1FI6A

Solution structure of the reps1 eh domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
92
structure length
92
Chain Sequence
WKITDEQRQYYVNQFKTIQPDLNGFIPGSAAKEFFTKSKLPILELSHIWELSDFDKDGALTLDEFCAAFHLVVARKNGYDLPEKLPESLMPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords EH DOMAIN PROTEIN REPS1
publication title Solution structure of the Reps1 EH domain and characterization of its binding to NPF target sequences.
pubmed doi rcsb
source organism Mus musculus
total genus 21
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2000-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1fi6A00
5KSZA 5F6TA 2KOTA 3TUYC 1L7ZA 2Y4QA 1EXRA 1G8IA 1LA3A 3I5GB 1DJWA 2JXLA 1Y6WA 2ZN9A 3VRPA 1H4BA 2NZ0A 2Q91A 1K8UA 4WRIA 1AJ5A 1IRJA 2CXJA 4QJ3B 5J3XA 1LKJA 4U8DA 1QIWA 1M39A 1NWDA 1S3PA 1SCMB 1WRZA 2H2KA 4DRWA 1DGVA 3PN7B 2LUCA 1BLQA 2KGBC 2DOQA 1QLKA 2LLTA 2SCPA 4MSPA 5BPJA 5AERA 2WORA 4CLNA 1DJHA 1AP4A 1S26D 1ZACA 4MZKA 1MXLC 1DJZA 1KFXL 2KFFA 4WQ3A 1WY9A 2BCXA 2KBIA 3EKHA 1OZSA 4QJ4B 1OOJA 4N1GA 2M1UA 3OX5A 4GGFA 2WCBA 1BJFA 1ODBA 1WLZA 1CNPA 1WDCC 2QACA 1YRUB 1SPYA 2H61C 1NIWA 2KYCA 1KK7Y 2M97A 1J7PA 2EGDA 1KFUS 1XK4C 1NCXA 4YI8A 1KWOC 3CR2A 2I7AA 2LANA 2WOSA 4M2PA 4YRUA 1SL9A 1BT6A 3NSOA 1D1OA 1VRKA 2NLNA 4IL1A 5ER4X 2WC8A 3SG4A 1H8BA 1DTLA 2JT3A 2E6WA 1QATA 2GGMA 4GNKB 1DJIA 1KK8B 1EG3A 5CSIA 4CIDA 3DD4A 1ZFSA 1F55A 1SNLA 1GJYA 2LUXA 1BODA 1CLLA 3LK0A 5B8IB 3CR4X 1QTXA 3I5GC 1PK0D 1K93D 1SYMA 2LE9B 4M2OA 2TN4A 1YTZC 1AJ4A 1QJTA 1PSBA 1BF5A 1XYDA 1FF1A 1J55A 1LVCD 3SG2A 2FCEA 1FI6A 1B7TY 1SCVA 5ER5A 2P6BB 3I5FB 1B8LA 4ICBA 2G2BA 1ZMZA 3AKAA 1EH2A 1KFUL 1K9KA 3O2PA 4I5KA 1DJGA 2M9GA 4AQJA 2ZNEA 2PRUA 1UHJA 3SG5A 3FWBA 4MRXA 2I18A 5I8NA 3OP0A 1QVIZ 2M8UA 3NSLA 2Q4UA 4MLWA 3TDZA 4BY5A 1TNXA 1C7VA 2K2FA 3DVJA 5HKWA 1CM1A 4PHKA 1EL4A 1S6JA 1AUIB 1CDNA 3QRXA 1S5GZ 1AVSA 2KI6C 4XJKA 2KNEA 3H4SE 4YGAA 5CSNA 1JWDA 5JJGA 4NDCA 2M49B 2HQ8A 2B1UA 2KQYA 3CR5X 3CLNA 3EK8A 1FPWA 2KGRA 1J7RA 1G4YR 2L2EA 3BQ3A 2WCEA 4OVNF 3BYAA 3EK7A 5AANA 4MVFA 2KFHA 1B8CA 1QX5B 1TRFA 1PSRA 1KWOB 2JC2A 4PDZA 1KSOA 1AK8A 2AAOA 4YBHB 3SG3A 3LL8B 2BL0B 1CMFA 1XFUO 2JQ6A 1YR5A 3KO0A 1MF8B 3KPXA 1A75A 2HF5A 1UHIA 2HETA 3LK1A 2LMTA 5CPVA 3BUNB 3OX6A 2F3YA 3EK4A 5HKZA 2AUCA 1J1DA 1OE9B 4D1EA 4P5OE 2F3ZA 1SBJA 1LA0A 1QX2A 2CCMA 4PHMA 1B1GA 1U5IB 1CFCA 1DF0A 2A4JA 4C0LA 3F45A 3TS5C 4UPGA 1ALVA 1MR8A 1J1EA 1KK7Z 2VRGA 4PALA 1BMOA 3SG6A 4DUQA 3I5FC 1XK4A 1TN4A 1K9PA 2K7BA 1OQPA 1MQ1A 1OZOA 2Y5IA 2R2IA 4OKHA 1KQVA 3BOWA 1DT7B 2L98A 3HX4A 4AOMA 3EVVA 4HREE 2K0JA 1DMOA 1B47A 1FBVA 4GPLB 4Q04A 5K89A 1SKTA 4C0KA 1PVBA 1QV1A 1UHNA 5KTYA 2L0PA 1YURA 2KAVA 2G9BA 4DS7A 1R2UA 3EVUA 3A8RA 1G33A 1XFXO 3DVMA 2V53A 1AHRA 1S1EA 2BE6A 1C7WA 4A4BA 1CFFA 2E30A 1IQ3A 1Q80A 1IJ5A 3FWCA 2LLSA 4OCIA 2L4IA 2LM5A 1JFKA 1E8AA 2JT8A 1CKKA 2JU0A 1MWNA 1Y1XA 1B7TZ 2RGIA 1WRLA 1SL8A 1ALWA 3DVKA 1B9AA 1FW4A 1NYAA 3JTDC 1GGWA 3BUMB 2ZKMX 1XO5A 4HRGA 1M46A 1F54A 5CSFA 1K90D 3BXKA 2CBLA 2BL0C 2FCDA 5DKNA 1LINA 1XA5A 2M7NA 2K7DA 1GQMA 1UP5A 4WQ2A 1PALA 1A03A 1YRTB 3JVTB 5HLOA 4PE1A 3I5IB 3PATA 2LP2A 1K96A 1CFPA 1F70A 1X02A 3SJSA 1KCYA 2LHIA 2M3WA 4N5XA 1DJYA 1OMVA 1S6IA 2ISDA 4YGCB 1K95A 1LXFC 2D8NA 2K7CA 1YX7A 1IH0A 1SY9A 3RLZA 2K2AA 3WNXB 2JRFA 1S6CA 3BUWB 2PSRA 3DF0B 3OB2B 4MBEA 3EKJA 4OV2A 2LAPA 4DIRA 3TS5B 1GGZA 1S36A 5PALA 1UUSA 2QPTA 1NX0A 1B4CA 3FIAA 2LP3A 3KEVA 2JWWA 4YGBB 2Y1MA 1QLSA 3CWGA 4DCKA 2M29A 3D0YB 4GFTA 4PE0A 4GAOA 1K94A 2K61A 2BBNA 3MSEB 2KBMA 5D7FA 1UHKA 1PVAA 5GQQC 2LMUA 1CLBA 1QX7A 2FOTA 3WHUB 1A4PA 1Y1UA 1YVLA 2NXQA 4MZJA 5IBWA 3AKBA 2COLB 4GGFC 4YGEB 1K9UA 1A29A 1M63B 2JPTA 1DGUA 1IKUA 1WRKA 1TCFA 3SG7A 4GBAA 1QS7A 1EJ3A 1SRAA 3RM1A 2JT0A 5TNCA 2LVKA 1SW8A 4HRHA 1NCZA 2IS9A 2ZFDA 5JOLA 2MBXA 3JTDB 2MHHA 1A75B 2O5GA 3JVTC 3IQOA 2ZN8A 4JPZB 3I5IC 4OR9B 3IQQA 2K7OA 5AFPA 2LCPA 3ZNIA 2L51A 1JUOA 1J7QA 3OHMB 1RK9A 1V1GA 2HQWA 1HQVA 1DF0B 1JC2A 1YUSA 4A4CA 1NP8A 1ZOTB 4ORBB 2EC6B 2PALA 4YI9A 1DJXA 1F4QA 2JOJA 3TDIA 3VRRA 1F4OA 1N0YA 2MAZA 1OMRA 4P2YB 1TNPA 2JNXA 2H61A 5HKYA 1W7JB 2EHBA 3PSRA 5DKQA 2LLUA 1BR1B 2KSPA 1EG4A 2MJWB 1NUBA 3CTNA 3KF9A 4I5NB 4ORCB 1XVJA 4USLA 3EVRA 5G08A 3K21A 1CTRA 2FJUB 4M2QA 1BOCA 1QVIY 2F2PA 2ZRTA 4I5JA 4PCWA 3CGAA 2L4HA 2MLFC 3E3RA 2Y1NA 1UWOA 4TNCA 3O78A 5FYXA 1NSHA 4CFQA 1SR6B 4FTGA 2WCFA 2JXCA 5KU1A 1ZUZA 3TZ1A 2OPOA 4E68A 1S5GY 4PE7A 1U5IA 1B8RA 4BY4A 4QJ5B 3WXAA 1IGVA 3VGOA 1XFWO 1IG5A 1BR4B 5AEQA 4ZCVA 4NDBA 3FS7A 1F8HA 3D10A 3I5HB 2LVJA 3LLEA 2SASA 1YVHA 1NPQA 4ETOA 2ZNDA 3TDUA 1K2HA 3BUXB 3OB1B 5CSJA 1YX8A 2L50A 5I2QA 2KI4C 1JBAA 2JTTA 1MXEA 2CT9A 1OSAA 2OTGB 1SL7A 1TOPA 1NCYA 1Y1AA 4N1FA 3NSKA 3AAKA 1JF2A 3KHEA 1N65A 3GK4X 1TNWA 3PALA 1NX2A 1KQMB 1JF0A 3LCPC 2EC6C 4MN0A 1TCOB 2JNFA 4MZLA 3WHTB 4NDDA 2GGZA 1QV0A 3SIBA 1XFZO 2OS8C 1L2OB 2I94A 2LV7A 2MA2A 4R1EA 2BKIB 5AXIA 4MRYA 1QIVA 1M45A 2KYFA 2HPSA 4GUKA 5D69A 1BU3A 3O6BA 3O4YA 1NX3A 1CFDA 2MLEC 4XYNA 1R6PA 1C07A 1WLMA 2LC5A 2BCBA 1FI5A 1MHOA 3SIAA 1CM4A 5I2OA 2F8PA 1JFJA 3GOFA 2AMIA 1SR6C 1JSAA 1RWYA 2PMYA 4L9MA 2PASA 1KSMA 1M31A 3ZWHA 2KHNA 1YUUA 1RECA 4ZCUA 3CS1A 1OMDA 2ZRSA 1CDPA 2PVBA 2K8MB 3NSIA 2GV5A 4GGNA 4JQ0D 1NX1A 4NQGA 3TUYB 4XJKB 1RTP1 2BE4A 1MUXA 3DF0A 2JTZA 4AQIA 1BG1A 1TTXA 1TIZA 1SCMC 1RFJA 3I5HC 2BCAA 1TNQA 4MEWA 4F0ZB 4PE4A 2KI6D 1QXPA 1DVIA 2BECA 3HCMA 3PN7C 5HYDA 2BKHB 4ORAB 1V1FA 2F2OA 1Y0VH 1A2XA 2F33A 2L5XB 3D0YA 4YGDB 5DKRA 4CFRA 2OTGC 3VROA 3CZTX 1CDMA 2KFGA 3PFVA 1CLMA 2KI4B 3GK1A 3IF7A 1RROA 1PRWA 1QASA 1IQ5A 1KQMC 1CMGA 3BUOB 2KQ6A 3VRNA 2CNPA 2BBMA 1IJ6A 4PHJA 4PHNA 1IWQA 2KAYA 1SK6D 4CPVA 1WDCB 1SMGA 2KAXA 1L2OC 3PLFB 4HSZA 3GK2A 1CB1A 2NCOA 4FQOA 2O60A 2I2RE 2OS8B 1UURA 2LMVA 2KDHA 2WNDA 3A4UB 3BOWB 4JWQA 3NXAA 5HLVA 3M0WA 3ICBA 1PULA 2NCPA 3PM8A 2CTNA 5I2LA 2JULA 1N2DA 1CDLA 2LHLA 3DVEA 1KK8C 1RJVA 3VRQA 2M1KB 2M0RA 1KFXS 2LVVA 3AAJA 2MRDA 1XFVO 1YUTA 3C1VA 1W7IB 1HT9A 2LVIA 4I5LB 2LNKA 2M7LA 1F71A 1UHHA 1J7OA 2JZIA 4C0JA 1XFYO
chains in the Genus database with same CATH superfamily
5KSZA 3D76A 5F6TA 2KOTA 3TUYC 1L7ZA 2Y4QA 1EXRA 1G8IA 1LA3A 3I5GB 1DJWA 2JXLA 1Y6WA 2ZN9A 3VRPA 1H4BA 2NZ0A 2Q91A 1K8UA 4WRIA 1AJ5A 1IRJA 2CXJA 4QJ3B 5J3XA 1LKJA 4U8DA 1QIWA 1M39A 1NWDA 1S3PA 1SCMB 1WRZA 2H2KA 4DRWA 1DGVA 3PN7B 2LUCA 1BLQA 2KGBC 2DOQA 1QLKA 2LLTA 2SCPA 4MSPA 5BPJA 5AERA 3L4LA 2WORA 4CLNA 3R1OA 1DJHA 3PJIA 1AP4A 1S26D 1ZACA 4MZKA 1MXLC 1DJZA 1KFXL 3RZSA 2KFFA 4WQ3A 1WY9A 2BCXA 2KBIA 3EKHA 1OZSA 4QJ4B 1OOJA 2P70A 4N1GA 2M1UA 3OX5A 4GGFA 2WCBA 1BJFA 1ODBA 1DEKA 1WLZA 1CNPA 1WDCC 2QACA 1YRUB 1SPYA 3SS4A 2H61C 1NIWA 2KYCA 1KK7Y 2M97A 1J7PA 2EGDA 1KFUS 1XK4C 1NCXA 4YI8A 1KWOC 3CR2A 2I7AA 2LANA 3Q8IA 3S0AA 2L2CA 2WOSA 4M2PA 4YRUA 1SL9A 1BT6A 3B7AA 3N7HA 3NSOA 1D1OA 1VRKA 2NLNA 4IL1A 5ER4X 2JPOA 2WC8A 3SG4A 1H8BA 2K60A 1DTLA 2JT3A 2E6WA 2QEVA 1QATA 2GGMA 4GNKB 1DJIA 1KK8B 1EG3A 5CSIA 4CIDA 3DD4A 1ZFSA 1F55A 1SNLA 1GJYA 2LUXA 1BODA 1CLLA 3LK0A 1P28A 3V2LA 5B8IB 3CR4X 1QTXA 3D77A 3I5GC 1PK0D 1K93D 1SYMA 2LE9B 4M2OA 2TN4A 1YTZC 1AJ4A 1QJTA 1PSBA 1BF5A 1XYDA 1FF1A 1J55A 1LVCD 3SG2A 2FCEA 1FI6A 1B7TY 1SCVA 5ER5A 2P6BB 3I5FB 2WC6A 1B8LA 4ICBA 2G2BA 1ZMZA 3AKAA 1EH2A 2QEOA 1KFUL 1K9KA 3O2PA 4OZDA 1QWVA 4I5KA 1DJGA 2M9GA 4AQJA 2ZNEA 2PRUA 1UHJA 3SG5A 3FWBA 4MRXA 2I18A 5I8NA 3OP0A 1QVIZ 2M8UA 3NSLA 2Q4UA 4MLWA 3TDZA 4BY5A 1TNXA 1C7VA 2K2FA 3DVJA 5HKWA 1CM1A 4PHKA 1EL4A 1S6JA 1AUIB 1CDNA 3QRXA 1SSEB 3L47A 1S5GZ 1AVSA 2GTEA 2H8VA 2KI6C 4XJKA 2KNEA 3H4SE 4YGAA 5CSNA 1JWDA 5JJGA 4FQTA 4NDCA 3D74A 2M49B 2HQ8A 2B1UA 2KQYA 3CR5X 3CLNA 3EK8A 3K1EA 2KGRA 1FPWA 1J7RA 2PQLA 1G4YR 2L2EA 3BQ3A 2WCEA 4OVNF 3BYAA 3EK7A 5AANA 4MVFA 2KFHA 1B8CA 1QX5B 1TRFA 1PSRA 1KWOB 2JC2A 2QDIA 4PDZA 1KSOA 1AK8A 2AAOA 4YBHB 3SG3A 3LL8B 2BL0B 1CMFA 1XFUO 2JQ6A 1YR5A 3KO0A 1MF8B 3KPXA 1A75A 2HF5A 1UHIA 2HETA 3LK1A 4JD9A 2LMTA 2YGUA 2KPHA 5CPVA 3BUNB 3OX6A 2F3YA 3EK4A 3S0DA 5HKZA 2AUCA 1J1DA 1OE9B 4D1EA 4P5OE 2F3ZA 1SBJA 1LA0A 1QX2A 2CCMA 2WCHA 4PHMA 1U5IB 1B1GA 1CFCA 1DF0A 2A4JA 4C0LA 3F45A 3TS5C 4UPGA 1ALVA 1MR8A 1J1EA 1KK7Z 2VRGA 3CABA 1BMOA 3OBVA 4PALA 3SG6A 4DUQA 3I5FC 1XK4A 1TN4A 4IJ7A 1K9PA 2K7BA 1OW4A 1OQPA 1MQ1A 1OZOA 2Y5IA 2R2IA 4OKHA 1KQVA 3DZTA 3BOWA 1DT7B 2L98A 3HX4A 4AOMA 3EVVA 4HREE 2K0JA 1DMOA 1B47A 1FBVA 4GPLB 1DELA 4Q04A 5K89A 1SKTA 4C0KA 1PVBA 1QV1A 1UHNA 5KTYA 2L0PA 1YURA 2KAVA 2G9BA 4DS7A 1R2UA 3EVUA 3A8RA 1G33A 1XFXO 3DVMA 2V53A 1AHRA 1S1EA 2BE6A 1C3YA 1C7WA 1OOIX 4A4BA 2E30A 3CZ0A 1IQ3A 1Q80A 1CFFA 1IJ5A 3DXLA 3R1VA 3FWCA 4F7FA 2LLSA 4OCIA 2L4IA 2LM5A 1JFKA 1E8AA 2JT8A 1CKKA 2JU0A 1MWNA 1Y1XA 1B7TZ 2RGIA 1TWOA 1SL8A 1ALWA 1WRLA 3DVKA 1B9AA 1C3ZA 1FW4A 1NYAA 3JTDC 1GGWA 3BUMB 2ZKMX 1XO5A 4HRGA 1M46A 3D73A 1F54A 5CSFA 1K90D 3PM2A 3BXKA 2CBLA 2BL0C 2FCDA 5DKNA 1LINA 1XA5A 2WCKA 3UO9A 2M7NA 2K7DA 1GQMA 1UP5A 4WQ2A 1PALA 1A03A 1YRTB 3JVTB 3FE8A 5HLOA 4PE1A 3I5IB 3PATA 2LP2A 1K96A 3S0GA 1CFPA 1F70A 1X02A 3SJSA 1KCYA 2LHIA 2M3WA 4N5XA 1DJYA 1OMVA 1S6IA 2ISDA 4YGCB 3R72A 1K95A 1LXFC 2D8NA 2K7CA 3UNWA 1YX7A 1IH0A 1SY9A 3RLZA 2K2AA 3WNXB 2JRFA 1S6CA 3BUWB 2PSRA 3DF0B 3OB2B 4MBEA 3EKJA 4OV2A 2LAPA 3D75A 4DIRA 3TS5B 1GGZA 1S36A 5PALA 3QMEA 1UUSA 2QPTA 1NX0A 1B4CA 3FIAA 3DYEA 2LP3A 3KEVA 2JWWA 4YGBB 2Y1MA 1QLSA 3CWGA 4DCKA 3WHUB 2M29A 3D0YB 4GFTA 4PE0A 3NHTA 4GAOA 1T14A 1K94A 2K61A 2BBNA 3MSEB 2KBMA 5D7FA 1UHKA 1PVAA 5GQQC 2LMUA 1CLBA 1QX7A 2FOTA 3NGVA 1A4PA 1Y1UA 1YVLA 2NXQA 4MZJA 5FI6A 3AKBA 5IBWA 2COLB 4GGFC 1OOGA 4JKTA 4YGEB 1K9UA 1A29A 1M63B 2JPTA 1DGUA 1IKUA 1DQEA 1WRKA 1TCFA 3SG7A 4GBAA 1QS7A 3O4XA 1EJ3A 2L5YA 1SRAA 3RM1A 2JT0A 5TNCA 3S0BA 2LVKA 1SW8A 4HRHA 1NCZA 1Z2CB 2IS9A 2ZFDA 5JOLA 2MBXA 3JTDB 3FE9A 2MHHA 1A75B 2O5GA 3JVTC 3IQOA 2ZN8A 4JPZB 3I5IC 4OR9B 3IQQA 2K7OA 5AFPA 2LCPA 3ZNIA 4INXA 2L51A 1JUOA 1J7QA 3OHMB 1RK9A 1V1GA 1ORGA 2HQWA 1HQVA 1DF0B 1JC2A 1YUSA 4A4CA 1NP8A 1ZOTB 4ORBB 2EC6B 2PALA 4YI9A 3R1PA 1DJXA 1F4QA 2JOJA 3CZ2A 3TDIA 3VRRA 1F4OA 1N0YA 2MAZA 1OMRA 4P2YB 3B88A 1TNPA 5EL2A 2JNXA 2H61A 5HKYA 5DICA 1W7JB 2EHBA 3PSRA 5DKQA 2LLUA 1BR1B 2KSPA 1EG4A 2MJWB 1NUBA 3CTNA 3B87A 3KF9A 4I5NB 1XVJA 2ERBA 3EVRA 4ORCB 4USLA 5G08A 3K21A 1CTRA 2FJUB 4M2QA 3OGNA 1QVIY 1BOCA 2F2PA 2ZRTA 4I5JA 4PCWA 3CGAA 2L4HA 2MLFC 3E3RA 2Y1NA 1UWOA 4TNCA 3O78A 5FYXA 1NSHA 4CFQA 1SR6B 4FTGA 2WCFA 2JXCA 5KU1A 1ZUZA 3TZ1A 2WC5A 2OPOA 4E68A 1S5GY 4PE7A 1U5IA 1B8RA 4BY4A 4QJ5B 5I94A 3DY9A 3WXAA 1IGVA 1XFRA 4KYNA 1XFWO 3VGOA 1IG5A 2BNXA 1BR4B 5AEQA 4ZCVA 4NDBA 3FS7A 1F8HA 3D10A 3I5HB 2LVJA 2WCMA 3LLEA 2SASA 1YVHA 1NPQA 4ETOA 2ZNDA 3TDUA 1K2HA 2WCLA 3BUXB 3D78A 3OB1B 2KLDA 1YX8A 2L50A 5CSJA 2KI4C 5I2QA 1JBAA 2JTTA 1MXEA 2CT9A 1OSAA 2OTGB 1SL7A 1TOPA 3CZ1A 1NCYA 1Y1AA 4N1FA 3NSKA 3AAKA 1JF2A 3KHEA 1N65A 2KLEA 3GK4X 1TNWA 3PALA 1NX2A 1KQMB 1JF0A 1LS8A 3LCPC 2EC6C 4MN0A 1TUJA 1TCOB 2PYQA 3VB1A 2FJYA 2JNFA 3S0EA 4MZLA 2QEHA 3WHTB 4NDDA 2GGZA 1QV0A 3SIBA 1XFZO 2OS8C 1L2OB 2I94A 3FE6A 2LV7A 2MA2A 3NHIA 4R1EA 2BKIB 5AXIA 4MRYA 1QIVA 2BAPA 1M45A 3B6XA 3BFBA 2KYFA 2HPSA 4GUKA 5D69A 1BU3A 4PT1A 3O6BA 3O4YA 1NX3A 1CFDA 1W9ZA 2MLEC 4XYNA 1R6PA 1C07A 1WLMA 2LC5A 2BCBA 1FI5A 1MHOA 3SIAA 1CM4A 5I2OA 2F8PA 1JFJA 3GOFA 2AMIA 1SR6C 1JSAA 1RWYA 2PMYA 4L9MA 2PASA 1KSMA 1M31A 3ZWHA 2KHNA 1YUUA 1RECA 4ZCUA 3CS1A 1OMDA 2ZRSA 3SS5A 1CDPA 2PVBA 3L4AA 2K8MB 3NSIA 2GV5A 4GGNA 4JQ0D 1NX1A 4NQGA 5FI7A 3TUYB 4XJKB 3SS3A 1IIOA 1RTP1 2BE4A 1MUXA 3DF0A 2JTZA 4AQIA 1BG1A 1TTXA 1TIZA 1SCMC 1RFJA 3I5HC 2BCAA 1TNQA 4MEWA 4F0ZB 4PE4A 2KI6D 1QXPA 1DVIA 2BECA 3HCMA 3IVTA 3PN7C 4INWA 5HYDA 2BKHB 4ORAB 1V1FA 2QEBA 2F2OA 1Y0VH 3B86A 1A2XA 2F33A 2L5XB 3D0YA 4YGDB 5DKRA 4CFRA 2OTGC 3VROA 3CZTX 1CDMA 2KFGA 1OOFA 3PFVA 1CLMA 2KI4B 5FI2A 3BFAA 3GK1A 3IF7A 1RROA 1PRWA 1QASA 1IQ5A 1KQMC 1CMGA 3BUOB 2KQ6A 3VRNA 2CNPA 2BBMA 1IJ6A 4PHJA 4PHNA 1Z4HA 1IWQA 2P71A 3S0FA 2KAYA 3CDNA 1SK6D 4CPVA 1WDCB 1SMGA 2KAXA 1L2OC 2WCJA 3PLFB 4HSZA 5HL1A 3GK2A 1CB1A 2NCOA 3BFHA 1TUZA 2I2RE 2O60A 4FQOA 2OS8B 1UURA 2LMVA 2KDHA 2WNDA 3A4UB 3BOWB 1OOHA 3NXAA 4JWQA 3M0WA 3ICBA 1PULA 5HLVA 3CYZA 2NCPA 3PM8A 2CTNA 5I2LA 2JULA 1DC1A 1N2DA 1CDLA 2LHLA 3DVEA 1KK8C 1RJVA 3VRQA 2M1KB 2M0RA 1KFXS 2LVVA 3AAJA 2MRDA 1XFVO 1YUTA 3C1VA 3BJHA 1W7IB 1HT9A 2LVIA 4I5LB 2LNKA 2M7LA 1F71A 1UHHA 1J7OA 2JZIA 5D3OA 4C0JA 1XFYO 1GM0A 3EG5B
chains in the Genus database with same CATH topology
5KSZA 5F6TA 2KOTA 3TUYC 1L7ZA 2Y4QA 1EXRA 1G8IA 1LA3A 3I5GB 1DJWA 2JXLA 1Y6WA 2ZN9A 3VRPA 1H4BA 2NZ0A 2Q91A 1K8UA 4WRIA 1AJ5A 1IRJA 2CXJA 4QJ3B 5J3XA 1LKJA 4U8DA 1QIWA 1M39A 1NWDA 1S3PA 1SCMB 1WRZA 2H2KA 4DRWA 1DGVA 3PN7B 2LUCA 1BLQA 2KGBC 2DOQA 1QLKA 2LLTA 2SCPA 4MSPA 5BPJA 5AERA 2WORA 4CLNA 1DJHA 1AP4A 1S26D 1ZACA 4MZKA 1MXLC 1DJZA 1KFXL 2KFFA 4WQ3A 1WY9A 2BCXA 2KBIA 3EKHA 1OZSA 4QJ4B 1OOJA 4N1GA 2M1UA 3OX5A 4GGFA 2WCBA 1BJFA 1ODBA 1WLZA 1CNPA 1WDCC 2QACA 1YRUB 1SPYA 2H61C 1NIWA 2KYCA 1KK7Y 2M97A 1J7PA 2EGDA 1KFUS 1XK4C 1NCXA 4YI8A 1KWOC 3CR2A 2I7AA 2LANA 2WOSA 4M2PA 4YRUA 1SL9A 1BT6A 3NSOA 1D1OA 1VRKA 2NLNA 4IL1A 5ER4X 2WC8A 3SG4A 1H8BA 1DTLA 2JT3A 2E6WA 1QATA 2GGMA 4GNKB 1DJIA 1KK8B 1EG3A 5CSIA 4CIDA 3DD4A 1ZFSA 1F55A 1SNLA 1GJYA 2LUXA 1BODA 1CLLA 3LK0A 5B8IB 3CR4X 1QTXA 3I5GC 1PK0D 1K93D 1SYMA 2LE9B 4M2OA 2TN4A 1YTZC 1AJ4A 1QJTA 1PSBA 1BF5A 1XYDA 1FF1A 1J55A 1LVCD 3SG2A 2FCEA 1FI6A 1B7TY 1SCVA 5ER5A 2P6BB 3I5FB 1B8LA 4ICBA 2G2BA 1ZMZA 3AKAA 1EH2A 1KFUL 1K9KA 3O2PA 4I5KA 1DJGA 2M9GA 4AQJA 2ZNEA 2PRUA 1UHJA 3SG5A 3FWBA 4MRXA 2I18A 5I8NA 3OP0A 1QVIZ 2M8UA 3NSLA 2Q4UA 4MLWA 3TDZA 4BY5A 1TNXA 1C7VA 2K2FA 3DVJA 5HKWA 1CM1A 4PHKA 1EL4A 1S6JA 1AUIB 1CDNA 3QRXA 1S5GZ 1AVSA 2KI6C 4XJKA 2KNEA 3H4SE 4YGAA 5CSNA 1JWDA 5JJGA 4NDCA 2M49B 2HQ8A 2B1UA 2KQYA 3CR5X 3CLNA 3EK8A 1FPWA 2KGRA 1J7RA 1G4YR 2L2EA 3BQ3A 2WCEA 4OVNF 3BYAA 3EK7A 5AANA 4MVFA 2KFHA 1B8CA 1QX5B 1TRFA 1PSRA 1KWOB 2JC2A 4PDZA 1KSOA 1AK8A 2AAOA 4YBHB 3SG3A 3LL8B 2BL0B 1CMFA 1XFUO 2JQ6A 1YR5A 3KO0A 1MF8B 3KPXA 1A75A 2HF5A 1UHIA 2HETA 3LK1A 2LMTA 5CPVA 3BUNB 3OX6A 2F3YA 3EK4A 5HKZA 2AUCA 1J1DA 1OE9B 4D1EA 4P5OE 2F3ZA 1SBJA 1LA0A 1QX2A 2CCMA 4PHMA 1B1GA 1U5IB 1CFCA 1DF0A 2A4JA 4C0LA 3F45A 3TS5C 4UPGA 1ALVA 1MR8A 1J1EA 1KK7Z 2VRGA 4PALA 1BMOA 3SG6A 4DUQA 3I5FC 1XK4A 1TN4A 1K9PA 2K7BA 1OQPA 1MQ1A 1OZOA 2Y5IA 2R2IA 4OKHA 1KQVA 3BOWA 1DT7B 2L98A 3HX4A 4AOMA 3EVVA 4HREE 2K0JA 1DMOA 1B47A 1FBVA 4GPLB 4Q04A 5K89A 1SKTA 4C0KA 1PVBA 1QV1A 1UHNA 5KTYA 2L0PA 1YURA 2KAVA 2G9BA 4DS7A 1R2UA 3EVUA 3A8RA 1G33A 1XFXO 3DVMA 2V53A 1AHRA 1S1EA 2BE6A 1C7WA 4A4BA 1CFFA 2E30A 1IQ3A 1Q80A 1IJ5A 3FWCA 2LLSA 4OCIA 2L4IA 2LM5A 1JFKA 1E8AA 2JT8A 1CKKA 2JU0A 1MWNA 1Y1XA 1B7TZ 2RGIA 1WRLA 1SL8A 1ALWA 3DVKA 1B9AA 1FW4A 1NYAA 3JTDC 1GGWA 3BUMB 2ZKMX 1XO5A 4HRGA 1M46A 1F54A 5CSFA 1K90D 3BXKA 2CBLA 2BL0C 2FCDA 5DKNA 1LINA 1XA5A 2M7NA 2K7DA 1GQMA 1UP5A 4WQ2A 1PALA 1A03A 1YRTB 3JVTB 5HLOA 4PE1A 3I5IB 3PATA 2LP2A 1K96A 1CFPA 1F70A 1X02A 3SJSA 1KCYA 2LHIA 2M3WA 4N5XA 1DJYA 1OMVA 1S6IA 2ISDA 4YGCB 1K95A 1LXFC 2D8NA 2K7CA 1YX7A 1IH0A 1SY9A 3RLZA 2K2AA 3WNXB 2JRFA 1S6CA 3BUWB 2PSRA 3DF0B 3OB2B 4MBEA 3EKJA 4OV2A 2LAPA 4DIRA 3TS5B 1GGZA 1S36A 5PALA 1UUSA 2QPTA 1NX0A 1B4CA 3FIAA 2LP3A 3KEVA 2JWWA 4YGBB 2Y1MA 1QLSA 3CWGA 4DCKA 2M29A 3D0YB 4GFTA 4PE0A 4GAOA 1K94A 2K61A 2BBNA 3MSEB 2KBMA 5D7FA 1UHKA 1PVAA 5GQQC 2LMUA 1CLBA 1QX7A 2FOTA 3WHUB 1A4PA 1Y1UA 1YVLA 2NXQA 4MZJA 5IBWA 3AKBA 2COLB 4GGFC 4YGEB 1K9UA 1A29A 1M63B 2JPTA 1DGUA 1IKUA 1WRKA 1TCFA 3SG7A 4GBAA 1QS7A 1EJ3A 1SRAA 3RM1A 2JT0A 5TNCA 2LVKA 1SW8A 4HRHA 1NCZA 2IS9A 2ZFDA 5JOLA 2MBXA 3JTDB 2MHHA 1A75B 2O5GA 3JVTC 3IQOA 2ZN8A 4JPZB 3I5IC 4OR9B 3IQQA 2K7OA 5AFPA 2LCPA 3ZNIA 2L51A 1JUOA 1J7QA 3OHMB 1RK9A 1V1GA 2HQWA 1HQVA 1DF0B 1JC2A 1YUSA 4A4CA 1NP8A 1ZOTB 4ORBB 2EC6B 2PALA 4YI9A 1DJXA 1F4QA 2JOJA 3TDIA 3VRRA 1F4OA 1N0YA 2MAZA 1OMRA 4P2YB 1TNPA 2JNXA 2H61A 5HKYA 1W7JB 2EHBA 3PSRA 5DKQA 2LLUA 1BR1B 2KSPA 1EG4A 2MJWB 1NUBA 3CTNA 3KF9A 4I5NB 4ORCB 1XVJA 4USLA 3EVRA 5G08A 3K21A 1CTRA 2FJUB 4M2QA 1BOCA 1QVIY 2F2PA 2ZRTA 4I5JA 4PCWA 3CGAA 2L4HA 2MLFC 3E3RA 2Y1NA 1UWOA 4TNCA 3O78A 5FYXA 1NSHA 4CFQA 1SR6B 4FTGA 2WCFA 2JXCA 5KU1A 1ZUZA 3TZ1A 2OPOA 4E68A 1S5GY 4PE7A 1U5IA 1B8RA 4BY4A 4QJ5B 3WXAA 1IGVA 3VGOA 1XFWO 1IG5A 1BR4B 5AEQA 4ZCVA 4NDBA 3FS7A 1F8HA 3D10A 3I5HB 2LVJA 3LLEA 2SASA 1YVHA 1NPQA 4ETOA 2ZNDA 3TDUA 1K2HA 3BUXB 3OB1B 5CSJA 1YX8A 2L50A 5I2QA 2KI4C 1JBAA 2JTTA 1MXEA 2CT9A 1OSAA 2OTGB 1SL7A 1TOPA 1NCYA 1Y1AA 4N1FA 3NSKA 3AAKA 1JF2A 3KHEA 1N65A 3GK4X 1TNWA 3PALA 1NX2A 1KQMB 1JF0A 3LCPC 2EC6C 4MN0A 1TCOB 2JNFA 4MZLA 3WHTB 4NDDA 2GGZA 1QV0A 3SIBA 1XFZO 2OS8C 1L2OB 2I94A 2LV7A 2MA2A 4R1EA 2BKIB 5AXIA 4MRYA 1QIVA 1M45A 2KYFA 2HPSA 4GUKA 5D69A 1BU3A 3O6BA 3O4YA 1NX3A 1CFDA 2MLEC 4XYNA 1R6PA 1C07A 1WLMA 2LC5A 2BCBA 1FI5A 1MHOA 3SIAA 1CM4A 5I2OA 2F8PA 1JFJA 3GOFA 2AMIA 1SR6C 1JSAA 1RWYA 2PMYA 4L9MA 2PASA 1KSMA 1M31A 3ZWHA 2KHNA 1YUUA 1RECA 4ZCUA 3CS1A 1OMDA 2ZRSA 1CDPA 2PVBA 2K8MB 3NSIA 2GV5A 4GGNA 4JQ0D 1NX1A 4NQGA 3TUYB 4XJKB 1RTP1 2BE4A 1MUXA 3DF0A 2JTZA 4AQIA 1BG1A 1TTXA 1TIZA 1SCMC 1RFJA 3I5HC 2BCAA 1TNQA 4MEWA 4F0ZB 4PE4A 2KI6D 1QXPA 1DVIA 2BECA 3HCMA 3PN7C 5HYDA 2BKHB 4ORAB 1V1FA 2F2OA 1Y0VH 1A2XA 2F33A 2L5XB 3D0YA 4YGDB 5DKRA 4CFRA 2OTGC 3VROA 3CZTX 1CDMA 2KFGA 3PFVA 1CLMA 2KI4B 3GK1A 3IF7A 1RROA 1PRWA 1QASA 1IQ5A 1KQMC 1CMGA 3BUOB 2KQ6A 3VRNA 2CNPA 2BBMA 1IJ6A 4PHJA 4PHNA 1IWQA 2KAYA 1SK6D 4CPVA 1WDCB 1SMGA 2KAXA 1L2OC 3PLFB 4HSZA 3GK2A 1CB1A 2NCOA 4FQOA 2O60A 2I2RE 2OS8B 1UURA 2LMVA 2KDHA 2WNDA 3A4UB 3BOWB 4JWQA 3NXAA 5HLVA 3M0WA 3ICBA 1PULA 2NCPA 3PM8A 2CTNA 5I2LA 2JULA 1N2DA 1CDLA 2LHLA 3DVEA 1KK8C 1RJVA 3VRQA 2M1KB 2M0RA 1KFXS 2LVVA 3AAJA 2MRDA 1XFVO 1YUTA 3C1VA 1W7IB 1HT9A 2LVIA 4I5LB 2LNKA 2M7LA 1F71A 1UHHA 1J7OA 2JZIA 4C0JA 1XFYO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KSZ A;  5F6T A;  2KOT A;  3TUY C;  1L7Z A;  2Y4Q A;  1EXR A;  1G8I A;  1LA3 A;  3I5G B;  1DJW A;  2JXL A;  1Y6W A;  2ZN9 A;  3VRP A;  1H4B A;  2NZ0 A;  2Q91 A;  1K8U A;  4WRI A;  1AJ5 A;  1IRJ A;  2CXJ A;  4QJ3 B;  5J3X A;  1LKJ A;  4U8D A;  1QIW A;  1M39 A;  1NWD A;  1S3P A;  1SCM B;  1WRZ A;  2H2K A;  4DRW A;  1DGV A;  3PN7 B;  2LUC A;  1BLQ A;  2KGB C;  2DOQ A;  1QLK A;  2LLT A;  2SCP A;  4MSP A;  5BPJ A;  5AER A;  2WOR A;  4CLN A;  1DJH A;  1AP4 A;  1S26 D;  1ZAC A;  4MZK A;  1MXL C;  1DJZ A;  1KFX L;  2KFF A;  4WQ3 A;  1WY9 A;  2BCX A;  2KBI A;  3EKH A;  1OZS A;  4QJ4 B;  1OOJ A;  4N1G A;  2M1U A;  3OX5 A;  4GGF A;  2WCB A;  1BJF A;  1ODB A;  1WLZ A;  1CNP A;  1WDC C;  2QAC A;  1YRU B;  1SPY A;  2H61 C;  1NIW A;  2KYC A;  1KK7 Y;  2M97 A;  1J7P A;  2EGD A;  1KFU S;  1XK4 C;  1NCX A;  4YI8 A;  1KWO C;  3CR2 A;  2I7A A;  2LAN A;  2WOS A;  4M2P A;  4YRU A;  1SL9 A;  1BT6 A;  3NSO A;  1D1O A;  1VRK A;  2NLN A;  4IL1 A;  5ER4 X;  2WC8 A;  3SG4 A;  1H8B A;  1DTL A;  2JT3 A;  2E6W A;  1QAT A;  2GGM A;  4GNK B;  1DJI A;  1KK8 B;  1EG3 A;  5CSI A;  4CID A;  3DD4 A;  1ZFS A;  1F55 A;  1SNL A;  1GJY A;  2LUX A;  1BOD A;  1CLL A;  3LK0 A;  5B8I B;  3CR4 X;  1QTX A;  3I5G C;  1PK0 D;  1K93 D;  1SYM A;  2LE9 B;  4M2O A;  2TN4 A;  1YTZ C;  1AJ4 A;  1QJT A;  1PSB A;  1BF5 A;  1XYD A;  1FF1 A;  1J55 A;  1LVC D;  3SG2 A;  2FCE A;  1FI6 A;  1B7T Y;  1SCV A;  5ER5 A;  2P6B B;  3I5F B;  1B8L A;  4ICB A;  2G2B A;  1ZMZ A;  3AKA A;  1EH2 A;  1KFU L;  1K9K A;  3O2P A;  4I5K A;  1DJG A;  2M9G A;  4AQJ A;  2ZNE A;  2PRU A;  1UHJ A;  3SG5 A;  3FWB A;  4MRX A;  2I18 A;  5I8N A;  3OP0 A;  1QVI Z;  2M8U A;  3NSL A;  2Q4U A;  4MLW A;  3TDZ A;  4BY5 A;  1TNX A;  1C7V A;  2K2F A;  3DVJ A;  5HKW A;  1CM1 A;  4PHK A;  1EL4 A;  1S6J A;  1AUI B;  1CDN A;  3QRX A;  1S5G Z;  1AVS A;  2KI6 C;  4XJK A;  2KNE A;  3H4S E;  4YGA A;  5CSN A;  1JWD A;  5JJG A;  4NDC A;  2M49 B;  2HQ8 A;  2B1U A;  2KQY A;  3CR5 X;  3CLN A;  3EK8 A;  1FPW A;  2KGR A;  1J7R A;  1G4Y R;  2L2E A;  3BQ3 A;  2WCE A;  4OVN F;  3BYA A;  3EK7 A;  5AAN A;  4MVF A;  2KFH A;  1B8C A;  1QX5 B;  1TRF A;  1PSR A;  1KWO B;  2JC2 A;  4PDZ A;  1KSO A;  1AK8 A;  2AAO A;  4YBH B;  3SG3 A;  3LL8 B;  2BL0 B;  1CMF A;  1XFU O;  2JQ6 A;  1YR5 A;  3KO0 A;  1MF8 B;  3KPX A;  1A75 A;  2HF5 A;  1UHI A;  2HET A;  3LK1 A;  2LMT A;  5CPV A;  3BUN B;  3OX6 A;  2F3Y A;  3EK4 A;  5HKZ A;  2AUC A;  1J1D A;  1OE9 B;  4D1E A;  4P5O E;  2F3Z A;  1SBJ A;  1LA0 A;  1QX2 A;  2CCM A;  4PHM A;  1B1G A;  1U5I B;  1CFC A;  1DF0 A;  2A4J A;  4C0L A;  3F45 A;  3TS5 C;  4UPG A;  1ALV A;  1MR8 A;  1J1E A;  1KK7 Z;  2VRG A;  4PAL A;  1BMO A;  3SG6 A;  4DUQ A;  3I5F C;  1XK4 A;  1TN4 A;  1K9P A;  2K7B A;  1OQP A;  1MQ1 A;  1OZO A;  2Y5I A;  2R2I A;  4OKH A;  1KQV A;  3BOW A;  1DT7 B;  2L98 A;  3HX4 A;  4AOM A;  3EVV A;  4HRE E;  2K0J A;  1DMO A;  1B47 A;  1FBV A;  4GPL B;  4Q04 A;  5K89 A;  1SKT A;  4C0K A;  1PVB A;  1QV1 A;  1UHN A;  5KTY A;  2L0P A;  1YUR A;  2KAV A;  2G9B A;  4DS7 A;  1R2U A;  3EVU A;  3A8R A;  1G33 A;  1XFX O;  3DVM A;  2V53 A;  1AHR A;  1S1E A;  2BE6 A;  1C7W A;  4A4B A;  1CFF A;  2E30 A;  1IQ3 A;  1Q80 A;  1IJ5 A;  3FWC A;  2LLS A;  4OCI A;  2L4I A;  2LM5 A;  1JFK A;  1E8A A;  2JT8 A;  1CKK A;  2JU0 A;  1MWN A;  1Y1X A;  1B7T Z;  2RGI A;  1WRL A;  1SL8 A;  1ALW A;  3DVK A;  1B9A A;  1FW4 A;  1NYA A;  3JTD C;  1GGW A;  3BUM B;  2ZKM X;  1XO5 A;  4HRG A;  1M46 A;  1F54 A;  5CSF A;  1K90 D;  3BXK A;  2CBL A;  2BL0 C;  2FCD A;  5DKN A;  1LIN A;  1XA5 A;  2M7N A;  2K7D A;  1GQM A;  1UP5 A;  4WQ2 A;  1PAL A;  1A03 A;  1YRT B;  3JVT B;  5HLO A;  4PE1 A;  3I5I B;  3PAT A;  2LP2 A;  1K96 A;  1CFP A;  1F70 A;  1X02 A;  3SJS A;  1KCY A;  2LHI A;  2M3W A;  4N5X A;  1DJY A;  1OMV A;  1S6I A;  2ISD A;  4YGC B;  1K95 A;  1LXF C;  2D8N A;  2K7C A;  1YX7 A;  1IH0 A;  1SY9 A;  3RLZ A;  2K2A A;  3WNX B;  2JRF A;  1S6C A;  3BUW B;  2PSR A;  3DF0 B;  3OB2 B;  4MBE A;  3EKJ A;  4OV2 A;  2LAP A;  4DIR A;  3TS5 B;  1GGZ A;  1S36 A;  5PAL A;  1UUS A;  2QPT A;  1NX0 A;  1B4C A;  3FIA A;  2LP3 A;  3KEV A;  2JWW A;  4YGB B;  2Y1M A;  1QLS A;  3CWG A;  4DCK A;  2M29 A;  3D0Y B;  4GFT A;  4PE0 A;  4GAO A;  1K94 A;  2K61 A;  2BBN A;  3MSE B;  2KBM A;  5D7F A;  1UHK A;  1PVA A;  5GQQ C;  2LMU A;  1CLB A;  1QX7 A;  2FOT A;  3WHU B;  1A4P A;  1Y1U A;  1YVL A;  2NXQ A;  4MZJ A;  5IBW A;  3AKB A;  2COL B;  4GGF C;  4YGE B;  1K9U A;  1A29 A;  1M63 B;  2JPT A;  1DGU A;  1IKU A;  1WRK A;  1TCF A;  3SG7 A;  4GBA A;  1QS7 A;  1EJ3 A;  1SRA A;  3RM1 A;  2JT0 A;  5TNC A;  2LVK A;  1SW8 A;  4HRH A;  1NCZ A;  2IS9 A;  2ZFD A;  5JOL A;  2MBX A;  3JTD B;  2MHH A;  1A75 B;  2O5G A;  3JVT C;  3IQO A;  2ZN8 A;  4JPZ B;  3I5I C;  4OR9 B;  3IQQ A;  2K7O A;  5AFP A;  2LCP A;  3ZNI A;  2L51 A;  1JUO A;  1J7Q A;  3OHM B;  1RK9 A;  1V1G A;  2HQW A;  1HQV A;  1DF0 B;  1JC2 A;  1YUS A;  4A4C A;  1NP8 A;  1ZOT B;  4ORB B;  2EC6 B;  2PAL A;  4YI9 A;  1DJX A;  1F4Q A;  2JOJ A;  3TDI A;  3VRR A;  1F4O A;  1N0Y A;  2MAZ A;  1OMR A;  4P2Y B;  1TNP A;  2JNX A;  2H61 A;  5HKY A;  1W7J B;  2EHB A;  3PSR A;  5DKQ A;  2LLU A;  1BR1 B;  2KSP A;  1EG4 A;  2MJW B;  1NUB A;  3CTN A;  3KF9 A;  4I5N B;  4ORC B;  1XVJ A;  4USL A;  3EVR A;  5G08 A;  3K21 A;  1CTR A;  2FJU B;  4M2Q A;  1BOC A;  1QVI Y;  2F2P A;  2ZRT A;  4I5J A;  4PCW A;  3CGA A;  2L4H A;  2MLF C;  3E3R A;  2Y1N A;  1UWO A;  4TNC A;  3O78 A;  5FYX A;  1NSH A;  4CFQ A;  1SR6 B;  4FTG A;  2WCF A;  2JXC A;  5KU1 A;  1ZUZ A;  3TZ1 A;  2OPO A;  4E68 A;  1S5G Y;  4PE7 A;  1U5I A;  1B8R A;  4BY4 A;  4QJ5 B;  3WXA A;  1IGV A;  3VGO A;  1XFW O;  1IG5 A;  1BR4 B;  5AEQ A;  4ZCV A;  4NDB A;  3FS7 A;  1F8H A;  3D10 A;  3I5H B;  2LVJ A;  3LLE A;  2SAS A;  1YVH A;  1NPQ A;  4ETO A;  2ZND A;  3TDU A;  1K2H A;  3BUX B;  3OB1 B;  5CSJ A;  1YX8 A;  2L50 A;  5I2Q A;  2KI4 C;  1JBA A;  2JTT A;  1MXE A;  2CT9 A;  1OSA A;  2OTG B;  1SL7 A;  1TOP A;  1NCY A;  1Y1A A;  4N1F A;  3NSK A;  3AAK A;  1JF2 A;  3KHE A;  1N65 A;  3GK4 X;  1TNW A;  3PAL A;  1NX2 A;  1KQM B;  1JF0 A;  3LCP C;  2EC6 C;  4MN0 A;  1TCO B;  2JNF A;  4MZL A;  3WHT B;  4NDD A;  2GGZ A;  1QV0 A;  3SIB A;  1XFZ O;  2OS8 C;  1L2O B;  2I94 A;  2LV7 A;  2MA2 A;  4R1E A;  2BKI B;  5AXI A;  4MRY A;  1QIV A;  1M45 A;  2KYF A;  2HPS A;  4GUK A;  5D69 A;  1BU3 A;  3O6B A;  3O4Y A;  1NX3 A;  1CFD A;  2MLE C;  4XYN A;  1R6P A;  1C07 A;  1WLM A;  2LC5 A;  2BCB A;  1FI5 A;  1MHO A;  3SIA A;  1CM4 A;  5I2O A;  2F8P A;  1JFJ A;  3GOF A;  2AMI A;  1SR6 C;  1JSA A;  1RWY A;  2PMY A;  4L9M A;  2PAS A;  1KSM A;  1M31 A;  3ZWH A;  2KHN A;  1YUU A;  1REC A;  4ZCU A;  3CS1 A;  1OMD A;  2ZRS A;  1CDP A;  2PVB A;  2K8M B;  3NSI A;  2GV5 A;  4GGN A;  4JQ0 D;  1NX1 A;  4NQG A;  3TUY B;  4XJK B;  1RTP 1;  2BE4 A;  1MUX A;  3DF0 A;  2JTZ A;  4AQI A;  1BG1 A;  1TTX A;  1TIZ A;  1SCM C;  1RFJ A;  3I5H C;  2BCA A;  1TNQ A;  4MEW A;  4F0Z B;  4PE4 A;  2KI6 D;  1QXP A;  1DVI A;  2BEC A;  3HCM A;  3PN7 C;  5HYD A;  2BKH B;  4ORA B;  1V1F A;  2F2O A;  1Y0V H;  1A2X A;  2F33 A;  2L5X B;  3D0Y A;  4YGD B;  5DKR A;  4CFR A;  2OTG C;  3VRO A;  3CZT X;  1CDM A;  2KFG A;  3PFV A;  1CLM A;  2KI4 B;  3GK1 A;  3IF7 A;  1RRO A;  1PRW A;  1QAS A;  1IQ5 A;  1KQM C;  1CMG A;  3BUO B;  2KQ6 A;  3VRN A;  2CNP A;  2BBM A;  1IJ6 A;  4PHJ A;  4PHN A;  1IWQ A;  2KAY A;  1SK6 D;  4CPV A;  1WDC B;  1SMG A;  2KAX A;  1L2O C;  3PLF B;  4HSZ A;  3GK2 A;  1CB1 A;  2NCO A;  4FQO A;  2O60 A;  2I2R E;  2OS8 B;  1UUR A;  2LMV A;  2KDH A;  2WND A;  3A4U B;  3BOW B;  4JWQ A;  3NXA A;  5HLV A;  3M0W A;  3ICB A;  1PUL A;  2NCP A;  3PM8 A;  2CTN A;  5I2L A;  2JUL A;  1N2D A;  1CDL A;  2LHL A;  3DVE A;  1KK8 C;  1RJV A;  3VRQ A;  2M1K B;  2M0R A;  1KFX S;  2LVV A;  3AAJ A;  2MRD A;  1XFV O;  1YUT A;  3C1V A;  1W7I B;  1HT9 A;  2LVI A;  4I5L B;  2LNK A;  2M7L A;  1F71 A;  1UHH A;  1J7O A;  2JZI A;  4C0J A;  1XFY O; 
#chains in the Genus database with same CATH topology
 5KSZ A;  3D76 A;  5F6T A;  2KOT A;  3TUY C;  1L7Z A;  2Y4Q A;  1EXR A;  1G8I A;  1LA3 A;  3I5G B;  1DJW A;  2JXL A;  1Y6W A;  2ZN9 A;  3VRP A;  1H4B A;  2NZ0 A;  2Q91 A;  1K8U A;  4WRI A;  1AJ5 A;  1IRJ A;  2CXJ A;  4QJ3 B;  5J3X A;  1LKJ A;  4U8D A;  1QIW A;  1M39 A;  1NWD A;  1S3P A;  1SCM B;  1WRZ A;  2H2K A;  4DRW A;  1DGV A;  3PN7 B;  2LUC A;  1BLQ A;  2KGB C;  2DOQ A;  1QLK A;  2LLT A;  2SCP A;  4MSP A;  5BPJ A;  5AER A;  3L4L A;  2WOR A;  4CLN A;  3R1O A;  1DJH A;  3PJI A;  1AP4 A;  1S26 D;  1ZAC A;  4MZK A;  1MXL C;  1DJZ A;  1KFX L;  3RZS A;  2KFF A;  4WQ3 A;  1WY9 A;  2BCX A;  2KBI A;  3EKH A;  1OZS A;  4QJ4 B;  1OOJ A;  2P70 A;  4N1G A;  2M1U A;  3OX5 A;  4GGF A;  2WCB A;  1BJF A;  1ODB A;  1DEK A;  1WLZ A;  1CNP A;  1WDC C;  2QAC A;  1YRU B;  1SPY A;  3SS4 A;  2H61 C;  1NIW A;  2KYC A;  1KK7 Y;  2M97 A;  1J7P A;  2EGD A;  1KFU S;  1XK4 C;  1NCX A;  4YI8 A;  1KWO C;  3CR2 A;  2I7A A;  2LAN A;  3Q8I A;  3S0A A;  2L2C A;  2WOS A;  4M2P A;  4YRU A;  1SL9 A;  1BT6 A;  3B7A A;  3N7H A;  3NSO A;  1D1O A;  1VRK A;  2NLN A;  4IL1 A;  5ER4 X;  2JPO A;  2WC8 A;  3SG4 A;  1H8B A;  2K60 A;  1DTL A;  2JT3 A;  2E6W A;  2QEV A;  1QAT A;  2GGM A;  4GNK B;  1DJI A;  1KK8 B;  1EG3 A;  5CSI A;  4CID A;  3DD4 A;  1ZFS A;  1F55 A;  1SNL A;  1GJY A;  2LUX A;  1BOD A;  1CLL A;  3LK0 A;  1P28 A;  3V2L A;  5B8I B;  3CR4 X;  1QTX A;  3D77 A;  3I5G C;  1PK0 D;  1K93 D;  1SYM A;  2LE9 B;  4M2O A;  2TN4 A;  1YTZ C;  1AJ4 A;  1QJT A;  1PSB A;  1BF5 A;  1XYD A;  1FF1 A;  1J55 A;  1LVC D;  3SG2 A;  2FCE A;  1FI6 A;  1B7T Y;  1SCV A;  5ER5 A;  2P6B B;  3I5F B;  2WC6 A;  1B8L A;  4ICB A;  2G2B A;  1ZMZ A;  3AKA A;  1EH2 A;  2QEO A;  1KFU L;  1K9K A;  3O2P A;  4OZD A;  1QWV A;  4I5K A;  1DJG A;  2M9G A;  4AQJ A;  2ZNE A;  2PRU A;  1UHJ A;  3SG5 A;  3FWB A;  4MRX A;  2I18 A;  5I8N A;  3OP0 A;  1QVI Z;  2M8U A;  3NSL A;  2Q4U A;  4MLW A;  3TDZ A;  4BY5 A;  1TNX A;  1C7V A;  2K2F A;  3DVJ A;  5HKW A;  1CM1 A;  4PHK A;  1EL4 A;  1S6J A;  1AUI B;  1CDN A;  3QRX A;  1SSE B;  3L47 A;  1S5G Z;  1AVS A;  2GTE A;  2H8V A;  2KI6 C;  4XJK A;  2KNE A;  3H4S E;  4YGA A;  5CSN A;  1JWD A;  5JJG A;  4FQT A;  4NDC A;  3D74 A;  2M49 B;  2HQ8 A;  2B1U A;  2KQY A;  3CR5 X;  3CLN A;  3EK8 A;  3K1E A;  2KGR A;  1FPW A;  1J7R A;  2PQL A;  1G4Y R;  2L2E A;  3BQ3 A;  2WCE A;  4OVN F;  3BYA A;  3EK7 A;  5AAN A;  4MVF A;  2KFH A;  1B8C A;  1QX5 B;  1TRF A;  1PSR A;  1KWO B;  2JC2 A;  2QDI A;  4PDZ A;  1KSO A;  1AK8 A;  2AAO A;  4YBH B;  3SG3 A;  3LL8 B;  2BL0 B;  1CMF A;  1XFU O;  2JQ6 A;  1YR5 A;  3KO0 A;  1MF8 B;  3KPX A;  1A75 A;  2HF5 A;  1UHI A;  2HET A;  3LK1 A;  4JD9 A;  2LMT A;  2YGU A;  2KPH A;  5CPV A;  3BUN B;  3OX6 A;  2F3Y A;  3EK4 A;  3S0D A;  5HKZ A;  2AUC A;  1J1D A;  1OE9 B;  4D1E A;  4P5O E;  2F3Z A;  1SBJ A;  1LA0 A;  1QX2 A;  2CCM A;  2WCH A;  4PHM A;  1U5I B;  1B1G A;  1CFC A;  1DF0 A;  2A4J A;  4C0L A;  3F45 A;  3TS5 C;  4UPG A;  1ALV A;  1MR8 A;  1J1E A;  1KK7 Z;  2VRG A;  3CAB A;  1BMO A;  3OBV A;  4PAL A;  3SG6 A;  4DUQ A;  3I5F C;  1XK4 A;  1TN4 A;  4IJ7 A;  1K9P A;  2K7B A;  1OW4 A;  1OQP A;  1MQ1 A;  1OZO A;  2Y5I A;  2R2I A;  4OKH A;  1KQV A;  3DZT A;  3BOW A;  1DT7 B;  2L98 A;  3HX4 A;  4AOM A;  3EVV A;  4HRE E;  2K0J A;  1DMO A;  1B47 A;  1FBV A;  4GPL B;  1DEL A;  4Q04 A;  5K89 A;  1SKT A;  4C0K A;  1PVB A;  1QV1 A;  1UHN A;  5KTY A;  2L0P A;  1YUR A;  2KAV A;  2G9B A;  4DS7 A;  1R2U A;  3EVU A;  3A8R A;  1G33 A;  1XFX O;  3DVM A;  2V53 A;  1AHR A;  1S1E A;  2BE6 A;  1C3Y A;  1C7W A;  1OOI X;  4A4B A;  2E30 A;  3CZ0 A;  1IQ3 A;  1Q80 A;  1CFF A;  1IJ5 A;  3DXL A;  3R1V A;  3FWC A;  4F7F A;  2LLS A;  4OCI A;  2L4I A;  2LM5 A;  1JFK A;  1E8A A;  2JT8 A;  1CKK A;  2JU0 A;  1MWN A;  1Y1X A;  1B7T Z;  2RGI A;  1TWO A;  1SL8 A;  1ALW A;  1WRL A;  3DVK A;  1B9A A;  1C3Z A;  1FW4 A;  1NYA A;  3JTD C;  1GGW A;  3BUM B;  2ZKM X;  1XO5 A;  4HRG A;  1M46 A;  3D73 A;  1F54 A;  5CSF A;  1K90 D;  3PM2 A;  3BXK A;  2CBL A;  2BL0 C;  2FCD A;  5DKN A;  1LIN A;  1XA5 A;  2WCK A;  3UO9 A;  2M7N A;  2K7D A;  1GQM A;  1UP5 A;  4WQ2 A;  1PAL A;  1A03 A;  1YRT B;  3JVT B;  3FE8 A;  5HLO A;  4PE1 A;  3I5I B;  3PAT A;  2LP2 A;  1K96 A;  3S0G A;  1CFP A;  1F70 A;  1X02 A;  3SJS A;  1KCY A;  2LHI A;  2M3W A;  4N5X A;  1DJY A;  1OMV A;  1S6I A;  2ISD A;  4YGC B;  3R72 A;  1K95 A;  1LXF C;  2D8N A;  2K7C A;  3UNW A;  1YX7 A;  1IH0 A;  1SY9 A;  3RLZ A;  2K2A A;  3WNX B;  2JRF A;  1S6C A;  3BUW B;  2PSR A;  3DF0 B;  3OB2 B;  4MBE A;  3EKJ A;  4OV2 A;  2LAP A;  3D75 A;  4DIR A;  3TS5 B;  1GGZ A;  1S36 A;  5PAL A;  3QME A;  1UUS A;  2QPT A;  1NX0 A;  1B4C A;  3FIA A;  3DYE A;  2LP3 A;  3KEV A;  2JWW A;  4YGB B;  2Y1M A;  1QLS A;  3CWG A;  4DCK A;  3WHU B;  2M29 A;  3D0Y B;  4GFT A;  4PE0 A;  3NHT A;  4GAO A;  1T14 A;  1K94 A;  2K61 A;  2BBN A;  3MSE B;  2KBM A;  5D7F A;  1UHK A;  1PVA A;  5GQQ C;  2LMU A;  1CLB A;  1QX7 A;  2FOT A;  3NGV A;  1A4P A;  1Y1U A;  1YVL A;  2NXQ A;  4MZJ A;  5FI6 A;  3AKB A;  5IBW A;  2COL B;  4GGF C;  1OOG A;  4JKT A;  4YGE B;  1K9U A;  1A29 A;  1M63 B;  2JPT A;  1DGU A;  1IKU A;  1DQE A;  1WRK A;  1TCF A;  3SG7 A;  4GBA A;  1QS7 A;  3O4X A;  1EJ3 A;  2L5Y A;  1SRA A;  3RM1 A;  2JT0 A;  5TNC A;  3S0B A;  2LVK A;  1SW8 A;  4HRH A;  1NCZ A;  1Z2C B;  2IS9 A;  2ZFD A;  5JOL A;  2MBX A;  3JTD B;  3FE9 A;  2MHH A;  1A75 B;  2O5G A;  3JVT C;  3IQO A;  2ZN8 A;  4JPZ B;  3I5I C;  4OR9 B;  3IQQ A;  2K7O A;  5AFP A;  2LCP A;  3ZNI A;  4INX A;  2L51 A;  1JUO A;  1J7Q A;  3OHM B;  1RK9 A;  1V1G A;  1ORG A;  2HQW A;  1HQV A;  1DF0 B;  1JC2 A;  1YUS A;  4A4C A;  1NP8 A;  1ZOT B;  4ORB B;  2EC6 B;  2PAL A;  4YI9 A;  3R1P A;  1DJX A;  1F4Q A;  2JOJ A;  3CZ2 A;  3TDI A;  3VRR A;  1F4O A;  1N0Y A;  2MAZ A;  1OMR A;  4P2Y B;  3B88 A;  1TNP A;  5EL2 A;  2JNX A;  2H61 A;  5HKY A;  5DIC A;  1W7J B;  2EHB A;  3PSR A;  5DKQ A;  2LLU A;  1BR1 B;  2KSP A;  1EG4 A;  2MJW B;  1NUB A;  3CTN A;  3B87 A;  3KF9 A;  4I5N B;  1XVJ A;  2ERB A;  3EVR A;  4ORC B;  4USL A;  5G08 A;  3K21 A;  1CTR A;  2FJU B;  4M2Q A;  3OGN A;  1QVI Y;  1BOC A;  2F2P A;  2ZRT A;  4I5J A;  4PCW A;  3CGA A;  2L4H A;  2MLF C;  3E3R A;  2Y1N A;  1UWO A;  4TNC A;  3O78 A;  5FYX A;  1NSH A;  4CFQ A;  1SR6 B;  4FTG A;  2WCF A;  2JXC A;  5KU1 A;  1ZUZ A;  3TZ1 A;  2WC5 A;  2OPO A;  4E68 A;  1S5G Y;  4PE7 A;  1U5I A;  1B8R A;  4BY4 A;  4QJ5 B;  5I94 A;  3DY9 A;  3WXA A;  1IGV A;  1XFR A;  4KYN A;  1XFW O;  3VGO A;  1IG5 A;  2BNX A;  1BR4 B;  5AEQ A;  4ZCV A;  4NDB A;  3FS7 A;  1F8H A;  3D10 A;  3I5H B;  2LVJ A;  2WCM A;  3LLE A;  2SAS A;  1YVH A;  1NPQ A;  4ETO A;  2ZND A;  3TDU A;  1K2H A;  2WCL A;  3BUX B;  3D78 A;  3OB1 B;  2KLD A;  1YX8 A;  2L50 A;  5CSJ A;  2KI4 C;  5I2Q A;  1JBA A;  2JTT A;  1MXE A;  2CT9 A;  1OSA A;  2OTG B;  1SL7 A;  1TOP A;  3CZ1 A;  1NCY A;  1Y1A A;  4N1F A;  3NSK A;  3AAK A;  1JF2 A;  3KHE A;  1N65 A;  2KLE A;  3GK4 X;  1TNW A;  3PAL A;  1NX2 A;  1KQM B;  1JF0 A;  1LS8 A;  3LCP C;  2EC6 C;  4MN0 A;  1TUJ A;  1TCO B;  2PYQ A;  3VB1 A;  2FJY A;  2JNF A;  3S0E A;  4MZL A;  2QEH A;  3WHT B;  4NDD A;  2GGZ A;  1QV0 A;  3SIB A;  1XFZ O;  2OS8 C;  1L2O B;  2I94 A;  3FE6 A;  2LV7 A;  2MA2 A;  3NHI A;  4R1E A;  2BKI B;  5AXI A;  4MRY A;  1QIV A;  2BAP A;  1M45 A;  3B6X A;  3BFB A;  2KYF A;  2HPS A;  4GUK A;  5D69 A;  1BU3 A;  4PT1 A;  3O6B A;  3O4Y A;  1NX3 A;  1CFD A;  1W9Z A;  2MLE C;  4XYN A;  1R6P A;  1C07 A;  1WLM A;  2LC5 A;  2BCB A;  1FI5 A;  1MHO A;  3SIA A;  1CM4 A;  5I2O A;  2F8P A;  1JFJ A;  3GOF A;  2AMI A;  1SR6 C;  1JSA A;  1RWY A;  2PMY A;  4L9M A;  2PAS A;  1KSM A;  1M31 A;  3ZWH A;  2KHN A;  1YUU A;  1REC A;  4ZCU A;  3CS1 A;  1OMD A;  2ZRS A;  3SS5 A;  1CDP A;  2PVB A;  3L4A A;  2K8M B;  3NSI A;  2GV5 A;  4GGN A;  4JQ0 D;  1NX1 A;  4NQG A;  5FI7 A;  3TUY B;  4XJK B;  3SS3 A;  1IIO A;  1RTP 1;  2BE4 A;  1MUX A;  3DF0 A;  2JTZ A;  4AQI A;  1BG1 A;  1TTX A;  1TIZ A;  1SCM C;  1RFJ A;  3I5H C;  2BCA A;  1TNQ A;  4MEW A;  4F0Z B;  4PE4 A;  2KI6 D;  1QXP A;  1DVI A;  2BEC A;  3HCM A;  3IVT A;  3PN7 C;  4INW A;  5HYD A;  2BKH B;  4ORA B;  1V1F A;  2QEB A;  2F2O A;  1Y0V H;  3B86 A;  1A2X A;  2F33 A;  2L5X B;  3D0Y A;  4YGD B;  5DKR A;  4CFR A;  2OTG C;  3VRO A;  3CZT X;  1CDM A;  2KFG A;  1OOF A;  3PFV A;  1CLM A;  2KI4 B;  5FI2 A;  3BFA A;  3GK1 A;  3IF7 A;  1RRO A;  1PRW A;  1QAS A;  1IQ5 A;  1KQM C;  1CMG A;  3BUO B;  2KQ6 A;  3VRN A;  2CNP A;  2BBM A;  1IJ6 A;  4PHJ A;  4PHN A;  1Z4H A;  1IWQ A;  2P71 A;  3S0F A;  2KAY A;  3CDN A;  1SK6 D;  4CPV A;  1WDC B;  1SMG A;  2KAX A;  1L2O C;  2WCJ A;  3PLF B;  4HSZ A;  5HL1 A;  3GK2 A;  1CB1 A;  2NCO A;  3BFH A;  1TUZ A;  2I2R E;  2O60 A;  4FQO A;  2OS8 B;  1UUR A;  2LMV A;  2KDH A;  2WND A;  3A4U B;  3BOW B;  1OOH A;  3NXA A;  4JWQ A;  3M0W A;  3ICB A;  1PUL A;  5HLV A;  3CYZ A;  2NCP A;  3PM8 A;  2CTN A;  5I2L A;  2JUL A;  1DC1 A;  1N2D A;  1CDL A;  2LHL A;  3DVE A;  1KK8 C;  1RJV A;  3VRQ A;  2M1K B;  2M0R A;  1KFX S;  2LVV A;  3AAJ A;  2MRD A;  1XFV O;  1YUT A;  3C1V A;  3BJH A;  1W7I B;  1HT9 A;  2LVI A;  4I5L B;  2LNK A;  2M7L A;  1F71 A;  1UHH A;  1J7O A;  2JZI A;  5D3O A;  4C0J A;  1XFY O;  1GM0 A;  3EG5 B; 
#chains in the Genus database with same CATH homology
 5KSZ A;  5F6T A;  2KOT A;  3TUY C;  1L7Z A;  2Y4Q A;  1EXR A;  1G8I A;  1LA3 A;  3I5G B;  1DJW A;  2JXL A;  1Y6W A;  2ZN9 A;  3VRP A;  1H4B A;  2NZ0 A;  2Q91 A;  1K8U A;  4WRI A;  1AJ5 A;  1IRJ A;  2CXJ A;  4QJ3 B;  5J3X A;  1LKJ A;  4U8D A;  1QIW A;  1M39 A;  1NWD A;  1S3P A;  1SCM B;  1WRZ A;  2H2K A;  4DRW A;  1DGV A;  3PN7 B;  2LUC A;  1BLQ A;  2KGB C;  2DOQ A;  1QLK A;  2LLT A;  2SCP A;  4MSP A;  5BPJ A;  5AER A;  2WOR A;  4CLN A;  1DJH A;  1AP4 A;  1S26 D;  1ZAC A;  4MZK A;  1MXL C;  1DJZ A;  1KFX L;  2KFF A;  4WQ3 A;  1WY9 A;  2BCX A;  2KBI A;  3EKH A;  1OZS A;  4QJ4 B;  1OOJ A;  4N1G A;  2M1U A;  3OX5 A;  4GGF A;  2WCB A;  1BJF A;  1ODB A;  1WLZ A;  1CNP A;  1WDC C;  2QAC A;  1YRU B;  1SPY A;  2H61 C;  1NIW A;  2KYC A;  1KK7 Y;  2M97 A;  1J7P A;  2EGD A;  1KFU S;  1XK4 C;  1NCX A;  4YI8 A;  1KWO C;  3CR2 A;  2I7A A;  2LAN A;  2WOS A;  4M2P A;  4YRU A;  1SL9 A;  1BT6 A;  3NSO A;  1D1O A;  1VRK A;  2NLN A;  4IL1 A;  5ER4 X;  2WC8 A;  3SG4 A;  1H8B A;  1DTL A;  2JT3 A;  2E6W A;  1QAT A;  2GGM A;  4GNK B;  1DJI A;  1KK8 B;  1EG3 A;  5CSI A;  4CID A;  3DD4 A;  1ZFS A;  1F55 A;  1SNL A;  1GJY A;  2LUX A;  1BOD A;  1CLL A;  3LK0 A;  5B8I B;  3CR4 X;  1QTX A;  3I5G C;  1PK0 D;  1K93 D;  1SYM A;  2LE9 B;  4M2O A;  2TN4 A;  1YTZ C;  1AJ4 A;  1QJT A;  1PSB A;  1BF5 A;  1XYD A;  1FF1 A;  1J55 A;  1LVC D;  3SG2 A;  2FCE A;  1FI6 A;  1B7T Y;  1SCV A;  5ER5 A;  2P6B B;  3I5F B;  1B8L A;  4ICB A;  2G2B A;  1ZMZ A;  3AKA A;  1EH2 A;  1KFU L;  1K9K A;  3O2P A;  4I5K A;  1DJG A;  2M9G A;  4AQJ A;  2ZNE A;  2PRU A;  1UHJ A;  3SG5 A;  3FWB A;  4MRX A;  2I18 A;  5I8N A;  3OP0 A;  1QVI Z;  2M8U A;  3NSL A;  2Q4U A;  4MLW A;  3TDZ A;  4BY5 A;  1TNX A;  1C7V A;  2K2F A;  3DVJ A;  5HKW A;  1CM1 A;  4PHK A;  1EL4 A;  1S6J A;  1AUI B;  1CDN A;  3QRX A;  1S5G Z;  1AVS A;  2KI6 C;  4XJK A;  2KNE A;  3H4S E;  4YGA A;  5CSN A;  1JWD A;  5JJG A;  4NDC A;  2M49 B;  2HQ8 A;  2B1U A;  2KQY A;  3CR5 X;  3CLN A;  3EK8 A;  1FPW A;  2KGR A;  1J7R A;  1G4Y R;  2L2E A;  3BQ3 A;  2WCE A;  4OVN F;  3BYA A;  3EK7 A;  5AAN A;  4MVF A;  2KFH A;  1B8C A;  1QX5 B;  1TRF A;  1PSR A;  1KWO B;  2JC2 A;  4PDZ A;  1KSO A;  1AK8 A;  2AAO A;  4YBH B;  3SG3 A;  3LL8 B;  2BL0 B;  1CMF A;  1XFU O;  2JQ6 A;  1YR5 A;  3KO0 A;  1MF8 B;  3KPX A;  1A75 A;  2HF5 A;  1UHI A;  2HET A;  3LK1 A;  2LMT A;  5CPV A;  3BUN B;  3OX6 A;  2F3Y A;  3EK4 A;  5HKZ A;  2AUC A;  1J1D A;  1OE9 B;  4D1E A;  4P5O E;  2F3Z A;  1SBJ A;  1LA0 A;  1QX2 A;  2CCM A;  4PHM A;  1B1G A;  1U5I B;  1CFC A;  1DF0 A;  2A4J A;  4C0L A;  3F45 A;  3TS5 C;  4UPG A;  1ALV A;  1MR8 A;  1J1E A;  1KK7 Z;  2VRG A;  4PAL A;  1BMO A;  3SG6 A;  4DUQ A;  3I5F C;  1XK4 A;  1TN4 A;  1K9P A;  2K7B A;  1OQP A;  1MQ1 A;  1OZO A;  2Y5I A;  2R2I A;  4OKH A;  1KQV A;  3BOW A;  1DT7 B;  2L98 A;  3HX4 A;  4AOM A;  3EVV A;  4HRE E;  2K0J A;  1DMO A;  1B47 A;  1FBV A;  4GPL B;  4Q04 A;  5K89 A;  1SKT A;  4C0K A;  1PVB A;  1QV1 A;  1UHN A;  5KTY A;  2L0P A;  1YUR A;  2KAV A;  2G9B A;  4DS7 A;  1R2U A;  3EVU A;  3A8R A;  1G33 A;  1XFX O;  3DVM A;  2V53 A;  1AHR A;  1S1E A;  2BE6 A;  1C7W A;  4A4B A;  1CFF A;  2E30 A;  1IQ3 A;  1Q80 A;  1IJ5 A;  3FWC A;  2LLS A;  4OCI A;  2L4I A;  2LM5 A;  1JFK A;  1E8A A;  2JT8 A;  1CKK A;  2JU0 A;  1MWN A;  1Y1X A;  1B7T Z;  2RGI A;  1WRL A;  1SL8 A;  1ALW A;  3DVK A;  1B9A A;  1FW4 A;  1NYA A;  3JTD C;  1GGW A;  3BUM B;  2ZKM X;  1XO5 A;  4HRG A;  1M46 A;  1F54 A;  5CSF A;  1K90 D;  3BXK A;  2CBL A;  2BL0 C;  2FCD A;  5DKN A;  1LIN A;  1XA5 A;  2M7N A;  2K7D A;  1GQM A;  1UP5 A;  4WQ2 A;  1PAL A;  1A03 A;  1YRT B;  3JVT B;  5HLO A;  4PE1 A;  3I5I B;  3PAT A;  2LP2 A;  1K96 A;  1CFP A;  1F70 A;  1X02 A;  3SJS A;  1KCY A;  2LHI A;  2M3W A;  4N5X A;  1DJY A;  1OMV A;  1S6I A;  2ISD A;  4YGC B;  1K95 A;  1LXF C;  2D8N A;  2K7C A;  1YX7 A;  1IH0 A;  1SY9 A;  3RLZ A;  2K2A A;  3WNX B;  2JRF A;  1S6C A;  3BUW B;  2PSR A;  3DF0 B;  3OB2 B;  4MBE A;  3EKJ A;  4OV2 A;  2LAP A;  4DIR A;  3TS5 B;  1GGZ A;  1S36 A;  5PAL A;  1UUS A;  2QPT A;  1NX0 A;  1B4C A;  3FIA A;  2LP3 A;  3KEV A;  2JWW A;  4YGB B;  2Y1M A;  1QLS A;  3CWG A;  4DCK A;  2M29 A;  3D0Y B;  4GFT A;  4PE0 A;  4GAO A;  1K94 A;  2K61 A;  2BBN A;  3MSE B;  2KBM A;  5D7F A;  1UHK A;  1PVA A;  5GQQ C;  2LMU A;  1CLB A;  1QX7 A;  2FOT A;  3WHU B;  1A4P A;  1Y1U A;  1YVL A;  2NXQ A;  4MZJ A;  5IBW A;  3AKB A;  2COL B;  4GGF C;  4YGE B;  1K9U A;  1A29 A;  1M63 B;  2JPT A;  1DGU A;  1IKU A;  1WRK A;  1TCF A;  3SG7 A;  4GBA A;  1QS7 A;  1EJ3 A;  1SRA A;  3RM1 A;  2JT0 A;  5TNC A;  2LVK A;  1SW8 A;  4HRH A;  1NCZ A;  2IS9 A;  2ZFD A;  5JOL A;  2MBX A;  3JTD B;  2MHH A;  1A75 B;  2O5G A;  3JVT C;  3IQO A;  2ZN8 A;  4JPZ B;  3I5I C;  4OR9 B;  3IQQ A;  2K7O A;  5AFP A;  2LCP A;  3ZNI A;  2L51 A;  1JUO A;  1J7Q A;  3OHM B;  1RK9 A;  1V1G A;  2HQW A;  1HQV A;  1DF0 B;  1JC2 A;  1YUS A;  4A4C A;  1NP8 A;  1ZOT B;  4ORB B;  2EC6 B;  2PAL A;  4YI9 A;  1DJX A;  1F4Q A;  2JOJ A;  3TDI A;  3VRR A;  1F4O A;  1N0Y A;  2MAZ A;  1OMR A;  4P2Y B;  1TNP A;  2JNX A;  2H61 A;  5HKY A;  1W7J B;  2EHB A;  3PSR A;  5DKQ A;  2LLU A;  1BR1 B;  2KSP A;  1EG4 A;  2MJW B;  1NUB A;  3CTN A;  3KF9 A;  4I5N B;  4ORC B;  1XVJ A;  4USL A;  3EVR A;  5G08 A;  3K21 A;  1CTR A;  2FJU B;  4M2Q A;  1BOC A;  1QVI Y;  2F2P A;  2ZRT A;  4I5J A;  4PCW A;  3CGA A;  2L4H A;  2MLF C;  3E3R A;  2Y1N A;  1UWO A;  4TNC A;  3O78 A;  5FYX A;  1NSH A;  4CFQ A;  1SR6 B;  4FTG A;  2WCF A;  2JXC A;  5KU1 A;  1ZUZ A;  3TZ1 A;  2OPO A;  4E68 A;  1S5G Y;  4PE7 A;  1U5I A;  1B8R A;  4BY4 A;  4QJ5 B;  3WXA A;  1IGV A;  3VGO A;  1XFW O;  1IG5 A;  1BR4 B;  5AEQ A;  4ZCV A;  4NDB A;  3FS7 A;  1F8H A;  3D10 A;  3I5H B;  2LVJ A;  3LLE A;  2SAS A;  1YVH A;  1NPQ A;  4ETO A;  2ZND A;  3TDU A;  1K2H A;  3BUX B;  3OB1 B;  5CSJ A;  1YX8 A;  2L50 A;  5I2Q A;  2KI4 C;  1JBA A;  2JTT A;  1MXE A;  2CT9 A;  1OSA A;  2OTG B;  1SL7 A;  1TOP A;  1NCY A;  1Y1A A;  4N1F A;  3NSK A;  3AAK A;  1JF2 A;  3KHE A;  1N65 A;  3GK4 X;  1TNW A;  3PAL A;  1NX2 A;  1KQM B;  1JF0 A;  3LCP C;  2EC6 C;  4MN0 A;  1TCO B;  2JNF A;  4MZL A;  3WHT B;  4NDD A;  2GGZ A;  1QV0 A;  3SIB A;  1XFZ O;  2OS8 C;  1L2O B;  2I94 A;  2LV7 A;  2MA2 A;  4R1E A;  2BKI B;  5AXI A;  4MRY A;  1QIV A;  1M45 A;  2KYF A;  2HPS A;  4GUK A;  5D69 A;  1BU3 A;  3O6B A;  3O4Y A;  1NX3 A;  1CFD A;  2MLE C;  4XYN A;  1R6P A;  1C07 A;  1WLM A;  2LC5 A;  2BCB A;  1FI5 A;  1MHO A;  3SIA A;  1CM4 A;  5I2O A;  2F8P A;  1JFJ A;  3GOF A;  2AMI A;  1SR6 C;  1JSA A;  1RWY A;  2PMY A;  4L9M A;  2PAS A;  1KSM A;  1M31 A;  3ZWH A;  2KHN A;  1YUU A;  1REC A;  4ZCU A;  3CS1 A;  1OMD A;  2ZRS A;  1CDP A;  2PVB A;  2K8M B;  3NSI A;  2GV5 A;  4GGN A;  4JQ0 D;  1NX1 A;  4NQG A;  3TUY B;  4XJK B;  1RTP 1;  2BE4 A;  1MUX A;  3DF0 A;  2JTZ A;  4AQI A;  1BG1 A;  1TTX A;  1TIZ A;  1SCM C;  1RFJ A;  3I5H C;  2BCA A;  1TNQ A;  4MEW A;  4F0Z B;  4PE4 A;  2KI6 D;  1QXP A;  1DVI A;  2BEC A;  3HCM A;  3PN7 C;  5HYD A;  2BKH B;  4ORA B;  1V1F A;  2F2O A;  1Y0V H;  1A2X A;  2F33 A;  2L5X B;  3D0Y A;  4YGD B;  5DKR A;  4CFR A;  2OTG C;  3VRO A;  3CZT X;  1CDM A;  2KFG A;  3PFV A;  1CLM A;  2KI4 B;  3GK1 A;  3IF7 A;  1RRO A;  1PRW A;  1QAS A;  1IQ5 A;  1KQM C;  1CMG A;  3BUO B;  2KQ6 A;  3VRN A;  2CNP A;  2BBM A;  1IJ6 A;  4PHJ A;  4PHN A;  1IWQ A;  2KAY A;  1SK6 D;  4CPV A;  1WDC B;  1SMG A;  2KAX A;  1L2O C;  3PLF B;  4HSZ A;  3GK2 A;  1CB1 A;  2NCO A;  4FQO A;  2O60 A;  2I2R E;  2OS8 B;  1UUR A;  2LMV A;  2KDH A;  2WND A;  3A4U B;  3BOW B;  4JWQ A;  3NXA A;  5HLV A;  3M0W A;  3ICB A;  1PUL A;  2NCP A;  3PM8 A;  2CTN A;  5I2L A;  2JUL A;  1N2D A;  1CDL A;  2LHL A;  3DVE A;  1KK8 C;  1RJV A;  3VRQ A;  2M1K B;  2M0R A;  1KFX S;  2LVV A;  3AAJ A;  2MRD A;  1XFV O;  1YUT A;  3C1V A;  1W7I B;  1HT9 A;  2LVI A;  4I5L B;  2LNK A;  2M7L A;  1F71 A;  1UHH A;  1J7O A;  2JZI A;  4C0J A;  1XFY O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...