2QEHA

Crystal structure of anopheles gambiae d7r4-serotonin complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
145
structure length
145
Chain Sequence
METVQDCENKLPPSLKSRLCEIRRYEIIEGPEMDKHIHCVMRALDFVYEDGRGDYHKLYDPLNIIELDKRHDVNLEKCIGECVQVPTSERAHVFYKCLLKSTTGRTFKKVFDLMELKKAGKVPQHQRYTAEFVQIMKDYDKALNC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligand binding protein
molecule keywords D7R4 Protein
publication title The Crystal Structure of D7r4, a Salivary Biogenic Amine-binding Protein from the Malaria Mosquito Anopheles gambiae
pubmed doi rcsb
source organism Anopheles gambiae
total genus 54
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2007-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2qehA00
3DZTA 4JD9A 4F7FA 3CYZA 3FE9A 3D78A 3D73A 2QEHA 2QEBA 2ERBA 3D74A 3D77A 4OZDA 3L4AA 1OW4A 3L47A 5EL2A 2JPOA 3CDNA 2QDIA 1QWVA 2WCLA 3R1VA 4INWA 3R1OA 2H8VA 2FJYA 3K1EA 3B7AA 3FE6A 2P70A 3R1PA 3N7HA 1ORGA 3FE8A 3S0DA 3DYEA 1C3YA 1TWOA 3DY9A 2PQLA 3BFBA 1XFRA 4PT1A 3Q8IA 3S0FA 5DICA 3RZSA 3V2LA 3BFHA 3B87A 2WCMA 3D75A 3BJHA 1GM0A 3B6XA 3S0AA 1TUJA 3OGNA 3B86A 3S0EA 2P71A 2WCJA 2KPHA 4INXA 3R72A 2GTEA 3CZ1A 2WCHA 3CABA 3D76A 3NHIA 3VB1A 2WC6A 3PJIA 1T14A 4FQTA 3S0GA 1OOFA 3CZ2A 2WCKA 3QMEA 3DXLA 3NGVA 3BFAA 3L4LA 2QEVA 1P28A 1OOIX 3S0BA 3B88A 2L2CA 3NHTA 1DQEA 3CZ0A 1C3ZA 2WC5A 2QEOA 1OOGA 1OOHA 1LS8A
chains in the Genus database with same CATH superfamily
1XVJA 1WRLA 3DZTA 3SG6A 1WDCB 2ZNEA 4GPLB 2OS8C 1QASA 2WCFA 1S1EA 2CXJA 1CM1A 2SASA 3JVTC 3O4XA 1G4YR 1YUTA 1Y0VH 4CFRA 5HKYA 2JPTA 3K21A 4ORCB 5DKNA 4C0LA 1CMFA 2BAPA 4OZDA 1F71A 1PVAA 3L4AA 2KAVA 4PHJA 2I7AA 3AAKA 4NDCA 1XK4A 1BMOA 2QDIA 1UHIA 1QWVA 1UP5A 2KI4B 5HKZA 2WCLA 3R1VA 1YTZC 2MLFC 3R1OA 3KHEA 2BCBA 3GK2A 4USLA 1XFWO 4MZJA 3I5IB 3SG7A 3RLZA 3ZNIA 1XFYO 4NDBA 2CNPA 3QRXA 2H61A 3PLFB 2M49B 3B7AA 3FE6A 2WOSA 3LCPC 1B8CA 3EK4A 2QPTA 2JNXA 2LP3A 1PSRA 3S0DA 2L4IA 2M7NA 3DYEA 3EK7A 1B47A 1EJ3A 1LA0A 1WRKA 2JU0A 2K0JA 3DY9A 2KI6C 3BXKA 4KYNA 5HLVA 1CDMA 2PQLA 1OE9B 3EVRA 1CNPA 2KOTA 2KSPA 3LK0A 1BR1B 2Y4QA 4PT1A 1K90D 2WC8A 1SCMC 2F3ZA 2O60A 2KYFA 1KFXS 3OB1B 3AAJA 1BU3A 2LVIA 2K60A 5DICA 2LVVA 1CFPA 2DOQA 3HX4A 5KSZA 5PALA 2JZIA 1S6IA 1C07A 1ZUZA 2ZRTA 4MN0A 4ZCVA 1B7TZ 3BFHA 2EHBA 3VGOA 2LMUA 2KDHA 2TN4A 4GUKA 3VRNA 1BF5A 1AVSA 1B9AA 4GBAA 4GNKB 3EVVA 2IS9A 3DVMA 1NWDA 2LHIA 3OGNA 2P71A 3EK8A 3OHMB 1EG3A 2EGDA 2LAPA 4CPVA 5CSNA 1JC2A 1B7TY 2GTEA 1WRZA 2EC6C 2GGZA 1HT9A 2A4JA 3CABA 3PM8A 3D76A 4M2QA 2NXQA 3NHIA 2BL0B 4TNCA 2M7LA 1MQ1A 2BBMA 5BPJA 2BE6A 1TIZA 4XYNA 1T14A 1FPWA 1DEKA 2ISDA 3WNXB 1IRJA 1OOFA 3O78A 2LM5A 2PALA 3TDUA 3QMEA 1G8IA 1WLZA 4F0ZB 2V53A 3DXLA 3GK4X 1QLKA 1B1GA 3KO0A 2HF5A 5CSIA 1A03A 5DKQA 4A4CA 1IIOA 2HPSA 1M63B 2M1UA 1RWYA 2KYCA 1RK9A 2LVJA 1KQMB 1PULA 3S0BA 3B88A 2LNKA 1KFUL 1U5IB 4Q04A 2G2BA 1UHJA 3C1VA 1C3ZA 5I2LA 3VRRA 3BUMB 1JWDA 1QX2A 1CLLA 1NPQA 1IGVA 1UHNA 2NLNA 3SG2A 4JD9A 1MXLC 1B8LA 4GGFC 5FI2A 1DF0A 3D73A 1RJVA 2I94A 2LP2A 2F2PA 1K93D 3RM1A 4OVNF 3CZTX 1W9ZA 1J7PA 3D77A 2K2FA 1TUZA 3IVTA 2BNXA 1MWNA 1OW4A 1XA5A 2JPOA 1SRAA 2JTZA 3CDNA 3CR4X 3PALA 5KU1A 3PM2A 1K95A 5AXIA 4C0KA 5FYXA 2WORA 1TTXA 4INWA 3D0YA 4MZLA 1J55A 1QX5B 4I5KA 2KAYA 2QACA 3AKBA 2KFGA 3SG3A 4PE7A 4PCWA 1L2OC 2KAXA 2MLEC 2LC5A 2P70A 4ORAB 3I5GC 1IQ5A 2JNFA 3OBVA 1S6JA 3FE8A 1QIVA 4PE0A 5I2OA 2OTGB 1N0YA 1PK0D 1NX0A 4YRUA 3JTDC 1TWOA 4MZKA 1SBJA 1KK8B 1KWOC 1OSAA 3FIAA 1SR6C 5I2QA 1XFZO 1S36A 4IL1A 1IQ3A 3BOWB 3OX6A 2LMTA 5HYDA 4JKTA 4A4BA 1IWQA 1KSMA 3S0FA 2F8PA 2PSRA 3TDIA 3RZSA 2LLSA 3NSIA 2OS8B 5HKWA 1RECA 2L50A 1RFJA 1OMVA 2G9BA 4DCKA 1IJ6A 3JVTB 2CTNA 3EKHA 3B87A 3WHTB 4MVFA 4N1FA 5ER4X 1DJHA 4DUQA 1C7VA 3CTNA 1A75B 1F54A 3CLNA 3NSLA 2LE9B 1GM0A 2PASA 2NZ0A 2M0RA 1V1FA 3S0AA 1J7RA 1KK7Z 2LHLA 4M2PA 1YURA 2BCXA 2CCMA 2L2EA 1S5GZ 1EG4A 2LMVA 4PE4A 1UWOA 3R72A 1BR4B 2Q4UA 2BCAA 2PMYA 1CLBA 3BUXB 3TS5C 2KI6D 1DT7B 3PJIA 2COLB 1XFUO 5AFPA 2L51A 3PN7C 1Z2CB 1PRWA 2H2KA 1KK7Y 2MA2A 4R1EA 4L9MA 1BT6A 3TDZA 2B1UA 1Y1UA 2WCKA 3BUWB 1A2XA 2HQ8A 2K7CA 4AOMA 1JUOA 3O6BA 3NGVA 4HSZA 4WQ3A 1S5GY 2F3YA 2QEVA 2JTTA 2KGBC 3CGAA 2JT3A 1JFJA 1NX2A 4PDZA 1XYDA 2NCPA 1OOIX 1DJIA 1OZOA 2K7OA 1Y6WA 3OB2B 1K9PA 1R2UA 4GGNA 1F8HA 1CM4A 5I94A 1BODA 1DQEA 2NCOA 3GOFA 5DKRA 1SCMB 2GGMA 5JJGA 1GQMA 1QJTA 2K2AA 2WC5A 1N2DA 3PFVA 2L4HA 3DVJA 2QEOA 4YI8A 3SJSA 4PHNA 1X02A 2KFFA 3FS7A 1Y1XA 2PYQA 2ZFDA 2MBXA 3OX5A 5G08A 4PE1A 4D1EA 4P2YB 3I5HC 4BY5A 4F7FA 1PVBA 1XK4C 3CYZA 4I5NB 3TUYC 1EH2A 2BBNA 5ER5A 1AP4A 1UUSA 1KFXL 3D74A 2L0PA 4I5LB 1DGVA 4ETOA 2KBMA 1HQVA 1NIWA 2R2IA 4GFTA 1ZACA 1SY9A 2MJWB 1F55A 1W7IB 5IBWA 1SNLA 1K9UA 2H61C 4MEWA 3L47A 1RTP1 2JT8A 1TOPA 4PALA 1MF8B 1NCZA 2EC6B 2I18A 4AQIA 1AJ5A 1K94A 2LUXA 3O4YA 1CMGA 2AAOA 4OCIA 1K2HA 3DVKA 1CDLA 4DRWA 1QXPA 2HETA 1DELA 2K7DA 2BE4A 4IJ7A 1A75A 4JPZB 1NX3A 3CR5X 2HQWA 1SPYA 4I5JA 2CBLA 1QATA 3CWGA 1OMDA 1UHHA 2FJYA 1RROA 1B4CA 2LVKA 2MRDA 3R1PA 3N7HA 4N1GA 1K9KA 1SK6D 1SL8A 3I5FC 1QX7A 1UHKA 2I2RE 3DF0B 4QJ3B 3LK1A 3EKJA 1DJGA 5AEQA 1FW4A 2FJUB 2P6BB 2WCEA 2LUCA 1SCVA 2AMIA 1S26D 1FBVA 1B8RA 3UO9A 1MR8A 2FCDA 1VRKA 3Q8IA 1S3PA 5I8NA 2D8NA 1YUSA 1DGUA 1KQVA 2E30A 3ZWHA 5FI6A 1BOCA 1DJZA 3V2LA 1KCYA 4ORBB 3SS4A 1AK8A 1WDCC 3TZ1A 5FI7A 3D75A 3A8RA 1CLMA 1ALVA 3BJHA 4HRHA 4MBEA 1DJYA 1Y1AA 1CFDA 1G33A 1OOJA 1LINA 1QS7A 1XO5A 1YX7A 2O5GA 2KNEA 3B6XA 2RGIA 1TUJA 3LLEA 1CB1A 3B86A 3NSKA 1YRUB 2WCJA 2JXLA 4MRXA 3M0WA 2KLEA 4HREE 4XJKB 1D1OA 1DMOA 1M39A 5HLOA 1TCFA 2M1KB 2LV7A 4JQ0D 1CFFA 3WHUB 1YX8A 3PATA 1AJ4A 3SS3A 4N5XA 1PSBA 3KPXA 2SCPA 1DC1A 1JSAA 1L2OB 2KI4C 1IKUA 2WC6A 4CLNA 4YGDB 2L5XB 2PVBA 3S0GA 1YVHA 5J3XA 2BKHB 2GV5A 1A29A 3I5IC 1CDNA 1LVCD 3CS1A 1JFKA 3I5GB 1BLQA 1IH0A 1NP8A 1QV1A 1NYAA 4YGCB 1YVLA 1DJWA 3KF9A 3SS5A 3BFAA 1AUIB 1U5IA 3JTDB 1IJ5A 1P28A 3L4LA 2Y5IA 3AKAA 2FOTA 4MRYA 2WNDA 4U8DA 1DVIA 1PALA 1QVIZ 3E3RA 1KWOB 4FTGA 5K89A 5HL1A 1MUXA 1SR6B 4DIRA 4YGBB 3ICBA 3NHTA 3BQ3A 2K8MB 3CZ0A 1BJFA 1XFXO 1ZOTB 4BY4A 2L5YA 3EVUA 3WXAA 2BECA 1OOGA 1M45A 1SL9A 4JWQA 4NDDA 3VRPA 4PHKA 1V1GA 1TNQA 2CT9A 1ALWA 1JF0A 2LANA 3LL8B 4MSPA 1J7OA 1QVIY 2M8UA 5F6TA 1F4OA 2JRFA 3FE9A 3DF0A 3D78A 3PSRA 1TNPA 2QEHA 1YUUA 2JC2A 2QEBA 2ERBA 1KSOA 4OKHA 2KFHA 1E8AA 2Q91A 2MAZA 1DF0B 1YRTB 1K96A 1N65A 2Y1MA 2JULA 1ODBA 4WRIA 1AHRA 3FWBA 3NXAA 1W7JB 5EL2A 1C7WA 4E68A 1GGZA 2JWWA 3IF7A 4GGFA 5GQQC 5D3OA 2M3WA 1QTXA 3TS5B 4QJ4B 1SYMA 4YBHB 3IQQA 1LS8A 4ICBA 1OMRA 1L7ZA 4GAOA 1DTLA 2ZNDA 1OZSA 1QLSA 2FCEA 3BUNB 3PN7B 4HRGA 1BG1A 2M97A 4DS7A 2BL0C 1KFUS 3D0YB 2H8VA 4UPGA 3K1EA 5TNCA 2ZKMX 5JOLA 3KEVA 3VRQA 5B8IB 4XJKA 3OP0A 1YR5A 3NSOA 1ORGA 2VRGA 1QIWA 5KTYA 1J7QA 1R6PA 5AANA 4MLWA 1C3YA 1GGWA 1SMGA 2KHNA 3BOWA 1UURA 1J1DA 3BFBA 3O2PA 1KQMC 2JOJA 2KBIA 4NQGA 1SL7A 2L98A 1FI5A 1FI6A 1XFRA 1SW8A 1WY9A 2ZN8A 5CSJA 1FF1A 4YGEB 3DVEA 5CPVA 2K61A 2LLTA 3F45A 1NUBA 3I5HB 1NCYA 2JXCA 4PHMA 4YGAA 3TUYB 2WCBA 2JQ6A 4M2OA 3FWCA 2MHHA 1S6CA 1NSHA 2JT0A 3BYAA 3HCMA 1J1EA 1XFVO 1MXEA 1NCXA 2WCMA 1H4BA 1ZFSA 4CFQA 1DJXA 4AQJA 4ZCUA 4OV2A 1F4QA 1IG5A 2F2OA 2KQ6A 1TNXA 3DD4A 5CSFA 2M29A 1CKKA 1TNWA 4P5OE 1CDPA 3S0EA 2M9GA 4CIDA 1K8UA 2KPHA 1LXFC 1WLMA 1TCOB 2Y1NA 3SG4A 1GJYA 1SSEB 4INXA 2E6WA 1JF2A 3GK1A 3CZ1A 1ZMZA 1EXRA 2WCHA 2KGRA 1TRFA 3SIBA 1SKTA 1M31A 1M46A 3VB1A 2YGUA 3A4UB 2BKIB 2PRUA 4FQTA 3CR2A 2ZRSA 3SG5A 5AERA 1LKJA 2LCPA 3CZ2A 3MSEB 4YI9A 1CFCA 3D10A 3IQOA 4C0JA 3I5FB 2ZN9A 5D69A 3VROA 3EG5B 4QJ5B 1OQPA 4FQOA 2OTGC 2L2CA 5D7FA 1LA3A 1QV0A 2KLDA 2F33A 3UNWA 1MHOA 1A4PA 1CTRA 4WQ2A 1EL4A 1Q80A 2KQYA 2OPOA 4OR9B 1KK8C 3H4SE 1TN4A 1H8BA 3BUOB 1Z4HA 1JBAA 2AUCA 1F70A 1OOHA 2LLUA 2K7BA 1NX1A 3SIAA
chains in the Genus database with same CATH topology
3DZTA 4JD9A 4F7FA 3CYZA 3FE9A 3D78A 3D73A 2QEHA 2QEBA 2ERBA 3D74A 3D77A 4OZDA 3L4AA 1OW4A 3L47A 5EL2A 2JPOA 3CDNA 2QDIA 1QWVA 2WCLA 3R1VA 4INWA 3R1OA 2H8VA 2FJYA 3K1EA 3B7AA 3FE6A 2P70A 3R1PA 3N7HA 1ORGA 3FE8A 3S0DA 3DYEA 1C3YA 1TWOA 3DY9A 2PQLA 3BFBA 1XFRA 4PT1A 3Q8IA 3S0FA 5DICA 3RZSA 3V2LA 3BFHA 3B87A 2WCMA 3D75A 3BJHA 1GM0A 3B6XA 3S0AA 1TUJA 3OGNA 3B86A 3S0EA 2P71A 2WCJA 2KPHA 4INXA 3R72A 2GTEA 3CZ1A 2WCHA 3CABA 3D76A 3NHIA 3VB1A 2WC6A 3PJIA 1T14A 4FQTA 3S0GA 1OOFA 3CZ2A 2WCKA 3QMEA 3DXLA 3NGVA 3BFAA 3L4LA 2QEVA 1P28A 1OOIX 3S0BA 3B88A 2L2CA 3NHTA 1DQEA 3CZ0A 1C3ZA 2WC5A 2QEOA 1OOGA 1OOHA 1LS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DZT A;  4JD9 A;  4F7F A;  3CYZ A;  3FE9 A;  3D78 A;  3D73 A;  2QEH A;  2QEB A;  2ERB A;  3D74 A;  3D77 A;  4OZD A;  3L4A A;  1OW4 A;  3L47 A;  5EL2 A;  2JPO A;  3CDN A;  2QDI A;  1QWV A;  2WCL A;  3R1V A;  4INW A;  3R1O A;  2H8V A;  2FJY A;  3K1E A;  3B7A A;  3FE6 A;  2P70 A;  3R1P A;  3N7H A;  1ORG A;  3FE8 A;  3S0D A;  3DYE A;  1C3Y A;  1TWO A;  3DY9 A;  2PQL A;  3BFB A;  1XFR A;  4PT1 A;  3Q8I A;  3S0F A;  5DIC A;  3RZS A;  3V2L A;  3BFH A;  3B87 A;  2WCM A;  3D75 A;  3BJH A;  1GM0 A;  3B6X A;  3S0A A;  1TUJ A;  3OGN A;  3B86 A;  3S0E A;  2P71 A;  2WCJ A;  2KPH A;  4INX A;  3R72 A;  2GTE A;  3CZ1 A;  2WCH A;  3CAB A;  3D76 A;  3NHI A;  3VB1 A;  2WC6 A;  3PJI A;  1T14 A;  4FQT A;  3S0G A;  1OOF A;  3CZ2 A;  2WCK A;  3QME A;  3DXL A;  3NGV A;  3BFA A;  3L4L A;  2QEV A;  1P28 A;  1OOI X;  3S0B A;  3B88 A;  2L2C A;  3NHT A;  1DQE A;  3CZ0 A;  1C3Z A;  2WC5 A;  2QEO A;  1OOG A;  1OOH A;  1LS8 A; 
#chains in the Genus database with same CATH topology
 1XVJ A;  1WRL A;  3DZT A;  3SG6 A;  1WDC B;  2ZNE A;  4GPL B;  2OS8 C;  1QAS A;  2WCF A;  1S1E A;  2CXJ A;  1CM1 A;  2SAS A;  3JVT C;  3O4X A;  1G4Y R;  1YUT A;  1Y0V H;  4CFR A;  5HKY A;  2JPT A;  3K21 A;  4ORC B;  5DKN A;  4C0L A;  1CMF A;  2BAP A;  4OZD A;  1F71 A;  1PVA A;  3L4A A;  2KAV A;  4PHJ A;  2I7A A;  3AAK A;  4NDC A;  1XK4 A;  1BMO A;  2QDI A;  1UHI A;  1QWV A;  1UP5 A;  2KI4 B;  5HKZ A;  2WCL A;  3R1V A;  1YTZ C;  2MLF C;  3R1O A;  3KHE A;  2BCB A;  3GK2 A;  4USL A;  1XFW O;  4MZJ A;  3I5I B;  3SG7 A;  3RLZ A;  3ZNI A;  1XFY O;  4NDB A;  2CNP A;  3QRX A;  2H61 A;  3PLF B;  2M49 B;  3B7A A;  3FE6 A;  2WOS A;  3LCP C;  1B8C A;  3EK4 A;  2QPT A;  2JNX A;  2LP3 A;  1PSR A;  3S0D A;  2L4I A;  2M7N A;  3DYE A;  3EK7 A;  1B47 A;  1EJ3 A;  1LA0 A;  1WRK A;  2JU0 A;  2K0J A;  3DY9 A;  2KI6 C;  3BXK A;  4KYN A;  5HLV A;  1CDM A;  2PQL A;  1OE9 B;  3EVR A;  1CNP A;  2KOT A;  2KSP A;  3LK0 A;  1BR1 B;  2Y4Q A;  4PT1 A;  1K90 D;  2WC8 A;  1SCM C;  2F3Z A;  2O60 A;  2KYF A;  1KFX S;  3OB1 B;  3AAJ A;  1BU3 A;  2LVI A;  2K60 A;  5DIC A;  2LVV A;  1CFP A;  2DOQ A;  3HX4 A;  5KSZ A;  5PAL A;  2JZI A;  1S6I A;  1C07 A;  1ZUZ A;  2ZRT A;  4MN0 A;  4ZCV A;  1B7T Z;  3BFH A;  2EHB A;  3VGO A;  2LMU A;  2KDH A;  2TN4 A;  4GUK A;  3VRN A;  1BF5 A;  1AVS A;  1B9A A;  4GBA A;  4GNK B;  3EVV A;  2IS9 A;  3DVM A;  1NWD A;  2LHI A;  3OGN A;  2P71 A;  3EK8 A;  3OHM B;  1EG3 A;  2EGD A;  2LAP A;  4CPV A;  5CSN A;  1JC2 A;  1B7T Y;  2GTE A;  1WRZ A;  2EC6 C;  2GGZ A;  1HT9 A;  2A4J A;  3CAB A;  3PM8 A;  3D76 A;  4M2Q A;  2NXQ A;  3NHI A;  2BL0 B;  4TNC A;  2M7L A;  1MQ1 A;  2BBM A;  5BPJ A;  2BE6 A;  1TIZ A;  4XYN A;  1T14 A;  1FPW A;  1DEK A;  2ISD A;  3WNX B;  1IRJ A;  1OOF A;  3O78 A;  2LM5 A;  2PAL A;  3TDU A;  3QME A;  1G8I A;  1WLZ A;  4F0Z B;  2V53 A;  3DXL A;  3GK4 X;  1QLK A;  1B1G A;  3KO0 A;  2HF5 A;  5CSI A;  1A03 A;  5DKQ A;  4A4C A;  1IIO A;  2HPS A;  1M63 B;  2M1U A;  1RWY A;  2KYC A;  1RK9 A;  2LVJ A;  1KQM B;  1PUL A;  3S0B A;  3B88 A;  2LNK A;  1KFU L;  1U5I B;  4Q04 A;  2G2B A;  1UHJ A;  3C1V A;  1C3Z A;  5I2L A;  3VRR A;  3BUM B;  1JWD A;  1QX2 A;  1CLL A;  1NPQ A;  1IGV A;  1UHN A;  2NLN A;  3SG2 A;  4JD9 A;  1MXL C;  1B8L A;  4GGF C;  5FI2 A;  1DF0 A;  3D73 A;  1RJV A;  2I94 A;  2LP2 A;  2F2P A;  1K93 D;  3RM1 A;  4OVN F;  3CZT X;  1W9Z A;  1J7P A;  3D77 A;  2K2F A;  1TUZ A;  3IVT A;  2BNX A;  1MWN A;  1OW4 A;  1XA5 A;  2JPO A;  1SRA A;  2JTZ A;  3CDN A;  3CR4 X;  3PAL A;  5KU1 A;  3PM2 A;  1K95 A;  5AXI A;  4C0K A;  5FYX A;  2WOR A;  1TTX A;  4INW A;  3D0Y A;  4MZL A;  1J55 A;  1QX5 B;  4I5K A;  2KAY A;  2QAC A;  3AKB A;  2KFG A;  3SG3 A;  4PE7 A;  4PCW A;  1L2O C;  2KAX A;  2MLE C;  2LC5 A;  2P70 A;  4ORA B;  3I5G C;  1IQ5 A;  2JNF A;  3OBV A;  1S6J A;  3FE8 A;  1QIV A;  4PE0 A;  5I2O A;  2OTG B;  1N0Y A;  1PK0 D;  1NX0 A;  4YRU A;  3JTD C;  1TWO A;  4MZK A;  1SBJ A;  1KK8 B;  1KWO C;  1OSA A;  3FIA A;  1SR6 C;  5I2Q A;  1XFZ O;  1S36 A;  4IL1 A;  1IQ3 A;  3BOW B;  3OX6 A;  2LMT A;  5HYD A;  4JKT A;  4A4B A;  1IWQ A;  1KSM A;  3S0F A;  2F8P A;  2PSR A;  3TDI A;  3RZS A;  2LLS A;  3NSI A;  2OS8 B;  5HKW A;  1REC A;  2L50 A;  1RFJ A;  1OMV A;  2G9B A;  4DCK A;  1IJ6 A;  3JVT B;  2CTN A;  3EKH A;  3B87 A;  3WHT B;  4MVF A;  4N1F A;  5ER4 X;  1DJH A;  4DUQ A;  1C7V A;  3CTN A;  1A75 B;  1F54 A;  3CLN A;  3NSL A;  2LE9 B;  1GM0 A;  2PAS A;  2NZ0 A;  2M0R A;  1V1F A;  3S0A A;  1J7R A;  1KK7 Z;  2LHL A;  4M2P A;  1YUR A;  2BCX A;  2CCM A;  2L2E A;  1S5G Z;  1EG4 A;  2LMV A;  4PE4 A;  1UWO A;  3R72 A;  1BR4 B;  2Q4U A;  2BCA A;  2PMY A;  1CLB A;  3BUX B;  3TS5 C;  2KI6 D;  1DT7 B;  3PJI A;  2COL B;  1XFU O;  5AFP A;  2L51 A;  3PN7 C;  1Z2C B;  1PRW A;  2H2K A;  1KK7 Y;  2MA2 A;  4R1E A;  4L9M A;  1BT6 A;  3TDZ A;  2B1U A;  1Y1U A;  2WCK A;  3BUW B;  1A2X A;  2HQ8 A;  2K7C A;  4AOM A;  1JUO A;  3O6B A;  3NGV A;  4HSZ A;  4WQ3 A;  1S5G Y;  2F3Y A;  2QEV A;  2JTT A;  2KGB C;  3CGA A;  2JT3 A;  1JFJ A;  1NX2 A;  4PDZ A;  1XYD A;  2NCP A;  1OOI X;  1DJI A;  1OZO A;  2K7O A;  1Y6W A;  3OB2 B;  1K9P A;  1R2U A;  4GGN A;  1F8H A;  1CM4 A;  5I94 A;  1BOD A;  1DQE A;  2NCO A;  3GOF A;  5DKR A;  1SCM B;  2GGM A;  5JJG A;  1GQM A;  1QJT A;  2K2A A;  2WC5 A;  1N2D A;  3PFV A;  2L4H A;  3DVJ A;  2QEO A;  4YI8 A;  3SJS A;  4PHN A;  1X02 A;  2KFF A;  3FS7 A;  1Y1X A;  2PYQ A;  2ZFD A;  2MBX A;  3OX5 A;  5G08 A;  4PE1 A;  4D1E A;  4P2Y B;  3I5H C;  4BY5 A;  4F7F A;  1PVB A;  1XK4 C;  3CYZ A;  4I5N B;  3TUY C;  1EH2 A;  2BBN A;  5ER5 A;  1AP4 A;  1UUS A;  1KFX L;  3D74 A;  2L0P A;  4I5L B;  1DGV A;  4ETO A;  2KBM A;  1HQV A;  1NIW A;  2R2I A;  4GFT A;  1ZAC A;  1SY9 A;  2MJW B;  1F55 A;  1W7I B;  5IBW A;  1SNL A;  1K9U A;  2H61 C;  4MEW A;  3L47 A;  1RTP 1;  2JT8 A;  1TOP A;  4PAL A;  1MF8 B;  1NCZ A;  2EC6 B;  2I18 A;  4AQI A;  1AJ5 A;  1K94 A;  2LUX A;  3O4Y A;  1CMG A;  2AAO A;  4OCI A;  1K2H A;  3DVK A;  1CDL A;  4DRW A;  1QXP A;  2HET A;  1DEL A;  2K7D A;  2BE4 A;  4IJ7 A;  1A75 A;  4JPZ B;  1NX3 A;  3CR5 X;  2HQW A;  1SPY A;  4I5J A;  2CBL A;  1QAT A;  3CWG A;  1OMD A;  1UHH A;  2FJY A;  1RRO A;  1B4C A;  2LVK A;  2MRD A;  3R1P A;  3N7H A;  4N1G A;  1K9K A;  1SK6 D;  1SL8 A;  3I5F C;  1QX7 A;  1UHK A;  2I2R E;  3DF0 B;  4QJ3 B;  3LK1 A;  3EKJ A;  1DJG A;  5AEQ A;  1FW4 A;  2FJU B;  2P6B B;  2WCE A;  2LUC A;  1SCV A;  2AMI A;  1S26 D;  1FBV A;  1B8R A;  3UO9 A;  1MR8 A;  2FCD A;  1VRK A;  3Q8I A;  1S3P A;  5I8N A;  2D8N A;  1YUS A;  1DGU A;  1KQV A;  2E30 A;  3ZWH A;  5FI6 A;  1BOC A;  1DJZ A;  3V2L A;  1KCY A;  4ORB B;  3SS4 A;  1AK8 A;  1WDC C;  3TZ1 A;  5FI7 A;  3D75 A;  3A8R A;  1CLM A;  1ALV A;  3BJH A;  4HRH A;  4MBE A;  1DJY A;  1Y1A A;  1CFD A;  1G33 A;  1OOJ A;  1LIN A;  1QS7 A;  1XO5 A;  1YX7 A;  2O5G A;  2KNE A;  3B6X A;  2RGI A;  1TUJ A;  3LLE A;  1CB1 A;  3B86 A;  3NSK A;  1YRU B;  2WCJ A;  2JXL A;  4MRX A;  3M0W A;  2KLE A;  4HRE E;  4XJK B;  1D1O A;  1DMO A;  1M39 A;  5HLO A;  1TCF A;  2M1K B;  2LV7 A;  4JQ0 D;  1CFF A;  3WHU B;  1YX8 A;  3PAT A;  1AJ4 A;  3SS3 A;  4N5X A;  1PSB A;  3KPX A;  2SCP A;  1DC1 A;  1JSA A;  1L2O B;  2KI4 C;  1IKU A;  2WC6 A;  4CLN A;  4YGD B;  2L5X B;  2PVB A;  3S0G A;  1YVH A;  5J3X A;  2BKH B;  2GV5 A;  1A29 A;  3I5I C;  1CDN A;  1LVC D;  3CS1 A;  1JFK A;  3I5G B;  1BLQ A;  1IH0 A;  1NP8 A;  1QV1 A;  1NYA A;  4YGC B;  1YVL A;  1DJW A;  3KF9 A;  3SS5 A;  3BFA A;  1AUI B;  1U5I A;  3JTD B;  1IJ5 A;  1P28 A;  3L4L A;  2Y5I A;  3AKA A;  2FOT A;  4MRY A;  2WND A;  4U8D A;  1DVI A;  1PAL A;  1QVI Z;  3E3R A;  1KWO B;  4FTG A;  5K89 A;  5HL1 A;  1MUX A;  1SR6 B;  4DIR A;  4YGB B;  3ICB A;  3NHT A;  3BQ3 A;  2K8M B;  3CZ0 A;  1BJF A;  1XFX O;  1ZOT B;  4BY4 A;  2L5Y A;  3EVU A;  3WXA A;  2BEC A;  1OOG A;  1M45 A;  1SL9 A;  4JWQ A;  4NDD A;  3VRP A;  4PHK A;  1V1G A;  1TNQ A;  2CT9 A;  1ALW A;  1JF0 A;  2LAN A;  3LL8 B;  4MSP A;  1J7O A;  1QVI Y;  2M8U A;  5F6T A;  1F4O A;  2JRF A;  3FE9 A;  3DF0 A;  3D78 A;  3PSR A;  1TNP A;  2QEH A;  1YUU A;  2JC2 A;  2QEB A;  2ERB A;  1KSO A;  4OKH A;  2KFH A;  1E8A A;  2Q91 A;  2MAZ A;  1DF0 B;  1YRT B;  1K96 A;  1N65 A;  2Y1M A;  2JUL A;  1ODB A;  4WRI A;  1AHR A;  3FWB A;  3NXA A;  1W7J B;  5EL2 A;  1C7W A;  4E68 A;  1GGZ A;  2JWW A;  3IF7 A;  4GGF A;  5GQQ C;  5D3O A;  2M3W A;  1QTX A;  3TS5 B;  4QJ4 B;  1SYM A;  4YBH B;  3IQQ A;  1LS8 A;  4ICB A;  1OMR A;  1L7Z A;  4GAO A;  1DTL A;  2ZND A;  1OZS A;  1QLS A;  2FCE A;  3BUN B;  3PN7 B;  4HRG A;  1BG1 A;  2M97 A;  4DS7 A;  2BL0 C;  1KFU S;  3D0Y B;  2H8V A;  4UPG A;  3K1E A;  5TNC A;  2ZKM X;  5JOL A;  3KEV A;  3VRQ A;  5B8I B;  4XJK A;  3OP0 A;  1YR5 A;  3NSO A;  1ORG A;  2VRG A;  1QIW A;  5KTY A;  1J7Q A;  1R6P A;  5AAN A;  4MLW A;  1C3Y A;  1GGW A;  1SMG A;  2KHN A;  3BOW A;  1UUR A;  1J1D A;  3BFB A;  3O2P A;  1KQM C;  2JOJ A;  2KBI A;  4NQG A;  1SL7 A;  2L98 A;  1FI5 A;  1FI6 A;  1XFR A;  1SW8 A;  1WY9 A;  2ZN8 A;  5CSJ A;  1FF1 A;  4YGE B;  3DVE A;  5CPV A;  2K61 A;  2LLT A;  3F45 A;  1NUB A;  3I5H B;  1NCY A;  2JXC A;  4PHM A;  4YGA A;  3TUY B;  2WCB A;  2JQ6 A;  4M2O A;  3FWC A;  2MHH A;  1S6C A;  1NSH A;  2JT0 A;  3BYA A;  3HCM A;  1J1E A;  1XFV O;  1MXE A;  1NCX A;  2WCM A;  1H4B A;  1ZFS A;  4CFQ A;  1DJX A;  4AQJ A;  4ZCU A;  4OV2 A;  1F4Q A;  1IG5 A;  2F2O A;  2KQ6 A;  1TNX A;  3DD4 A;  5CSF A;  2M29 A;  1CKK A;  1TNW A;  4P5O E;  1CDP A;  3S0E A;  2M9G A;  4CID A;  1K8U A;  2KPH A;  1LXF C;  1WLM A;  1TCO B;  2Y1N A;  3SG4 A;  1GJY A;  1SSE B;  4INX A;  2E6W A;  1JF2 A;  3GK1 A;  3CZ1 A;  1ZMZ A;  1EXR A;  2WCH A;  2KGR A;  1TRF A;  3SIB A;  1SKT A;  1M31 A;  1M46 A;  3VB1 A;  2YGU A;  3A4U B;  2BKI B;  2PRU A;  4FQT A;  3CR2 A;  2ZRS A;  3SG5 A;  5AER A;  1LKJ A;  2LCP A;  3CZ2 A;  3MSE B;  4YI9 A;  1CFC A;  3D10 A;  3IQO A;  4C0J A;  3I5F B;  2ZN9 A;  5D69 A;  3VRO A;  3EG5 B;  4QJ5 B;  1OQP A;  4FQO A;  2OTG C;  2L2C A;  5D7F A;  1LA3 A;  1QV0 A;  2KLD A;  2F33 A;  3UNW A;  1MHO A;  1A4P A;  1CTR A;  4WQ2 A;  1EL4 A;  1Q80 A;  2KQY A;  2OPO A;  4OR9 B;  1KK8 C;  3H4S E;  1TN4 A;  1H8B A;  3BUO B;  1Z4H A;  1JBA A;  2AUC A;  1F70 A;  1OOH A;  2LLU A;  2K7B A;  1NX1 A;  3SIA A; 
#chains in the Genus database with same CATH homology
 3DZT A;  4JD9 A;  4F7F A;  3CYZ A;  3FE9 A;  3D78 A;  3D73 A;  2QEH A;  2QEB A;  2ERB A;  3D74 A;  3D77 A;  4OZD A;  3L4A A;  1OW4 A;  3L47 A;  5EL2 A;  2JPO A;  3CDN A;  2QDI A;  1QWV A;  2WCL A;  3R1V A;  4INW A;  3R1O A;  2H8V A;  2FJY A;  3K1E A;  3B7A A;  3FE6 A;  2P70 A;  3R1P A;  3N7H A;  1ORG A;  3FE8 A;  3S0D A;  3DYE A;  1C3Y A;  1TWO A;  3DY9 A;  2PQL A;  3BFB A;  1XFR A;  4PT1 A;  3Q8I A;  3S0F A;  5DIC A;  3RZS A;  3V2L A;  3BFH A;  3B87 A;  2WCM A;  3D75 A;  3BJH A;  1GM0 A;  3B6X A;  3S0A A;  1TUJ A;  3OGN A;  3B86 A;  3S0E A;  2P71 A;  2WCJ A;  2KPH A;  4INX A;  3R72 A;  2GTE A;  3CZ1 A;  2WCH A;  3CAB A;  3D76 A;  3NHI A;  3VB1 A;  2WC6 A;  3PJI A;  1T14 A;  4FQT A;  3S0G A;  1OOF A;  3CZ2 A;  2WCK A;  3QME A;  3DXL A;  3NGV A;  3BFA A;  3L4L A;  2QEV A;  1P28 A;  1OOI X;  3S0B A;  3B88 A;  2L2C A;  3NHT A;  1DQE A;  3CZ0 A;  1C3Z A;  2WC5 A;  2QEO A;  1OOG A;  1OOH A;  1LS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...