1TUJA

Solution structure of the honey bee general odorant binding protein asp2 in complex with trimethylsilyl-d4 propionate
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
IDQDTVVAKYMEYLMPDIMPCADELHISEDIATNIQAAKNGADMSQLGCLKACVMKRIEMLKGTELYVEPVYKMIEVVHAGNADDIQLVKGIANECIENAKGETDECNIGNKYTDCYIEKLFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords odorant binding protein ASP2
publication title Solution structure of the honey bee general odorant binding protein ASP2 in complex with trimethylsilyl-d4 propionate
rcsb
source organism Apis mellifera
total genus 32
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2004-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 1tujA00
2P71A 3DXLA 3NGVA 3L47A 1XFRA 4FQTA 2FJYA 3S0BA 3RZSA 2WCLA 3S0EA 3R1OA 3B88A 2WCKA 2QEVA 3NHIA 3B6XA 4OZDA 2QEHA 3QMEA 2QEOA 3L4LA 2KPHA 3DY9A 4F7FA 3D78A 4INXA 4PT1A 3CDNA 3N7HA 1DQEA 3DYEA 3FE8A 1OOHA 1OOGA 2H8VA 1P28A 2QDIA 1C3YA 3V2LA 3BFBA 2PQLA 3L4AA 2JPOA 3CZ2A 3VB1A 3CYZA 3CZ0A 1C3ZA 3S0GA 2WCMA 3CABA 3D73A 2WCHA 1QWVA 2QEBA 1GM0A 3FE6A 1LS8A 3B7AA 5EL2A 3D76A 3Q8IA 3CZ1A 3S0DA 3K1EA 3D77A 2P70A 3PJIA 3R1PA 3R1VA 4JD9A 3DZTA 1TWOA 3OGNA 3D74A 3BFAA 3BFHA 1ORGA 3B87A 1TUJA 1OOIX 1T14A 3NHTA 1OOFA 2WC5A 3D75A 2WCJA 4INWA 2L2CA 2ERBA 2GTEA 3FE9A 3BJHA 5DICA 2WC6A 3S0AA 3R72A 1OW4A 3S0FA 3B86A
chains in the Genus database with same CATH superfamily
2KQYA 1CMFA 2CTNA 2BKIB 2LANA 1JFJA 5HL1A 1XFRA 1UHKA 4DCKA 1PK0D 3RZSA 1UWOA 1V1GA 1XFVO 3S0EA 3TDUA 3R1OA 1JF2A 1N65A 4YGEB 1EG4A 4DIRA 1DJZA 3NHIA 3TUYC 3VRNA 1SR6C 1XFYO 1RTP1 2F3YA 3QMEA 3C1VA 3L4LA 2BBMA 2KPHA 1NCYA 2I94A 1DJGA 3D78A 1PVAA 2GGZA 4C0KA 4PT1A 1SK6D 3N7HA 2K8MB 3TDIA 1B1GA 2JNFA 1SBJA 2I18A 3LL8B 4AQJA 1OOGA 2H8VA 1A75B 1Q80A 1U5IA 5AEQA 2VRGA 1XVJA 4NDCA 1F4QA 1B47A 1BJFA 3JVTB 4NQGA 3L4AA 2JPOA 3NSLA 4JQ0D 5FYXA 1M39A 1UURA 2JZIA 3CZ2A 5BPJA 5TNCA 3VB1A 4M2OA 1A03A 2K0JA 1TNWA 1WRKA 4A4CA 4PHKA 2M8UA 1LXFC 4GUKA 1RK9A 2MRDA 1UHJA 1YRTB 2JT0A 3EVUA 1TIZA 4GGNA 2QEBA 1WDCB 2Y4QA 3IQOA 3PATA 2K7DA 1AJ5A 2LLSA 3GK1A 4WRIA 3ICBA 4YRUA 1DF0B 1B9AA 2BECA 2LVKA 5I2LA 3VRQA 1BF5A 5K89A 1D1OA 2FCDA 4M2QA 1NCXA 2EGDA 2KHNA 2BKHB 4CLNA 2JXLA 3CLNA 2CBLA 4PE7A 1S1EA 3CZTX 4CPVA 4QJ5B 1YRUB 2H2KA 3F45A 3O78A 1XFZO 2LNKA 4PE1A 1SYMA 3CR5X 4PE4A 2KFGA 2BE4A 2I7AA 4USLA 1KSOA 1C7WA 1IG5A 2F33A 2GGMA 4I5KA 5HYDA 5FI7A 1F71A 5D69A 1K93D 2Q4UA 5JOLA 2M1KB 2QACA 2M3WA 1SKTA 1CFFA 1BR1B 2CNPA 1S36A 1S5GY 3CTNA 3EK7A 3PSRA 5AXIA 1QASA 4UPGA 1EH2A 3PN7B 5F6TA 4D1EA 5JJGA 2FCEA 1SNLA 2KBIA 1J55A 4MN0A 2KI6D 2JNXA 2ZRSA 1PULA 3I5IB 1YVHA 3TZ1A 1X02A 5G08A 3OB2B 1IJ5A 2LAPA 1BMOA 4ORBB 1DGUA 3NHTA 4OKHA 1J7PA 2WC5A 2LV7A 1OMDA 1Y1XA 2WCJA 1IKUA 1SW8A 1GJYA 2L2CA 3AAJA 2PALA 4INWA 2ERBA 2F2PA 1CDNA 4MRYA 2G9BA 2GTEA 3AAKA 4PHJA 2M97A 1HT9A 2KQ6A 2WC6A 2KI4C 2ZN8A 2H61C 2BAPA 4HSZA 2WOSA 4YGBB 1EG3A 2BCAA 2KFFA 2KOTA 1E8AA 3TDZA 5KTYA 1UUSA 3NGVA 2JU0A 2Y5IA 1W9ZA 4FQTA 2FJYA 4I5LB 1DJXA 2RGIA 1RJVA 1BR4B 3O6BA 2M1UA 1FW4A 1A4PA 3BOWB 2CXJA 2L5XB 2WCKA 1OZOA 3TS5C 1Y1AA 1CKKA 2KLEA 1GGWA 1YVLA 2ZNEA 1CDPA 1JF0A 1BU3A 4OZDA 2QEHA 2F3ZA 1KK8C 3SG4A 3BUOB 2OS8B 3DY9A 2L50A 1QS7A 4F7FA 1QVIZ 4INXA 1L7ZA 3O4YA 1KFUL 1DQEA 1QX7A 2WORA 3DYEA 1R2UA 1KFXL 2L5YA 1H8BA 1LVCD 1W7IB 4PHNA 1TUZA 3DVEA 3FE8A 3PN7C 1OOHA 4ZCUA 5HKZA 1SY9A 1JC2A 2M49B 2CT9A 1FBVA 3IF7A 5AERA 4YGAA 1R6PA 1C3YA 1CNPA 1QXPA 2HQ8A 2L98A 3RM1A 3OP0A 1SCVA 2LLTA 3SIBA 1YX8A 3CR2A 3SS5A 3KEVA 4CFRA 2Y1MA 5DKNA 1CLMA 2WNDA 1BODA 1W7JB 2OTGC 4QJ3B 1BLQA 4YBHB 2LP3A 5GQQC 5I94A 1MUXA 1S26D 4JPZB 1SL9A 1WRLA 3JTDC 1DJHA 3E3RA 2WCHA 3FE6A 3OHMB 2L2EA 1OZSA 2KNEA 3LK1A 1SCMC 1LKJA 1K90D 1MHOA 1TNPA 5I2OA 4MRXA 4MZJA 3BUMB 3WHUB 1IGVA 1MF8B 1XYDA 2MHHA 1H4BA 2G2BA 4OCIA 3O4XA 4P5OE 2EC6C 3SS4A 1DTLA 1DVIA 4NDDA 1XK4C 2M7NA 1L2OC 1YUUA 2LUCA 3I5HC 4E68A 4MZLA 5IBWA 1QIVA 1J7RA 2LUXA 2P70A 2H61A 4HREE 3R1PA 1SRAA 2MAZA 1SL7A 4XJKA 1CMGA 1JFKA 1OSAA 1NWDA 4JWQA 3BXKA 1J7QA 3ZWHA 4AQIA 5CPVA 5AANA 1CLBA 5CSIA 1KWOB 1K9KA 2JXCA 3QRXA 3D74A 3BFHA 2KLDA 2ZRTA 1OOJA 3I5GB 1RECA 3B87A 5PALA 1OMVA 4HRHA 2BCXA 2E30A 2ZKMX 1U5IB 3DF0A 2BL0B 4MEWA 5CSJA 3VGOA 1B4CA 1ZUZA 3KO0A 3D75A 2KYCA 1IWQA 1MWNA 2YGUA 3ZNIA 4CFQA 4GBAA 1M31A 3HX4A 1A2XA 1KSMA 1AK8A 1NCZA 2BCBA 3CS1A 2ZNDA 1TCOB 5CSNA 5D7FA 1CM1A 4C0LA 3D0YA 4PALA 3CWGA 1NIWA 4WQ3A 1QLKA 2LE9B 2SASA 1OMRA 2JQ6A 3NSIA 4XJKB 1G33A 3UNWA 5D3OA 3LLEA 1OW4A 1RFJA 2COLB 4L9MA 5DKRA 1CFPA 1A29A 3I5FB 1ZMZA 1S6JA 3DXLA 3L47A 1CFCA 4GGFC 1UHIA 1ZOTB 4C0JA 3VRRA 1XFUO 3DVKA 2KFHA 4CIDA 1F70A 2Y1NA 1NP8A 4GNKB 5FI6A 1K94A 4DS7A 2IS9A 4DUQA 1LA0A 3HCMA 2JULA 1YURA 1M45A 3JVTC 2PASA 3B6XA 1NYAA 2KYFA 4TNCA 4YI9A 1EJ3A 1MR8A 4PHMA 2QEOA 2LP2A 1DGVA 3PM2A 1IIOA 2PSRA 3M0WA 1LA3A 1ZFSA 1NPQA 4ORAB 5HKWA 2KSPA 1ODBA 4BY4A 1XK4A 1CM4A 3NSKA 2SCPA 1OQPA 1WDCC 4MZKA 1F4OA 1M46A 1P28A 1FF1A 2AUCA 2NCOA 2JPTA 3AKBA 3V2LA 3BFBA 3I5GC 4I5NB 2PQLA 3TUYB 1SR6B 1K9UA 2K7CA 3CYZA 3CZ0A 1C3ZA 3GK2A 3S0GA 1IQ3A 1B8CA 1DJIA 3KF9A 4MBEA 1QVIY 2AAOA 1KK7Z 2PMYA 2WCMA 3CABA 3D73A 1XFWO 5J3XA 1B7TZ 1QWVA 2EHBA 3BUXB 1QX2A 2JC2A 5ER5A 1J1EA 5EL2A 5I8NA 2M7LA 1AHRA 2JT3A 3MSEB 2D8NA 3Q8IA 1MQ1A 3SS3A 1FI6A 1Y6WA 3SG7A 1EXRA 1SSEB 3CZ1A 3K1EA 3KPXA 3S0DA 1KQMB 2JRFA 4QJ4B 1B8RA 3DVJA 1OE9B 3I5IC 4FTGA 4A4BA 1QATA 5KSZA 2KAVA 4GFTA 2K2FA 4ICBA 2WCEA 4OV2A 4N5XA 1BOCA 4U8DA 2LC5A 4XYNA 3FWCA 2L4HA 2BBNA 3R1VA 2L51A 4OVNF 3FS7A 4JD9A 3EK8A 3EVRA 2BNXA 3DD4A 1AVSA 1ZACA 2PVBA 2ZN9A 3DZTA 2K60A 4GGFA 1K9PA 2QPTA 4N1GA 2ISDA 1A75A 2HETA 1KQVA 4HRGA 3FIAA 4AOMA 2KBMA 1XO5A 1ORGA 2L0PA 5I2QA 1NX1A 1JSAA 1IRJA 4ORCB 2NCPA 1Y0VH 2CCMA 1QX5B 2V53A 3GOFA 4Q04A 1TUJA 2HQWA 2KAYA 1UHHA 3BQ3A 1DJYA 4IL1A 3WHTB 1DELA 2R2IA 1T14A 3SG5A 3CR4X 1OOFA 3PALA 2MBXA 2E6WA 2OPOA 1AUIB 2LVJA 3PFVA 1DJWA 2A4JA 2B1UA 1QV0A 3EKJA 3GK4X 1MXLC 4WQ2A 2KGBC 2LVVA 1ALVA 5DICA 1SPYA 2LHIA 3S0AA 2O60A 2NLNA 1DF0A 1NX0A 3NSOA 1YTZC 2OS8C 4MSPA 1J7OA 1QV1A 2JOJA 3LK0A 1IJ6A 3B86A 4IJ7A 2GV5A 2M9GA 3OB1B 1DC1A 2NXQA 2P71A 2KDHA 3LCPC 1S6CA 1K96A 3EVVA 3S0BA 3SIAA 5B8IB 1PSBA 2WCLA 3D10A 1BG1A 3EKHA 1M63B 2HF5A 3B88A 3DVMA 5KU1A 1PSRA 1KQMC 1Z4HA 1CB1A 1DMOA 1WY9A 2KAXA 2QEVA 2LMTA 2JTZA 1G4YR 3H4SE 5DKQA 2KI4B 4I5JA 4MLWA 1NX2A 2LM5A 2M29A 2AMIA 1NUBA 2DOQA 3KHEA 4PCWA 1S6IA 2MJWB 1QTXA 1N0YA 1DEKA 1SL8A 2K7BA 4KYNA 3WXAA 3CDNA 2K2AA 1CLLA 3EG5B 1C7VA 1PVBA 1AP4A 1GGZA 1AJ4A 3FWBA 2TN4A 4MVFA 3RLZA 4F0ZB 1K8UA 2QDIA 1K95A 2KI6C 4N1FA 2Q91A 3TS5B 1DT7B 1UP5A 3VRPA 3EK4A 4FQOA 4R1EA 3IQQA 1Y1UA 1IQ5A 1KK8B 3K21A 1KCYA 1CFDA 1SMGA 1XA5A 3DF0B 1QLSA 1B8LA 4GPLB 3CGAA 3SG3A 1FPWA 2LMUA 2LHLA 5CSFA 3WNXB 2K61A 4BY5A 1F8HA 3SJSA 1GM0A 1XFXO 1LS8A 2PRUA 4DRWA 2I2RE 3D0YB 2JTTA 1S3PA 1S5GZ 3B7AA 1YUSA 3SG2A 1CDMA 4YGCB 2ZFDA 3D76A 1KWOC 2BE6A 1KFUS 4PDZA 2LLUA 1IH0A 1MXEA 1BT6A 1KFXS 3BOWA 1WRZA 3UO9A 4GAOA 1NX3A 2FOTA 2JWWA 3D77A 2OTGB 4JKTA 1RROA 5HLVA 1QIWA 2F8PA 1JBAA 5HKYA 1HQVA 1TNXA 2HPSA 3JTDB 1YUTA 1F54A 1KK7Y 4P2YB 1Z2CB 1F55A 2BL0C 1B7TY 3PJIA 4ZCVA 5AFPA 2JT8A 2NZ0A 1GQMA 1SCMB 4NDBA 3IVTA 2FJUB 4PE0A 5FI2A 1CTRA 3BUWB 1PRWA 1EL4A 3BUNB 1TWOA 2LCPA 3NXAA 4M2PA 3A4UB 4YGDB 1TOPA 3OGNA 1G8IA 1TN4A 4YI8A 1TCFA 1YX7A 3BFAA 1JWDA 2MLFC 3PM8A 1K2HA 2EC6B 2O5GA 1V1FA 1TTXA 1YR5A 1JUOA 2L4IA 1LINA 2KGRA 1L2OB 2P6BB 3I5HB 3O2PA 1J1DA 5HLOA 1OOIX 2MLEC 1FI5A 1ALWA 1TNQA 1C07A 3I5FC 3VROA 3OBVA 1PALA 3SG6A 1NSHA 1UHNA 2F2OA 1WLMA 2WC8A 1WLZA 2WCFA 2LVIA 1TRFA 3AKAA 2K7OA 5ER4X 1VRKA 1QJTA 1CDLA 3BYAA 3FE9A 1N2DA 3BJHA 3PLFB 4ETOA 3A8RA 3R72A 3OX5A 2WCBA 2M0RA 2PYQA 1RWYA 3OX6A 2LMVA 2MA2A 4OR9B 3S0FA
chains in the Genus database with same CATH topology
2P71A 3DXLA 3NGVA 3L47A 1XFRA 4FQTA 2FJYA 3S0BA 3RZSA 2WCLA 3S0EA 3R1OA 3B88A 2WCKA 2QEVA 3NHIA 3B6XA 4OZDA 2QEHA 3QMEA 2QEOA 3L4LA 2KPHA 3DY9A 4F7FA 3D78A 4INXA 4PT1A 3CDNA 3N7HA 1DQEA 3DYEA 3FE8A 1OOHA 1OOGA 2H8VA 1P28A 2QDIA 1C3YA 3V2LA 3BFBA 2PQLA 3L4AA 2JPOA 3CZ2A 3VB1A 3CYZA 3CZ0A 1C3ZA 3S0GA 2WCMA 3CABA 3D73A 2WCHA 1QWVA 2QEBA 1GM0A 3FE6A 1LS8A 3B7AA 5EL2A 3D76A 3Q8IA 3CZ1A 3S0DA 3K1EA 3D77A 2P70A 3PJIA 3R1PA 3R1VA 4JD9A 3DZTA 1TWOA 3OGNA 3D74A 3BFAA 3BFHA 1ORGA 3B87A 1TUJA 1OOIX 1T14A 3NHTA 1OOFA 2WC5A 3D75A 2WCJA 4INWA 2L2CA 2ERBA 2GTEA 3FE9A 3BJHA 5DICA 2WC6A 3S0AA 3R72A 1OW4A 3S0FA 3B86A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P71 A;  3DXL A;  3NGV A;  3L47 A;  1XFR A;  4FQT A;  2FJY A;  3S0B A;  3RZS A;  2WCL A;  3S0E A;  3R1O A;  3B88 A;  2WCK A;  2QEV A;  3NHI A;  3B6X A;  4OZD A;  2QEH A;  3QME A;  2QEO A;  3L4L A;  2KPH A;  3DY9 A;  4F7F A;  3D78 A;  4INX A;  4PT1 A;  3CDN A;  3N7H A;  1DQE A;  3DYE A;  3FE8 A;  1OOH A;  1OOG A;  2H8V A;  1P28 A;  2QDI A;  1C3Y A;  3V2L A;  3BFB A;  2PQL A;  3L4A A;  2JPO A;  3CZ2 A;  3VB1 A;  3CYZ A;  3CZ0 A;  1C3Z A;  3S0G A;  2WCM A;  3CAB A;  3D73 A;  2WCH A;  1QWV A;  2QEB A;  1GM0 A;  3FE6 A;  1LS8 A;  3B7A A;  5EL2 A;  3D76 A;  3Q8I A;  3CZ1 A;  3S0D A;  3K1E A;  3D77 A;  2P70 A;  3PJI A;  3R1P A;  3R1V A;  4JD9 A;  3DZT A;  1TWO A;  3OGN A;  3D74 A;  3BFA A;  3BFH A;  1ORG A;  3B87 A;  1TUJ A;  1OOI X;  1T14 A;  3NHT A;  1OOF A;  2WC5 A;  3D75 A;  2WCJ A;  4INW A;  2L2C A;  2ERB A;  2GTE A;  3FE9 A;  3BJH A;  5DIC A;  2WC6 A;  3S0A A;  3R72 A;  1OW4 A;  3S0F A;  3B86 A; 
#chains in the Genus database with same CATH topology
 2KQY A;  1CMF A;  2CTN A;  2BKI B;  2LAN A;  1JFJ A;  5HL1 A;  1XFR A;  1UHK A;  4DCK A;  1PK0 D;  3RZS A;  1UWO A;  1V1G A;  1XFV O;  3S0E A;  3TDU A;  3R1O A;  1JF2 A;  1N65 A;  4YGE B;  1EG4 A;  4DIR A;  1DJZ A;  3NHI A;  3TUY C;  3VRN A;  1SR6 C;  1XFY O;  1RTP 1;  2F3Y A;  3QME A;  3C1V A;  3L4L A;  2BBM A;  2KPH A;  1NCY A;  2I94 A;  1DJG A;  3D78 A;  1PVA A;  2GGZ A;  4C0K A;  4PT1 A;  1SK6 D;  3N7H A;  2K8M B;  3TDI A;  1B1G A;  2JNF A;  1SBJ A;  2I18 A;  3LL8 B;  4AQJ A;  1OOG A;  2H8V A;  1A75 B;  1Q80 A;  1U5I A;  5AEQ A;  2VRG A;  1XVJ A;  4NDC A;  1F4Q A;  1B47 A;  1BJF A;  3JVT B;  4NQG A;  3L4A A;  2JPO A;  3NSL A;  4JQ0 D;  5FYX A;  1M39 A;  1UUR A;  2JZI A;  3CZ2 A;  5BPJ A;  5TNC A;  3VB1 A;  4M2O A;  1A03 A;  2K0J A;  1TNW A;  1WRK A;  4A4C A;  4PHK A;  2M8U A;  1LXF C;  4GUK A;  1RK9 A;  2MRD A;  1UHJ A;  1YRT B;  2JT0 A;  3EVU A;  1TIZ A;  4GGN A;  2QEB A;  1WDC B;  2Y4Q A;  3IQO A;  3PAT A;  2K7D A;  1AJ5 A;  2LLS A;  3GK1 A;  4WRI A;  3ICB A;  4YRU A;  1DF0 B;  1B9A A;  2BEC A;  2LVK A;  5I2L A;  3VRQ A;  1BF5 A;  5K89 A;  1D1O A;  2FCD A;  4M2Q A;  1NCX A;  2EGD A;  2KHN A;  2BKH B;  4CLN A;  2JXL A;  3CLN A;  2CBL A;  4PE7 A;  1S1E A;  3CZT X;  4CPV A;  4QJ5 B;  1YRU B;  2H2K A;  3F45 A;  3O78 A;  1XFZ O;  2LNK A;  4PE1 A;  1SYM A;  3CR5 X;  4PE4 A;  2KFG A;  2BE4 A;  2I7A A;  4USL A;  1KSO A;  1C7W A;  1IG5 A;  2F33 A;  2GGM A;  4I5K A;  5HYD A;  5FI7 A;  1F71 A;  5D69 A;  1K93 D;  2Q4U A;  5JOL A;  2M1K B;  2QAC A;  2M3W A;  1SKT A;  1CFF A;  1BR1 B;  2CNP A;  1S36 A;  1S5G Y;  3CTN A;  3EK7 A;  3PSR A;  5AXI A;  1QAS A;  4UPG A;  1EH2 A;  3PN7 B;  5F6T A;  4D1E A;  5JJG A;  2FCE A;  1SNL A;  2KBI A;  1J55 A;  4MN0 A;  2KI6 D;  2JNX A;  2ZRS A;  1PUL A;  3I5I B;  1YVH A;  3TZ1 A;  1X02 A;  5G08 A;  3OB2 B;  1IJ5 A;  2LAP A;  1BMO A;  4ORB B;  1DGU A;  3NHT A;  4OKH A;  1J7P A;  2WC5 A;  2LV7 A;  1OMD A;  1Y1X A;  2WCJ A;  1IKU A;  1SW8 A;  1GJY A;  2L2C A;  3AAJ A;  2PAL A;  4INW A;  2ERB A;  2F2P A;  1CDN A;  4MRY A;  2G9B A;  2GTE A;  3AAK A;  4PHJ A;  2M97 A;  1HT9 A;  2KQ6 A;  2WC6 A;  2KI4 C;  2ZN8 A;  2H61 C;  2BAP A;  4HSZ A;  2WOS A;  4YGB B;  1EG3 A;  2BCA A;  2KFF A;  2KOT A;  1E8A A;  3TDZ A;  5KTY A;  1UUS A;  3NGV A;  2JU0 A;  2Y5I A;  1W9Z A;  4FQT A;  2FJY A;  4I5L B;  1DJX A;  2RGI A;  1RJV A;  1BR4 B;  3O6B A;  2M1U A;  1FW4 A;  1A4P A;  3BOW B;  2CXJ A;  2L5X B;  2WCK A;  1OZO A;  3TS5 C;  1Y1A A;  1CKK A;  2KLE A;  1GGW A;  1YVL A;  2ZNE A;  1CDP A;  1JF0 A;  1BU3 A;  4OZD A;  2QEH A;  2F3Z A;  1KK8 C;  3SG4 A;  3BUO B;  2OS8 B;  3DY9 A;  2L50 A;  1QS7 A;  4F7F A;  1QVI Z;  4INX A;  1L7Z A;  3O4Y A;  1KFU L;  1DQE A;  1QX7 A;  2WOR A;  3DYE A;  1R2U A;  1KFX L;  2L5Y A;  1H8B A;  1LVC D;  1W7I B;  4PHN A;  1TUZ A;  3DVE A;  3FE8 A;  3PN7 C;  1OOH A;  4ZCU A;  5HKZ A;  1SY9 A;  1JC2 A;  2M49 B;  2CT9 A;  1FBV A;  3IF7 A;  5AER A;  4YGA A;  1R6P A;  1C3Y A;  1CNP A;  1QXP A;  2HQ8 A;  2L98 A;  3RM1 A;  3OP0 A;  1SCV A;  2LLT A;  3SIB A;  1YX8 A;  3CR2 A;  3SS5 A;  3KEV A;  4CFR A;  2Y1M A;  5DKN A;  1CLM A;  2WND A;  1BOD A;  1W7J B;  2OTG C;  4QJ3 B;  1BLQ A;  4YBH B;  2LP3 A;  5GQQ C;  5I94 A;  1MUX A;  1S26 D;  4JPZ B;  1SL9 A;  1WRL A;  3JTD C;  1DJH A;  3E3R A;  2WCH A;  3FE6 A;  3OHM B;  2L2E A;  1OZS A;  2KNE A;  3LK1 A;  1SCM C;  1LKJ A;  1K90 D;  1MHO A;  1TNP A;  5I2O A;  4MRX A;  4MZJ A;  3BUM B;  3WHU B;  1IGV A;  1MF8 B;  1XYD A;  2MHH A;  1H4B A;  2G2B A;  4OCI A;  3O4X A;  4P5O E;  2EC6 C;  3SS4 A;  1DTL A;  1DVI A;  4NDD A;  1XK4 C;  2M7N A;  1L2O C;  1YUU A;  2LUC A;  3I5H C;  4E68 A;  4MZL A;  5IBW A;  1QIV A;  1J7R A;  2LUX A;  2P70 A;  2H61 A;  4HRE E;  3R1P A;  1SRA A;  2MAZ A;  1SL7 A;  4XJK A;  1CMG A;  1JFK A;  1OSA A;  1NWD A;  4JWQ A;  3BXK A;  1J7Q A;  3ZWH A;  4AQI A;  5CPV A;  5AAN A;  1CLB A;  5CSI A;  1KWO B;  1K9K A;  2JXC A;  3QRX A;  3D74 A;  3BFH A;  2KLD A;  2ZRT A;  1OOJ A;  3I5G B;  1REC A;  3B87 A;  5PAL A;  1OMV A;  4HRH A;  2BCX A;  2E30 A;  2ZKM X;  1U5I B;  3DF0 A;  2BL0 B;  4MEW A;  5CSJ A;  3VGO A;  1B4C A;  1ZUZ A;  3KO0 A;  3D75 A;  2KYC A;  1IWQ A;  1MWN A;  2YGU A;  3ZNI A;  4CFQ A;  4GBA A;  1M31 A;  3HX4 A;  1A2X A;  1KSM A;  1AK8 A;  1NCZ A;  2BCB A;  3CS1 A;  2ZND A;  1TCO B;  5CSN A;  5D7F A;  1CM1 A;  4C0L A;  3D0Y A;  4PAL A;  3CWG A;  1NIW A;  4WQ3 A;  1QLK A;  2LE9 B;  2SAS A;  1OMR A;  2JQ6 A;  3NSI A;  4XJK B;  1G33 A;  3UNW A;  5D3O A;  3LLE A;  1OW4 A;  1RFJ A;  2COL B;  4L9M A;  5DKR A;  1CFP A;  1A29 A;  3I5F B;  1ZMZ A;  1S6J A;  3DXL A;  3L47 A;  1CFC A;  4GGF C;  1UHI A;  1ZOT B;  4C0J A;  3VRR A;  1XFU O;  3DVK A;  2KFH A;  4CID A;  1F70 A;  2Y1N A;  1NP8 A;  4GNK B;  5FI6 A;  1K94 A;  4DS7 A;  2IS9 A;  4DUQ A;  1LA0 A;  3HCM A;  2JUL A;  1YUR A;  1M45 A;  3JVT C;  2PAS A;  3B6X A;  1NYA A;  2KYF A;  4TNC A;  4YI9 A;  1EJ3 A;  1MR8 A;  4PHM A;  2QEO A;  2LP2 A;  1DGV A;  3PM2 A;  1IIO A;  2PSR A;  3M0W A;  1LA3 A;  1ZFS A;  1NPQ A;  4ORA B;  5HKW A;  2KSP A;  1ODB A;  4BY4 A;  1XK4 A;  1CM4 A;  3NSK A;  2SCP A;  1OQP A;  1WDC C;  4MZK A;  1F4O A;  1M46 A;  1P28 A;  1FF1 A;  2AUC A;  2NCO A;  2JPT A;  3AKB A;  3V2L A;  3BFB A;  3I5G C;  4I5N B;  2PQL A;  3TUY B;  1SR6 B;  1K9U A;  2K7C A;  3CYZ A;  3CZ0 A;  1C3Z A;  3GK2 A;  3S0G A;  1IQ3 A;  1B8C A;  1DJI A;  3KF9 A;  4MBE A;  1QVI Y;  2AAO A;  1KK7 Z;  2PMY A;  2WCM A;  3CAB A;  3D73 A;  1XFW O;  5J3X A;  1B7T Z;  1QWV A;  2EHB A;  3BUX B;  1QX2 A;  2JC2 A;  5ER5 A;  1J1E A;  5EL2 A;  5I8N A;  2M7L A;  1AHR A;  2JT3 A;  3MSE B;  2D8N A;  3Q8I A;  1MQ1 A;  3SS3 A;  1FI6 A;  1Y6W A;  3SG7 A;  1EXR A;  1SSE B;  3CZ1 A;  3K1E A;  3KPX A;  3S0D A;  1KQM B;  2JRF A;  4QJ4 B;  1B8R A;  3DVJ A;  1OE9 B;  3I5I C;  4FTG A;  4A4B A;  1QAT A;  5KSZ A;  2KAV A;  4GFT A;  2K2F A;  4ICB A;  2WCE A;  4OV2 A;  4N5X A;  1BOC A;  4U8D A;  2LC5 A;  4XYN A;  3FWC A;  2L4H A;  2BBN A;  3R1V A;  2L51 A;  4OVN F;  3FS7 A;  4JD9 A;  3EK8 A;  3EVR A;  2BNX A;  3DD4 A;  1AVS A;  1ZAC A;  2PVB A;  2ZN9 A;  3DZT A;  2K60 A;  4GGF A;  1K9P A;  2QPT A;  4N1G A;  2ISD A;  1A75 A;  2HET A;  1KQV A;  4HRG A;  3FIA A;  4AOM A;  2KBM A;  1XO5 A;  1ORG A;  2L0P A;  5I2Q A;  1NX1 A;  1JSA A;  1IRJ A;  4ORC B;  2NCP A;  1Y0V H;  2CCM A;  1QX5 B;  2V53 A;  3GOF A;  4Q04 A;  1TUJ A;  2HQW A;  2KAY A;  1UHH A;  3BQ3 A;  1DJY A;  4IL1 A;  3WHT B;  1DEL A;  2R2I A;  1T14 A;  3SG5 A;  3CR4 X;  1OOF A;  3PAL A;  2MBX A;  2E6W A;  2OPO A;  1AUI B;  2LVJ A;  3PFV A;  1DJW A;  2A4J A;  2B1U A;  1QV0 A;  3EKJ A;  3GK4 X;  1MXL C;  4WQ2 A;  2KGB C;  2LVV A;  1ALV A;  5DIC A;  1SPY A;  2LHI A;  3S0A A;  2O60 A;  2NLN A;  1DF0 A;  1NX0 A;  3NSO A;  1YTZ C;  2OS8 C;  4MSP A;  1J7O A;  1QV1 A;  2JOJ A;  3LK0 A;  1IJ6 A;  3B86 A;  4IJ7 A;  2GV5 A;  2M9G A;  3OB1 B;  1DC1 A;  2NXQ A;  2P71 A;  2KDH A;  3LCP C;  1S6C A;  1K96 A;  3EVV A;  3S0B A;  3SIA A;  5B8I B;  1PSB A;  2WCL A;  3D10 A;  1BG1 A;  3EKH A;  1M63 B;  2HF5 A;  3B88 A;  3DVM A;  5KU1 A;  1PSR A;  1KQM C;  1Z4H A;  1CB1 A;  1DMO A;  1WY9 A;  2KAX A;  2QEV A;  2LMT A;  2JTZ A;  1G4Y R;  3H4S E;  5DKQ A;  2KI4 B;  4I5J A;  4MLW A;  1NX2 A;  2LM5 A;  2M29 A;  2AMI A;  1NUB A;  2DOQ A;  3KHE A;  4PCW A;  1S6I A;  2MJW B;  1QTX A;  1N0Y A;  1DEK A;  1SL8 A;  2K7B A;  4KYN A;  3WXA A;  3CDN A;  2K2A A;  1CLL A;  3EG5 B;  1C7V A;  1PVB A;  1AP4 A;  1GGZ A;  1AJ4 A;  3FWB A;  2TN4 A;  4MVF A;  3RLZ A;  4F0Z B;  1K8U A;  2QDI A;  1K95 A;  2KI6 C;  4N1F A;  2Q91 A;  3TS5 B;  1DT7 B;  1UP5 A;  3VRP A;  3EK4 A;  4FQO A;  4R1E A;  3IQQ A;  1Y1U A;  1IQ5 A;  1KK8 B;  3K21 A;  1KCY A;  1CFD A;  1SMG A;  1XA5 A;  3DF0 B;  1QLS A;  1B8L A;  4GPL B;  3CGA A;  3SG3 A;  1FPW A;  2LMU A;  2LHL A;  5CSF A;  3WNX B;  2K61 A;  4BY5 A;  1F8H A;  3SJS A;  1GM0 A;  1XFX O;  1LS8 A;  2PRU A;  4DRW A;  2I2R E;  3D0Y B;  2JTT A;  1S3P A;  1S5G Z;  3B7A A;  1YUS A;  3SG2 A;  1CDM A;  4YGC B;  2ZFD A;  3D76 A;  1KWO C;  2BE6 A;  1KFU S;  4PDZ A;  2LLU A;  1IH0 A;  1MXE A;  1BT6 A;  1KFX S;  3BOW A;  1WRZ A;  3UO9 A;  4GAO A;  1NX3 A;  2FOT A;  2JWW A;  3D77 A;  2OTG B;  4JKT A;  1RRO A;  5HLV A;  1QIW A;  2F8P A;  1JBA A;  5HKY A;  1HQV A;  1TNX A;  2HPS A;  3JTD B;  1YUT A;  1F54 A;  1KK7 Y;  4P2Y B;  1Z2C B;  1F55 A;  2BL0 C;  1B7T Y;  3PJI A;  4ZCV A;  5AFP A;  2JT8 A;  2NZ0 A;  1GQM A;  1SCM B;  4NDB A;  3IVT A;  2FJU B;  4PE0 A;  5FI2 A;  1CTR A;  3BUW B;  1PRW A;  1EL4 A;  3BUN B;  1TWO A;  2LCP A;  3NXA A;  4M2P A;  3A4U B;  4YGD B;  1TOP A;  3OGN A;  1G8I A;  1TN4 A;  4YI8 A;  1TCF A;  1YX7 A;  3BFA A;  1JWD A;  2MLF C;  3PM8 A;  1K2H A;  2EC6 B;  2O5G A;  1V1F A;  1TTX A;  1YR5 A;  1JUO A;  2L4I A;  1LIN A;  2KGR A;  1L2O B;  2P6B B;  3I5H B;  3O2P A;  1J1D A;  5HLO A;  1OOI X;  2MLE C;  1FI5 A;  1ALW A;  1TNQ A;  1C07 A;  3I5F C;  3VRO A;  3OBV A;  1PAL A;  3SG6 A;  1NSH A;  1UHN A;  2F2O A;  1WLM A;  2WC8 A;  1WLZ A;  2WCF A;  2LVI A;  1TRF A;  3AKA A;  2K7O A;  5ER4 X;  1VRK A;  1QJT A;  1CDL A;  3BYA A;  3FE9 A;  1N2D A;  3BJH A;  3PLF B;  4ETO A;  3A8R A;  3R72 A;  3OX5 A;  2WCB A;  2M0R A;  2PYQ A;  1RWY A;  3OX6 A;  2LMV A;  2MA2 A;  4OR9 B;  3S0F A; 
#chains in the Genus database with same CATH homology
 2P71 A;  3DXL A;  3NGV A;  3L47 A;  1XFR A;  4FQT A;  2FJY A;  3S0B A;  3RZS A;  2WCL A;  3S0E A;  3R1O A;  3B88 A;  2WCK A;  2QEV A;  3NHI A;  3B6X A;  4OZD A;  2QEH A;  3QME A;  2QEO A;  3L4L A;  2KPH A;  3DY9 A;  4F7F A;  3D78 A;  4INX A;  4PT1 A;  3CDN A;  3N7H A;  1DQE A;  3DYE A;  3FE8 A;  1OOH A;  1OOG A;  2H8V A;  1P28 A;  2QDI A;  1C3Y A;  3V2L A;  3BFB A;  2PQL A;  3L4A A;  2JPO A;  3CZ2 A;  3VB1 A;  3CYZ A;  3CZ0 A;  1C3Z A;  3S0G A;  2WCM A;  3CAB A;  3D73 A;  2WCH A;  1QWV A;  2QEB A;  1GM0 A;  3FE6 A;  1LS8 A;  3B7A A;  5EL2 A;  3D76 A;  3Q8I A;  3CZ1 A;  3S0D A;  3K1E A;  3D77 A;  2P70 A;  3PJI A;  3R1P A;  3R1V A;  4JD9 A;  3DZT A;  1TWO A;  3OGN A;  3D74 A;  3BFA A;  3BFH A;  1ORG A;  3B87 A;  1TUJ A;  1OOI X;  1T14 A;  3NHT A;  1OOF A;  2WC5 A;  3D75 A;  2WCJ A;  4INW A;  2L2C A;  2ERB A;  2GTE A;  3FE9 A;  3BJH A;  5DIC A;  2WC6 A;  3S0A A;  3R72 A;  1OW4 A;  3S0F A;  3B86 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...