKHA 1G33A 1WLZA 2KLEA 2JPTA 1TN4A 1YUTA 2SCPA 1CFFA 1ZFSA 1KFUL 2F3YA 4YBHB 3S0BA 1Y0VH 1ALWA 3CR4X 3OX5A 5B8IB 1UHKA 4IL1A 2LV7A 3WXAA 1M63B 4MLWA 1OZOA 1A29A 1UP5A 2KYFA 2OS8C 3OBVA 1BJFA 1LXFC 1RK9A 1SCVA 5HYDA 2AMIA 3I5FC 3VRNA 1IH0A 4FQOA 1YX7A 3BUXB 2KFFA 1JF0A 5PALA 4I5KA 2WCMA 3OHMB 1UHHA 3GOFA 1IQ5A 3BOWB 2R2IA 1OE9B 1DJZA 1C7VA 2LVKA 3FWCA 1YR5A 1X02A 4BY5A 1SL8A 1L2OC 3GK1A 1QATA 2L4IA 1QIVA 1TOPA 1G8IA 4USLA 1S1EA 2LHIA 3BFAA 2BNXA 3I5FB 2MJWB 1B8RA 2JT3A 4F7FA 2TN4A 3IQQA 5D7FA 1AUIB 3B86A 3TZ1A 2D8NA 2A4JA 1FI5A 1B9AA 3BUWB 1MR8A 3AAKA 1ORGA 2IS9A 3CZ0A 1GGZA 4CFQA 2KFGA 3BOWA 1MUXA 3L4AA 2P6BB 4GGFC 4L9MA 4CFRA 2ZNDA 1K8UA 1PVAA 1TUJA 1XFWO 3VRRA 2Y1NA 1OOHA 3JTDC 5EL2A 1KSOA 1Y1UA 4WQ2A 1KK7Y 1K9KA 2COLB 1PRWA 4HRHA 4KYNA 1QXPA 1QX7A 5CSJA 4ZCUA 1HT9A 4DCKA 1TNXA 1S3PA 1NX0A 2ERBA 1OOFA 4ETOA 2F33A 1JWDA 2BECA 1JC2A 1FPWA 1IQ3A 3BXKA 2JXCA 3S0DA 3O4XA 1MWNA 3AAJA 5CSIA 2AAOA 3VB1A 1J55A 4E68A 1SSEB 4ZCVA 4PT1A 1YRTB 3KEVA 1MHOA 3Q8IA 2V53A 5GQQC 1JFJA 1M39A 2EHBA 2LP3A 1CDMA 5DKQA 1B47A 2BBNA 2BCXA 3B87A 5I94A 4MBEA 2HETA 2LE9B 1DQEA 1SMGA 1YVLA 2WC8A 2Y4QA 1KFUS 3UNWA 1ODBA 1ALVA 1TNWA 2GGMA 3I5HC 4GGFA 2ZKMX 2LLUA 4INWA 4M2PA 5CSFA 5HKZA 2MLEC 2ZRTA 3PM2A 3FE9A 3DXLA 1T14A 3PSRA 1DJHA 3C1VA 3D75A 2K7OA 5FI6A 2JT0A 3NHIA 2LM5A 1DF0B 1WY9A 2WCHA 3D0YB 1C7WA 1KK8B 3LK1A 3V2LA 4C0KA 5HL1A 2JULA 1XA5A 3WNXB 1OOGA 4R1EA 1LVCD
chains in the Genus database with same CATH topology
3S0EA 4OZDA 3CDNA 3D73A 2QDIA 2QEOA 3DYEA 1OW4A 3D77A 3N7HA 3OGNA 2GTEA 3R1VA 3L4LA 3B88A 3CYZA 3S0BA 3D74A 1C3YA 2L2CA 4FQTA 3CABA 3K1EA 2WC6A 2P71A 2WCMA 3B6XA 2WCLA 1LS8A 2WC5A 3BFBA 2WCJA 3BFAA 2KPHA 4F7FA 4JD9A 3BJHA 2H8VA 3B86A 1TWOA 2WCKA 3CZ1A 2JPOA 1ORGA 3CZ0A 3L4AA 5DICA 1QWVA 1TUJA 3FE8A 3DZTA 1GM0A 1OOHA 5EL2A 1P28A 3S0FA 3D78A 2ERBA 1OOFA 3S0DA 3PJIA 1OOIX 3VB1A 2QEHA 2PQLA 2P70A 3D76A 4PT1A 3Q8IA 3CZ2A 3S0GA 3R72A 3R1OA 3S0AA 3B87A 3NHTA 3RZSA 1DQEA 3BFHA 3FE6A 4INWA 3FE9A 3DXLA 1T14A 3D75A 1XFRA 2QEBA 1C3ZA 3L47A 3NHIA 3B7AA 3NGVA 2WCHA 3R1PA 4INXA 2FJYA 3V2LA 3QMEA 3DY9A 1OOGA 2QEVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S0E A;  4OZD A;  3CDN A;  3D73 A;  2QDI A;  2QEO A;  3DYE A;  1OW4 A;  3D77 A;  3N7H A;  3OGN A;  2GTE A;  3R1V A;  3L4L A;  3B88 A;  3CYZ A;  3S0B A;  3D74 A;  1C3Y A;  2L2C A;  4FQT A;  3CAB A;  3K1E A;  2WC6 A;  2P71 A;  2WCM A;  3B6X A;  2WCL A;  1LS8 A;  2WC5 A;  3BFB A;  2WCJ A;  3BFA A;  2KPH A;  4F7F A;  4JD9 A;  3BJH A;  2H8V A;  3B86 A;  1TWO A;  2WCK A;  3CZ1 A;  2JPO A;  1ORG A;  3CZ0 A;  3L4A A;  5DIC A;  1QWV A;  1TUJ A;  3FE8 A;  3DZT A;  1GM0 A;  1OOH A;  5EL2 A;  1P28 A;  3S0F A;  3D78 A;  2ERB A;  1OOF A;  3S0D A;  3PJI A;  1OOI X;  3VB1 A;  2QEH A;  2PQL A;  2P70 A;  3D76 A;  4PT1 A;  3Q8I A;  3CZ2 A;  3S0G A;  3R72 A;  3R1O A;  3S0A A;  3B87 A;  3NHT A;  3RZS A;  1DQE A;  3BFH A;  3FE6 A;  4INW A;  3FE9 A;  3DXL A;  1T14 A;  3D75 A;  1XFR A;  2QEB A;  1C3Z A;  3L47 A;  3NHI A;  3B7A A;  3NGV A;  2WCH A;  3R1P A;  4INX A;  2FJY A;  3V2L A;  3QME A;  3DY9 A;  1OOG A;  2QEV A; 
#chains in the Genus database with same CATH topology
 1NIW A;  4NDC A;  1JFK A;  2EC6 C;  4PDZ A;  2M1K B;  1BG1 A;  1F71 A;  1NX3 A;  1YTZ C;  2QDI A;  2QEO A;  2L51 A;  1S6C A;  4OKH A;  4D1E A;  3DYE A;  3ICB A;  1OW4 A;  1MQ1 A;  1PSB A;  3SG6 A;  3DVJ A;  3HCM A;  4JQ0 D;  3O2P A;  5F6T A;  5AXI A;  4IJ7 A;  4N1G A;  4FTG A;  1CDN A;  3IF7 A;  1SCM C;  2GTE A;  3D0Y A;  4PCW A;  1PK0 D;  2BAP A;  1DJG A;  2LNK A;  3R1V A;  2JZI A;  2JTT A;  1KWO C;  3VRP A;  5I8N A;  4A4B A;  2EC6 B;  2F3Z A;  4YGE B;  2LHL A;  2KI6 C;  1CKK A;  3LL8 B;  2F2P A;  1NP8 A;  1C3Y A;  1HQV A;  1F55 A;  1XFU O;  3GK4 X;  2M0R A;  4MZK A;  3NSK A;  3TUY B;  1GJY A;  1RWY A;  2L2C A;  3FS7 A;  3I5I B;  3SIB A;  4PE4 A;  3IVT A;  2NZ0 A;  1KWO B;  5I2Q A;  1NX1 A;  4GBA A;  2KHN A;  1B8L A;  3ZWH A;  4GFT A;  5TNC A;  3B6X A;  3EK7 A;  4YI9 A;  1CM4 A;  1OMR A;  1OSA A;  3EG5 B;  3RZS A;  1LS8 A;  1XFV O;  2JC2 A;  2JT8 A;  4N1F A;  4PHM A;  1N65 A;  3JVT C;  1M46 A;  1XVJ A;  1R2U A;  3O6B A;  2LLT A;  2KQ6 A;  3M0W A;  1Y1X A;  1CLB A;  1MF8 B;  1H4B A;  3E3R A;  2KPH A;  1TUZ A;  3UO9 A;  2BE4 A;  1W7I B;  2KBM A;  1DJW A;  4JD9 A;  1K9U A;  2O5G A;  1DEL A;  2M7L A;  2WCE A;  1TCF A;  2O60 A;  2ZNE A;  1CDL A;  1G4Y R;  2KAV A;  1QWV A;  2MHH A;  2M29 A;  2AUC A;  1SK6 D;  2CBL A;  1IRJ A;  1TCO B;  1P28 A;  4HRE E;  2F2O A;  4WRI A;  4JWQ A;  2KYC A;  1S26 D;  1D1O A;  2JTZ A;  2OS8 B;  4M2O A;  2LAP A;  2CCM A;  4YRU A;  1FI6 A;  2H61 C;  2PSR A;  1DC1 A;  3BUN B;  2HQ8 A;  2LMV A;  4PE7 A;  1DGV A;  4DUQ A;  4QJ4 B;  5G08 A;  1JBA A;  1OOI X;  3RLZ A;  1DEK A;  2PQL A;  3KHE A;  4DS7 A;  3H4S E;  1BOC A;  1QLS A;  4NDD A;  1OQP A;  4YGB B;  1A75 B;  1EH2 A;  1V1F A;  2M3W A;  1S6J A;  3BYA A;  5D3O A;  2ISD A;  2HPS A;  3SIA A;  2K0J A;  2WCF A;  1SY9 A;  2K61 A;  1REC A;  4XYN A;  3S0A A;  1L2O B;  1C07 A;  4U8D A;  4GGN A;  3BUO B;  2KI4 C;  1SYM A;  3NHT A;  3SG7 A;  3SG4 A;  1NSH A;  1AHR A;  2JQ6 A;  2M7N A;  3EVV A;  1E8A A;  2LMU A;  2HQW A;  4CID A;  4AOM A;  4P5O E;  2BKI B;  2K7B A;  4MRY A;  4ORA B;  5AAN A;  1YX8 A;  3DF0 B;  3EK4 A;  1XFR A;  5IBW A;  2QEB A;  4OR9 B;  5DKN A;  4UPG A;  1A75 A;  1NWD A;  2L2E A;  1XFY O;  3A4U B;  2KSP A;  3KF9 A;  3FWB A;  3JTD B;  1IGV A;  1N0Y A;  2PRU A;  2H61 A;  3QRX A;  2RGI A;  1J7O A;  4C0L A;  3CDN A;  3KPX A;  1KSM A;  2LVJ A;  1JUO A;  5ER4 X;  2L98 A;  5ER5 A;  1W9Z A;  3D77 A;  3BUM B;  1B1G A;  1CFD A;  3N7H A;  2L5X B;  3DF0 A;  5FI7 A;  3CZT X;  1KFX L;  3SG5 A;  1Y1A A;  1XFX O;  4DRW A;  1K96 A;  4QJ3 B;  2Q4U A;  3L4L A;  3AKA A;  1NYA A;  2B1U A;  3B88 A;  2SAS A;  3EK8 A;  3HX4 A;  4ORC B;  1TNP A;  2LC5 A;  1LIN A;  1FF1 A;  1FW4 A;  4PAL A;  4AQJ A;  4PHN A;  1B7T Z;  1RTP 1;  2NXQ A;  2ZN8 A;  1LA3 A;  2LUX A;  1OOJ A;  1QV0 A;  1K90 D;  1RRO A;  3TS5 C;  4FQT A;  1K95 A;  1SRA A;  3I5H B;  3IQO A;  2FJU B;  3K1E A;  1EXR A;  1JSA A;  2BL0 C;  3LCP C;  2E6W A;  5AFP A;  1DJI A;  1XK4 C;  1NPQ A;  3NSI A;  4TNC A;  1M31 A;  2KI6 D;  2WC5 A;  1CLM A;  2PMY A;  1IJ6 A;  3CLN A;  2LAN A;  1Z2C B;  1WDC C;  3GK2 A;  3A8R A;  1TTX A;  3BFB A;  2BE6 A;  3NSO A;  1BR4 B;  1M45 A;  2WCJ A;  3PM8 A;  1WRK A;  4I5L B;  2BCA A;  3OB2 B;  3TS5 B;  1W7J B;  1R6P A;  1CLL A;  2NLN A;  3K21 A;  4AQI A;  1NCZ A;  4PHJ A;  3BJH A;  2H8V A;  1J1E A;  3I5G C;  4OV2 A;  3PFV A;  2BL0 B;  3NSL A;  2L0P A;  3AKB A;  4OVN F;  4YGA A;  1EL4 A;  2K8M B;  3BQ3 A;  1KCY A;  1WLM A;  2JNX A;  5DIC A;  1CDP A;  4DIR A;  5FYX A;  1SKT A;  1SCM B;  2M49 B;  3DZT A;  1NCY A;  4MRX A;  2NCP A;  4GAO A;  1GM0 A;  1QTX A;  1A03 A;  4GNK B;  2JU0 A;  1QS7 A;  1DGU A;  3DVM A;  4HSZ A;  1K93 D;  3EVR A;  3I5G B;  4I5N B;  3PLF B;  2OPO A;  1JF2 A;  3OP0 A;  1J7Q A;  1XK4 A;  2Y5I A;  1OMV A;  1ZUZ A;  2G2B A;  1SL7 A;  2PYQ A;  2JXL A;  3DD4 A;  3D76 A;  4MVF A;  2K2A A;  3EVU A;  1IIO A;  1KFX S;  3PAL A;  4P2Y B;  3NXA A;  3R72 A;  5FI2 A;  2CTN A;  1BMO A;  1ZMZ A;  2HF5 A;  2WOS A;  3JVT B;  3LLE A;  1BOD A;  3KO0 A;  3TDI A;  4NDB A;  1PSR A;  1BLQ A;  1AK8 A;  2LP2 A;  3DVK A;  3BFH A;  4GPL B;  4M2Q A;  3O4Y A;  1FBV A;  1QLK A;  2EGD A;  1KQM C;  3OX6 A;  2CT9 A;  5HLV A;  2BCB A;  2I18 A;  2L5Y A;  3SS4 A;  4I5J A;  3MSE B;  5J3X A;  3SS3 A;  1BU3 A;  2LLS A;  1K9P A;  1QV1 A;  1A2X A;  1GQM A;  2NCO A;  5KTY A;  3B7A A;  2BKH B;  3NGV A;  4INX A;  4PHK A;  2FJY A;  1IKU A;  3QME A;  4ICB A;  3DY9 A;  2PAL A;  2JOJ A;  3PAT A;  1UWO A;  1DVI A;  1YUS A;  2E30 A;  1NX2 A;  4XJK B;  1S5G Z;  2FCD A;  2GGZ A;  3D73 A;  4N5X A;  4BY4 A;  1CM1 A;  2I94 A;  1KQM B;  1NUB A;  1S5G Y;  2Q91 A;  2KDH A;  2ZN9 A;  3RM1 A;  2Y1M A;  1DJX A;  1J7R A;  3OGN A;  3D10 A;  3CGA A;  2KAY A;  1BF5 A;  1SNL A;  3F45 A;  1AVS A;  1MXL C;  2LVI A;  1GGW A;  1A4P A;  2M97 A;  1CB1 A;  1IG5 A;  1WRL A;  2K2F A;  1PAL A;  3CYZ A;  2MRD A;  5D69 A;  4XJK A;  2LUC A;  1TRF A;  2PAS A;  2QPT A;  1XFZ O;  3D74 A;  4YGD B;  1WRZ A;  2LVV A;  1QIW A;  2LCP A;  1S36 A;  2I7A A;  2M8U A;  3ZNI A;  2KI4 B;  1UUS A;  2F8P A;  1KK7 Z;  1SL9 A;  3EKJ A;  5K89 A;  3CAB A;  1RFJ A;  2WC6 A;  2JWW A;  4CLN A;  5JJG A;  2P71 A;  4YI8 A;  5KU1 A;  1TNQ A;  1YVH A;  1PUL A;  1N2D A;  2JNF A;  1B8C A;  2KQY A;  2WCL A;  3TDZ A;  2OTG C;  2MA2 A;  4WQ3 A;  4MZL A;  2M1U A;  2WOR A;  1DTL A;  5HKW A;  2M9G A;  1LKJ A;  2MBX A;  1UHI A;  1K94 A;  4PE0 A;  4JKT A;  2PVB A;  1CNP A;  3CS1 A;  2KFH A;  1CFP A;  2WND A;  1NCX A;  1SR6 C;  5JOL A;  1XO5 A;  1SW8 A;  4MEW A;  4MSP A;  2K7D A;  3PN7 C;  3DVE A;  1TWO A;  1U5I B;  1UHJ A;  2JPO A;  2KAX A;  2MLF C;  2WCK A;  1QVI Z;  3CZ1 A;  4PE1 A;  1CFC A;  2OTG B;  1RJV A;  1AP4 A;  5HKY A;  4NQG A;  4HRG A;  1B7T Y;  1QVI Y;  4JPZ B;  1BT6 A;  1KK8 C;  3CWG A;  1H8B A;  3FE8 A;  1F54 A;  3VRQ A;  2FCE A;  1ZAC A;  1F4Q A;  1AJ5 A;  2CXJ A;  1EG3 A;  3CR2 A;  3SJS A;  1QX5 B;  1CMF A;  2KGR A;  2FOT A;  2H2K A;  2YGU A;  3S0F A;  1SR6 B;  3OB1 B;  1YRU B;  3TDU A;  1UUR A;  3PN7 B;  3D78 A;  1ZOT B;  5CSN A;  1F8H A;  1J7P A;  1U5I A;  4YGC B;  2BBM A;  1AJ4 A;  4GUK A;  4Q04 A;  5I2L A;  3WHU B;  2K7C A;  2L4H A;  2G9B A;  2VRG A;  3WHT B;  2KGB C;  1PVB A;  2I2R E;  3PJI A;  2JRF A;  4F0Z B;  1OMD A;  4C0J A;  2QEH A;  1DMO A;  1EJ3 A;  1UHN A;  2P70 A;  1F4O A;  4A4C A;  1SPY A;  1V1G A;  1XYD A;  1B4C A;  2GV5 A;  1YUU A;  2K60 A;  3CZ2 A;  4OCI A;  3S0G A;  1OZS A;  4MZJ A;  1DJY A;  1LA0 A;  3SG2 A;  1QJT A;  3SG3 A;  5KSZ A;  1WDC B;  3R1O A;  4MN0 A;  5CPV A;  3FIA A;  3VRO A;  3TUY C;  2KNE A;  2ZFD A;  3CR5 X;  1YUR A;  3I5I C;  1DF0 A;  3FE6 A;  1Y6W A;  4CPV A;  1MXE A;  1K2H A;  2L50 A;  5BPJ A;  5AEQ A;  1BR1 B;  1SBJ A;  5DKR A;  1CMG A;  2MAZ A;  5AER A;  1F70 A;  1VRK A;  1C3Z A;  2CNP A;  3L47 A;  1Q80 A;  3CTN A;  1DT7 B;  1J1D A;  3R1P A;  1IWQ A;  1QX2 A;  1S6I A;  4ORB B;  5HLO A;  3O78 A;  1L7Z A;  2QAC A;  2QEV A;  2WCB A;  3S0E A;  1IJ5 A;  4QJ5 B;  4OZD A;  3SS5 A;  2KLD A;  2KOT A;  3LK0 A;  1QAS A;  1EG4 A;  1Z4H A;  2KBI A;  2LMT A;  3VGO A;  2ZRS A;  2DOQ A;  5I2O A;  1KQV A;  1TIZ A;  1CTR A;  3EKH A;  1G33 A;  1WLZ A;  2KLE A;  2JPT A;  1TN4 A;  1YUT A;  2SCP A;  1CFF A;  1ZFS A;  1KFU L;  2F3Y A;  4YBH B;  3S0B A;  1Y0V H;  1ALW A;  3CR4 X;  3OX5 A;  5B8I B;  1UHK A;  4IL1 A;  2LV7 A;  3WXA A;  1M63 B;  4MLW A;  1OZO A;  1A29 A;  1UP5 A;  2KYF A;  2OS8 C;  3OBV A;  1BJF A;  1LXF C;  1RK9 A;  1SCV A;  5HYD A;  2AMI A;  3I5F C;  3VRN A;  1IH0 A;  4FQO A;  1YX7 A;  3BUX B;  2KFF A;  1JF0 A;  5PAL A;  4I5K A;  2WCM A;  3OHM B;  1UHH A;  3GOF A;  1IQ5 A;  3BOW B;  2R2I A;  1OE9 B;  1DJZ A;  1C7V A;  2LVK A;  3FWC A;  1YR5 A;  1X02 A;  4BY5 A;  1SL8 A;  1L2O C;  3GK1 A;  1QAT A;  2L4I A;  1QIV A;  1TOP A;  1G8I A;  4USL A;  1S1E A;  2LHI A;  3BFA A;  2BNX A;  3I5F B;  2MJW B;  1B8R A;  2JT3 A;  4F7F A;  2TN4 A;  3IQQ A;  5D7F A;  1AUI B;  3B86 A;  3TZ1 A;  2D8N A;  2A4J A;  1FI5 A;  1B9A A;  3BUW B;  1MR8 A;  3AAK A;  1ORG A;  2IS9 A;  3CZ0 A;  1GGZ A;  4CFQ A;  2KFG A;  3BOW A;  1MUX A;  3L4A A;  2P6B B;  4GGF C;  4L9M A;  4CFR A;  2ZND A;  1K8U A;  1PVA A;  1TUJ A;  1XFW O;  3VRR A;  2Y1N A;  1OOH A;  3JTD C;  5EL2 A;  1KSO A;  1Y1U A;  4WQ2 A;  1KK7 Y;  1K9K A;  2COL B;  1PRW A;  4HRH A;  4KYN A;  1QXP A;  1QX7 A;  5CSJ A;  4ZCU A;  1HT9 A;  4DCK A;  1TNX A;  1S3P A;  1NX0 A;  2ERB A;  1OOF A;  4ETO A;  2F33 A;  1JWD A;  2BEC A;  1JC2 A;  1FPW A;  1IQ3 A;  3BXK A;  2JXC A;  3S0D A;  3O4X A;  1MWN A;  3AAJ A;  5CSI A;  2AAO A;  3VB1 A;  1J55 A;  4E68 A;  1SSE B;  4ZCV A;  4PT1 A;  1YRT B;  3KEV A;  1MHO A;  3Q8I A;  2V53 A;  5GQQ C;  1JFJ A;  1M39 A;  2EHB A;  2LP3 A;  1CDM A;  5DKQ A;  1B47 A;  2BBN A;  2BCX A;  3B87 A;  5I94 A;  4MBE A;  2HET A;  2LE9 B;  1DQE A;  1SMG A;  1YVL A;  2WC8 A;  2Y4Q A;  1KFU S;  3UNW A;  1ODB A;  1ALV A;  1TNW A;  2GGM A;  3I5H C;  4GGF A;  2ZKM X;  2LLU A;  4INW A;  4M2P A;  5CSF A;  5HKZ A;  2MLE C;  2ZRT A;  3PM2 A;  3FE9 A;  3DXL A;  1T14 A;  3PSR A;  1DJH A;  3C1V A;  3D75 A;  2K7O A;  5FI6 A;  2JT0 A;  3NHI A;  2LM5 A;  1DF0 B;  1WY9 A;  2WCH A;  3D0Y B;  1C7W A;  1KK8 B;  3LK1 A;  3V2L A;  4C0K A;  5HL1 A;  2JUL A;  1XA5 A;  3WNX B;  1OOG A;  4R1E A;  1LVC D; 
#chains in the Genus database with same CATH homology
 3S0E A;  4OZD A;  3CDN A;  3D73 A;  2QDI A;  2QEO A;  3DYE A;  1OW4 A;  3D77 A;  3N7H A;  3OGN A;  2GTE A;  3R1V A;  3L4L A;  3B88 A;  3CYZ A;  3S0B A;  3D74 A;  1C3Y A;  2L2C A;  4FQT A;  3CAB A;  3K1E A;  2WC6 A;  2P71 A;  2WCM A;  3B6X A;  2WCL A;  1LS8 A;  2WC5 A;  3BFB A;  2WCJ A;  3BFA A;  2KPH A;  4F7F A;  4JD9 A;  3BJH A;  2H8V A;  3B86 A;  1TWO A;  2WCK A;  3CZ1 A;  2JPO A;  1ORG A;  3CZ0 A;  3L4A A;  5DIC A;  1QWV A;  1TUJ A;  3FE8 A;  3DZT A;  1GM0 A;  1OOH A;  5EL2 A;  1P28 A;  3S0F A;  3D78 A;  2ERB A;  1OOF A;  3S0D A;  3PJI A;  1OOI X;  3VB1 A;  2QEH A;  2PQL A;  2P70 A;  3D76 A;  4PT1 A;  3Q8I A;  3CZ2 A;  3S0G A;  3R72 A;  3R1O A;  3S0A A;  3B87 A;  3NHT A;  3RZS A;  1DQE A;  3BFH A;  3FE6 A;  4INW A;  3FE9 A;  3DXL A;  1T14 A;  3D75 A;  1XFR A;  2QEB A;  1C3Z A;  3L47 A;  3NHI A;  3B7A A;  3NGV A;  2WCH A;  3R1P A;  4INX A;  2FJY A;  3V2L A;  3QME A;  3DY9 A;  1OOG A;  2QEV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...