1TUJA

Solution structure of the honey bee general odorant binding protein asp2 in complex with trimethylsilyl-d4 propionate
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
IDQDTVVAKYMEYLMPDIMPCADELHISEDIATNIQAAKNGADMSQLGCLKACVMKRIEMLKGTELYVEPVYKMIEVVHAGNADDIQLVKGIANECIENAKGETDECNIGNKYTDCYIEKLFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords odorant binding protein ASP2
publication title Solution structure of the honey bee general odorant binding protein ASP2 in complex with trimethylsilyl-d4 propionate
rcsb
source organism Apis mellifera
molecule tags Transport protein
total genus 32
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2004-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 1tujA00
2WC5A 2PQLA 3CDNA 3DY9A 3D76A 3L4LA 4OZDA 3S0GA 2WCLA 3QMEA 2WCJA 2QEOA 3B87A 3NHTA 1TUJA 1OW4A 4INWA 4INXA 2WCHA 3V2LA 3R1PA 2P70A 3D75A 3BFAA 2QEBA 5DICA 1LS8A 2QDIA 2WC6A 3BFBA 3CABA 3S0AA 2JPOA 1XFRA 1OOIX 1OOGA 3FE8A 3B7AA 3R1OA 4JD9A 1ORGA 2ERBA 3D78A 3FE6A 3DXLA 3B88A 2FJYA 3OGNA 2P71A 3L47A 3L4AA 4FQTA 1OOHA 3R1VA 4PT1A 1TWOA 3S0BA 2WCKA 3VB1A 2QEVA 3CYZA 3N7HA 3FE9A 1QWVA 3B6XA 3DZTA 2QEHA 3B86A 3BJHA 3PJIA 3S0EA 3CZ1A 3RZSA 3R72A 3D73A 1GM0A 3D77A 4F7FA 2L2CA 3NHIA 2H8VA 3D74A 1C3ZA 3NGVA 3CZ0A 3K1EA 1OOFA 3CZ2A 1C3YA 2WCMA 3S0DA 3S0FA 1P28A 3Q8IA 3BFHA 1T14A 1DQEA 3DYEA 5EL2A 2KPHA 2GTEA
chains in the Genus database with same CATH superfamily
4PALA 1GQMA 1KQMB 1YRUB 2WC5A 3BUXB 4YGCB 1CDLA 1XFZO 1NYAA 1ZUZA 1KWOB 3D0YB 5HYDA 4MLWA 3AAJA 3D76A 3IF7A 3KHEA 2PMYA 4YGAA 4AOMA 4AQJA 1ODBA 1IIOA 2SASA 1BJFA 2K2AA 2WCLA 2LM5A 2Y5IA 1TTXA 2OS8C 1KSOA 1TCFA 1SY9A 1Y6WA 4WQ3A 3QMEA 3LK1A 1YUTA 3RM1A 2WCJA 3EVUA 2PRUA 3JVTB 1K96A 2LVKA 2K61A 2M7NA 3NXAA 1QIWA 2ZN9A 4GAOA 4I5NB 4JPZB 3TS5B 1ALWA 2IS9A 1K95A 1QS7A 3ICBA 3NSLA 1X02A 3CGAA 3FIAA 3V2LA 5KTYA 1OZSA 4D1EA 2BCXA 1XK4C 2NZ0A 5IBWA 3BFAA 3AAKA 1S6JA 3CTNA 1JBAA 1A29A 2K0JA 1K9UA 2NCPA 3HX4A 4I5KA 3VROA 1WRLA 2KLDA 1MXEA 1OMVA 2KYCA 2MAZA 3B7AA 3A4UB 2M49B 4DUQA 1K2HA 2CT9A 5CPVA 1OMRA 1SL8A 1HT9A 5CSJA 1UHJA 2L2EA 1PALA 1OSAA 2M1UA 1WLMA 3CR4X 1BT6A 4MRYA 2Y1MA 4WQ2A 1V1FA 5FYXA 3UNWA 4L9MA 4PE4A 1BG1A 2KDHA 2KQ6A 1QVIY 2NCOA 3FE6A 3OX6A 5KSZA 2VRGA 2LVVA 1DELA 1BU3A 2JXCA 3B88A 3SG6A 2Y4QA 1WRZA 3JTDC 1NSHA 3DVKA 3R1VA 4N1FA 2L98A 4NDCA 3MSEB 2KYFA 1KK8C 2FCEA 2ZN8A 1QLSA 1BF5A 1TCOB 5ER5A 1IKUA 2QEVA 5HKYA 3N7HA 2LHIA 4PHMA 5AANA 4KYNA 3SG5A 3DZTA 1N2DA 3CS1A 1TN4A 4OV2A 3SJSA 1ZMZA 1PVBA 1KK7Y 1EG3A 4PDZA 2LVJA 2M1KB 2LNKA 3UO9A 1LA0A 3OB2B 1LA3A 4YRUA 1G4YR 3LK0A 3TUYB 1K9PA 1LXFC 3GK2A 1DJYA 2MRDA 4YBHB 1S1EA 3OX5A 3R72A 3I5GB 1GM0A 2HETA 3TDUA 2OPOA 1SNLA 4A4BA 1H4BA 2L2CA 1QXPA 1R2UA 2LC5A 3EVRA 2LAPA 3NHIA 3TDIA 2LLUA 2PALA 1C3ZA 2WCFA 2COLB 3BXKA 1BR1B 2CNPA 3EK4A 3PATA 3PN7B 1NX1A 1WRKA 1C3YA 1G33A 2AUCA 4MZKA 3QRXA 4N1GA 2JULA 5DKNA 1S5GY 3BQ3A 3I5HC 4XJKA 3SG4A 2JC2A 2OTGB 5TNCA 1FI6A 3DD4A 3Q8IA 1AVSA 4XYNA 1NCYA 2ZNEA 3A8RA 1A75B 4MRXA 1PSRA 2PVBA 1SPYA 4IJ7A 1SCMC 3DYEA 2H61A 5I8NA 1KFUS 1XFYO 4NDDA 2KPHA 1J7PA 1KFXL 4DRWA 1A75A 2AAOA 1RECA 2SCPA 1IJ5A 2PQLA 3DVMA 4I5LB 1FBVA 5JOLA 1KSMA 1NWDA 5I94A 1QVIZ 2MLFC 3VRNA 1ALVA 4GGNA 2I94A 1YURA 2L4HA 2L5XB 1XFWO 3S0GA 2KFGA 3VRQA 3PALA 1UHHA 2KQYA 3BYAA 1DJZA 4MZJA 2QEOA 3C1VA 3NHTA 4INWA 4QJ4B 5I2QA 5PALA 2KAYA 1IWQA 2D8NA 2M29A 1CFCA 3CLNA 1KK7Z 1MXLC 1EH2A 1TNQA 2F8PA 3R1PA 4NDBA 1UURA 2JWWA 1B47A 1OQPA 1M31A 4YI8A 4M2OA 1YVLA 1L7ZA 2QEBA 5DICA 1J55A 3BFBA 1CMGA 1DEKA 2LLSA 1UHNA 3S0AA 1OE9B 2NXQA 1CLMA 1SKTA 2JPOA 5FI2A 1WDCB 4CIDA 1UHIA 1OOIX 1UWOA 3O78A 2BL0C 3FE8A 3H4SE 2KLEA 2QACA 3NSOA 4M2PA 1MHOA 3SS4A 4AQIA 1K93D 1A4PA 3FS7A 2LUXA 3D0YA 1LINA 3O2PA 1WLZA 1CDPA 1IJ6A 2K7CA 1S6CA 2HQWA 3OB1B 2MLEC 3D78A 2BBMA 2CXJA 3SIBA 2JRFA 2NLNA 1IQ5A 2FJYA 5F6TA 2LCPA 2OS8B 1B8CA 3SG2A 1E8AA 2P71A 3I5FC 3L4AA 1QX2A 3PSRA 1S5GZ 2KFFA 1S6IA 1Z2CB 1QASA 2BKHB 1L2OC 1SRAA 2WCKA 2JT0A 4M2QA 1J7OA 1EG4A 3CYZA 1TNWA 1XA5A 2JOJA 3M0WA 4CFQA 4ORCB 1B1GA 1S36A 2AMIA 2BCAA 1UHKA 1TIZA 1J1DA 1CFDA 3BUWB 1QLKA 5I2LA 2M97A 5FI7A 4MEWA 5HKWA 2PYQA 3IQOA 4GFTA 2R2IA 4PCWA 1ZFSA 1SK6D 1DJXA 3RZSA 2BAPA 2JTZA 2QPTA 3D77A 4MSPA 2BE4A 2KI6D 4NQGA 5CSFA 1DVIA 3PLFB 1TNPA 1XVJA 1CTRA 1IGVA 2KNEA 1MF8B 3CZTX 3WHTB 1JF2A 4PE1A 3KPXA 1B7TY 1DJWA 1DTLA 4YGDB 5ER4X 1QJTA 2L5YA 2LMVA 2K7OA 3JTDB 1K94A 2EGDA 2LP2A 3S0DA 2BECA 2ZNDA 3O4XA 3SG7A 1C07A 2K2FA 5AFPA 2B1UA 3KEVA 1DC1A 2JTTA 2LP3A 4WRIA 2RGIA 2EC6C 3S0FA 5DKRA 3BUOB 3CR2A 3BFHA 1N65A 2G9BA 1JF0A 1RFJA 1DQEA 2L51A 2M3WA 3F45A 4HREE 3BUNB 2KSPA 3PM8A 2KAVA 1FI5A 1B8RA 3GOFA 1QX7A 1F4QA 2ZRTA 4DCKA 1AJ4A 2JT3A 2LMTA 5J3XA 1JC2A 2ZRSA 3EK8A 4R1EA 4A4CA 3NSIA 1MUXA 1LVCD 1XFXO 5D3OA 3RLZA 2HF5A 2WC8A 2I2RE 1SBJA 1QV0A 2E6WA 3L4LA 3OP0A 1JFKA 4MN0A 1EJ3A 1KFUL 1RWYA 1FW4A 3ZWHA 1YX8A 3B87A 2BKIB 1CLBA 1CDNA 1TUJA 3PN7C 1HQVA 3WXAA 2EHBA 5CSIA 1KCYA 4INXA 1K9KA 2KI6C 5AEQA 5I2OA 2WCHA 1XFVO 3I5HB 4HSZA 2PSRA 3IQQA 1MR8A 1F55A 4C0KA 1PRWA 1SMGA 2F33A 2P70A 4GPLB 1W7IB 3D75A 2CCMA 1NP8A 2MHHA 4FTGA 2H61C 2WC6A 2G2BA 2CBLA 1KQVA 1F71A 1SCMB 2F3YA 2K7DA 1XFRA 2BNXA 2I7AA 1AUIB 1Y1AA 3E3RA 5D7FA 1UUSA 1RJVA 3DF0B 3SS5A 1CNPA 1PVAA 1NX3A 3EKJA 1CKKA 1FPWA 3AKAA 3I5IB 4CPVA 1XFUO 3R1OA 4I5JA 3EK7A 3WNXB 1UP5A 1B7TZ 1QATA 3NSKA 1DGVA 1M39A 1G8IA 1SL9A 1AP4A 3BOWB 1M45A 2K60A 2KFHA 3L47A 2MA2A 3OHMB 1BMOA 2V53A 2LE9B 4FQTA 4PT1A 5BPJA 4QJ5B 1FF1A 1TWOA 1XO5A 3S0BA 2KBMA 2KI4C 1SCVA 5GQQC 4UPGA 3VB1A 1S26D 3FE9A 2ISDA 3B6XA 4TNCA 4OCIA 1YRTB 2PASA 1BOCA 1F70A 2DOQA 2QEHA 2GGMA 3KO0A 3DVEA 1B8LA 4YGBB 1U5IB 2WCBA 1OZOA 2L50A 2KGBC 1CMFA 2O60A 1SR6C 1MWNA 1OMDA 3S0EA 1KQMC 5HLOA 2L0PA 4GGFA 2BL0B 3CZ1A 3HCMA 4OKHA 1BLQA 1KWOC 1NX2A 4DIRA 4F7FA 2FCDA 4OR9B 1B4CA 1NPQA 4JWQA 2H8VA 1C7WA 4GNKB 1GGWA 1W9ZA 2ZFDA 1J7QA 4E68A 3CZ0A 3BUMB 4HRGA 1EL4A 1RTP1 2JNXA 2ZKMX 3TZ1A 4FQOA 1M46A 4USLA 5K89A 1PK0D 4U8DA 3CZ2A 3JVTC 3I5FB 1B9AA 2JU0A 2WORA 4MZLA 3TS5C 4PHJA 3OBVA 4ORAB 3TDZA 2F2PA 1L2OB 1DMOA 4ZCUA 5AXIA 1JFJA 2TN4A 1TNXA 4Q04A 5B8IB 1BR4B 4MBEA 1RROA 1QTXA 3D10A 4C0LA 4DS7A 1CFFA 1QIVA 1P28A 1YTZC 3K21A 1T14A 1XK4A 2BBNA 1AK8A 1XYDA 1K90D 4PHNA 5G08A 1F8HA 2A4JA 2KHNA 1EXRA 5CSNA 4F0ZB 2Q4UA 2GTEA 1IRJA 1R6PA 1QV1A 3CDNA 2I18A 1CM4A 2LUCA 2MJWB 3DY9A 3SIAA 1W7JB 1PULA 5DKQA 4P5OE 1JUOA 1DGUA 1SL7A 1SSEB 2CTNA 4OZDA 1A03A 4YGEB 1DT7B 1H8BA 5FI6A 1KK8B 2K7BA 4PE0A 1M63B 3CR5X 4YI9A 3PFVA 4C0JA 1OW4A 4ICBA 3FWCA 1CDMA 1YX7A 4GBAA 4ZCVA 5KU1A 2JPTA 1YUSA 1BODA 1TUZA 2EC6B 2M7LA 3FWBA 2K8MB 3SS3A 1F4OA 5D69A 4ETOA 1Y1UA 1LS8A 2QDIA 3CABA 2JQ6A 1NX0A 2GGZA 3TUYC 2H2KA 3WHUB 2M0RA 1S3PA 1CB1A 1OOGA 1Y0VH 2WNDA 2MBXA 4P2YB 3CWGA 3I5GC 3PM2A 2F2OA 3VRPA 3VRRA 4CFRA 1IQ3A 5AERA 1AJ5A 4JKTA 1J7RA 1AHRA 3LL8B 2WOSA 1DF0B 1NIWA 2JZIA 1CM1A 1CFPA 1OOJA 4JD9A 1ORGA 1TOPA 1JWDA 1SYMA 1GJYA 1SW8A 2ERBA 2LMUA 3DXLA 3O6BA 1VRKA 1ZACA 3ZNIA 2Q91A 1DF0A 3OGNA 2FJUB 5HKZA 1OOHA 4BY4A 1DJIA 2KGRA 2M9GA 1RK9A 2LV7A 1D1OA 1ZOTB 4GUKA 2O5GA 4XJKB 1QWVA 3GK4X 5HL1A 2HPSA 2OTGC 2KAXA 1MQ1A 1CLLA 1NUBA 2M8UA 3IVTA 3KF9A 3EVVA 1YVHA 4HRHA 3GK1A 4IL1A 3B86A 4OVNF 2LVIA 2BCBA 3BJHA 1YUUA 4ORBB 1N0YA 2L4IA 1PSBA 1YR5A 2KOTA 1NCZA 1TRFA 1K8UA 5HLVA 3PJIA 3EG5B 3EKHA 3DF0A 2GV5A 3SG3A 4N5XA 3D73A 1Z4HA 1Y1XA 2JT8A 2LLTA 2HQ8A 3O4YA 1C7VA 2Y1NA 3D74A 1Q80A 2JNFA 3NGVA 4BY5A 1IG5A 1GGZA 3K1EA 1F54A 4PE7A 3AKBA 4CLNA 3I5IC 1OOFA 4QJ3B 3LLEA 2F3ZA 2P6BB 3BOWA 5JJGA 1JSAA 1QX5B 2WCMA 1DJHA 2BE6A 4PHKA 1A2XA 1IH0A 2KI4B 1KFXS 1WY9A 2KBIA 1DJGA 2FOTA 1V1GA 2YGUA 4MVFA 2E30A 1LKJA 3DVJA 1NCXA 2JXLA 1U5IA 1WDCC 2LHLA 2WCEA 3LCPC 4JQ0D 5EL2A 1SR6B 4GGFC 1J1EA 3VGOA 2LANA
chains in the Genus database with same CATH topology
2WC5A 2PQLA 3CDNA 3DY9A 3D76A 3L4LA 4OZDA 3S0GA 2WCLA 3QMEA 2WCJA 2QEOA 3B87A 3NHTA 1TUJA 1OW4A 4INWA 4INXA 2WCHA 3V2LA 3R1PA 2P70A 3D75A 3BFAA 2QEBA 5DICA 1LS8A 2QDIA 2WC6A 3BFBA 3CABA 3S0AA 2JPOA 1XFRA 1OOIX 1OOGA 3FE8A 3B7AA 3R1OA 4JD9A 1ORGA 2ERBA 3D78A 3FE6A 3DXLA 3B88A 2FJYA 3OGNA 2P71A 3L47A 3L4AA 4FQTA 1OOHA 3R1VA 4PT1A 1TWOA 3S0BA 2WCKA 3VB1A 2QEVA 3CYZA 3N7HA 3FE9A 1QWVA 3B6XA 3DZTA 2QEHA 3B86A 3BJHA 3PJIA 3S0EA 3CZ1A 3RZSA 3R72A 3D73A 1GM0A 3D77A 4F7FA 2L2CA 3NHIA 2H8VA 3D74A 1C3ZA 3NGVA 3CZ0A 3K1EA 1OOFA 3CZ2A 1C3YA 2WCMA 3S0DA 3S0FA 1P28A 3Q8IA 3BFHA 1T14A 1DQEA 3DYEA 5EL2A 2KPHA 2GTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WC5 A;  2PQL A;  3CDN A;  3DY9 A;  3D76 A;  3L4L A;  4OZD A;  3S0G A;  2WCL A;  3QME A;  2WCJ A;  2QEO A;  3B87 A;  3NHT A;  1TUJ A;  1OW4 A;  4INW A;  4INX A;  2WCH A;  3V2L A;  3R1P A;  2P70 A;  3D75 A;  3BFA A;  2QEB A;  5DIC A;  1LS8 A;  2QDI A;  2WC6 A;  3BFB A;  3CAB A;  3S0A A;  2JPO A;  1XFR A;  1OOI X;  1OOG A;  3FE8 A;  3B7A A;  3R1O A;  4JD9 A;  1ORG A;  2ERB A;  3D78 A;  3FE6 A;  3DXL A;  3B88 A;  2FJY A;  3OGN A;  2P71 A;  3L47 A;  3L4A A;  4FQT A;  1OOH A;  3R1V A;  4PT1 A;  1TWO A;  3S0B A;  2WCK A;  3VB1 A;  2QEV A;  3CYZ A;  3N7H A;  3FE9 A;  1QWV A;  3B6X A;  3DZT A;  2QEH A;  3B86 A;  3BJH A;  3PJI A;  3S0E A;  3CZ1 A;  3RZS A;  3R72 A;  3D73 A;  1GM0 A;  3D77 A;  4F7F A;  2L2C A;  3NHI A;  2H8V A;  3D74 A;  1C3Z A;  3NGV A;  3CZ0 A;  3K1E A;  1OOF A;  3CZ2 A;  1C3Y A;  2WCM A;  3S0D A;  3S0F A;  1P28 A;  3Q8I A;  3BFH A;  1T14 A;  1DQE A;  3DYE A;  5EL2 A;  2KPH A;  2GTE A; 
#chains in the Genus database with same CATH topology
 4PAL A;  1GQM A;  1KQM B;  1YRU B;  2WC5 A;  3BUX B;  4YGC B;  1CDL A;  1XFZ O;  1NYA A;  1ZUZ A;  1KWO B;  3D0Y B;  5HYD A;  4MLW A;  3AAJ A;  3D76 A;  3IF7 A;  3KHE A;  2PMY A;  4YGA A;  4AOM A;  4AQJ A;  1ODB A;  1IIO A;  2SAS A;  1BJF A;  2K2A A;  2WCL A;  2LM5 A;  2Y5I A;  1TTX A;  2OS8 C;  1KSO A;  1TCF A;  1SY9 A;  1Y6W A;  4WQ3 A;  3QME A;  3LK1 A;  1YUT A;  3RM1 A;  2WCJ A;  3EVU A;  2PRU A;  3JVT B;  1K96 A;  2LVK A;  2K61 A;  2M7N A;  3NXA A;  1QIW A;  2ZN9 A;  4GAO A;  4I5N B;  4JPZ B;  3TS5 B;  1ALW A;  2IS9 A;  1K95 A;  1QS7 A;  3ICB A;  3NSL A;  1X02 A;  3CGA A;  3FIA A;  3V2L A;  5KTY A;  1OZS A;  4D1E A;  2BCX A;  1XK4 C;  2NZ0 A;  5IBW A;  3BFA A;  3AAK A;  1S6J A;  3CTN A;  1JBA A;  1A29 A;  2K0J A;  1K9U A;  2NCP A;  3HX4 A;  4I5K A;  3VRO A;  1WRL A;  2KLD A;  1MXE A;  1OMV A;  2KYC A;  2MAZ A;  3B7A A;  3A4U B;  2M49 B;  4DUQ A;  1K2H A;  2CT9 A;  5CPV A;  1OMR A;  1SL8 A;  1HT9 A;  5CSJ A;  1UHJ A;  2L2E A;  1PAL A;  1OSA A;  2M1U A;  1WLM A;  3CR4 X;  1BT6 A;  4MRY A;  2Y1M A;  4WQ2 A;  1V1F A;  5FYX A;  3UNW A;  4L9M A;  4PE4 A;  1BG1 A;  2KDH A;  2KQ6 A;  1QVI Y;  2NCO A;  3FE6 A;  3OX6 A;  5KSZ A;  2VRG A;  2LVV A;  1DEL A;  1BU3 A;  2JXC A;  3B88 A;  3SG6 A;  2Y4Q A;  1WRZ A;  3JTD C;  1NSH A;  3DVK A;  3R1V A;  4N1F A;  2L98 A;  4NDC A;  3MSE B;  2KYF A;  1KK8 C;  2FCE A;  2ZN8 A;  1QLS A;  1BF5 A;  1TCO B;  5ER5 A;  1IKU A;  2QEV A;  5HKY A;  3N7H A;  2LHI A;  4PHM A;  5AAN A;  4KYN A;  3SG5 A;  3DZT A;  1N2D A;  3CS1 A;  1TN4 A;  4OV2 A;  3SJS A;  1ZMZ A;  1PVB A;  1KK7 Y;  1EG3 A;  4PDZ A;  2LVJ A;  2M1K B;  2LNK A;  3UO9 A;  1LA0 A;  3OB2 B;  1LA3 A;  4YRU A;  1G4Y R;  3LK0 A;  3TUY B;  1K9P A;  1LXF C;  3GK2 A;  1DJY A;  2MRD A;  4YBH B;  1S1E A;  3OX5 A;  3R72 A;  3I5G B;  1GM0 A;  2HET A;  3TDU A;  2OPO A;  1SNL A;  4A4B A;  1H4B A;  2L2C A;  1QXP A;  1R2U A;  2LC5 A;  3EVR A;  2LAP A;  3NHI A;  3TDI A;  2LLU A;  2PAL A;  1C3Z A;  2WCF A;  2COL B;  3BXK A;  1BR1 B;  2CNP A;  3EK4 A;  3PAT A;  3PN7 B;  1NX1 A;  1WRK A;  1C3Y A;  1G33 A;  2AUC A;  4MZK A;  3QRX A;  4N1G A;  2JUL A;  5DKN A;  1S5G Y;  3BQ3 A;  3I5H C;  4XJK A;  3SG4 A;  2JC2 A;  2OTG B;  5TNC A;  1FI6 A;  3DD4 A;  3Q8I A;  1AVS A;  4XYN A;  1NCY A;  2ZNE A;  3A8R A;  1A75 B;  4MRX A;  1PSR A;  2PVB A;  1SPY A;  4IJ7 A;  1SCM C;  3DYE A;  2H61 A;  5I8N A;  1KFU S;  1XFY O;  4NDD A;  2KPH A;  1J7P A;  1KFX L;  4DRW A;  1A75 A;  2AAO A;  1REC A;  2SCP A;  1IJ5 A;  2PQL A;  3DVM A;  4I5L B;  1FBV A;  5JOL A;  1KSM A;  1NWD A;  5I94 A;  1QVI Z;  2MLF C;  3VRN A;  1ALV A;  4GGN A;  2I94 A;  1YUR A;  2L4H A;  2L5X B;  1XFW O;  3S0G A;  2KFG A;  3VRQ A;  3PAL A;  1UHH A;  2KQY A;  3BYA A;  1DJZ A;  4MZJ A;  2QEO A;  3C1V A;  3NHT A;  4INW A;  4QJ4 B;  5I2Q A;  5PAL A;  2KAY A;  1IWQ A;  2D8N A;  2M29 A;  1CFC A;  3CLN A;  1KK7 Z;  1MXL C;  1EH2 A;  1TNQ A;  2F8P A;  3R1P A;  4NDB A;  1UUR A;  2JWW A;  1B47 A;  1OQP A;  1M31 A;  4YI8 A;  4M2O A;  1YVL A;  1L7Z A;  2QEB A;  5DIC A;  1J55 A;  3BFB A;  1CMG A;  1DEK A;  2LLS A;  1UHN A;  3S0A A;  1OE9 B;  2NXQ A;  1CLM A;  1SKT A;  2JPO A;  5FI2 A;  1WDC B;  4CID A;  1UHI A;  1OOI X;  1UWO A;  3O78 A;  2BL0 C;  3FE8 A;  3H4S E;  2KLE A;  2QAC A;  3NSO A;  4M2P A;  1MHO A;  3SS4 A;  4AQI A;  1K93 D;  1A4P A;  3FS7 A;  2LUX A;  3D0Y A;  1LIN A;  3O2P A;  1WLZ A;  1CDP A;  1IJ6 A;  2K7C A;  1S6C A;  2HQW A;  3OB1 B;  2MLE C;  3D78 A;  2BBM A;  2CXJ A;  3SIB A;  2JRF A;  2NLN A;  1IQ5 A;  2FJY A;  5F6T A;  2LCP A;  2OS8 B;  1B8C A;  3SG2 A;  1E8A A;  2P71 A;  3I5F C;  3L4A A;  1QX2 A;  3PSR A;  1S5G Z;  2KFF A;  1S6I A;  1Z2C B;  1QAS A;  2BKH B;  1L2O C;  1SRA A;  2WCK A;  2JT0 A;  4M2Q A;  1J7O A;  1EG4 A;  3CYZ A;  1TNW A;  1XA5 A;  2JOJ A;  3M0W A;  4CFQ A;  4ORC B;  1B1G A;  1S36 A;  2AMI A;  2BCA A;  1UHK A;  1TIZ A;  1J1D A;  1CFD A;  3BUW B;  1QLK A;  5I2L A;  2M97 A;  5FI7 A;  4MEW A;  5HKW A;  2PYQ A;  3IQO A;  4GFT A;  2R2I A;  4PCW A;  1ZFS A;  1SK6 D;  1DJX A;  3RZS A;  2BAP A;  2JTZ A;  2QPT A;  3D77 A;  4MSP A;  2BE4 A;  2KI6 D;  4NQG A;  5CSF A;  1DVI A;  3PLF B;  1TNP A;  1XVJ A;  1CTR A;  1IGV A;  2KNE A;  1MF8 B;  3CZT X;  3WHT B;  1JF2 A;  4PE1 A;  3KPX A;  1B7T Y;  1DJW A;  1DTL A;  4YGD B;  5ER4 X;  1QJT A;  2L5Y A;  2LMV A;  2K7O A;  3JTD B;  1K94 A;  2EGD A;  2LP2 A;  3S0D A;  2BEC A;  2ZND A;  3O4X A;  3SG7 A;  1C07 A;  2K2F A;  5AFP A;  2B1U A;  3KEV A;  1DC1 A;  2JTT A;  2LP3 A;  4WRI A;  2RGI A;  2EC6 C;  3S0F A;  5DKR A;  3BUO B;  3CR2 A;  3BFH A;  1N65 A;  2G9B A;  1JF0 A;  1RFJ A;  1DQE A;  2L51 A;  2M3W A;  3F45 A;  4HRE E;  3BUN B;  2KSP A;  3PM8 A;  2KAV A;  1FI5 A;  1B8R A;  3GOF A;  1QX7 A;  1F4Q A;  2ZRT A;  4DCK A;  1AJ4 A;  2JT3 A;  2LMT A;  5J3X A;  1JC2 A;  2ZRS A;  3EK8 A;  4R1E A;  4A4C A;  3NSI A;  1MUX A;  1LVC D;  1XFX O;  5D3O A;  3RLZ A;  2HF5 A;  2WC8 A;  2I2R E;  1SBJ A;  1QV0 A;  2E6W A;  3L4L A;  3OP0 A;  1JFK A;  4MN0 A;  1EJ3 A;  1KFU L;  1RWY A;  1FW4 A;  3ZWH A;  1YX8 A;  3B87 A;  2BKI B;  1CLB A;  1CDN A;  1TUJ A;  3PN7 C;  1HQV A;  3WXA A;  2EHB A;  5CSI A;  1KCY A;  4INX A;  1K9K A;  2KI6 C;  5AEQ A;  5I2O A;  2WCH A;  1XFV O;  3I5H B;  4HSZ A;  2PSR A;  3IQQ A;  1MR8 A;  1F55 A;  4C0K A;  1PRW A;  1SMG A;  2F33 A;  2P70 A;  4GPL B;  1W7I B;  3D75 A;  2CCM A;  1NP8 A;  2MHH A;  4FTG A;  2H61 C;  2WC6 A;  2G2B A;  2CBL A;  1KQV A;  1F71 A;  1SCM B;  2F3Y A;  2K7D A;  1XFR A;  2BNX A;  2I7A A;  1AUI B;  1Y1A A;  3E3R A;  5D7F A;  1UUS A;  1RJV A;  3DF0 B;  3SS5 A;  1CNP A;  1PVA A;  1NX3 A;  3EKJ A;  1CKK A;  1FPW A;  3AKA A;  3I5I B;  4CPV A;  1XFU O;  3R1O A;  4I5J A;  3EK7 A;  3WNX B;  1UP5 A;  1B7T Z;  1QAT A;  3NSK A;  1DGV A;  1M39 A;  1G8I A;  1SL9 A;  1AP4 A;  3BOW B;  1M45 A;  2K60 A;  2KFH A;  3L47 A;  2MA2 A;  3OHM B;  1BMO A;  2V53 A;  2LE9 B;  4FQT A;  4PT1 A;  5BPJ A;  4QJ5 B;  1FF1 A;  1TWO A;  1XO5 A;  3S0B A;  2KBM A;  2KI4 C;  1SCV A;  5GQQ C;  4UPG A;  3VB1 A;  1S26 D;  3FE9 A;  2ISD A;  3B6X A;  4TNC A;  4OCI A;  1YRT B;  2PAS A;  1BOC A;  1F70 A;  2DOQ A;  2QEH A;  2GGM A;  3KO0 A;  3DVE A;  1B8L A;  4YGB B;  1U5I B;  2WCB A;  1OZO A;  2L50 A;  2KGB C;  1CMF A;  2O60 A;  1SR6 C;  1MWN A;  1OMD A;  3S0E A;  1KQM C;  5HLO A;  2L0P A;  4GGF A;  2BL0 B;  3CZ1 A;  3HCM A;  4OKH A;  1BLQ A;  1KWO C;  1NX2 A;  4DIR A;  4F7F A;  2FCD A;  4OR9 B;  1B4C A;  1NPQ A;  4JWQ A;  2H8V A;  1C7W A;  4GNK B;  1GGW A;  1W9Z A;  2ZFD A;  1J7Q A;  4E68 A;  3CZ0 A;  3BUM B;  4HRG A;  1EL4 A;  1RTP 1;  2JNX A;  2ZKM X;  3TZ1 A;  4FQO A;  1M46 A;  4USL A;  5K89 A;  1PK0 D;  4U8D A;  3CZ2 A;  3JVT C;  3I5F B;  1B9A A;  2JU0 A;  2WOR A;  4MZL A;  3TS5 C;  4PHJ A;  3OBV A;  4ORA B;  3TDZ A;  2F2P A;  1L2O B;  1DMO A;  4ZCU A;  5AXI A;  1JFJ A;  2TN4 A;  1TNX A;  4Q04 A;  5B8I B;  1BR4 B;  4MBE A;  1RRO A;  1QTX A;  3D10 A;  4C0L A;  4DS7 A;  1CFF A;  1QIV A;  1P28 A;  1YTZ C;  3K21 A;  1T14 A;  1XK4 A;  2BBN A;  1AK8 A;  1XYD A;  1K90 D;  4PHN A;  5G08 A;  1F8H A;  2A4J A;  2KHN A;  1EXR A;  5CSN A;  4F0Z B;  2Q4U A;  2GTE A;  1IRJ A;  1R6P A;  1QV1 A;  3CDN A;  2I18 A;  1CM4 A;  2LUC A;  2MJW B;  3DY9 A;  3SIA A;  1W7J B;  1PUL A;  5DKQ A;  4P5O E;  1JUO A;  1DGU A;  1SL7 A;  1SSE B;  2CTN A;  4OZD A;  1A03 A;  4YGE B;  1DT7 B;  1H8B A;  5FI6 A;  1KK8 B;  2K7B A;  4PE0 A;  1M63 B;  3CR5 X;  4YI9 A;  3PFV A;  4C0J A;  1OW4 A;  4ICB A;  3FWC A;  1CDM A;  1YX7 A;  4GBA A;  4ZCV A;  5KU1 A;  2JPT A;  1YUS A;  1BOD A;  1TUZ A;  2EC6 B;  2M7L A;  3FWB A;  2K8M B;  3SS3 A;  1F4O A;  5D69 A;  4ETO A;  1Y1U A;  1LS8 A;  2QDI A;  3CAB A;  2JQ6 A;  1NX0 A;  2GGZ A;  3TUY C;  2H2K A;  3WHU B;  2M0R A;  1S3P A;  1CB1 A;  1OOG A;  1Y0V H;  2WND A;  2MBX A;  4P2Y B;  3CWG A;  3I5G C;  3PM2 A;  2F2O A;  3VRP A;  3VRR A;  4CFR A;  1IQ3 A;  5AER A;  1AJ5 A;  4JKT A;  1J7R A;  1AHR A;  3LL8 B;  2WOS A;  1DF0 B;  1NIW A;  2JZI A;  1CM1 A;  1CFP A;  1OOJ A;  4JD9 A;  1ORG A;  1TOP A;  1JWD A;  1SYM A;  1GJY A;  1SW8 A;  2ERB A;  2LMU A;  3DXL A;  3O6B A;  1VRK A;  1ZAC A;  3ZNI A;  2Q91 A;  1DF0 A;  3OGN A;  2FJU B;  5HKZ A;  1OOH A;  4BY4 A;  1DJI A;  2KGR A;  2M9G A;  1RK9 A;  2LV7 A;  1D1O A;  1ZOT B;  4GUK A;  2O5G A;  4XJK B;  1QWV A;  3GK4 X;  5HL1 A;  2HPS A;  2OTG C;  2KAX A;  1MQ1 A;  1CLL A;  1NUB A;  2M8U A;  3IVT A;  3KF9 A;  3EVV A;  1YVH A;  4HRH A;  3GK1 A;  4IL1 A;  3B86 A;  4OVN F;  2LVI A;  2BCB A;  3BJH A;  1YUU A;  4ORB B;  1N0Y A;  2L4I A;  1PSB A;  1YR5 A;  2KOT A;  1NCZ A;  1TRF A;  1K8U A;  5HLV A;  3PJI A;  3EG5 B;  3EKH A;  3DF0 A;  2GV5 A;  3SG3 A;  4N5X A;  3D73 A;  1Z4H A;  1Y1X A;  2JT8 A;  2LLT A;  2HQ8 A;  3O4Y A;  1C7V A;  2Y1N A;  3D74 A;  1Q80 A;  2JNF A;  3NGV A;  4BY5 A;  1IG5 A;  1GGZ A;  3K1E A;  1F54 A;  4PE7 A;  3AKB A;  4CLN A;  3I5I C;  1OOF A;  4QJ3 B;  3LLE A;  2F3Z A;  2P6B B;  3BOW A;  5JJG A;  1JSA A;  1QX5 B;  2WCM A;  1DJH A;  2BE6 A;  4PHK A;  1A2X A;  1IH0 A;  2KI4 B;  1KFX S;  1WY9 A;  2KBI A;  1DJG A;  2FOT A;  1V1G A;  2YGU A;  4MVF A;  2E30 A;  1LKJ A;  3DVJ A;  1NCX A;  2JXL A;  1U5I A;  1WDC C;  2LHL A;  2WCE A;  3LCP C;  4JQ0 D;  5EL2 A;  1SR6 B;  4GGF C;  1J1E A;  3VGO A;  2LAN A; 
#chains in the Genus database with same CATH homology
 2WC5 A;  2PQL A;  3CDN A;  3DY9 A;  3D76 A;  3L4L A;  4OZD A;  3S0G A;  2WCL A;  3QME A;  2WCJ A;  2QEO A;  3B87 A;  3NHT A;  1TUJ A;  1OW4 A;  4INW A;  4INX A;  2WCH A;  3V2L A;  3R1P A;  2P70 A;  3D75 A;  3BFA A;  2QEB A;  5DIC A;  1LS8 A;  2QDI A;  2WC6 A;  3BFB A;  3CAB A;  3S0A A;  2JPO A;  1XFR A;  1OOI X;  1OOG A;  3FE8 A;  3B7A A;  3R1O A;  4JD9 A;  1ORG A;  2ERB A;  3D78 A;  3FE6 A;  3DXL A;  3B88 A;  2FJY A;  3OGN A;  2P71 A;  3L47 A;  3L4A A;  4FQT A;  1OOH A;  3R1V A;  4PT1 A;  1TWO A;  3S0B A;  2WCK A;  3VB1 A;  2QEV A;  3CYZ A;  3N7H A;  3FE9 A;  1QWV A;  3B6X A;  3DZT A;  2QEH A;  3B86 A;  3BJH A;  3PJI A;  3S0E A;  3CZ1 A;  3RZS A;  3R72 A;  3D73 A;  1GM0 A;  3D77 A;  4F7F A;  2L2C A;  3NHI A;  2H8V A;  3D74 A;  1C3Z A;  3NGV A;  3CZ0 A;  3K1E A;  1OOF A;  3CZ2 A;  1C3Y A;  2WCM A;  3S0D A;  3S0F A;  1P28 A;  3Q8I A;  3BFH A;  1T14 A;  1DQE A;  3DYE A;  5EL2 A;  2KPH A;  2GTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...