1TUJA

Solution structure of the honey bee general odorant binding protein asp2 in complex with trimethylsilyl-d4 propionate
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
IDQDTVVAKYMEYLMPDIMPCADELHISEDIATNIQAAKNGADMSQLGCLKACVMKRIEMLKGTELYVEPVYKMIEVVHAGNADDIQLVKGIANECIENAKGETDECNIGNKYTDCYIEKLFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords odorant binding protein ASP2
publication title Solution structure of the honey bee general odorant binding protein ASP2 in complex with trimethylsilyl-d4 propionate
rcsb
source organism Apis mellifera
molecule tags Transport protein
total genus 32
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2004-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 1tujA00
2QEVA 1GM0A 3B87A 3CDNA 3S0FA 4INWA 3S0AA 1TUJA 2QEHA 4OZDA 3DZTA 2WCLA 3DYEA 3B7AA 1ORGA 3B88A 3S0DA 3RZSA 4JD9A 2QEBA 1C3ZA 5DICA 1OOGA 3D74A 3L47A 3DXLA 3N7HA 3FE8A 1XFRA 1OOIX 3QMEA 3NGVA 3CYZA 3NHIA 2QDIA 3Q8IA 2WC6A 2QEOA 3B86A 3BFBA 4F7FA 1C3YA 3D75A 3K1EA 3VB1A 2JPOA 2H8VA 1LS8A 3R72A 2WCHA 2FJYA 1OW4A 4PT1A 3D73A 3L4AA 3R1OA 2WCJA 3D77A 3BJHA 3BFAA 1TWOA 1QWVA 3FE9A 5EL2A 1OOFA 2WCKA 2GTEA 3NHTA 2L2CA 3BFHA 1P28A 2P71A 4INXA 3L4LA 2KPHA 3DY9A 3R1VA 2ERBA 3FE6A 3V2LA 3B6XA 3CABA 2PQLA 3PJIA 3S0EA 1OOHA 1DQEA 2WCMA 2WC5A 4FQTA 2P70A 3R1PA 3OGNA 3S0BA 3CZ0A 1T14A 3S0GA 3D76A 3CZ1A 3D78A 3CZ2A
chains in the Genus database with same CATH superfamily
2QEVA 2L4IA 1B8CA 1F4OA 1WDCC 1BR1B 3B87A 3DF0A 2NCPA 4INWA 1H4BA 3CR5X 1TUJA 1XFWO 1AJ5A 2P6BB 3A4UB 2JU0A 2MLEC 3DYEA 1WLMA 3EK4A 3S0DA 2K7BA 3TDIA 4M2OA 2M7LA 3EVRA 1B47A 3D78A 2BCAA 2GV5A 3LK1A 1WRLA 3SIBA 4NDCA 5CSNA 1GGWA 2KI6C 3L47A 3SG5A 4YI9A 2LV7A 1WRKA 3FE8A 2LLUA 5I2LA 4P2YB 1JWDA 3CYZA 3I5HC 1FI5A 2K8MB 2LC5A 3LK0A 4OV2A 3KF9A 1DC1A 2LLTA 2ZRTA 2YGUA 1DELA 1TRFA 3BFBA 1WRZA 3CWGA 2OTGC 3O4XA 4PHNA 4F7FA 3DD4A 1KSOA 4I5KA 4USLA 1YX7A 1DJIA 2K7OA 3AKBA 3K1EA 4JQ0D 1PSRA 1BLQA 1TNWA 2M1KB 2Y5IA 4PALA 3ZNIA 1C07A 2WORA 2JXLA 4U8DA 1CMGA 2JPOA 2JWWA 1LS8A 2H8VA 2LNKA 4A4CA 1KWOB 2H61C 2Q91A 1BF5A 1OW4A 2AUCA 3TZ1A 1SYMA 1GQMA 2LCPA 2WCJA 2F3ZA 1EH2A 2QPTA 5HL1A 2ZNDA 2M8UA 1DJYA 2K0JA 3FS7A 5KTYA 1XFXO 2F3YA 1ZOTB 2L50A 1S36A 2LMUA 1ALVA 4MZKA 1LINA 1YUTA 1W7IB 3FE9A 3PLFB 4HSZA 1G8IA 1S5GY 3SG3A 5K89A 2WCKA 5DKQA 2JT3A 1CMFA 5BPJA 3BUOB 1N0YA 1BMOA 3PM2A 3BFHA 1QIWA 1A03A 2NXQA 1S5GZ 4MLWA 1CDNA 1NCYA 1DJGA 2LVIA 1UHNA 2PASA 3JVTB 2KBMA 3O2PA 4GGFA 3DY9A 2M9GA 1CDLA 4DS7A 2JC2A 1B1GA 1UHKA 2KFHA 2D8NA 1TIZA 3DF0B 4DRWA 1LA0A 1X02A 2I2RE 3GK2A 3UNWA 2TN4A 1OE9B 2BL0B 2KYCA 3LL8B 4N1GA 3IQOA 2FCDA 4GGNA 2BNXA 1A2XA 1J55A 1FBVA 1SPYA 2H2KA 2MA2A 2WC5A 1Q80A 1W7JB 1SCMC 2KOTA 1RECA 3EVVA 1AJ4A 5JOLA 5CSFA 3NSKA 2KI4B 2K60A 1NX2A 1QVIY 4OVNF 1DTLA 3CR2A 2MRDA 1EG4A 4BY5A 3D76A 2RGIA 1JBAA 1LVCD 2ZNEA 1A4PA 1F54A 2E30A 1QVIZ 3NSLA 1YRUB 4AQJA 1BOCA 3ICBA 2LLSA 3SG2A 2PSRA 1WY9A 1ZMZA 1F70A 1V1FA 2HF5A 1VRKA 4MSPA 3S0FA 1MF8B 4ORAB 4GFTA 4OZDA 3VRRA 1ODBA 2COLB 1NCXA 3DZTA 2WCLA 3C1VA 1JSAA 1S1EA 2JNXA 5HLVA 1K94A 4I5JA 4PHMA 1K8UA 2F2PA 2JQ6A 1ALWA 1UHHA 1KWOC 1PK0D 5IBWA 3RZSA 4PE7A 1JUOA 1C3ZA 2JULA 2F33A 3HCMA 1XO5A 1K9KA 2LP3A 3TDUA 2I7AA 2R2IA 1MWNA 1XYDA 4JPZB 3AAJA 1G4YR 1K90D 3N7HA 2JPTA 1GJYA 5FI6A 1AUIB 3OX5A 3QRXA 3NGVA 1RFJA 1DJWA 1CDPA 4M2QA 1ZFSA 2K2FA 2QDIA 2M49B 1KQMB 2L2EA 1XFZO 3Q8IA 4OCIA 3SS5A 1BT6A 1SBJA 4MZJA 1S26D 4TNCA 1J7RA 1PRWA 2EHBA 2WCEA 1BU3A 1KK7Z 2KYFA 1QS7A 4BY4A 1DJXA 1KFUL 2BKIB 2GGMA 2LVKA 4GGFC 2WCBA 3PFVA 4OR9B 1QJTA 5DKNA 1IGVA 3JVTC 1UHJA 1IWQA 1SKTA 2JT0A 4MZLA 3O4YA 1R2UA 5KU1A 2NLNA 4PDZA 1E8AA 1MUXA 2ISDA 3VB1A 2BCBA 4A4BA 2GGZA 3R72A 2LUCA 4CFQA 2WCHA 2BL0C 3SG6A 3L4AA 3SS3A 5I8NA 2KQYA 3I5FB 4FQOA 1MXEA 2KAXA 1YX8A 2BBNA 2KAYA 1LKJA 4JKTA 4UPGA 1JFJA 1F71A 1NCZA 3BJHA 1C7WA 1Z4HA 1L7ZA 3PN7B 3I5GB 5ER4X 4QJ5B 1J7OA 1CM1A 1EJ3A 1BR4B 1SK6D 1B8LA 3FWBA 1PSBA 2LAPA 2FCEA 5J3XA 2L0PA 1CNPA 2KI4C 1YTZC 3TS5B 1TUZA 1XVJA 3KO0A 3RM1A 1ZUZA 2LUXA 3TDZA 3I5IB 5D3OA 1J1EA 2K2AA 2KLDA 2M97A 3K21A 1IJ6A 3V2LA 3CZTX 2WNDA 3MSEB 4ORBB 2PQLA 5AEQA 2KFGA 2WCFA 3JTDB 1S6CA 4PHJA 1K9PA 2Y4QA 3DVEA 1DJHA 1ZACA 3VRNA 1M39A 4MN0A 3S0EA 2SASA 3EG5B 3NSIA 4GNKB 1S3PA 1KSMA 2MHHA 2JZIA 5B8IB 1UUSA 4HRGA 3FIAA 4IL1A 3GOFA 3R1PA 2DOQA 3E3RA 3OGNA 1K96A 2LMTA 1A29A 3SJSA 3VGOA 2K7DA 4ZCVA 2KBIA 2BE6A 2SCPA 1RWYA 1W9ZA 1YUSA 2B1UA 2Y1MA 4F0ZB 1FW4A 1C7VA 4GBAA 2Y1NA 1KQMC 3CZ2A 1GGZA 4JWQA 1EXRA 1IH0A 1J1DA 2M29A 5AANA 2VRGA 1KFXL 3CDNA 1Y1XA 5ER5A 1V1GA 1JF2A 1KFXS 4E68A 2QEHA 3EKHA 1QIVA 2CBLA 1CFFA 5D7FA 3VROA 4QJ4B 2M0RA 2IS9A 3TUYB 1B7TZ 2CTNA 1ORGA 3B88A 2MAZA 1CLMA 1CB1A 2BAPA 4CFRA 2ZRSA 3D10A 1CM4A 2F2OA 4R1EA 1OQPA 1XFVO 1Y6WA 4JD9A 5JJGA 1S6IA 3I5FC 3O78A 3O6BA 1QX2A 4YRUA 1RTP1 3GK1A 3D74A 2ZKMX 1XK4A 3AKAA 3DXLA 1A75B 1SR6B 1B8RA 2HETA 1RK9A 2O60A 3H4SE 3NSOA 4HREE 1AK8A 3EK7A 1OOIX 3I5GC 2LP2A 3PN7C 1A75A 2QACA 3QMEA 4XJKA 3NHIA 3IQQA 5GQQC 1QX5B 3DVKA 2L4HA 3SG4A 2LHLA 3CS1A 5FI2A 2WC6A 2QEOA 3BXKA 3I5HB 1KQVA 2KGBC 3F45A 2CNPA 4WRIA 3TS5C 2O5GA 2PRUA 5I2OA 5PALA 1RROA 1MHOA 4NQGA 1C3YA 3I5IC 3D75A 1TNPA 4ORCB 5CSIA 1RJVA 1SCVA 1QTXA 1QV1A 1YRTB 1F8HA 1KK8B 3HX4A 2MJWB 1J7PA 2BECA 2CT9A 4M2PA 3JTDC 1OMDA 1JF0A 3D73A 4QJ3B 1F55A 1TN4A 1D1OA 1YVLA 3CTNA 4KYNA 1G33A 3KPXA 1CTRA 1YURA 3D77A 2PVBA 1KK7Y 1SRAA 1R6PA 1TWOA 2JNFA 3GK4X 3EKJA 1YUUA 3CLNA 3OP0A 5D69A 1SY9A 5FI7A 1CKKA 2KFFA 2L51A 4ETOA 1TNXA 2CCMA 5DKRA 1IIOA 1EL4A 1NP8A 2BCXA 2GTEA 1BJFA 1M46A 4CIDA 2FOTA 4GUKA 1HQVA 1YVHA 3LCPC 3NHTA 1XFUO 4YBHB 1U5IB 2L2CA 1KFUS 2LE9B 3PALA 1LA3A 1TTXA 1Y1AA 1IJ5A 1SL9A 2P71A 2KHNA 3A8RA 3L4LA 4INXA 2KPHA 1B9AA 1JC2A 1K93D 4P5OE 1OZSA 2ZN8A 2OS8B 1TCFA 4GAOA 3R1VA 2ERBA 3FE6A 1IQ3A 4C0JA 1K95A 1OOJA 1B4CA 1NSHA 4IJ7A 2LVVA 3CABA 4GPLB 1N2DA 3VRPA 2MLFC 1QLSA 1K9UA 1OMRA 3PJIA 3D0YB 2KSPA 4YGBB 3TUYC 1DQEA 2BBMA 2G2BA 1SL8A 3D0YA 1QXPA 3PSRA 4ICBA 1Z2CB 2WOSA 2HQWA 3WHTB 2AAOA 4YI8A 1SW8A 1XK4C 3LLEA 4FQTA 5HKYA 2P70A 3BQ3A 3BUMB 3CR4X 1XA5A 2JTZA 2JTTA 5F6TA 1DVIA 4I5NB 5FYXA 5HKZA 3ZWHA 1DGUA 2L98A 3CZ0A 1SR6C 4PE1A 1FI6A 1Y0VH 1NX3A 2OPOA 1SCMB 3S0GA 1IG5A 3BOWB 1DEKA 1DGVA 4DCKA 2G9BA 4YGCB 5TNCA 5KSZA 1SSEB 2M7NA 2V53A 1PVAA 2JXCA 4I5LB 1CFCA 3BOWA 5HKWA 1CFPA 1OOHA 1IRJA 4XYNA 1AVSA 4WQ2A 1KCYA 1GM0A 4HRHA 1TCOB 1AHRA 4MRXA 3DVMA 3S0AA 1IKUA 1DMOA 1J7QA 2M1UA 2EC6B 2L5XB 3B7AA 5I94A 1SNLA 3IF7A 1KK8C 1L2OB 4YGEB 4AQIA 4MBEA 4OKHA 2LANA 1QX7A 4XJKB 2QEBA 1NIWA 2JOJA 1MQ1A 5DICA 3WHUB 1F4QA 2K61A 1OOGA 1H8BA 2A4JA 1SL7A 2KI6D 1M45A 2ZN9A 1K2HA 4PHKA 5AERA 1LXFC 2M3WA 2I94A 1XFRA 2JT8A 1XFYO 1WLZA 1M31A 1AP4A 4N5XA 5G08A 4L9MA 1EG3A 3EK8A 4C0KA 3B86A 1SMGA 1B7TY 2MBXA 4YGAA 1WDCB 1NX0A 1QASA 2ZFDA 4MRYA 1QATA 3NXAA 4DIRA 4AOMA 3OB2B 1CFDA 4CPVA 3OX6A 4NDDA 1NUBA 1DF0B 2OS8C 3CGAA 4CLNA 2FJUB 4DUQA 3PM8A 1DT7B 1DF0A 1UURA 2FJYA 2KLEA 4PT1A 5CSJA 3VRQA 4PE0A 3R1OA 3WNXB 1OZOA 4PCWA 1BODA 2F8PA 5AFPA 4PE4A 5CPVA 1CLBA 1CLLA 3SG7A 1IQ5A 3IVTA 2KQ6A 4YGDB 5HYDA 1FF1A 1CDMA 1JFKA 3BUNB 5HLOA 3OBVA 3BFAA 1DJZA 1MR8A 4MEWA 3FWCA 2CXJA 4FTGA 2K7CA 2NCOA 1QWVA 2KGRA 4WQ3A 5EL2A 3PATA 4N1FA 1OOFA 1UP5A 2EGDA 2LVJA 3WXAA 1HT9A 1UHIA 2E6WA 3OB1B 2BKHB 3BUWB 3SIAA 3UO9A 1BG1A 1QLKA 2KDHA 2LHIA 3M0WA 1TNQA 2OTGB 2I18A 4ZCUA 3SS4A 1NYAA 1P28A 4MVFA 4D1EA 2WC8A 1N65A 3OHMB 1NX1A 3BUXB 1FPWA 1PALA 3B6XA 2PMYA 1OMVA 3KHEA 3KEVA 2KAVA 1UWOA 2JRFA 2EC6C 2H61A 4C0LA 1MXLC 1NPQA 2PYQA 1PULA 2BE4A 2WCMA 1L2OC 3BYAA 3EVUA 5I2QA 2HPSA 1TOPA 2Q4UA 2NZ0A 3RLZA 2LMVA 1QV0A 2KNEA 2L5YA 2LM5A 1PVBA 3AAKA 3DVJA 3S0BA 1T14A 1S6JA 1M63B 1U5IA 2PALA 1OSAA 3CZ1A 4Q04A 2AMIA 4NDBA 1NWDA 1Y1UA 1YR5A 5AXIA 2HQ8A
chains in the Genus database with same CATH topology
2QEVA 1GM0A 3B87A 3CDNA 3S0FA 4INWA 3S0AA 1TUJA 2QEHA 4OZDA 3DZTA 2WCLA 3DYEA 3B7AA 1ORGA 3B88A 3S0DA 3RZSA 4JD9A 2QEBA 1C3ZA 5DICA 1OOGA 3D74A 3L47A 3DXLA 3N7HA 3FE8A 1XFRA 1OOIX 3QMEA 3NGVA 3CYZA 3NHIA 2QDIA 3Q8IA 2WC6A 2QEOA 3B86A 3BFBA 4F7FA 1C3YA 3D75A 3K1EA 3VB1A 2JPOA 2H8VA 1LS8A 3R72A 2WCHA 2FJYA 1OW4A 4PT1A 3D73A 3L4AA 3R1OA 2WCJA 3D77A 3BJHA 3BFAA 1TWOA 1QWVA 3FE9A 5EL2A 1OOFA 2WCKA 2GTEA 3NHTA 2L2CA 3BFHA 1P28A 2P71A 4INXA 3L4LA 2KPHA 3DY9A 3R1VA 2ERBA 3FE6A 3V2LA 3B6XA 3CABA 2PQLA 3PJIA 3S0EA 1OOHA 1DQEA 2WCMA 2WC5A 4FQTA 2P70A 3R1PA 3OGNA 3S0BA 3CZ0A 1T14A 3S0GA 3D76A 3CZ1A 3D78A 3CZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEV A;  1GM0 A;  3B87 A;  3CDN A;  3S0F A;  4INW A;  3S0A A;  1TUJ A;  2QEH A;  4OZD A;  3DZT A;  2WCL A;  3DYE A;  3B7A A;  1ORG A;  3B88 A;  3S0D A;  3RZS A;  4JD9 A;  2QEB A;  1C3Z A;  5DIC A;  1OOG A;  3D74 A;  3L47 A;  3DXL A;  3N7H A;  3FE8 A;  1XFR A;  1OOI X;  3QME A;  3NGV A;  3CYZ A;  3NHI A;  2QDI A;  3Q8I A;  2WC6 A;  2QEO A;  3B86 A;  3BFB A;  4F7F A;  1C3Y A;  3D75 A;  3K1E A;  3VB1 A;  2JPO A;  2H8V A;  1LS8 A;  3R72 A;  2WCH A;  2FJY A;  1OW4 A;  4PT1 A;  3D73 A;  3L4A A;  3R1O A;  2WCJ A;  3D77 A;  3BJH A;  3BFA A;  1TWO A;  1QWV A;  3FE9 A;  5EL2 A;  1OOF A;  2WCK A;  2GTE A;  3NHT A;  2L2C A;  3BFH A;  1P28 A;  2P71 A;  4INX A;  3L4L A;  2KPH A;  3DY9 A;  3R1V A;  2ERB A;  3FE6 A;  3V2L A;  3B6X A;  3CAB A;  2PQL A;  3PJI A;  3S0E A;  1OOH A;  1DQE A;  2WCM A;  2WC5 A;  4FQT A;  2P70 A;  3R1P A;  3OGN A;  3S0B A;  3CZ0 A;  1T14 A;  3S0G A;  3D76 A;  3CZ1 A;  3D78 A;  3CZ2 A; 
#chains in the Genus database with same CATH topology
 2QEV A;  2L4I A;  1B8C A;  1F4O A;  1WDC C;  1BR1 B;  3B87 A;  3DF0 A;  2NCP A;  4INW A;  1H4B A;  3CR5 X;  1TUJ A;  1XFW O;  1AJ5 A;  2P6B B;  3A4U B;  2JU0 A;  2MLE C;  3DYE A;  1WLM A;  3EK4 A;  3S0D A;  2K7B A;  3TDI A;  4M2O A;  2M7L A;  3EVR A;  1B47 A;  3D78 A;  2BCA A;  2GV5 A;  3LK1 A;  1WRL A;  3SIB A;  4NDC A;  5CSN A;  1GGW A;  2KI6 C;  3L47 A;  3SG5 A;  4YI9 A;  2LV7 A;  1WRK A;  3FE8 A;  2LLU A;  5I2L A;  4P2Y B;  1JWD A;  3CYZ A;  3I5H C;  1FI5 A;  2K8M B;  2LC5 A;  3LK0 A;  4OV2 A;  3KF9 A;  1DC1 A;  2LLT A;  2ZRT A;  2YGU A;  1DEL A;  1TRF A;  3BFB A;  1WRZ A;  3CWG A;  2OTG C;  3O4X A;  4PHN A;  4F7F A;  3DD4 A;  1KSO A;  4I5K A;  4USL A;  1YX7 A;  1DJI A;  2K7O A;  3AKB A;  3K1E A;  4JQ0 D;  1PSR A;  1BLQ A;  1TNW A;  2M1K B;  2Y5I A;  4PAL A;  3ZNI A;  1C07 A;  2WOR A;  2JXL A;  4U8D A;  1CMG A;  2JPO A;  2JWW A;  1LS8 A;  2H8V A;  2LNK A;  4A4C A;  1KWO B;  2H61 C;  2Q91 A;  1BF5 A;  1OW4 A;  2AUC A;  3TZ1 A;  1SYM A;  1GQM A;  2LCP A;  2WCJ A;  2F3Z A;  1EH2 A;  2QPT A;  5HL1 A;  2ZND A;  2M8U A;  1DJY A;  2K0J A;  3FS7 A;  5KTY A;  1XFX O;  2F3Y A;  1ZOT B;  2L50 A;  1S36 A;  2LMU A;  1ALV A;  4MZK A;  1LIN A;  1YUT A;  1W7I B;  3FE9 A;  3PLF B;  4HSZ A;  1G8I A;  1S5G Y;  3SG3 A;  5K89 A;  2WCK A;  5DKQ A;  2JT3 A;  1CMF A;  5BPJ A;  3BUO B;  1N0Y A;  1BMO A;  3PM2 A;  3BFH A;  1QIW A;  1A03 A;  2NXQ A;  1S5G Z;  4MLW A;  1CDN A;  1NCY A;  1DJG A;  2LVI A;  1UHN A;  2PAS A;  3JVT B;  2KBM A;  3O2P A;  4GGF A;  3DY9 A;  2M9G A;  1CDL A;  4DS7 A;  2JC2 A;  1B1G A;  1UHK A;  2KFH A;  2D8N A;  1TIZ A;  3DF0 B;  4DRW A;  1LA0 A;  1X02 A;  2I2R E;  3GK2 A;  3UNW A;  2TN4 A;  1OE9 B;  2BL0 B;  2KYC A;  3LL8 B;  4N1G A;  3IQO A;  2FCD A;  4GGN A;  2BNX A;  1A2X A;  1J55 A;  1FBV A;  1SPY A;  2H2K A;  2MA2 A;  2WC5 A;  1Q80 A;  1W7J B;  1SCM C;  2KOT A;  1REC A;  3EVV A;  1AJ4 A;  5JOL A;  5CSF A;  3NSK A;  2KI4 B;  2K60 A;  1NX2 A;  1QVI Y;  4OVN F;  1DTL A;  3CR2 A;  2MRD A;  1EG4 A;  4BY5 A;  3D76 A;  2RGI A;  1JBA A;  1LVC D;  2ZNE A;  1A4P A;  1F54 A;  2E30 A;  1QVI Z;  3NSL A;  1YRU B;  4AQJ A;  1BOC A;  3ICB A;  2LLS A;  3SG2 A;  2PSR A;  1WY9 A;  1ZMZ A;  1F70 A;  1V1F A;  2HF5 A;  1VRK A;  4MSP A;  3S0F A;  1MF8 B;  4ORA B;  4GFT A;  4OZD A;  3VRR A;  1ODB A;  2COL B;  1NCX A;  3DZT A;  2WCL A;  3C1V A;  1JSA A;  1S1E A;  2JNX A;  5HLV A;  1K94 A;  4I5J A;  4PHM A;  1K8U A;  2F2P A;  2JQ6 A;  1ALW A;  1UHH A;  1KWO C;  1PK0 D;  5IBW A;  3RZS A;  4PE7 A;  1JUO A;  1C3Z A;  2JUL A;  2F33 A;  3HCM A;  1XO5 A;  1K9K A;  2LP3 A;  3TDU A;  2I7A A;  2R2I A;  1MWN A;  1XYD A;  4JPZ B;  3AAJ A;  1G4Y R;  1K90 D;  3N7H A;  2JPT A;  1GJY A;  5FI6 A;  1AUI B;  3OX5 A;  3QRX A;  3NGV A;  1RFJ A;  1DJW A;  1CDP A;  4M2Q A;  1ZFS A;  2K2F A;  2QDI A;  2M49 B;  1KQM B;  2L2E A;  1XFZ O;  3Q8I A;  4OCI A;  3SS5 A;  1BT6 A;  1SBJ A;  4MZJ A;  1S26 D;  4TNC A;  1J7R A;  1PRW A;  2EHB A;  2WCE A;  1BU3 A;  1KK7 Z;  2KYF A;  1QS7 A;  4BY4 A;  1DJX A;  1KFU L;  2BKI B;  2GGM A;  2LVK A;  4GGF C;  2WCB A;  3PFV A;  4OR9 B;  1QJT A;  5DKN A;  1IGV A;  3JVT C;  1UHJ A;  1IWQ A;  1SKT A;  2JT0 A;  4MZL A;  3O4Y A;  1R2U A;  5KU1 A;  2NLN A;  4PDZ A;  1E8A A;  1MUX A;  2ISD A;  3VB1 A;  2BCB A;  4A4B A;  2GGZ A;  3R72 A;  2LUC A;  4CFQ A;  2WCH A;  2BL0 C;  3SG6 A;  3L4A A;  3SS3 A;  5I8N A;  2KQY A;  3I5F B;  4FQO A;  1MXE A;  2KAX A;  1YX8 A;  2BBN A;  2KAY A;  1LKJ A;  4JKT A;  4UPG A;  1JFJ A;  1F71 A;  1NCZ A;  3BJH A;  1C7W A;  1Z4H A;  1L7Z A;  3PN7 B;  3I5G B;  5ER4 X;  4QJ5 B;  1J7O A;  1CM1 A;  1EJ3 A;  1BR4 B;  1SK6 D;  1B8L A;  3FWB A;  1PSB A;  2LAP A;  2FCE A;  5J3X A;  2L0P A;  1CNP A;  2KI4 C;  1YTZ C;  3TS5 B;  1TUZ A;  1XVJ A;  3KO0 A;  3RM1 A;  1ZUZ A;  2LUX A;  3TDZ A;  3I5I B;  5D3O A;  1J1E A;  2K2A A;  2KLD A;  2M97 A;  3K21 A;  1IJ6 A;  3V2L A;  3CZT X;  2WND A;  3MSE B;  4ORB B;  2PQL A;  5AEQ A;  2KFG A;  2WCF A;  3JTD B;  1S6C A;  4PHJ A;  1K9P A;  2Y4Q A;  3DVE A;  1DJH A;  1ZAC A;  3VRN A;  1M39 A;  4MN0 A;  3S0E A;  2SAS A;  3EG5 B;  3NSI A;  4GNK B;  1S3P A;  1KSM A;  2MHH A;  2JZI A;  5B8I B;  1UUS A;  4HRG A;  3FIA A;  4IL1 A;  3GOF A;  3R1P A;  2DOQ A;  3E3R A;  3OGN A;  1K96 A;  2LMT A;  1A29 A;  3SJS A;  3VGO A;  2K7D A;  4ZCV A;  2KBI A;  2BE6 A;  2SCP A;  1RWY A;  1W9Z A;  1YUS A;  2B1U A;  2Y1M A;  4F0Z B;  1FW4 A;  1C7V A;  4GBA A;  2Y1N A;  1KQM C;  3CZ2 A;  1GGZ A;  4JWQ A;  1EXR A;  1IH0 A;  1J1D A;  2M29 A;  5AAN A;  2VRG A;  1KFX L;  3CDN A;  1Y1X A;  5ER5 A;  1V1G A;  1JF2 A;  1KFX S;  4E68 A;  2QEH A;  3EKH A;  1QIV A;  2CBL A;  1CFF A;  5D7F A;  3VRO A;  4QJ4 B;  2M0R A;  2IS9 A;  3TUY B;  1B7T Z;  2CTN A;  1ORG A;  3B88 A;  2MAZ A;  1CLM A;  1CB1 A;  2BAP A;  4CFR A;  2ZRS A;  3D10 A;  1CM4 A;  2F2O A;  4R1E A;  1OQP A;  1XFV O;  1Y6W A;  4JD9 A;  5JJG A;  1S6I A;  3I5F C;  3O78 A;  3O6B A;  1QX2 A;  4YRU A;  1RTP 1;  3GK1 A;  3D74 A;  2ZKM X;  1XK4 A;  3AKA A;  3DXL A;  1A75 B;  1SR6 B;  1B8R A;  2HET A;  1RK9 A;  2O60 A;  3H4S E;  3NSO A;  4HRE E;  1AK8 A;  3EK7 A;  1OOI X;  3I5G C;  2LP2 A;  3PN7 C;  1A75 A;  2QAC A;  3QME A;  4XJK A;  3NHI A;  3IQQ A;  5GQQ C;  1QX5 B;  3DVK A;  2L4H A;  3SG4 A;  2LHL A;  3CS1 A;  5FI2 A;  2WC6 A;  2QEO A;  3BXK A;  3I5H B;  1KQV A;  2KGB C;  3F45 A;  2CNP A;  4WRI A;  3TS5 C;  2O5G A;  2PRU A;  5I2O A;  5PAL A;  1RRO A;  1MHO A;  4NQG A;  1C3Y A;  3I5I C;  3D75 A;  1TNP A;  4ORC B;  5CSI A;  1RJV A;  1SCV A;  1QTX A;  1QV1 A;  1YRT B;  1F8H A;  1KK8 B;  3HX4 A;  2MJW B;  1J7P A;  2BEC A;  2CT9 A;  4M2P A;  3JTD C;  1OMD A;  1JF0 A;  3D73 A;  4QJ3 B;  1F55 A;  1TN4 A;  1D1O A;  1YVL A;  3CTN A;  4KYN A;  1G33 A;  3KPX A;  1CTR A;  1YUR A;  3D77 A;  2PVB A;  1KK7 Y;  1SRA A;  1R6P A;  1TWO A;  2JNF A;  3GK4 X;  3EKJ A;  1YUU A;  3CLN A;  3OP0 A;  5D69 A;  1SY9 A;  5FI7 A;  1CKK A;  2KFF A;  2L51 A;  4ETO A;  1TNX A;  2CCM A;  5DKR A;  1IIO A;  1EL4 A;  1NP8 A;  2BCX A;  2GTE A;  1BJF A;  1M46 A;  4CID A;  2FOT A;  4GUK A;  1HQV A;  1YVH A;  3LCP C;  3NHT A;  1XFU O;  4YBH B;  1U5I B;  2L2C A;  1KFU S;  2LE9 B;  3PAL A;  1LA3 A;  1TTX A;  1Y1A A;  1IJ5 A;  1SL9 A;  2P71 A;  2KHN A;  3A8R A;  3L4L A;  4INX A;  2KPH A;  1B9A A;  1JC2 A;  1K93 D;  4P5O E;  1OZS A;  2ZN8 A;  2OS8 B;  1TCF A;  4GAO A;  3R1V A;  2ERB A;  3FE6 A;  1IQ3 A;  4C0J A;  1K95 A;  1OOJ A;  1B4C A;  1NSH A;  4IJ7 A;  2LVV A;  3CAB A;  4GPL B;  1N2D A;  3VRP A;  2MLF C;  1QLS A;  1K9U A;  1OMR A;  3PJI A;  3D0Y B;  2KSP A;  4YGB B;  3TUY C;  1DQE A;  2BBM A;  2G2B A;  1SL8 A;  3D0Y A;  1QXP A;  3PSR A;  4ICB A;  1Z2C B;  2WOS A;  2HQW A;  3WHT B;  2AAO A;  4YI8 A;  1SW8 A;  1XK4 C;  3LLE A;  4FQT A;  5HKY A;  2P70 A;  3BQ3 A;  3BUM B;  3CR4 X;  1XA5 A;  2JTZ A;  2JTT A;  5F6T A;  1DVI A;  4I5N B;  5FYX A;  5HKZ A;  3ZWH A;  1DGU A;  2L98 A;  3CZ0 A;  1SR6 C;  4PE1 A;  1FI6 A;  1Y0V H;  1NX3 A;  2OPO A;  1SCM B;  3S0G A;  1IG5 A;  3BOW B;  1DEK A;  1DGV A;  4DCK A;  2G9B A;  4YGC B;  5TNC A;  5KSZ A;  1SSE B;  2M7N A;  2V53 A;  1PVA A;  2JXC A;  4I5L B;  1CFC A;  3BOW A;  5HKW A;  1CFP A;  1OOH A;  1IRJ A;  4XYN A;  1AVS A;  4WQ2 A;  1KCY A;  1GM0 A;  4HRH A;  1TCO B;  1AHR A;  4MRX A;  3DVM A;  3S0A A;  1IKU A;  1DMO A;  1J7Q A;  2M1U A;  2EC6 B;  2L5X B;  3B7A A;  5I94 A;  1SNL A;  3IF7 A;  1KK8 C;  1L2O B;  4YGE B;  4AQI A;  4MBE A;  4OKH A;  2LAN A;  1QX7 A;  4XJK B;  2QEB A;  1NIW A;  2JOJ A;  1MQ1 A;  5DIC A;  3WHU B;  1F4Q A;  2K61 A;  1OOG A;  1H8B A;  2A4J A;  1SL7 A;  2KI6 D;  1M45 A;  2ZN9 A;  1K2H A;  4PHK A;  5AER A;  1LXF C;  2M3W A;  2I94 A;  1XFR A;  2JT8 A;  1XFY O;  1WLZ A;  1M31 A;  1AP4 A;  4N5X A;  5G08 A;  4L9M A;  1EG3 A;  3EK8 A;  4C0K A;  3B86 A;  1SMG A;  1B7T Y;  2MBX A;  4YGA A;  1WDC B;  1NX0 A;  1QAS A;  2ZFD A;  4MRY A;  1QAT A;  3NXA A;  4DIR A;  4AOM A;  3OB2 B;  1CFD A;  4CPV A;  3OX6 A;  4NDD A;  1NUB A;  1DF0 B;  2OS8 C;  3CGA A;  4CLN A;  2FJU B;  4DUQ A;  3PM8 A;  1DT7 B;  1DF0 A;  1UUR A;  2FJY A;  2KLE A;  4PT1 A;  5CSJ A;  3VRQ A;  4PE0 A;  3R1O A;  3WNX B;  1OZO A;  4PCW A;  1BOD A;  2F8P A;  5AFP A;  4PE4 A;  5CPV A;  1CLB A;  1CLL A;  3SG7 A;  1IQ5 A;  3IVT A;  2KQ6 A;  4YGD B;  5HYD A;  1FF1 A;  1CDM A;  1JFK A;  3BUN B;  5HLO A;  3OBV A;  3BFA A;  1DJZ A;  1MR8 A;  4MEW A;  3FWC A;  2CXJ A;  4FTG A;  2K7C A;  2NCO A;  1QWV A;  2KGR A;  4WQ3 A;  5EL2 A;  3PAT A;  4N1F A;  1OOF A;  1UP5 A;  2EGD A;  2LVJ A;  3WXA A;  1HT9 A;  1UHI A;  2E6W A;  3OB1 B;  2BKH B;  3BUW B;  3SIA A;  3UO9 A;  1BG1 A;  1QLK A;  2KDH A;  2LHI A;  3M0W A;  1TNQ A;  2OTG B;  2I18 A;  4ZCU A;  3SS4 A;  1NYA A;  1P28 A;  4MVF A;  4D1E A;  2WC8 A;  1N65 A;  3OHM B;  1NX1 A;  3BUX B;  1FPW A;  1PAL A;  3B6X A;  2PMY A;  1OMV A;  3KHE A;  3KEV A;  2KAV A;  1UWO A;  2JRF A;  2EC6 C;  2H61 A;  4C0L A;  1MXL C;  1NPQ A;  2PYQ A;  1PUL A;  2BE4 A;  2WCM A;  1L2O C;  3BYA A;  3EVU A;  5I2Q A;  2HPS A;  1TOP A;  2Q4U A;  2NZ0 A;  3RLZ A;  2LMV A;  1QV0 A;  2KNE A;  2L5Y A;  2LM5 A;  1PVB A;  3AAK A;  3DVJ A;  3S0B A;  1T14 A;  1S6J A;  1M63 B;  1U5I A;  2PAL A;  1OSA A;  3CZ1 A;  4Q04 A;  2AMI A;  4NDB A;  1NWD A;  1Y1U A;  1YR5 A;  5AXI A;  2HQ8 A; 
#chains in the Genus database with same CATH homology
 2QEV A;  1GM0 A;  3B87 A;  3CDN A;  3S0F A;  4INW A;  3S0A A;  1TUJ A;  2QEH A;  4OZD A;  3DZT A;  2WCL A;  3DYE A;  3B7A A;  1ORG A;  3B88 A;  3S0D A;  3RZS A;  4JD9 A;  2QEB A;  1C3Z A;  5DIC A;  1OOG A;  3D74 A;  3L47 A;  3DXL A;  3N7H A;  3FE8 A;  1XFR A;  1OOI X;  3QME A;  3NGV A;  3CYZ A;  3NHI A;  2QDI A;  3Q8I A;  2WC6 A;  2QEO A;  3B86 A;  3BFB A;  4F7F A;  1C3Y A;  3D75 A;  3K1E A;  3VB1 A;  2JPO A;  2H8V A;  1LS8 A;  3R72 A;  2WCH A;  2FJY A;  1OW4 A;  4PT1 A;  3D73 A;  3L4A A;  3R1O A;  2WCJ A;  3D77 A;  3BJH A;  3BFA A;  1TWO A;  1QWV A;  3FE9 A;  5EL2 A;  1OOF A;  2WCK A;  2GTE A;  3NHT A;  2L2C A;  3BFH A;  1P28 A;  2P71 A;  4INX A;  3L4L A;  2KPH A;  3DY9 A;  3R1V A;  2ERB A;  3FE6 A;  3V2L A;  3B6X A;  3CAB A;  2PQL A;  3PJI A;  3S0E A;  1OOH A;  1DQE A;  2WCM A;  2WC5 A;  4FQT A;  2P70 A;  3R1P A;  3OGN A;  3S0B A;  3CZ0 A;  1T14 A;  3S0G A;  3D76 A;  3CZ1 A;  3D78 A;  3CZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...