1E8AA

The three-dimensional structure of human s100a12
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
87
structure length
87
Chain Sequence
TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S100A12
publication title The Three-Dimensional Structure of Human S100A12
pubmed doi rcsb
molecule tags Antifungal protein
total genus 34
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1e8aA00
1KCYA 3GK1A 2D8NA 1MHOA 1J55A 3KPXA 1F55A 2JNFA 2ZRSA 2M8UA 1DJXA 2KHNA 5F6TA 1QX5B 1DF0B 2M1UA 3DVEA 2JTTA 3CLNA 4AQIA 2LCPA 3CR4X 5IBWA 1WDCC 1YRTB 2CXJA 2KGRA 3PFVA 1SL7A 2LC5A 5CSJA 3VRQA 4NDDA 4AOMA 1W7JB 3GOFA 3SG4A 1MUXA 1SYMA 4AQJA 1Q80A 2HETA 1TTXA 1ODBA 1SCMB 2EGDA 5KTYA 1BLQA 4L9MA 1IWQA 2L4IA 2ZN8A 1S6IA 1V1FA 1PVAA 2NZ0A 4ORCB 1S6JA 4C0LA 4MRXA 3I5GB 3VRPA 1E8AA 2JXCA 3I5FB 1IJ5A 3SG2A 3JTDB 1B8LA 1BF5A 3CR2A 3MSEB 2WOSA 1PULA 3PN7C 5KU1A 1SMGA 4ICBA 1XA5A 1CMFA 3OB1B 1MQ1A 1ZMZA 1KSOA 2F8PA 3AAKA 1QS7A 4QJ3B 4YGBB 1C07A 1AK8A 3SIAA 1IKUA 3KO0A 1QIWA 1B8RA 4MN0A 1IJ6A 1CLLA 2KQYA 4GBAA 1WRLA 4PHNA 2QPTA 5FYXA 1KWOC 1HT9A 2LHIA 2KAXA 1YTZC 2OTGB 2JTZA 2LVIA 1ZOTB 1UHIA 1DJZA 1S36A 3AAJA 4CLNA 2H2KA 1KK8C 2Q4UA 1S26D 3DF0B 1CKKA 1LVCD 4PALA 1YX7A 2LHLA 4YRUA 2KFGA 1D1OA 1B47A 3FIAA 3I5HB 1VRKA 1QVIZ 1IG5A 1IGVA 1NYAA 5DKNA 4TNCA 1Y1XA 1DJYA 2LMTA 1K9UA 1BOCA 5G08A 1DJGA 3TUYB 1MWNA 3BOWA 3NSKA 1OQPA 2F3YA 1KFUL 3M0WA 4JWQA 1BG1A 1QX2A 5DKRA 4A4BA 1N65A 2PMYA 3LCPC 1XFXO 1AJ4A 1BR4B 2B1UA 1K2HA 4YGEB 1YUTA 3RLZA 2L5XB 1TCFA 4WRIA 2LUXA 1W7IB 1TNXA 4YI9A 2SCPA 2M1KB 1UURA 2K7BA 4MZJA 3WXAA 1AJ5A 3AKBA 1CNPA 3BYAA 4MBEA 2I7AA 2KI4C 1JC2A 1BJFA 4XJKA 3TDIA 2M7NA 2KGBC 1SY9A 2M49B 4GGFC 1MXEA 3AKAA 4FTGA 2GGMA 2WCBA 3H4SE 2KNEA 5JOLA 4HREE 1PSBA 2KBMA 1YR5A 1L2OC 1U5IB 2F3ZA 2LP2A 1SL8A 4GGFA 2PVBA 3EK4A 1SNLA 1WRZA 2Y1MA 4CPVA 1SW8A 1S5GY 1FPWA 2M29A 1AHRA 3ZWHA 1SR6C 1B7TZ 2Y4QA 5HKWA 2F2PA 1PVBA 5I8NA 5AANA 3BUOB 5HKYA 4YGAA 1K95A 2FCDA 4PCWA 2V53A 3ICBA 3EKHA 3NXAA 1PK0D 4M2OA 1B1GA 4N5XA 4WQ3A 2MJWB 1KWOB 1L7ZA 1A03A 4DUQA 1JSAA 3SG3A 2NCOA 1QXPA 3LK0A 2Y5IA 2KI6C 1IRJA 3PALA 3IQQA 1KK8B 1PSRA 2HQWA 1DMOA 1F4QA 4ORAB 5D7FA 1WLZA 1FW4A 2ZRTA 1JFJA 3PSRA 2LAPA 5I2LA 1F8HA 1CB1A 1M63B 4PHKA 2LLTA 3VRNA 2EHBA 2I94A 2BKIB 1RECA 3WHTB 1F70A 3I5IC 2O5GA 1G4YR 4M2PA 2MBXA 1QV0A 1NX3A 2L2EA 3OP0A 5GQQC 4MSPA 1JFKA 2K7OA 1YRUB 1YVHA 2JULA 1CFCA 2LVVA 1NX1A 3JVTC 2M9GA 1YX8A 4MZKA 3TDZA 2JT8A 1YUSA 2L4HA 1BT6A 1K94A 1SL9A 2WCFA 1RTP1 3DD4A 2F2OA 1BMOA 1KFUS 1XFYO 1B4CA 2MHHA 1DJHA 1OMDA 1QATA 4U8DA 2H61C 1R2UA 2AAOA 4QJ4B 5K89A 2KI4B 2LLUA 1C7VA 1QTXA 4E68A 1NX2A 1WY9A 2ZNEA 2JC2A 1DJIA 4HRHA 1OSAA 1HQVA 1EXRA 1S6CA 5TNCA 2H61A 3GK4X 3DVKA 1J7QA 1L2OB 4CFQA 3OHMB 4XYNA 1A75A 2EC6C 3BUWB 5D69A 4ETOA 4ZCVA 1BODA 2LVJA 1H8BA 4YGCB 1JF2A 1LA3A 1IQ3A 1GJYA 1LA0A 4OVNF 1DGVA 5PALA 1S3PA 1XVJA 1J1EA 1GQMA 2K0JA 5DKQA 1J7PA 1CLBA 1RJVA 2AUCA 1MR8A 2BE4A 1SKTA 3O2PA 1BR1B 2K8MB 2GGZA 1M45A 1M31A 1NP8A 1TN4A 4MVFA 4Q04A 2BKHB 1TNPA 1H4BA 2E30A 2PRUA 4R1EA 2I2RE 3VRRA 1B8CA 1TOPA 2FOTA 2PASA 1NIWA 2L50A 4ZCUA 1C7WA 1CDNA 1YVLA 2M3WA 3D0YA 1KFXS 5JJGA 1EG3A 3EK8A 1QJTA 2MLFC 1XYDA 2MAZA 1FBVA 1V1GA 2BL0C 1K90D 1RFJA 2WCEA 1LINA 2ZN9A 1BU3A 4YGDB 1WDCB 3KF9A 2QACA 5B8IB 2K7CA 2M97A 3BXKA 1DF0A 1IQ5A 5HLVA 1WRKA 2CBLA 2LM5A 2R2IA 1UHNA 2KAVA 4I5NB 2L51A 2F33A 1ZFSA 3BUNB 3O6BA 3VGOA 2KFFA 1AP4A 1NX0A 3D10A 2MRDA 1TNWA 1N2DA 1CFPA 4D1EA 2ZFDA 2OS8C 3I5GC 1DJWA 1F54A 4MRYA 5AERA 1CLMA 3OX6A 3TZ1A 3LK1A 1UP5A 5BPJA 2LP3A 3PN7B 1LKJA 3CZTX 2BBNA 4PE7A 3WNXB 3EVUA 1A4PA 1CTRA 1OOJA 4PHMA 3WHUB 2OPOA 4P5OE 2O60A 2LUCA 3EVVA 1K9KA 3TS5C 1LXFC 2JT3A 2NCPA 4WQ2A 1TIZA 1ALWA 2OTGC 1J7RA 2EC6B 3HCMA 1KQMC 2KBIA 3CS1A 3DVMA 1DTLA 3F45A 1K96A 1N0YA 1G8IA 1UHHA 2CNPA 3O4YA 2L0PA 2BE6A 2JOJA 1QVIY 3BOWB 1ALVA 2ISDA 1XFZO 2HQ8A 4DRWA 3KHEA 2LMVA 2LE9B 2P6BB 3DF0A 3HX4A 5I2QA 1Y1UA 3SG7A 3SG6A 4F0ZB 1PRWA 2BCAA 1QASA 1QV1A 1CDMA 2WNDA 1NCXA 1KK7Z 1J1DA 5CPVA 2LANA 1SPYA 3IQOA 1AUIB 1CM4A 5AFPA 4JPZB 2HPSA 2Q91A 1K93D 3EVRA 2K2FA 4IL1A 1OMVA 1XFVO 1KSMA 3C1VA 1QLSA 1QX7A 2L98A 2JPTA 4NDCA 1XFUO 1GGWA 2LV7A 1RWYA 4GPLB 1R6PA 3LLEA 2KYFA 5KSZA 1YUUA 4XJKB 1J7OA 1OE9B 1NCZA 2WC8A 1QIVA 3E3RA 3A8RA 5CSNA 4M2QA 1XK4C 2LVKA 2JXLA 2BL0B 2JZIA 1SRAA 4DS7A 2HF5A 2FCEA 2LNKA 4YI8A 1UUSA 3ZNIA 2KI6D 3VROA 1CM1A 2KSPA 4DCKA 3FWCA 1CDLA 2I18A 1XK4A 3NSOA 3PATA 4MEWA 2AMIA 1FI5A 2G2BA 3NSIA 4UPGA 2PALA 2JWWA 2OS8B 4PE4A 1DVIA 1JUOA 2PSRA 1YURA 2CCMA 2JT0A 1CFFA 4GAOA 4GNKB 1S1EA 5CSFA 1U5IA 1S5GZ 3EK7A 1CDPA 1TCOB 4GFTA 3NSLA 2GV5A 1F4OA 4HSZA 3CTNA 1B7TY 4YBHB 5HLOA 2ZKMX 1OZSA 2FJUB 1IH0A 1SR6B 1UHKA 2KYCA 2SASA 2NLNA 4FQOA 1EL4A 4A4CA 2CTNA 3PM8A 5HYDA 3TS5B 1NUBA 4ORBB 1DT7B 1SBJA 2LMUA 4OR9B 4I5KA 2NXQA 1SK6D 2KFHA 4JQ0D 1KQMB 3FS7A 3FWBA 2ZNDA 1NCYA 4OKHA 3GK2A 2COLB 2JU0A 4PDZA 1FF1A 4I5JA 4MZLA 1A2XA 4P2YB 1EH2A 3BUMB 4OV2A 3CGAA 1KQVA 1B9AA 4GUKA 2MA2A 4N1FA 1KK7Y 2IS9A 2G9BA 5CSIA 3BQ3A 2CT9A 2JRFA 1XFWO 3BUXB 3I5IB 1EG4A 5ER4X 3SG5A 2BCBA 3EKJA 3RM1A 1TRFA 1NWDA 2WORA 3PLFB 2BCXA 1SCMC 1AVSA 2Y1NA 3JVTB 3OX5A 2LLSA 1MXLC 2K61A 4MLWA 1GGZA 5I2OA 2BECA 1RROA 4BY4A 1K8UA 2KOTA 1ZUZA 4DIRA 1K9PA 3I5FC 1JWDA 1PALA 3JTDC 4HRGA 4NDBA 1F71A 1FI6A 1M46A 2JNXA 1SCVA 1CFDA 1XO5A 2E6WA 3LL8B 1MF8B 1NPQA 1CMGA 3SIBA 2M7LA 1A75B 3CWGA 2VRGA 3DVJA 4NQGA 2K7DA 2K2AA 1ZACA 4N1GA 3SJSA 1QLKA 1DGUA 4QJ5B 2DOQA 2M0RA 1WLMA 4OCIA 5AEQA 1Y0VH 1JBAA 1Y1AA 3OB2B 1UHJA 5J3XA 3IF7A 3O78A 4PE1A 2MLEC 4I5LB 3A4UB 1G33A 5ER5A 4GGNA 1A29A 2BBMA 1EJ3A 4CFRA 3CR5X 3TDUA 1TNQA 3I5HC 3KEVA 5HKZA 2KDHA 4PE0A 2A4JA 1Y6WA 4CIDA 2TN4A 2RGIA 3TUYC 2KAYA 1M39A 2JQ6A 1JF0A 1KFXL 1OZOA 3QRXA 4USLA 4C0KA 4PHJA 2KQ6A 5AXIA 3K21A 4BY5A 1RK9A 1UWOA 3D0YB 4C0JA 1NSHA 1X02A 1OMRA
chains in the Genus database with same CATH superfamily
2KLEA 2BAPA 3GK1A 1SSEB 2D8NA 1C3YA 4KYNA 1MHOA 1KCYA 1J55A 3KPXA 1F55A 2JNFA 1OOGA 2ZRSA 2M8UA 1DJXA 2KHNA 5F6TA 1QX5B 3D75A 3SS5A 1DF0B 2M1UA 5D3OA 3DVEA 1BODA 2JTTA 3CLNA 4JKTA 4AQIA 2LCPA 3CR4X 3R1OA 5IBWA 1WDCC 1YRTB 2CXJA 2KGRA 3PFVA 1SL7A 2LC5A 5CSJA 3VRQA 4NDDA 4AOMA 1W7JB 3GOFA 3SG4A 1MUXA 2P70A 1SYMA 4AQJA 1Q80A 2HETA 3FE8A 1Z2CB 1TTXA 2KLDA 1TWOA 1ODBA 1SCMB 2EGDA 5KTYA 1BLQA 4L9MA 1IWQA 2L4IA 2ZN8A 1S6IA 1V1FA 1PVAA 2NZ0A 4ORCB 1S6JA 4C0LA 3K1EA 4MRXA 3I5GB 3VRPA 1E8AA 2JXCA 2WCMA 3I5FB 1IJ5A 3SG2A 3JTDB 1B8LA 1BF5A 3CR2A 3MSEB 2WOSA 1PULA 5FI2A 3PN7C 5KU1A 1SMGA 4ICBA 1XA5A 1CMFA 3OB1B 3B86A 1MQ1A 1ZMZA 1KSOA 2F8PA 3AAKA 1QS7A 3PM2A 4QJ3B 4YGBB 1C07A 1AK8A 3SIAA 1IKUA 3KO0A 1QIWA 1B8RA 4MN0A 1IJ6A 1CLLA 2KQYA 4GBAA 1WRLA 4PHNA 2QPTA 5FYXA 1KWOC 1HT9A 3SS4A 2LHIA 2KAXA 1YTZC 2OTGB 2JTZA 2LVIA 1ZOTB 2WC5A 1UHIA 1DJZA 1S36A 3AAJA 4CLNA 2H2KA 1KK8C 2Q4UA 1S26D 3DF0B 1DC1A 3D73A 1CKKA 1LVCD 4PALA 1YX7A 2LHLA 4YRUA 2KFGA 1D1OA 1B47A 3FIAA 3I5HB 1VRKA 1QVIZ 1IG5A 1IGVA 1NYAA 5DKNA 4TNCA 1Y1XA 1DJYA 2LMTA 1K9UA 1BOCA 5G08A 1DJGA 1OW4A 3TUYB 1MWNA 3BOWA 3NSKA 1OQPA 3L4AA 2F3YA 3UO9A 1KFUL 3M0WA 4JWQA 1BG1A 1QX2A 5DKRA 4A4BA 1N65A 2PMYA 3LCPC 1XFXO 2WC6A 3S0FA 1AJ4A 1BR4B 2B1UA 1K2HA 4YGEB 1YUTA 3RLZA 2L5XB 1TCFA 4WRIA 2LUXA 1W7IB 1TNXA 4YI9A 2SCPA 4F7FA 2M1KB 1UURA 2K7BA 3CZ1A 4MZJA 3WXAA 1AJ5A 3BFAA 3AKBA 1CNPA 3BYAA 4MBEA 2I7AA 2KI4C 1JC2A 1BJFA 1T14A 4XJKA 3TDIA 2M7NA 2JPOA 2KGBC 3Q8IA 1SY9A 2M49B 4GGFC 1MXEA 3AKAA 4FTGA 2GGMA 2WCBA 3H4SE 2KNEA 5JOLA 1OOIX 4HREE 1PSBA 2KBMA 1YR5A 1L2OC 1U5IB 2F3ZA 2LP2A 1SL8A 4GGFA 2PVBA 3EK4A 1SNLA 1WRZA 2Y1MA 4CPVA 1SW8A 1S5GY 1FPWA 1GM0A 2M29A 1AHRA 1DELA 3ZWHA 2PQLA 1LS8A 4INWA 1SR6C 1B7TZ 2Y4QA 5HKWA 2F2PA 1PVBA 5I8NA 5AANA 3BUOB 5HKYA 4YGAA 1K95A 2FCDA 4PCWA 2V53A 3ICBA 2KPHA 3EKHA 3NXAA 1PK0D 4M2OA 1B1GA 4N5XA 4WQ3A 2MJWB 1KWOB 1L7ZA 1OOHA 4DUQA 1A03A 1JSAA 3SG3A 2NCOA 3O4XA 1QXPA 3LK0A 2Y5IA 2KI6C 1IRJA 3PALA 3IQQA 1KK8B 1PSRA 2HQWA 1DMOA 1F4QA 4ORAB 5D7FA 1WLZA 1FW4A 3R1PA 2ZRTA 1JFJA 3PSRA 2LAPA 5I2LA 2WCJA 1F8HA 1CB1A 1M63B 4PHKA 2LLTA 3VRNA 1Z4HA 2EHBA 2H8VA 2I94A 2BKIB 1RECA 3WHTB 1F70A 3I5IC 2O5GA 1G4YR 3DXLA 4M2PA 1QV0A 1NX3A 2L2EA 3OP0A 5GQQC 2MBXA 4MSPA 3S0DA 1JFKA 2K7OA 1YRUB 1W9ZA 1YVHA 2JULA 1CFCA 2LVVA 3NHTA 1NX1A 3BFBA 3JVTC 2M9GA 1YX8A 4MZKA 3TDZA 2JT8A 1YUSA 2L4HA 3CZ2A 1BT6A 1K94A 1SL9A 2WCFA 1RTP1 3DD4A 2F2OA 1BMOA 1KFUS 1XFYO 1B4CA 5I94A 2MHHA 1DJHA 1OMDA 1QATA 4U8DA 2H61C 1R2UA 2AAOA 4QJ4B 5K89A 2KI4B 2BNXA 2LLUA 1C7VA 1QTXA 4E68A 1NX2A 1WY9A 2ZNEA 2JC2A 1DJIA 4HRHA 1OSAA 1HQVA 1EXRA 1S6CA 5TNCA 2H61A 3GK4X 3DVKA 1J7QA 1P28A 1C3ZA 1L2OB 4CFQA 3OHMB 4XYNA 1A75A 2EC6C 3BUWB 3D78A 5D69A 4ZCVA 4ETOA 2LVJA 3B7AA 1H8BA 3DY9A 3SS3A 4YGCB 1JF2A 3R1VA 1LA3A 1IQ3A 1GJYA 1LA0A 4OVNF 1DGVA 5PALA 1S3PA 1XVJA 1J1EA 1GQMA 2FJYA 2K0JA 5DKQA 1J7PA 2ERBA 1TUZA 1CLBA 1QWVA 1RJVA 1DQEA 1MR8A 2AUCA 1SKTA 2BE4A 3RZSA 3O2PA 1BR1B 2K8MB 5HL1A 2GGZA 1XFRA 1M31A 1M45A 1NP8A 1TN4A 3NHIA 4MVFA 2BKHB 4Q04A 1TNPA 1H4BA 2E30A 2PRUA 4R1EA 2I2RE 3VRRA 1B8CA 1TOPA 2FOTA 2PASA 3L4LA 1NIWA 2L50A 3L47A 4ZCUA 1C7WA 1CDNA 1YVLA 2M3WA 4OZDA 3D0YA 1KFXS 5JJGA 1EG3A 3EK8A 1QJTA 2MLFC 1XYDA 2MAZA 1FBVA 3PJIA 1V1GA 2BL0C 4INXA 1K90D 1RFJA 2WCEA 1LINA 2WCHA 2ZN9A 1BU3A 4YGDB 1WDCB 3KF9A 2QACA 5B8IB 2K7CA 2M97A 3BXKA 1DF0A 1IQ5A 2YGUA 5HLVA 1WRKA 2CBLA 2LM5A 2QEOA 1UHNA 2R2IA 2KAVA 3V2LA 4I5NB 2L51A 2F33A 1ZFSA 3BUNB 3O6BA 3VGOA 2KFFA 1AP4A 1NX0A 3D10A 2MRDA 1TNWA 1N2DA 1CFPA 4D1EA 2ZFDA 2OS8C 2WCLA 3I5GC 3FE9A 1DJWA 1F54A 2K60A 4MRYA 5AERA 1CLMA 3CDNA 3OX6A 3LK1A 1UP5A 3TZ1A 5BPJA 2LP3A 3PN7B 1LKJA 3CZTX 2BBNA 4PE7A 3WNXB 3EVUA 1A4PA 1CTRA 1OOJA 4PHMA 3WHUB 2OPOA 4P5OE 2O60A 2LUCA 3EVVA 1K9KA 3TS5C 1LXFC 2JT3A 2NCPA 4WQ2A 1TIZA 1ALWA 2OTGC 1J7RA 3VB1A 1OOFA 2EC6B 3HCMA 1KQMC 3B88A 3QMEA 2KBIA 3CS1A 3DVMA 1DTLA 3F45A 1K96A 1N0YA 1G8IA 1UHHA 2CNPA 3O4YA 2L0PA 2BE6A 2JOJA 1QVIY 3BOWB 1ALVA 2ISDA 1XFZO 3B6XA 2HQ8A 4DRWA 3KHEA 2LMVA 2LE9B 2P6BB 3DF0A 3HX4A 3S0BA 5I2QA 1Y1UA 3SG7A 1IIOA 3SG6A 4F0ZB 1PRWA 1QV1A 1QASA 2BCAA 1CDMA 2WNDA 1NCXA 3CYZA 3S0EA 1KK7Z 1J1DA 5CPVA 2LANA 1SPYA 3IQOA 1AUIB 1CM4A 4PT1A 5AFPA 2QEBA 2HPSA 4JPZB 3S0AA 2Q91A 1K93D 3EVRA 2K2FA 2PYQA 4IL1A 1OMVA 1XFVO 1KSMA 3D74A 3C1VA 1QLSA 1QX7A 2L98A 2JPTA 4NDCA 1XFUO 1GGWA 2LV7A 1RWYA 4GPLB 1R6PA 3B87A 2KYFA 3LLEA 5KSZA 1YUUA 4XJKB 1J7OA 1OE9B 1NCZA 2WC8A 1QIVA 3E3RA 3A8RA 4JD9A 5CSNA 4M2QA 1XK4C 2LVKA 2JXLA 2BL0B 2JZIA 1SRAA 4DS7A 2HF5A 2FCEA 3EG5B 2LNKA 4YI8A 1UUSA 3ZNIA 2KI6D 3VROA 1CM1A 2KSPA 4DCKA 3FWCA 1CDLA 2I18A 1XK4A 3NSOA 3PATA 4IJ7A 4MEWA 2AMIA 1FI5A 2G2BA 3NSIA 4UPGA 2PALA 2JWWA 2OS8B 4PE4A 1DVIA 1JUOA 5FI6A 2PSRA 1YURA 2CCMA 2JT0A 3UNWA 1CFFA 4GAOA 4GNKB 1S1EA 5CSFA 1U5IA 1S5GZ 3EK7A 1CDPA 1TCOB 4GFTA 3NSLA 2GV5A 1F4OA 3R72A 4HSZA 3CTNA 1B7TY 4YBHB 5HLOA 2ZKMX 1OZSA 2FJUB 1IH0A 2L5YA 1SR6B 3N7HA 1UHKA 2KYCA 2SASA 2NLNA 4FQOA 1EL4A 4A4CA 2CTNA 3PM8A 5HYDA 3TS5B 1NUBA 4ORBB 1DT7B 1SBJA 2LMUA 4OR9B 4I5KA 2NXQA 1SK6D 2KFHA 4JQ0D 1KQMB 3FS7A 3FWBA 2ZNDA 1NCYA 4OKHA 3GK2A 2COLB 2GTEA 2JU0A 4PDZA 1FF1A 4I5JA 4MZLA 1A2XA 4P2YB 1EH2A 3BUMB 4OV2A 3CGAA 1KQVA 1B9AA 4GUKA 2MA2A 4N1FA 1KK7Y 2IS9A 3CABA 2G9BA 5CSIA 3BQ3A 2CT9A 2JRFA 1XFWO 3BUXB 3I5IB 1EG4A 1DEKA 5ER4X 2QDIA 3SG5A 2BCBA 3EKJA 3RM1A 3BJHA 1TRFA 1NWDA 2WORA 3D77A 2BCXA 1SCMC 3PLFB 1AVSA 2Y1NA 3JVTB 3OX5A 5DICA 2LLSA 1TUJA 2WCKA 1MXLC 2K61A 3DYEA 1GGZA 4MLWA 2BECA 5I2OA 1RROA 4BY4A 1K8UA 2KOTA 3BFHA 1ZUZA 4DIRA 1K9PA 3I5FC 1JWDA 1PALA 3JTDC 4HRGA 4NDBA 1F71A 1FI6A 1M46A 2JNXA 1SCVA 1CFDA 1XO5A 2E6WA 2QEVA 1MF8B 1NPQA 3LL8B 3OGNA 1CMGA 3SIBA 2M7LA 1A75B 3CWGA 2VRGA 3DVJA 4NQGA 2K7DA 2K2AA 1ZACA 4N1GA 5FI7A 3OBVA 3SJSA 1QLKA 3DZTA 1DGUA 4QJ5B 2DOQA 2M0RA 1WLMA 4OCIA 2QEHA 1Y0VH 5AEQA 1Y1AA 3OB2B 1UHJA 5J3XA 1JBAA 3IF7A 3O78A 4PE1A 2MLEC 4I5LB 3A4UB 1G33A 5ER5A 4GGNA 1ORGA 1A29A 2BBMA 1EJ3A 3D76A 3CR5X 4CFRA 3TDUA 3FE6A 1TNQA 3I5HC 3KEVA 5EL2A 5HKZA 2KDHA 4PE0A 2A4JA 3IVTA 1Y6WA 2P71A 4CIDA 2TN4A 2RGIA 3NGVA 2KAYA 3S0GA 3TUYC 1M39A 2JQ6A 1JF0A 1KFXL 1OZOA 3QRXA 4USLA 4C0KA 3CZ0A 4PHJA 2KQ6A 5AXIA 2L2CA 3K21A 4BY5A 4FQTA 1RK9A 1UWOA 3D0YB 4C0JA 1NSHA 1X02A 1OMRA
chains in the Genus database with same CATH topology
1KCYA 3GK1A 2D8NA 1MHOA 1J55A 3KPXA 1F55A 2JNFA 2ZRSA 2M8UA 1DJXA 2KHNA 5F6TA 1QX5B 1DF0B 2M1UA 3DVEA 2JTTA 3CLNA 4AQIA 2LCPA 3CR4X 5IBWA 1WDCC 1YRTB 2CXJA 2KGRA 3PFVA 1SL7A 2LC5A 5CSJA 3VRQA 4NDDA 4AOMA 1W7JB 3GOFA 3SG4A 1MUXA 1SYMA 4AQJA 1Q80A 2HETA 1TTXA 1ODBA 1SCMB 2EGDA 5KTYA 1BLQA 4L9MA 1IWQA 2L4IA 2ZN8A 1S6IA 1V1FA 1PVAA 2NZ0A 4ORCB 1S6JA 4C0LA 4MRXA 3I5GB 3VRPA 1E8AA 2JXCA 3I5FB 1IJ5A 3SG2A 3JTDB 1B8LA 1BF5A 3CR2A 3MSEB 2WOSA 1PULA 3PN7C 5KU1A 1SMGA 4ICBA 1XA5A 1CMFA 3OB1B 1MQ1A 1ZMZA 1KSOA 2F8PA 3AAKA 1QS7A 4QJ3B 4YGBB 1C07A 1AK8A 3SIAA 1IKUA 3KO0A 1QIWA 1B8RA 4MN0A 1IJ6A 1CLLA 2KQYA 4GBAA 1WRLA 4PHNA 2QPTA 5FYXA 1KWOC 1HT9A 2LHIA 2KAXA 1YTZC 2OTGB 2JTZA 2LVIA 1ZOTB 1UHIA 1DJZA 1S36A 3AAJA 4CLNA 2H2KA 1KK8C 2Q4UA 1S26D 3DF0B 1CKKA 1LVCD 4PALA 1YX7A 2LHLA 4YRUA 2KFGA 1D1OA 1B47A 3FIAA 3I5HB 1VRKA 1QVIZ 1IG5A 1IGVA 1NYAA 5DKNA 4TNCA 1Y1XA 1DJYA 2LMTA 1K9UA 1BOCA 5G08A 1DJGA 3TUYB 1MWNA 3BOWA 3NSKA 1OQPA 2F3YA 1KFUL 3M0WA 4JWQA 1BG1A 1QX2A 5DKRA 4A4BA 1N65A 2PMYA 3LCPC 1XFXO 1AJ4A 1BR4B 2B1UA 1K2HA 4YGEB 1YUTA 3RLZA 2L5XB 1TCFA 4WRIA 2LUXA 1W7IB 1TNXA 4YI9A 2SCPA 2M1KB 1UURA 2K7BA 4MZJA 3WXAA 1AJ5A 3AKBA 1CNPA 3BYAA 4MBEA 2I7AA 2KI4C 1JC2A 1BJFA 4XJKA 3TDIA 2M7NA 2KGBC 1SY9A 2M49B 4GGFC 1MXEA 3AKAA 4FTGA 2GGMA 2WCBA 3H4SE 2KNEA 5JOLA 4HREE 1PSBA 2KBMA 1YR5A 1L2OC 1U5IB 2F3ZA 2LP2A 1SL8A 4GGFA 2PVBA 3EK4A 1SNLA 1WRZA 2Y1MA 4CPVA 1SW8A 1S5GY 1FPWA 2M29A 1AHRA 3ZWHA 1SR6C 1B7TZ 2Y4QA 5HKWA 2F2PA 1PVBA 5I8NA 5AANA 3BUOB 5HKYA 4YGAA 1K95A 2FCDA 4PCWA 2V53A 3ICBA 3EKHA 3NXAA 1PK0D 4M2OA 1B1GA 4N5XA 4WQ3A 2MJWB 1KWOB 1L7ZA 1A03A 4DUQA 1JSAA 3SG3A 2NCOA 1QXPA 3LK0A 2Y5IA 2KI6C 1IRJA 3PALA 3IQQA 1KK8B 1PSRA 2HQWA 1DMOA 1F4QA 4ORAB 5D7FA 1WLZA 1FW4A 2ZRTA 1JFJA 3PSRA 2LAPA 5I2LA 1F8HA 1CB1A 1M63B 4PHKA 2LLTA 3VRNA 2EHBA 2I94A 2BKIB 1RECA 3WHTB 1F70A 3I5IC 2O5GA 1G4YR 4M2PA 2MBXA 1QV0A 1NX3A 2L2EA 3OP0A 5GQQC 4MSPA 1JFKA 2K7OA 1YRUB 1YVHA 2JULA 1CFCA 2LVVA 1NX1A 3JVTC 2M9GA 1YX8A 4MZKA 3TDZA 2JT8A 1YUSA 2L4HA 1BT6A 1K94A 1SL9A 2WCFA 1RTP1 3DD4A 2F2OA 1BMOA 1KFUS 1XFYO 1B4CA 2MHHA 1DJHA 1OMDA 1QATA 4U8DA 2H61C 1R2UA 2AAOA 4QJ4B 5K89A 2KI4B 2LLUA 1C7VA 1QTXA 4E68A 1NX2A 1WY9A 2ZNEA 2JC2A 1DJIA 4HRHA 1OSAA 1HQVA 1EXRA 1S6CA 5TNCA 2H61A 3GK4X 3DVKA 1J7QA 1L2OB 4CFQA 3OHMB 4XYNA 1A75A 2EC6C 3BUWB 5D69A 4ETOA 4ZCVA 1BODA 2LVJA 1H8BA 4YGCB 1JF2A 1LA3A 1IQ3A 1GJYA 1LA0A 4OVNF 1DGVA 5PALA 1S3PA 1XVJA 1J1EA 1GQMA 2K0JA 5DKQA 1J7PA 1CLBA 1RJVA 2AUCA 1MR8A 2BE4A 1SKTA 3O2PA 1BR1B 2K8MB 2GGZA 1M45A 1M31A 1NP8A 1TN4A 4MVFA 4Q04A 2BKHB 1TNPA 1H4BA 2E30A 2PRUA 4R1EA 2I2RE 3VRRA 1B8CA 1TOPA 2FOTA 2PASA 1NIWA 2L50A 4ZCUA 1C7WA 1CDNA 1YVLA 2M3WA 3D0YA 1KFXS 5JJGA 1EG3A 3EK8A 1QJTA 2MLFC 1XYDA 2MAZA 1FBVA 1V1GA 2BL0C 1K90D 1RFJA 2WCEA 1LINA 2ZN9A 1BU3A 4YGDB 1WDCB 3KF9A 2QACA 5B8IB 2K7CA 2M97A 3BXKA 1DF0A 1IQ5A 5HLVA 1WRKA 2CBLA 2LM5A 2R2IA 1UHNA 2KAVA 4I5NB 2L51A 2F33A 1ZFSA 3BUNB 3O6BA 3VGOA 2KFFA 1AP4A 1NX0A 3D10A 2MRDA 1TNWA 1N2DA 1CFPA 4D1EA 2ZFDA 2OS8C 3I5GC 1DJWA 1F54A 4MRYA 5AERA 1CLMA 3OX6A 3TZ1A 3LK1A 1UP5A 5BPJA 2LP3A 3PN7B 1LKJA 3CZTX 2BBNA 4PE7A 3WNXB 3EVUA 1A4PA 1CTRA 1OOJA 4PHMA 3WHUB 2OPOA 4P5OE 2O60A 2LUCA 3EVVA 1K9KA 3TS5C 1LXFC 2JT3A 2NCPA 4WQ2A 1TIZA 1ALWA 2OTGC 1J7RA 2EC6B 3HCMA 1KQMC 2KBIA 3CS1A 3DVMA 1DTLA 3F45A 1K96A 1N0YA 1G8IA 1UHHA 2CNPA 3O4YA 2L0PA 2BE6A 2JOJA 1QVIY 3BOWB 1ALVA 2ISDA 1XFZO 2HQ8A 4DRWA 3KHEA 2LMVA 2LE9B 2P6BB 3DF0A 3HX4A 5I2QA 1Y1UA 3SG7A 3SG6A 4F0ZB 1PRWA 2BCAA 1QASA 1QV1A 1CDMA 2WNDA 1NCXA 1KK7Z 1J1DA 5CPVA 2LANA 1SPYA 3IQOA 1AUIB 1CM4A 5AFPA 4JPZB 2HPSA 2Q91A 1K93D 3EVRA 2K2FA 4IL1A 1OMVA 1XFVO 1KSMA 3C1VA 1QLSA 1QX7A 2L98A 2JPTA 4NDCA 1XFUO 1GGWA 2LV7A 1RWYA 4GPLB 1R6PA 3LLEA 2KYFA 5KSZA 1YUUA 4XJKB 1J7OA 1OE9B 1NCZA 2WC8A 1QIVA 3E3RA 3A8RA 5CSNA 4M2QA 1XK4C 2LVKA 2JXLA 2BL0B 2JZIA 1SRAA 4DS7A 2HF5A 2FCEA 2LNKA 4YI8A 1UUSA 3ZNIA 2KI6D 3VROA 1CM1A 2KSPA 4DCKA 3FWCA 1CDLA 2I18A 1XK4A 3NSOA 3PATA 4MEWA 2AMIA 1FI5A 2G2BA 3NSIA 4UPGA 2PALA 2JWWA 2OS8B 4PE4A 1DVIA 1JUOA 2PSRA 1YURA 2CCMA 2JT0A 1CFFA 4GAOA 4GNKB 1S1EA 5CSFA 1U5IA 1S5GZ 3EK7A 1CDPA 1TCOB 4GFTA 3NSLA 2GV5A 1F4OA 4HSZA 3CTNA 1B7TY 4YBHB 5HLOA 2ZKMX 1OZSA 2FJUB 1IH0A 1SR6B 1UHKA 2KYCA 2SASA 2NLNA 4FQOA 1EL4A 4A4CA 2CTNA 3PM8A 5HYDA 3TS5B 1NUBA 4ORBB 1DT7B 1SBJA 2LMUA 4OR9B 4I5KA 2NXQA 1SK6D 2KFHA 4JQ0D 1KQMB 3FS7A 3FWBA 2ZNDA 1NCYA 4OKHA 3GK2A 2COLB 2JU0A 4PDZA 1FF1A 4I5JA 4MZLA 1A2XA 4P2YB 1EH2A 3BUMB 4OV2A 3CGAA 1KQVA 1B9AA 4GUKA 2MA2A 4N1FA 1KK7Y 2IS9A 2G9BA 5CSIA 3BQ3A 2CT9A 2JRFA 1XFWO 3BUXB 3I5IB 1EG4A 5ER4X 3SG5A 2BCBA 3EKJA 3RM1A 1TRFA 1NWDA 2WORA 3PLFB 2BCXA 1SCMC 1AVSA 2Y1NA 3JVTB 3OX5A 2LLSA 1MXLC 2K61A 4MLWA 1GGZA 5I2OA 2BECA 1RROA 4BY4A 1K8UA 2KOTA 1ZUZA 4DIRA 1K9PA 3I5FC 1JWDA 1PALA 3JTDC 4HRGA 4NDBA 1F71A 1FI6A 1M46A 2JNXA 1SCVA 1CFDA 1XO5A 2E6WA 3LL8B 1MF8B 1NPQA 1CMGA 3SIBA 2M7LA 1A75B 3CWGA 2VRGA 3DVJA 4NQGA 2K7DA 2K2AA 1ZACA 4N1GA 3SJSA 1QLKA 1DGUA 4QJ5B 2DOQA 2M0RA 1WLMA 4OCIA 5AEQA 1Y0VH 1JBAA 1Y1AA 3OB2B 1UHJA 5J3XA 3IF7A 3O78A 4PE1A 2MLEC 4I5LB 3A4UB 1G33A 5ER5A 4GGNA 1A29A 2BBMA 1EJ3A 4CFRA 3CR5X 3TDUA 1TNQA 3I5HC 3KEVA 5HKZA 2KDHA 4PE0A 2A4JA 1Y6WA 4CIDA 2TN4A 2RGIA 3TUYC 2KAYA 1M39A 2JQ6A 1JF0A 1KFXL 1OZOA 3QRXA 4USLA 4C0KA 4PHJA 2KQ6A 5AXIA 3K21A 4BY5A 1RK9A 1UWOA 3D0YB 4C0JA 1NSHA 1X02A 1OMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KCY A;  3GK1 A;  2D8N A;  1MHO A;  1J55 A;  3KPX A;  1F55 A;  2JNF A;  2ZRS A;  2M8U A;  1DJX A;  2KHN A;  5F6T A;  1QX5 B;  1DF0 B;  2M1U A;  3DVE A;  2JTT A;  3CLN A;  4AQI A;  2LCP A;  3CR4 X;  5IBW A;  1WDC C;  1YRT B;  2CXJ A;  2KGR A;  3PFV A;  1SL7 A;  2LC5 A;  5CSJ A;  3VRQ A;  4NDD A;  4AOM A;  1W7J B;  3GOF A;  3SG4 A;  1MUX A;  1SYM A;  4AQJ A;  1Q80 A;  2HET A;  1TTX A;  1ODB A;  1SCM B;  2EGD A;  5KTY A;  1BLQ A;  4L9M A;  1IWQ A;  2L4I A;  2ZN8 A;  1S6I A;  1V1F A;  1PVA A;  2NZ0 A;  4ORC B;  1S6J A;  4C0L A;  4MRX A;  3I5G B;  3VRP A;  1E8A A;  2JXC A;  3I5F B;  1IJ5 A;  3SG2 A;  3JTD B;  1B8L A;  1BF5 A;  3CR2 A;  3MSE B;  2WOS A;  1PUL A;  3PN7 C;  5KU1 A;  1SMG A;  4ICB A;  1XA5 A;  1CMF A;  3OB1 B;  1MQ1 A;  1ZMZ A;  1KSO A;  2F8P A;  3AAK A;  1QS7 A;  4QJ3 B;  4YGB B;  1C07 A;  1AK8 A;  3SIA A;  1IKU A;  3KO0 A;  1QIW A;  1B8R A;  4MN0 A;  1IJ6 A;  1CLL A;  2KQY A;  4GBA A;  1WRL A;  4PHN A;  2QPT A;  5FYX A;  1KWO C;  1HT9 A;  2LHI A;  2KAX A;  1YTZ C;  2OTG B;  2JTZ A;  2LVI A;  1ZOT B;  1UHI A;  1DJZ A;  1S36 A;  3AAJ A;  4CLN A;  2H2K A;  1KK8 C;  2Q4U A;  1S26 D;  3DF0 B;  1CKK A;  1LVC D;  4PAL A;  1YX7 A;  2LHL A;  4YRU A;  2KFG A;  1D1O A;  1B47 A;  3FIA A;  3I5H B;  1VRK A;  1QVI Z;  1IG5 A;  1IGV A;  1NYA A;  5DKN A;  4TNC A;  1Y1X A;  1DJY A;  2LMT A;  1K9U A;  1BOC A;  5G08 A;  1DJG A;  3TUY B;  1MWN A;  3BOW A;  3NSK A;  1OQP A;  2F3Y A;  1KFU L;  3M0W A;  4JWQ A;  1BG1 A;  1QX2 A;  5DKR A;  4A4B A;  1N65 A;  2PMY A;  3LCP C;  1XFX O;  1AJ4 A;  1BR4 B;  2B1U A;  1K2H A;  4YGE B;  1YUT A;  3RLZ A;  2L5X B;  1TCF A;  4WRI A;  2LUX A;  1W7I B;  1TNX A;  4YI9 A;  2SCP A;  2M1K B;  1UUR A;  2K7B A;  4MZJ A;  3WXA A;  1AJ5 A;  3AKB A;  1CNP A;  3BYA A;  4MBE A;  2I7A A;  2KI4 C;  1JC2 A;  1BJF A;  4XJK A;  3TDI A;  2M7N A;  2KGB C;  1SY9 A;  2M49 B;  4GGF C;  1MXE A;  3AKA A;  4FTG A;  2GGM A;  2WCB A;  3H4S E;  2KNE A;  5JOL A;  4HRE E;  1PSB A;  2KBM A;  1YR5 A;  1L2O C;  1U5I B;  2F3Z A;  2LP2 A;  1SL8 A;  4GGF A;  2PVB A;  3EK4 A;  1SNL A;  1WRZ A;  2Y1M A;  4CPV A;  1SW8 A;  1S5G Y;  1FPW A;  2M29 A;  1AHR A;  3ZWH A;  1SR6 C;  1B7T Z;  2Y4Q A;  5HKW A;  2F2P A;  1PVB A;  5I8N A;  5AAN A;  3BUO B;  5HKY A;  4YGA A;  1K95 A;  2FCD A;  4PCW A;  2V53 A;  3ICB A;  3EKH A;  3NXA A;  1PK0 D;  4M2O A;  1B1G A;  4N5X A;  4WQ3 A;  2MJW B;  1KWO B;  1L7Z A;  1A03 A;  4DUQ A;  1JSA A;  3SG3 A;  2NCO A;  1QXP A;  3LK0 A;  2Y5I A;  2KI6 C;  1IRJ A;  3PAL A;  3IQQ A;  1KK8 B;  1PSR A;  2HQW A;  1DMO A;  1F4Q A;  4ORA B;  5D7F A;  1WLZ A;  1FW4 A;  2ZRT A;  1JFJ A;  3PSR A;  2LAP A;  5I2L A;  1F8H A;  1CB1 A;  1M63 B;  4PHK A;  2LLT A;  3VRN A;  2EHB A;  2I94 A;  2BKI B;  1REC A;  3WHT B;  1F70 A;  3I5I C;  2O5G A;  1G4Y R;  4M2P A;  2MBX A;  1QV0 A;  1NX3 A;  2L2E A;  3OP0 A;  5GQQ C;  4MSP A;  1JFK A;  2K7O A;  1YRU B;  1YVH A;  2JUL A;  1CFC A;  2LVV A;  1NX1 A;  3JVT C;  2M9G A;  1YX8 A;  4MZK A;  3TDZ A;  2JT8 A;  1YUS A;  2L4H A;  1BT6 A;  1K94 A;  1SL9 A;  2WCF A;  1RTP 1;  3DD4 A;  2F2O A;  1BMO A;  1KFU S;  1XFY O;  1B4C A;  2MHH A;  1DJH A;  1OMD A;  1QAT A;  4U8D A;  2H61 C;  1R2U A;  2AAO A;  4QJ4 B;  5K89 A;  2KI4 B;  2LLU A;  1C7V A;  1QTX A;  4E68 A;  1NX2 A;  1WY9 A;  2ZNE A;  2JC2 A;  1DJI A;  4HRH A;  1OSA A;  1HQV A;  1EXR A;  1S6C A;  5TNC A;  2H61 A;  3GK4 X;  3DVK A;  1J7Q A;  1L2O B;  4CFQ A;  3OHM B;  4XYN A;  1A75 A;  2EC6 C;  3BUW B;  5D69 A;  4ETO A;  4ZCV A;  1BOD A;  2LVJ A;  1H8B A;  4YGC B;  1JF2 A;  1LA3 A;  1IQ3 A;  1GJY A;  1LA0 A;  4OVN F;  1DGV A;  5PAL A;  1S3P A;  1XVJ A;  1J1E A;  1GQM A;  2K0J A;  5DKQ A;  1J7P A;  1CLB A;  1RJV A;  2AUC A;  1MR8 A;  2BE4 A;  1SKT A;  3O2P A;  1BR1 B;  2K8M B;  2GGZ A;  1M45 A;  1M31 A;  1NP8 A;  1TN4 A;  4MVF A;  4Q04 A;  2BKH B;  1TNP A;  1H4B A;  2E30 A;  2PRU A;  4R1E A;  2I2R E;  3VRR A;  1B8C A;  1TOP A;  2FOT A;  2PAS A;  1NIW A;  2L50 A;  4ZCU A;  1C7W A;  1CDN A;  1YVL A;  2M3W A;  3D0Y A;  1KFX S;  5JJG A;  1EG3 A;  3EK8 A;  1QJT A;  2MLF C;  1XYD A;  2MAZ A;  1FBV A;  1V1G A;  2BL0 C;  1K90 D;  1RFJ A;  2WCE A;  1LIN A;  2ZN9 A;  1BU3 A;  4YGD B;  1WDC B;  3KF9 A;  2QAC A;  5B8I B;  2K7C A;  2M97 A;  3BXK A;  1DF0 A;  1IQ5 A;  5HLV A;  1WRK A;  2CBL A;  2LM5 A;  2R2I A;  1UHN A;  2KAV A;  4I5N B;  2L51 A;  2F33 A;  1ZFS A;  3BUN B;  3O6B A;  3VGO A;  2KFF A;  1AP4 A;  1NX0 A;  3D10 A;  2MRD A;  1TNW A;  1N2D A;  1CFP A;  4D1E A;  2ZFD A;  2OS8 C;  3I5G C;  1DJW A;  1F54 A;  4MRY A;  5AER A;  1CLM A;  3OX6 A;  3TZ1 A;  3LK1 A;  1UP5 A;  5BPJ A;  2LP3 A;  3PN7 B;  1LKJ A;  3CZT X;  2BBN A;  4PE7 A;  3WNX B;  3EVU A;  1A4P A;  1CTR A;  1OOJ A;  4PHM A;  3WHU B;  2OPO A;  4P5O E;  2O60 A;  2LUC A;  3EVV A;  1K9K A;  3TS5 C;  1LXF C;  2JT3 A;  2NCP A;  4WQ2 A;  1TIZ A;  1ALW A;  2OTG C;  1J7R A;  2EC6 B;  3HCM A;  1KQM C;  2KBI A;  3CS1 A;  3DVM A;  1DTL A;  3F45 A;  1K96 A;  1N0Y A;  1G8I A;  1UHH A;  2CNP A;  3O4Y A;  2L0P A;  2BE6 A;  2JOJ A;  1QVI Y;  3BOW B;  1ALV A;  2ISD A;  1XFZ O;  2HQ8 A;  4DRW A;  3KHE A;  2LMV A;  2LE9 B;  2P6B B;  3DF0 A;  3HX4 A;  5I2Q A;  1Y1U A;  3SG7 A;  3SG6 A;  4F0Z B;  1PRW A;  2BCA A;  1QAS A;  1QV1 A;  1CDM A;  2WND A;  1NCX A;  1KK7 Z;  1J1D A;  5CPV A;  2LAN A;  1SPY A;  3IQO A;  1AUI B;  1CM4 A;  5AFP A;  4JPZ B;  2HPS A;  2Q91 A;  1K93 D;  3EVR A;  2K2F A;  4IL1 A;  1OMV A;  1XFV O;  1KSM A;  3C1V A;  1QLS A;  1QX7 A;  2L98 A;  2JPT A;  4NDC A;  1XFU O;  1GGW A;  2LV7 A;  1RWY A;  4GPL B;  1R6P A;  3LLE A;  2KYF A;  5KSZ A;  1YUU A;  4XJK B;  1J7O A;  1OE9 B;  1NCZ A;  2WC8 A;  1QIV A;  3E3R A;  3A8R A;  5CSN A;  4M2Q A;  1XK4 C;  2LVK A;  2JXL A;  2BL0 B;  2JZI A;  1SRA A;  4DS7 A;  2HF5 A;  2FCE A;  2LNK A;  4YI8 A;  1UUS A;  3ZNI A;  2KI6 D;  3VRO A;  1CM1 A;  2KSP A;  4DCK A;  3FWC A;  1CDL A;  2I18 A;  1XK4 A;  3NSO A;  3PAT A;  4MEW A;  2AMI A;  1FI5 A;  2G2B A;  3NSI A;  4UPG A;  2PAL A;  2JWW A;  2OS8 B;  4PE4 A;  1DVI A;  1JUO A;  2PSR A;  1YUR A;  2CCM A;  2JT0 A;  1CFF A;  4GAO A;  4GNK B;  1S1E A;  5CSF A;  1U5I A;  1S5G Z;  3EK7 A;  1CDP A;  1TCO B;  4GFT A;  3NSL A;  2GV5 A;  1F4O A;  4HSZ A;  3CTN A;  1B7T Y;  4YBH B;  5HLO A;  2ZKM X;  1OZS A;  2FJU B;  1IH0 A;  1SR6 B;  1UHK A;  2KYC A;  2SAS A;  2NLN A;  4FQO A;  1EL4 A;  4A4C A;  2CTN A;  3PM8 A;  5HYD A;  3TS5 B;  1NUB A;  4ORB B;  1DT7 B;  1SBJ A;  2LMU A;  4OR9 B;  4I5K A;  2NXQ A;  1SK6 D;  2KFH A;  4JQ0 D;  1KQM B;  3FS7 A;  3FWB A;  2ZND A;  1NCY A;  4OKH A;  3GK2 A;  2COL B;  2JU0 A;  4PDZ A;  1FF1 A;  4I5J A;  4MZL A;  1A2X A;  4P2Y B;  1EH2 A;  3BUM B;  4OV2 A;  3CGA A;  1KQV A;  1B9A A;  4GUK A;  2MA2 A;  4N1F A;  1KK7 Y;  2IS9 A;  2G9B A;  5CSI A;  3BQ3 A;  2CT9 A;  2JRF A;  1XFW O;  3BUX B;  3I5I B;  1EG4 A;  5ER4 X;  3SG5 A;  2BCB A;  3EKJ A;  3RM1 A;  1TRF A;  1NWD A;  2WOR A;  3PLF B;  2BCX A;  1SCM C;  1AVS A;  2Y1N A;  3JVT B;  3OX5 A;  2LLS A;  1MXL C;  2K61 A;  4MLW A;  1GGZ A;  5I2O A;  2BEC A;  1RRO A;  4BY4 A;  1K8U A;  2KOT A;  1ZUZ A;  4DIR A;  1K9P A;  3I5F C;  1JWD A;  1PAL A;  3JTD C;  4HRG A;  4NDB A;  1F71 A;  1FI6 A;  1M46 A;  2JNX A;  1SCV A;  1CFD A;  1XO5 A;  2E6W A;  3LL8 B;  1MF8 B;  1NPQ A;  1CMG A;  3SIB A;  2M7L A;  1A75 B;  3CWG A;  2VRG A;  3DVJ A;  4NQG A;  2K7D A;  2K2A A;  1ZAC A;  4N1G A;  3SJS A;  1QLK A;  1DGU A;  4QJ5 B;  2DOQ A;  2M0R A;  1WLM A;  4OCI A;  5AEQ A;  1Y0V H;  1JBA A;  1Y1A A;  3OB2 B;  1UHJ A;  5J3X A;  3IF7 A;  3O78 A;  4PE1 A;  2MLE C;  4I5L B;  3A4U B;  1G33 A;  5ER5 A;  4GGN A;  1A29 A;  2BBM A;  1EJ3 A;  4CFR A;  3CR5 X;  3TDU A;  1TNQ A;  3I5H C;  3KEV A;  5HKZ A;  2KDH A;  4PE0 A;  2A4J A;  1Y6W A;  4CID A;  2TN4 A;  2RGI A;  3TUY C;  2KAY A;  1M39 A;  2JQ6 A;  1JF0 A;  1KFX L;  1OZO A;  3QRX A;  4USL A;  4C0K A;  4PHJ A;  2KQ6 A;  5AXI A;  3K21 A;  4BY5 A;  1RK9 A;  1UWO A;  3D0Y B;  4C0J A;  1NSH A;  1X02 A;  1OMR A; 
#chains in the Genus database with same CATH topology
 2KLE A;  2BAP A;  3GK1 A;  1SSE B;  2D8N A;  1C3Y A;  4KYN A;  1MHO A;  1KCY A;  1J55 A;  3KPX A;  1F55 A;  2JNF A;  1OOG A;  2ZRS A;  2M8U A;  1DJX A;  2KHN A;  5F6T A;  1QX5 B;  3D75 A;  3SS5 A;  1DF0 B;  2M1U A;  5D3O A;  3DVE A;  1BOD A;  2JTT A;  3CLN A;  4JKT A;  4AQI A;  2LCP A;  3CR4 X;  3R1O A;  5IBW A;  1WDC C;  1YRT B;  2CXJ A;  2KGR A;  3PFV A;  1SL7 A;  2LC5 A;  5CSJ A;  3VRQ A;  4NDD A;  4AOM A;  1W7J B;  3GOF A;  3SG4 A;  1MUX A;  2P70 A;  1SYM A;  4AQJ A;  1Q80 A;  2HET A;  3FE8 A;  1Z2C B;  1TTX A;  2KLD A;  1TWO A;  1ODB A;  1SCM B;  2EGD A;  5KTY A;  1BLQ A;  4L9M A;  1IWQ A;  2L4I A;  2ZN8 A;  1S6I A;  1V1F A;  1PVA A;  2NZ0 A;  4ORC B;  1S6J A;  4C0L A;  3K1E A;  4MRX A;  3I5G B;  3VRP A;  1E8A A;  2JXC A;  2WCM A;  3I5F B;  1IJ5 A;  3SG2 A;  3JTD B;  1B8L A;  1BF5 A;  3CR2 A;  3MSE B;  2WOS A;  1PUL A;  5FI2 A;  3PN7 C;  5KU1 A;  1SMG A;  4ICB A;  1XA5 A;  1CMF A;  3OB1 B;  3B86 A;  1MQ1 A;  1ZMZ A;  1KSO A;  2F8P A;  3AAK A;  1QS7 A;  3PM2 A;  4QJ3 B;  4YGB B;  1C07 A;  1AK8 A;  3SIA A;  1IKU A;  3KO0 A;  1QIW A;  1B8R A;  4MN0 A;  1IJ6 A;  1CLL A;  2KQY A;  4GBA A;  1WRL A;  4PHN A;  2QPT A;  5FYX A;  1KWO C;  1HT9 A;  3SS4 A;  2LHI A;  2KAX A;  1YTZ C;  2OTG B;  2JTZ A;  2LVI A;  1ZOT B;  2WC5 A;  1UHI A;  1DJZ A;  1S36 A;  3AAJ A;  4CLN A;  2H2K A;  1KK8 C;  2Q4U A;  1S26 D;  3DF0 B;  1DC1 A;  3D73 A;  1CKK A;  1LVC D;  4PAL A;  1YX7 A;  2LHL A;  4YRU A;  2KFG A;  1D1O A;  1B47 A;  3FIA A;  3I5H B;  1VRK A;  1QVI Z;  1IG5 A;  1IGV A;  1NYA A;  5DKN A;  4TNC A;  1Y1X A;  1DJY A;  2LMT A;  1K9U A;  1BOC A;  5G08 A;  1DJG A;  1OW4 A;  3TUY B;  1MWN A;  3BOW A;  3NSK A;  1OQP A;  3L4A A;  2F3Y A;  3UO9 A;  1KFU L;  3M0W A;  4JWQ A;  1BG1 A;  1QX2 A;  5DKR A;  4A4B A;  1N65 A;  2PMY A;  3LCP C;  1XFX O;  2WC6 A;  3S0F A;  1AJ4 A;  1BR4 B;  2B1U A;  1K2H A;  4YGE B;  1YUT A;  3RLZ A;  2L5X B;  1TCF A;  4WRI A;  2LUX A;  1W7I B;  1TNX A;  4YI9 A;  2SCP A;  4F7F A;  2M1K B;  1UUR A;  2K7B A;  3CZ1 A;  4MZJ A;  3WXA A;  1AJ5 A;  3BFA A;  3AKB A;  1CNP A;  3BYA A;  4MBE A;  2I7A A;  2KI4 C;  1JC2 A;  1BJF A;  1T14 A;  4XJK A;  3TDI A;  2M7N A;  2JPO A;  2KGB C;  3Q8I A;  1SY9 A;  2M49 B;  4GGF C;  1MXE A;  3AKA A;  4FTG A;  2GGM A;  2WCB A;  3H4S E;  2KNE A;  5JOL A;  1OOI X;  4HRE E;  1PSB A;  2KBM A;  1YR5 A;  1L2O C;  1U5I B;  2F3Z A;  2LP2 A;  1SL8 A;  4GGF A;  2PVB A;  3EK4 A;  1SNL A;  1WRZ A;  2Y1M A;  4CPV A;  1SW8 A;  1S5G Y;  1FPW A;  1GM0 A;  2M29 A;  1AHR A;  1DEL A;  3ZWH A;  2PQL A;  1LS8 A;  4INW A;  1SR6 C;  1B7T Z;  2Y4Q A;  5HKW A;  2F2P A;  1PVB A;  5I8N A;  5AAN A;  3BUO B;  5HKY A;  4YGA A;  1K95 A;  2FCD A;  4PCW A;  2V53 A;  3ICB A;  2KPH A;  3EKH A;  3NXA A;  1PK0 D;  4M2O A;  1B1G A;  4N5X A;  4WQ3 A;  2MJW B;  1KWO B;  1L7Z A;  1OOH A;  4DUQ A;  1A03 A;  1JSA A;  3SG3 A;  2NCO A;  3O4X A;  1QXP A;  3LK0 A;  2Y5I A;  2KI6 C;  1IRJ A;  3PAL A;  3IQQ A;  1KK8 B;  1PSR A;  2HQW A;  1DMO A;  1F4Q A;  4ORA B;  5D7F A;  1WLZ A;  1FW4 A;  3R1P A;  2ZRT A;  1JFJ A;  3PSR A;  2LAP A;  5I2L A;  2WCJ A;  1F8H A;  1CB1 A;  1M63 B;  4PHK A;  2LLT A;  3VRN A;  1Z4H A;  2EHB A;  2H8V A;  2I94 A;  2BKI B;  1REC A;  3WHT B;  1F70 A;  3I5I C;  2O5G A;  1G4Y R;  3DXL A;  4M2P A;  1QV0 A;  1NX3 A;  2L2E A;  3OP0 A;  5GQQ C;  2MBX A;  4MSP A;  3S0D A;  1JFK A;  2K7O A;  1YRU B;  1W9Z A;  1YVH A;  2JUL A;  1CFC A;  2LVV A;  3NHT A;  1NX1 A;  3BFB A;  3JVT C;  2M9G A;  1YX8 A;  4MZK A;  3TDZ A;  2JT8 A;  1YUS A;  2L4H A;  3CZ2 A;  1BT6 A;  1K94 A;  1SL9 A;  2WCF A;  1RTP 1;  3DD4 A;  2F2O A;  1BMO A;  1KFU S;  1XFY O;  1B4C A;  5I94 A;  2MHH A;  1DJH A;  1OMD A;  1QAT A;  4U8D A;  2H61 C;  1R2U A;  2AAO A;  4QJ4 B;  5K89 A;  2KI4 B;  2BNX A;  2LLU A;  1C7V A;  1QTX A;  4E68 A;  1NX2 A;  1WY9 A;  2ZNE A;  2JC2 A;  1DJI A;  4HRH A;  1OSA A;  1HQV A;  1EXR A;  1S6C A;  5TNC A;  2H61 A;  3GK4 X;  3DVK A;  1J7Q A;  1P28 A;  1C3Z A;  1L2O B;  4CFQ A;  3OHM B;  4XYN A;  1A75 A;  2EC6 C;  3BUW B;  3D78 A;  5D69 A;  4ZCV A;  4ETO A;  2LVJ A;  3B7A A;  1H8B A;  3DY9 A;  3SS3 A;  4YGC B;  1JF2 A;  3R1V A;  1LA3 A;  1IQ3 A;  1GJY A;  1LA0 A;  4OVN F;  1DGV A;  5PAL A;  1S3P A;  1XVJ A;  1J1E A;  1GQM A;  2FJY A;  2K0J A;  5DKQ A;  1J7P A;  2ERB A;  1TUZ A;  1CLB A;  1QWV A;  1RJV A;  1DQE A;  1MR8 A;  2AUC A;  1SKT A;  2BE4 A;  3RZS A;  3O2P A;  1BR1 B;  2K8M B;  5HL1 A;  2GGZ A;  1XFR A;  1M31 A;  1M45 A;  1NP8 A;  1TN4 A;  3NHI A;  4MVF A;  2BKH B;  4Q04 A;  1TNP A;  1H4B A;  2E30 A;  2PRU A;  4R1E A;  2I2R E;  3VRR A;  1B8C A;  1TOP A;  2FOT A;  2PAS A;  3L4L A;  1NIW A;  2L50 A;  3L47 A;  4ZCU A;  1C7W A;  1CDN A;  1YVL A;  2M3W A;  4OZD A;  3D0Y A;  1KFX S;  5JJG A;  1EG3 A;  3EK8 A;  1QJT A;  2MLF C;  1XYD A;  2MAZ A;  1FBV A;  3PJI A;  1V1G A;  2BL0 C;  4INX A;  1K90 D;  1RFJ A;  2WCE A;  1LIN A;  2WCH A;  2ZN9 A;  1BU3 A;  4YGD B;  1WDC B;  3KF9 A;  2QAC A;  5B8I B;  2K7C A;  2M97 A;  3BXK A;  1DF0 A;  1IQ5 A;  2YGU A;  5HLV A;  1WRK A;  2CBL A;  2LM5 A;  2QEO A;  1UHN A;  2R2I A;  2KAV A;  3V2L A;  4I5N B;  2L51 A;  2F33 A;  1ZFS A;  3BUN B;  3O6B A;  3VGO A;  2KFF A;  1AP4 A;  1NX0 A;  3D10 A;  2MRD A;  1TNW A;  1N2D A;  1CFP A;  4D1E A;  2ZFD A;  2OS8 C;  2WCL A;  3I5G C;  3FE9 A;  1DJW A;  1F54 A;  2K60 A;  4MRY A;  5AER A;  1CLM A;  3CDN A;  3OX6 A;  3LK1 A;  1UP5 A;  3TZ1 A;  5BPJ A;  2LP3 A;  3PN7 B;  1LKJ A;  3CZT X;  2BBN A;  4PE7 A;  3WNX B;  3EVU A;  1A4P A;  1CTR A;  1OOJ A;  4PHM A;  3WHU B;  2OPO A;  4P5O E;  2O60 A;  2LUC A;  3EVV A;  1K9K A;  3TS5 C;  1LXF C;  2JT3 A;  2NCP A;  4WQ2 A;  1TIZ A;  1ALW A;  2OTG C;  1J7R A;  3VB1 A;  1OOF A;  2EC6 B;  3HCM A;  1KQM C;  3B88 A;  3QME A;  2KBI A;  3CS1 A;  3DVM A;  1DTL A;  3F45 A;  1K96 A;  1N0Y A;  1G8I A;  1UHH A;  2CNP A;  3O4Y A;  2L0P A;  2BE6 A;  2JOJ A;  1QVI Y;  3BOW B;  1ALV A;  2ISD A;  1XFZ O;  3B6X A;  2HQ8 A;  4DRW A;  3KHE A;  2LMV A;  2LE9 B;  2P6B B;  3DF0 A;  3HX4 A;  3S0B A;  5I2Q A;  1Y1U A;  3SG7 A;  1IIO A;  3SG6 A;  4F0Z B;  1PRW A;  1QV1 A;  1QAS A;  2BCA A;  1CDM A;  2WND A;  1NCX A;  3CYZ A;  3S0E A;  1KK7 Z;  1J1D A;  5CPV A;  2LAN A;  1SPY A;  3IQO A;  1AUI B;  1CM4 A;  4PT1 A;  5AFP A;  2QEB A;  2HPS A;  4JPZ B;  3S0A A;  2Q91 A;  1K93 D;  3EVR A;  2K2F A;  2PYQ A;  4IL1 A;  1OMV A;  1XFV O;  1KSM A;  3D74 A;  3C1V A;  1QLS A;  1QX7 A;  2L98 A;  2JPT A;  4NDC A;  1XFU O;  1GGW A;  2LV7 A;  1RWY A;  4GPL B;  1R6P A;  3B87 A;  2KYF A;  3LLE A;  5KSZ A;  1YUU A;  4XJK B;  1J7O A;  1OE9 B;  1NCZ A;  2WC8 A;  1QIV A;  3E3R A;  3A8R A;  4JD9 A;  5CSN A;  4M2Q A;  1XK4 C;  2LVK A;  2JXL A;  2BL0 B;  2JZI A;  1SRA A;  4DS7 A;  2HF5 A;  2FCE A;  3EG5 B;  2LNK A;  4YI8 A;  1UUS A;  3ZNI A;  2KI6 D;  3VRO A;  1CM1 A;  2KSP A;  4DCK A;  3FWC A;  1CDL A;  2I18 A;  1XK4 A;  3NSO A;  3PAT A;  4IJ7 A;  4MEW A;  2AMI A;  1FI5 A;  2G2B A;  3NSI A;  4UPG A;  2PAL A;  2JWW A;  2OS8 B;  4PE4 A;  1DVI A;  1JUO A;  5FI6 A;  2PSR A;  1YUR A;  2CCM A;  2JT0 A;  3UNW A;  1CFF A;  4GAO A;  4GNK B;  1S1E A;  5CSF A;  1U5I A;  1S5G Z;  3EK7 A;  1CDP A;  1TCO B;  4GFT A;  3NSL A;  2GV5 A;  1F4O A;  3R72 A;  4HSZ A;  3CTN A;  1B7T Y;  4YBH B;  5HLO A;  2ZKM X;  1OZS A;  2FJU B;  1IH0 A;  2L5Y A;  1SR6 B;  3N7H A;  1UHK A;  2KYC A;  2SAS A;  2NLN A;  4FQO A;  1EL4 A;  4A4C A;  2CTN A;  3PM8 A;  5HYD A;  3TS5 B;  1NUB A;  4ORB B;  1DT7 B;  1SBJ A;  2LMU A;  4OR9 B;  4I5K A;  2NXQ A;  1SK6 D;  2KFH A;  4JQ0 D;  1KQM B;  3FS7 A;  3FWB A;  2ZND A;  1NCY A;  4OKH A;  3GK2 A;  2COL B;  2GTE A;  2JU0 A;  4PDZ A;  1FF1 A;  4I5J A;  4MZL A;  1A2X A;  4P2Y B;  1EH2 A;  3BUM B;  4OV2 A;  3CGA A;  1KQV A;  1B9A A;  4GUK A;  2MA2 A;  4N1F A;  1KK7 Y;  2IS9 A;  3CAB A;  2G9B A;  5CSI A;  3BQ3 A;  2CT9 A;  2JRF A;  1XFW O;  3BUX B;  3I5I B;  1EG4 A;  1DEK A;  5ER4 X;  2QDI A;  3SG5 A;  2BCB A;  3EKJ A;  3RM1 A;  3BJH A;  1TRF A;  1NWD A;  2WOR A;  3D77 A;  2BCX A;  1SCM C;  3PLF B;  1AVS A;  2Y1N A;  3JVT B;  3OX5 A;  5DIC A;  2LLS A;  1TUJ A;  2WCK A;  1MXL C;  2K61 A;  3DYE A;  1GGZ A;  4MLW A;  2BEC A;  5I2O A;  1RRO A;  4BY4 A;  1K8U A;  2KOT A;  3BFH A;  1ZUZ A;  4DIR A;  1K9P A;  3I5F C;  1JWD A;  1PAL A;  3JTD C;  4HRG A;  4NDB A;  1F71 A;  1FI6 A;  1M46 A;  2JNX A;  1SCV A;  1CFD A;  1XO5 A;  2E6W A;  2QEV A;  1MF8 B;  1NPQ A;  3LL8 B;  3OGN A;  1CMG A;  3SIB A;  2M7L A;  1A75 B;  3CWG A;  2VRG A;  3DVJ A;  4NQG A;  2K7D A;  2K2A A;  1ZAC A;  4N1G A;  5FI7 A;  3OBV A;  3SJS A;  1QLK A;  3DZT A;  1DGU A;  4QJ5 B;  2DOQ A;  2M0R A;  1WLM A;  4OCI A;  2QEH A;  1Y0V H;  5AEQ A;  1Y1A A;  3OB2 B;  1UHJ A;  5J3X A;  1JBA A;  3IF7 A;  3O78 A;  4PE1 A;  2MLE C;  4I5L B;  3A4U B;  1G33 A;  5ER5 A;  4GGN A;  1ORG A;  1A29 A;  2BBM A;  1EJ3 A;  3D76 A;  3CR5 X;  4CFR A;  3TDU A;  3FE6 A;  1TNQ A;  3I5H C;  3KEV A;  5EL2 A;  5HKZ A;  2KDH A;  4PE0 A;  2A4J A;  3IVT A;  1Y6W A;  2P71 A;  4CID A;  2TN4 A;  2RGI A;  3NGV A;  2KAY A;  3S0G A;  3TUY C;  1M39 A;  2JQ6 A;  1JF0 A;  1KFX L;  1OZO A;  3QRX A;  4USL A;  4C0K A;  3CZ0 A;  4PHJ A;  2KQ6 A;  5AXI A;  2L2C A;  3K21 A;  4BY5 A;  4FQT A;  1RK9 A;  1UWO A;  3D0Y B;  4C0J A;  1NSH A;  1X02 A;  1OMR A; 
#chains in the Genus database with same CATH homology
 1KCY A;  3GK1 A;  2D8N A;  1MHO A;  1J55 A;  3KPX A;  1F55 A;  2JNF A;  2ZRS A;  2M8U A;  1DJX A;  2KHN A;  5F6T A;  1QX5 B;  1DF0 B;  2M1U A;  3DVE A;  2JTT A;  3CLN A;  4AQI A;  2LCP A;  3CR4 X;  5IBW A;  1WDC C;  1YRT B;  2CXJ A;  2KGR A;  3PFV A;  1SL7 A;  2LC5 A;  5CSJ A;  3VRQ A;  4NDD A;  4AOM A;  1W7J B;  3GOF A;  3SG4 A;  1MUX A;  1SYM A;  4AQJ A;  1Q80 A;  2HET A;  1TTX A;  1ODB A;  1SCM B;  2EGD A;  5KTY A;  1BLQ A;  4L9M A;  1IWQ A;  2L4I A;  2ZN8 A;  1S6I A;  1V1F A;  1PVA A;  2NZ0 A;  4ORC B;  1S6J A;  4C0L A;  4MRX A;  3I5G B;  3VRP A;  1E8A A;  2JXC A;  3I5F B;  1IJ5 A;  3SG2 A;  3JTD B;  1B8L A;  1BF5 A;  3CR2 A;  3MSE B;  2WOS A;  1PUL A;  3PN7 C;  5KU1 A;  1SMG A;  4ICB A;  1XA5 A;  1CMF A;  3OB1 B;  1MQ1 A;  1ZMZ A;  1KSO A;  2F8P A;  3AAK A;  1QS7 A;  4QJ3 B;  4YGB B;  1C07 A;  1AK8 A;  3SIA A;  1IKU A;  3KO0 A;  1QIW A;  1B8R A;  4MN0 A;  1IJ6 A;  1CLL A;  2KQY A;  4GBA A;  1WRL A;  4PHN A;  2QPT A;  5FYX A;  1KWO C;  1HT9 A;  2LHI A;  2KAX A;  1YTZ C;  2OTG B;  2JTZ A;  2LVI A;  1ZOT B;  1UHI A;  1DJZ A;  1S36 A;  3AAJ A;  4CLN A;  2H2K A;  1KK8 C;  2Q4U A;  1S26 D;  3DF0 B;  1CKK A;  1LVC D;  4PAL A;  1YX7 A;  2LHL A;  4YRU A;  2KFG A;  1D1O A;  1B47 A;  3FIA A;  3I5H B;  1VRK A;  1QVI Z;  1IG5 A;  1IGV A;  1NYA A;  5DKN A;  4TNC A;  1Y1X A;  1DJY A;  2LMT A;  1K9U A;  1BOC A;  5G08 A;  1DJG A;  3TUY B;  1MWN A;  3BOW A;  3NSK A;  1OQP A;  2F3Y A;  1KFU L;  3M0W A;  4JWQ A;  1BG1 A;  1QX2 A;  5DKR A;  4A4B A;  1N65 A;  2PMY A;  3LCP C;  1XFX O;  1AJ4 A;  1BR4 B;  2B1U A;  1K2H A;  4YGE B;  1YUT A;  3RLZ A;  2L5X B;  1TCF A;  4WRI A;  2LUX A;  1W7I B;  1TNX A;  4YI9 A;  2SCP A;  2M1K B;  1UUR A;  2K7B A;  4MZJ A;  3WXA A;  1AJ5 A;  3AKB A;  1CNP A;  3BYA A;  4MBE A;  2I7A A;  2KI4 C;  1JC2 A;  1BJF A;  4XJK A;  3TDI A;  2M7N A;  2KGB C;  1SY9 A;  2M49 B;  4GGF C;  1MXE A;  3AKA A;  4FTG A;  2GGM A;  2WCB A;  3H4S E;  2KNE A;  5JOL A;  4HRE E;  1PSB A;  2KBM A;  1YR5 A;  1L2O C;  1U5I B;  2F3Z A;  2LP2 A;  1SL8 A;  4GGF A;  2PVB A;  3EK4 A;  1SNL A;  1WRZ A;  2Y1M A;  4CPV A;  1SW8 A;  1S5G Y;  1FPW A;  2M29 A;  1AHR A;  3ZWH A;  1SR6 C;  1B7T Z;  2Y4Q A;  5HKW A;  2F2P A;  1PVB A;  5I8N A;  5AAN A;  3BUO B;  5HKY A;  4YGA A;  1K95 A;  2FCD A;  4PCW A;  2V53 A;  3ICB A;  3EKH A;  3NXA A;  1PK0 D;  4M2O A;  1B1G A;  4N5X A;  4WQ3 A;  2MJW B;  1KWO B;  1L7Z A;  1A03 A;  4DUQ A;  1JSA A;  3SG3 A;  2NCO A;  1QXP A;  3LK0 A;  2Y5I A;  2KI6 C;  1IRJ A;  3PAL A;  3IQQ A;  1KK8 B;  1PSR A;  2HQW A;  1DMO A;  1F4Q A;  4ORA B;  5D7F A;  1WLZ A;  1FW4 A;  2ZRT A;  1JFJ A;  3PSR A;  2LAP A;  5I2L A;  1F8H A;  1CB1 A;  1M63 B;  4PHK A;  2LLT A;  3VRN A;  2EHB A;  2I94 A;  2BKI B;  1REC A;  3WHT B;  1F70 A;  3I5I C;  2O5G A;  1G4Y R;  4M2P A;  2MBX A;  1QV0 A;  1NX3 A;  2L2E A;  3OP0 A;  5GQQ C;  4MSP A;  1JFK A;  2K7O A;  1YRU B;  1YVH A;  2JUL A;  1CFC A;  2LVV A;  1NX1 A;  3JVT C;  2M9G A;  1YX8 A;  4MZK A;  3TDZ A;  2JT8 A;  1YUS A;  2L4H A;  1BT6 A;  1K94 A;  1SL9 A;  2WCF A;  1RTP 1;  3DD4 A;  2F2O A;  1BMO A;  1KFU S;  1XFY O;  1B4C A;  2MHH A;  1DJH A;  1OMD A;  1QAT A;  4U8D A;  2H61 C;  1R2U A;  2AAO A;  4QJ4 B;  5K89 A;  2KI4 B;  2LLU A;  1C7V A;  1QTX A;  4E68 A;  1NX2 A;  1WY9 A;  2ZNE A;  2JC2 A;  1DJI A;  4HRH A;  1OSA A;  1HQV A;  1EXR A;  1S6C A;  5TNC A;  2H61 A;  3GK4 X;  3DVK A;  1J7Q A;  1L2O B;  4CFQ A;  3OHM B;  4XYN A;  1A75 A;  2EC6 C;  3BUW B;  5D69 A;  4ETO A;  4ZCV A;  1BOD A;  2LVJ A;  1H8B A;  4YGC B;  1JF2 A;  1LA3 A;  1IQ3 A;  1GJY A;  1LA0 A;  4OVN F;  1DGV A;  5PAL A;  1S3P A;  1XVJ A;  1J1E A;  1GQM A;  2K0J A;  5DKQ A;  1J7P A;  1CLB A;  1RJV A;  2AUC A;  1MR8 A;  2BE4 A;  1SKT A;  3O2P A;  1BR1 B;  2K8M B;  2GGZ A;  1M45 A;  1M31 A;  1NP8 A;  1TN4 A;  4MVF A;  4Q04 A;  2BKH B;  1TNP A;  1H4B A;  2E30 A;  2PRU A;  4R1E A;  2I2R E;  3VRR A;  1B8C A;  1TOP A;  2FOT A;  2PAS A;  1NIW A;  2L50 A;  4ZCU A;  1C7W A;  1CDN A;  1YVL A;  2M3W A;  3D0Y A;  1KFX S;  5JJG A;  1EG3 A;  3EK8 A;  1QJT A;  2MLF C;  1XYD A;  2MAZ A;  1FBV A;  1V1G A;  2BL0 C;  1K90 D;  1RFJ A;  2WCE A;  1LIN A;  2ZN9 A;  1BU3 A;  4YGD B;  1WDC B;  3KF9 A;  2QAC A;  5B8I B;  2K7C A;  2M97 A;  3BXK A;  1DF0 A;  1IQ5 A;  5HLV A;  1WRK A;  2CBL A;  2LM5 A;  2R2I A;  1UHN A;  2KAV A;  4I5N B;  2L51 A;  2F33 A;  1ZFS A;  3BUN B;  3O6B A;  3VGO A;  2KFF A;  1AP4 A;  1NX0 A;  3D10 A;  2MRD A;  1TNW A;  1N2D A;  1CFP A;  4D1E A;  2ZFD A;  2OS8 C;  3I5G C;  1DJW A;  1F54 A;  4MRY A;  5AER A;  1CLM A;  3OX6 A;  3TZ1 A;  3LK1 A;  1UP5 A;  5BPJ A;  2LP3 A;  3PN7 B;  1LKJ A;  3CZT X;  2BBN A;  4PE7 A;  3WNX B;  3EVU A;  1A4P A;  1CTR A;  1OOJ A;  4PHM A;  3WHU B;  2OPO A;  4P5O E;  2O60 A;  2LUC A;  3EVV A;  1K9K A;  3TS5 C;  1LXF C;  2JT3 A;  2NCP A;  4WQ2 A;  1TIZ A;  1ALW A;  2OTG C;  1J7R A;  2EC6 B;  3HCM A;  1KQM C;  2KBI A;  3CS1 A;  3DVM A;  1DTL A;  3F45 A;  1K96 A;  1N0Y A;  1G8I A;  1UHH A;  2CNP A;  3O4Y A;  2L0P A;  2BE6 A;  2JOJ A;  1QVI Y;  3BOW B;  1ALV A;  2ISD A;  1XFZ O;  2HQ8 A;  4DRW A;  3KHE A;  2LMV A;  2LE9 B;  2P6B B;  3DF0 A;  3HX4 A;  5I2Q A;  1Y1U A;  3SG7 A;  3SG6 A;  4F0Z B;  1PRW A;  2BCA A;  1QAS A;  1QV1 A;  1CDM A;  2WND A;  1NCX A;  1KK7 Z;  1J1D A;  5CPV A;  2LAN A;  1SPY A;  3IQO A;  1AUI B;  1CM4 A;  5AFP A;  4JPZ B;  2HPS A;  2Q91 A;  1K93 D;  3EVR A;  2K2F A;  4IL1 A;  1OMV A;  1XFV O;  1KSM A;  3C1V A;  1QLS A;  1QX7 A;  2L98 A;  2JPT A;  4NDC A;  1XFU O;  1GGW A;  2LV7 A;  1RWY A;  4GPL B;  1R6P A;  3LLE A;  2KYF A;  5KSZ A;  1YUU A;  4XJK B;  1J7O A;  1OE9 B;  1NCZ A;  2WC8 A;  1QIV A;  3E3R A;  3A8R A;  5CSN A;  4M2Q A;  1XK4 C;  2LVK A;  2JXL A;  2BL0 B;  2JZI A;  1SRA A;  4DS7 A;  2HF5 A;  2FCE A;  2LNK A;  4YI8 A;  1UUS A;  3ZNI A;  2KI6 D;  3VRO A;  1CM1 A;  2KSP A;  4DCK A;  3FWC A;  1CDL A;  2I18 A;  1XK4 A;  3NSO A;  3PAT A;  4MEW A;  2AMI A;  1FI5 A;  2G2B A;  3NSI A;  4UPG A;  2PAL A;  2JWW A;  2OS8 B;  4PE4 A;  1DVI A;  1JUO A;  2PSR A;  1YUR A;  2CCM A;  2JT0 A;  1CFF A;  4GAO A;  4GNK B;  1S1E A;  5CSF A;  1U5I A;  1S5G Z;  3EK7 A;  1CDP A;  1TCO B;  4GFT A;  3NSL A;  2GV5 A;  1F4O A;  4HSZ A;  3CTN A;  1B7T Y;  4YBH B;  5HLO A;  2ZKM X;  1OZS A;  2FJU B;  1IH0 A;  1SR6 B;  1UHK A;  2KYC A;  2SAS A;  2NLN A;  4FQO A;  1EL4 A;  4A4C A;  2CTN A;  3PM8 A;  5HYD A;  3TS5 B;  1NUB A;  4ORB B;  1DT7 B;  1SBJ A;  2LMU A;  4OR9 B;  4I5K A;  2NXQ A;  1SK6 D;  2KFH A;  4JQ0 D;  1KQM B;  3FS7 A;  3FWB A;  2ZND A;  1NCY A;  4OKH A;  3GK2 A;  2COL B;  2JU0 A;  4PDZ A;  1FF1 A;  4I5J A;  4MZL A;  1A2X A;  4P2Y B;  1EH2 A;  3BUM B;  4OV2 A;  3CGA A;  1KQV A;  1B9A A;  4GUK A;  2MA2 A;  4N1F A;  1KK7 Y;  2IS9 A;  2G9B A;  5CSI A;  3BQ3 A;  2CT9 A;  2JRF A;  1XFW O;  3BUX B;  3I5I B;  1EG4 A;  5ER4 X;  3SG5 A;  2BCB A;  3EKJ A;  3RM1 A;  1TRF A;  1NWD A;  2WOR A;  3PLF B;  2BCX A;  1SCM C;  1AVS A;  2Y1N A;  3JVT B;  3OX5 A;  2LLS A;  1MXL C;  2K61 A;  4MLW A;  1GGZ A;  5I2O A;  2BEC A;  1RRO A;  4BY4 A;  1K8U A;  2KOT A;  1ZUZ A;  4DIR A;  1K9P A;  3I5F C;  1JWD A;  1PAL A;  3JTD C;  4HRG A;  4NDB A;  1F71 A;  1FI6 A;  1M46 A;  2JNX A;  1SCV A;  1CFD A;  1XO5 A;  2E6W A;  3LL8 B;  1MF8 B;  1NPQ A;  1CMG A;  3SIB A;  2M7L A;  1A75 B;  3CWG A;  2VRG A;  3DVJ A;  4NQG A;  2K7D A;  2K2A A;  1ZAC A;  4N1G A;  3SJS A;  1QLK A;  1DGU A;  4QJ5 B;  2DOQ A;  2M0R A;  1WLM A;  4OCI A;  5AEQ A;  1Y0V H;  1JBA A;  1Y1A A;  3OB2 B;  1UHJ A;  5J3X A;  3IF7 A;  3O78 A;  4PE1 A;  2MLE C;  4I5L B;  3A4U B;  1G33 A;  5ER5 A;  4GGN A;  1A29 A;  2BBM A;  1EJ3 A;  4CFR A;  3CR5 X;  3TDU A;  1TNQ A;  3I5H C;  3KEV A;  5HKZ A;  2KDH A;  4PE0 A;  2A4J A;  1Y6W A;  4CID A;  2TN4 A;  2RGI A;  3TUY C;  2KAY A;  1M39 A;  2JQ6 A;  1JF0 A;  1KFX L;  1OZO A;  3QRX A;  4USL A;  4C0K A;  4PHJ A;  2KQ6 A;  5AXI A;  3K21 A;  4BY5 A;  1RK9 A;  1UWO A;  3D0Y B;  4C0J A;  1NSH A;  1X02 A;  1OMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...