1FI6A

Solution structure of the reps1 eh domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
92
structure length
92
Chain Sequence
WKITDEQRQYYVNQFKTIQPDLNGFIPGSAAKEFFTKSKLPILELSHIWELSDFDKDGALTLDEFCAAFHLVVARKNGYDLPEKLPESLMPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EH DOMAIN PROTEIN REPS1
publication title Solution structure of the Reps1 EH domain and characterization of its binding to NPF target sequences.
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis/exocytosis
total genus 21
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2000-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1fi6A00
1SBJA 3DF0A 3EVRA 2SASA 2COLB 3EVUA 2LHLA 1IQ5A 1VRKA 1PSBA 3BYAA 4PE0A 1B8RA 4A4CA 2WCFA 2BCAA 2LCPA 4I5JA 3PN7C 1EH2A 2I2RE 2NZ0A 1TNQA 1A4PA 1EG4A 1RECA 1RROA 5CSNA 2OTGB 3EVVA 1YUSA 1MUXA 4MSPA 1JF0A 2CNPA 2ZRSA 2OS8C 4XYNA 2NCPA 4GGFC 3TUYB 3HX4A 1TCFA 1B8LA 1XFUO 4C0JA 1XFYO 5CPVA 1J7OA 1IJ6A 3WNXB 1NUBA 2KI4B 1CLLA 5CSIA 1Y1AA 2LVJA 3SIAA 1QJTA 4AQJA 4P2YB 2AAOA 2BL0C 3D0YA 3TZ1A 1TN4A 5B8IB 1SMGA 1K90D 3IQOA 1K8UA 2Q91A 1OE9B 3I5HB 4WQ2A 1S3PA 1B1GA 2LAPA 2IS9A 2PMYA 1F55A 1J7PA 5AERA 1FI6A 1IH0A 2HF5A 2M7LA 2JC2A 1UP5A 4MVFA 1LA0A 4ETOA 3SG6A 3CTNA 3VGOA 2LNKA 1BT6A 1C7WA 1G33A 2LV7A 1KSOA 2WCEA 5HKWA 2KAVA 1QVIZ 3WHTB 5PALA 1LINA 2BBMA 2LLTA 2JOJA 4BY5A 4M2QA 3D10A 2KBMA 2Y5IA 3ZNIA 1V1GA 2BL0B 4PE7A 1F4QA 1DF0B 3F45A 4M2OA 1TNWA 3O2PA 1L2OB 2EGDA 1SCMB 2BE4A 2WORA 4N5XA 3OX6A 4NDCA 1MQ1A 3OP0A 4QJ5B 1D1OA 1AJ4A 1QVIY 2HETA 3CWGA 1CNPA 2GGZA 2JT8A 5AXIA 2I7AA 1BR4B 2V53A 1YUTA 4MBEA 2QACA 3ICBA 3EK4A 1FPWA 2JTZA 3BUOB 1NX3A 1SCVA 2KNEA 1LVCD 1C7VA 4DIRA 1K95A 1SR6B 2CBLA 1CMFA 5JJGA 2E6WA 1KSMA 3KEVA 3PATA 4MZJA 1PRWA 4MRYA 3IQQA 4YGEB 2BKIB 1KK7Z 2FCDA 1GGWA 3EKJA 2LANA 4MLWA 1J7QA 2G9BA 1UURA 1CDLA 2R2IA 2BKHB 4GBAA 4YI9A 1AUIB 2WNDA 1K96A 2BECA 1S5GZ 1QX5B 1UHKA 1XK4C 1JSAA 2LMUA 3FWBA 1XFWO 3CS1A 1EG3A 2LVVA 5BPJA 1QS7A 1M31A 1S36A 1OZOA 1DJWA 5IBWA 2KFHA 1KK7Y 1S6JA 2KGBC 2Y1NA 2A4JA 3FIAA 3OHMB 4DS7A 1WLMA 2B1UA 3SG7A 3BOWB 3KPXA 4QJ3B 1U5IA 2KI6C 1PSRA 2GGMA 1UHIA 2M49B 2LHIA 1S5GY 1TOPA 1QATA 1F70A 4QJ4B 1PULA 2F33A 1YX7A 1JF2A 1AVSA 1ZFSA 2TN4A 2F2OA 4DCKA 5DKRA 2Y4QA 5KSZA 1LXFC 3DVEA 1MWNA 1KFUS 1K9KA 2OTGC 1IQ3A 4MRXA 2L0PA 3DVJA 1CDMA 5JOLA 1CKKA 5I2LA 2KGRA 2LUCA 3OB1B 1IJ5A 2FCEA 2L51A 2E30A 2KSPA 2MAZA 2F2PA 2M8UA 2O60A 3I5FB 5I2OA 4XJKB 2KI4C 2P6BB 1OMRA 2ISDA 1J7RA 1DJZA 2NCOA 2MRDA 4YBHB 1CDNA 2M3WA 1OMDA 2PVBA 4OKHA 1KK8B 3O6BA 4GGFA 3I5HC 3BUNB 1DMOA 1J55A 4GAOA 3AAKA 1EXRA 1SYMA 1WRLA 1AHRA 1IGVA 2L4IA 1XVJA 2FOTA 1N2DA 2JULA 2PASA 1N65A 1YUUA 2KFFA 3RLZA 1BG1A 5DKNA 3VRPA 1S26D 2KAXA 3SJSA 1DF0A 1MXEA 1ZOTB 1BOCA 2QPTA 1JBAA 4PHKA 2LMVA 1NIWA 4MEWA 4CFQA 1QASA 1S6CA 1A75A 1JC2A 4PE1A 1R2UA 5AFPA 3A8RA 4DRWA 3NSKA 1B8CA 3KO0A 5D69A 1BJFA 3I5GC 2VRGA 1KQVA 1L2OC 3O78A 1SCMC 1BODA 4A4BA 1GGZA 5J3XA 1WRKA 4PHJA 5FYXA 2JRFA 1CDPA 3BXKA 2JNFA 1JWDA 2M29A 1FBVA 2CT9A 1Q80A 1Y0VH 4USLA 2KOTA 3DVMA 1DJIA 2K2FA 1XFVO 2K7OA 4HSZA 2LP2A 3JTDB 4C0KA 2JNXA 2WC8A 2JTTA 1SR6C 2F3ZA 3GK1A 3SIBA 2CTNA 4AQIA 1CM1A 2K7BA 1DJGA 2ZRTA 3I5GB 1YX8A 2GV5A 1FF1A 1GQMA 1PK0D 1NWDA 3GK4X 3GK2A 2MA2A 5GQQC 1RFJA 5KTYA 1NX1A 4GPLB 4BY4A 3BUXB 2M1UA 1QX2A 3VROA 1K94A 1UHJA 2LE9B 3KHEA 1TNXA 3OX5A 1XFZO 1CB1A 2L50A 1CFCA 3VRNA 1MF8B 2JT3A 2WCBA 2BCBA 2K0JA 2LUXA 3CR5X 1CTRA 1XK4A 4FTGA 1AP4A 1BR1B 2JT0A 4NDBA 3HCMA 1PVBA 1CMGA 3K21A 3M0WA 3ZWHA 4PHNA 4NDDA 3D0YB 4D1EA 2M0RA 5HLVA 1CM4A 2BBNA 1MR8A 1J1EA 3DD4A 2L5XB 1CFDA 4U8DA 3LL8B 1UHHA 1QIWA 1QLSA 1ODBA 1JUOA 4MN0A 1H8BA 2L98A 5HKZA 1OSAA 1ALVA 4YGCB 1NCZA 2KI6D 5F6TA 2KQYA 1HT9A 1WY9A 1B7TZ 2K8MB 2NLNA 3I5FC 1BLQA 4PE4A 3TS5B 4JWQA 3PLFB 1UHNA 1BF5A 2K61A 1F71A 1RK9A 4C0LA 3BUWB 1G8IA 1KK8C 3NSOA 4ORBB 1NCYA 2I94A 2MHHA 3AKAA 1NYAA 1SL8A 3QRXA 1V1FA 4R1EA 1W7JB 1B7TY 1KFXL 1KQMB 4UPGA 1YVHA 2LLSA 1IWQA 1B47A 1FI5A 2LLUA 3SG2A 4MZLA 5ER5A 2LVIA 1KCYA 1RWYA 3BQ3A 3IF7A 3LK1A 3LLEA 1X02A 3EK8A 4CLNA 3PSRA 1ALWA 2K7DA 2LMTA 5DKQA 2G2BA 5AEQA 1B9AA 3TDIA 2BCXA 1DGVA 1A29A 4OV2A 3NSIA 5KU1A 1L7ZA 1Y1XA 2CCMA 4GGNA 1S6IA 2LC5A 1NCXA 4L9MA 1W7IB 4OCIA 4PDZA 1C07A 1NX2A 2JXLA 2AMIA 4CIDA 2ZNDA 2H2KA 1OZSA 1XO5A 1YR5A 4M2PA 2JZIA 1QV1A 1QXPA 5AANA 2Q4UA 3E3RA 2KHNA 1XFXO 2LM5A 4I5NB 2MBXA 3FS7A 1UUSA 3JTDC 4WQ3A 1QLKA 3SG3A 1N0YA 4OR9B 3SG5A 1YRUB 4CPVA 1DGUA 5TNCA 4E68A 1U5IB 2JQ6A 2ZFDA 5CSFA 1QTXA 1KWOB 1Y1UA 1A03A 1FW4A 1WLZA 1MXLC 2KYCA 1CLBA 1K9PA 1OOJA 2Y1MA 1IRJA 1B4CA 1TRFA 3PM8A 2KDHA 1ZUZA 3TDZA 3A4UB 1M46A 4I5KA 2K7CA 2JWWA 2KQ6A 1OMVA 1RJVA 4ORCB 1EJ3A 2M7NA 3VRRA 1OQPA 1PVAA 2KBIA 2M9GA 4PHMA 4FQOA 1CLMA 2KFGA 2HQWA 2JXCA 1WRZA 2EC6C 2JPTA 1TNPA 3H4SE 3PN7B 3SG4A 3I5IC 3C1VA 2PALA 1F54A 4PALA 1RTP1 1S1EA 4ZCVA 1E8AA 3DF0B 4YI8A 4YGBB 1TCOB 4YRUA 3CR4X 2OS8B 2ZN9A 1SL7A 1LKJA 2OPOA 1M63B 2BE6A 1AJ5A 3LCPC 3BOWA 1SKTA 1SY9A 4N1FA 3WXAA 1R6PA 4MZKA 2HPSA 1QV0A 5G08A 5CSJA 1DJYA 1DJXA 2ZKMX 3KF9A 4CFRA 1LA3A 3CR2A 4DUQA 1GJYA 4ZCUA 3CLNA 1NP8A 2SCPA 2EC6B 3TDUA 2MLFC 3BUMB 3I5IB 3LK0A 4YGAA 3TS5C 1A75B 5ER4X 2LVKA 2F3YA 4PCWA 1WDCC 1M45A 2HQ8A 2WOSA 3OB2B 3VRQA 1SNLA 1HQVA 3PALA 4ICBA 2CXJA 1DVIA 1J1DA 1ZMZA 5HKYA 2I18A 2L4HA 1UWOA 4XJKA 1CFPA 1YVLA 1KQMC 2H61A 2KAYA 2MLEC 4AOMA 1IKUA 3MSEB 2MJWB 1XYDA 2NXQA 4Q04A 1JFJA 1SK6D 1YURA 5HYDA 3DVKA 1BMOA 4IL1A 3RM1A 1YRTB 1IG5A 2PSRA 3WHUB 2H61C 1BU3A 3CGAA 1G4YR 1WDCB 1JFKA 4GUKA 5HLOA 4ORAB 1PALA 1MHOA 3O4YA 2D8NA 1NX0A 1Y6WA 4GFTA 4TNCA 1A2XA 3GOFA 1ZACA 1CFFA 4YGDB 1SL9A 1KFXS 5K89A 3FWCA 3NXAA 2RGIA 2M97A 1SPYA 3JVTC 4OVNF 2FJUB 3EK7A 5D7FA 1SRAA 1K93D 2ZN8A 2ZNEA 1DTLA 3CZTX 4P5OE 1XA5A 1QX7A 2DOQA 4JQ0D 1NPQA 5I8NA 4NQGA 4I5LB 4HRGA 4HRHA 1H4BA 1KWOC 1K2HA 1DT7B 5I2QA 4N1GA 1M39A 1KFUL 4F0ZB 2PRUA 2M1KB 3AKBA 2F8PA 1F8HA 1TTXA 3NSLA 3EKHA 3AAJA 4GNKB 2O5GA 4HREE 2L2EA 1AK8A 3TUYC 4WRIA 1QIVA 2KYFA 1TIZA 1SW8A 2AUCA 3PFVA 1F4OA 1K9UA 3JVTB 4JPZB 1EL4A 1DJHA 2JU0A 1YTZC 1NSHA 2EHBA 2LP3A 2K2AA
chains in the Genus database with same CATH superfamily
1SBJA 3DF0A 3EVRA 2SASA 1TWOA 2COLB 3EVUA 2LHLA 1IQ5A 1VRKA 1PSBA 3BYAA 4PE0A 1B8RA 4A4CA 2WCFA 2BCAA 2KLDA 2LCPA 4I5JA 3PN7C 1EH2A 2I2RE 2NZ0A 1TNQA 1A4PA 1EG4A 1RECA 1RROA 5CSNA 2OTGB 3EVVA 1YUSA 1MUXA 4MSPA 1JF0A 2CNPA 2ZRSA 2OS8C 4XYNA 3R1PA 2NCPA 3L4LA 4GGFC 3TUYB 3HX4A 1TCFA 1B8LA 1XFUO 1Z4HA 4C0JA 1XFYO 5CPVA 1J7OA 1IJ6A 3WNXB 1NUBA 2KI4B 1CLLA 5CSIA 1Y1AA 2LVJA 5FI7A 3SIAA 1QJTA 1P28A 4AQJA 4P2YB 2AAOA 2BL0C 3D0YA 3TZ1A 1TN4A 5B8IB 1SMGA 1K90D 3IQOA 1K8UA 2Q91A 1OE9B 3OGNA 3I5HB 2ERBA 4WQ2A 1S3PA 1B1GA 5FI6A 2LAPA 2IS9A 2PMYA 1F55A 1J7PA 5AERA 1FI6A 1IH0A 2HF5A 2M7LA 2JC2A 1UP5A 4MVFA 1LA0A 4ETOA 1IIOA 3SG6A 3CTNA 3VGOA 2LNKA 1BT6A 1C7WA 1G33A 2LV7A 1KSOA 2WCEA 1W9ZA 5HKWA 2KAVA 1QVIZ 3WHTB 5PALA 1LINA 2BBMA 2LLTA 2JOJA 4BY5A 4M2QA 3D10A 2KBMA 2Y5IA 3ZNIA 1V1GA 2BL0B 4PE7A 1F4QA 1DF0B 3F45A 4M2OA 1TNWA 3O2PA 3D75A 1L2OB 2EGDA 1SCMB 2BE4A 2WORA 4N5XA 3OX6A 4NDCA 1MQ1A 2FJYA 3S0EA 3OP0A 4QJ5B 1D1OA 1AJ4A 1QVIY 2HETA 3CWGA 3R1VA 2GGZA 2JT8A 1CNPA 3N7HA 5AXIA 2I7AA 1BR4B 2V53A 1YUTA 4MBEA 2QACA 3ICBA 3EK4A 3Q8IA 2JTZA 1FPWA 3BUOB 1NX3A 1SCVA 2KNEA 1LVCD 3NGVA 1C7VA 4DIRA 1K95A 1DC1A 1SR6B 2CBLA 2L5YA 1CMFA 5JJGA 2E6WA 1KSMA 3KEVA 3PATA 4JD9A 4MZJA 1PRWA 4MRYA 3IQQA 3FE9A 4YGEB 2BKIB 5DICA 1KK7Z 2FCDA 1GGWA 3EKJA 2LANA 3DY9A 4MLWA 1J7QA 2G9BA 1C3ZA 1UURA 1CDLA 2R2IA 2BKHB 4GBAA 4YI9A 1AUIB 2WNDA 1K96A 2BECA 1S5GZ 1QX5B 1UHKA 1XK4C 2QEHA 1JSAA 2LMUA 2WC5A 3FWBA 1XFWO 3CS1A 1EG3A 2LVVA 5BPJA 1QS7A 1M31A 1S36A 1OZOA 1DJWA 5IBWA 2KFHA 1KK7Y 1S6JA 2KGBC 2Y1NA 1DQEA 2A4JA 3FIAA 3OHMB 4DS7A 1WLMA 2B1UA 3SG7A 3BOWB 3KPXA 4QJ3B 1U5IA 2KI6C 3CZ1A 1PSRA 1XFRA 2GGMA 1UHIA 2M49B 2LHIA 1S5GY 1TOPA 1QATA 1F70A 4QJ4B 1PULA 2F33A 1YX7A 1JF2A 1AVSA 1ZFSA 2TN4A 2F2OA 4DCKA 2K60A 5DKRA 2Y4QA 5KSZA 3S0AA 1LXFC 3DVEA 1MWNA 1KFUS 1K9KA 2OTGC 1IQ3A 4MRXA 2L0PA 3DVJA 3D74A 1CDMA 5JOLA 1CKKA 5I2LA 2KGRA 2LUCA 3SS4A 3OB1B 1IJ5A 2FCEA 2L51A 2E30A 2KSPA 2MAZA 2F2PA 2M8UA 2O60A 3I5FB 3L47A 5I2OA 4XJKB 2KI4C 2P6BB 1OMRA 2ISDA 1J7RA 1DJZA 2NCOA 2MRDA 4YBHB 1OOIX 1CDNA 3CZ0A 2M3WA 1QWVA 1OMDA 2PVBA 3OBVA 4OKHA 1KK8B 3O6BA 4GGFA 3D73A 3I5HC 2WCJA 3BUNB 1DMOA 1J55A 4GAOA 3AAKA 1EXRA 1SYMA 1WRLA 1AHRA 1IGVA 2L4IA 1XVJA 2FOTA 1N2DA 2JULA 2PASA 1N65A 1YUUA 2KFFA 2KPHA 3RLZA 1BG1A 5DKNA 4IJ7A 3VRPA 1S26D 2KAXA 1Z2CB 3SJSA 1DF0A 1MXEA 1ZOTB 1BOCA 2QPTA 1JBAA 4PHKA 2LMVA 1NIWA 4MEWA 4CFQA 1QASA 4PT1A 1S6CA 3UO9A 1A75A 1JC2A 4PE1A 1R2UA 5AFPA 3A8RA 4DRWA 3NSKA 1B8CA 3D77A 3KO0A 1BJFA 3I5GC 5D69A 5HL1A 2VRGA 1KQVA 3S0GA 1L2OC 3O78A 1SCMC 1BODA 4A4BA 1GGZA 5J3XA 1WRKA 4PHJA 5FYXA 2JRFA 1CDPA 3BXKA 2JNFA 1JWDA 2M29A 1FBVA 1ORGA 1Q80A 1Y0VH 2CT9A 2KOTA 3NHIA 3DVMA 3DXLA 1DJIA 4USLA 2K2FA 1XFVO 2K7OA 4HSZA 2LP2A 3JTDB 4C0KA 2JNXA 2WC8A 2JTTA 3NHTA 1SR6C 2F3ZA 3GK1A 5D3OA 3SIBA 3S0DA 2CTNA 4AQIA 1CM1A 2K7BA 1DJGA 2ZRTA 3I5GB 1YX8A 2GV5A 1FF1A 1GQMA 1PK0D 1NWDA 3GK4X 3B6XA 3GK2A 2MA2A 3B87A 5GQQC 1RFJA 5KTYA 1NX1A 4GPLB 2KLEA 3BUXB 4BY4A 4JKTA 2JPOA 2M1UA 1QX2A 3VROA 3CZ2A 1K94A 1UHJA 2LE9B 3CABA 3EG5B 3KHEA 1OW4A 1TNXA 5I94A 3OX5A 1XFZO 2QDIA 1CB1A 2L50A 1CFCA 3VRNA 1MF8B 2JT3A 2WCBA 2BCBA 2K0JA 2LUXA 3CR5X 1CTRA 1XK4A 4FTGA 1AP4A 1BR1B 2JT0A 4NDBA 3HCMA 3CDNA 1PVBA 1CMGA 3K21A 3M0WA 3ZWHA 4PHNA 4NDDA 3D0YB 4D1EA 2M0RA 5HLVA 1CM4A 2BBNA 1MR8A 4F7FA 1J1EA 3DD4A 1OOFA 2L5XB 1CFDA 4U8DA 3LL8B 1UHHA 1QIWA 1QLSA 3R1OA 3PJIA 1ODBA 1JUOA 4MN0A 1H8BA 2L98A 3D76A 5HKZA 1OSAA 1ALVA 4YGCB 1NCZA 2KI6D 5F6TA 2KQYA 1HT9A 1WY9A 1B7TZ 2K8MB 2NLNA 3B86A 3I5FC 1BLQA 4PE4A 2PYQA 2WCHA 3TS5B 4JWQA 5EL2A 3PLFB 1UHNA 1BF5A 2K61A 1F71A 1RK9A 2QEOA 4C0LA 3BUWB 1G8IA 1KK8C 3NSOA 4ORBB 1NCYA 2I94A 2MHHA 3AKAA 1NYAA 1SL8A 3QRXA 3VB1A 1V1FA 4R1EA 1W7JB 1B7TY 1KFXL 1KQMB 4UPGA 1YVHA 2LLSA 1IWQA 3B7AA 1B47A 1FI5A 2LLUA 3SG2A 4MZLA 3CYZA 5ER5A 2LVIA 3S0FA 1KCYA 1RWYA 3BQ3A 3IF7A 3LK1A 3LLEA 1X02A 3EK8A 4CLNA 3PSRA 1ALWA 2K7DA 2LMTA 1GM0A 5DKQA 2G2BA 5AEQA 1B9AA 3BJHA 3TDIA 2YGUA 2BCXA 1DGVA 1A29A 4OV2A 3NSIA 5KU1A 1L7ZA 1Y1XA 2CCMA 4GGNA 3K1EA 1S6IA 2LC5A 1NCXA 4L9MA 1W7IB 4OCIA 2QEVA 4PDZA 1C07A 1NX2A 2JXLA 2AMIA 4CIDA 3QMEA 2ZNDA 2H2KA 1OZSA 1OOHA 1XO5A 1YR5A 2JZIA 1QV1A 1QXPA 4M2PA 5AANA 2Q4UA 3E3RA 2KHNA 1XFXO 2PQLA 2LM5A 4I5NB 2MBXA 3FS7A 1UUSA 3JTDC 3FE6A 1QLKA 4WQ3A 1N0YA 3SG3A 4OR9B 3SG5A 1YRUB 4CPVA 1DGUA 5TNCA 3BFHA 4E68A 3D78A 1U5IB 2JQ6A 2ZFDA 5CSFA 1QTXA 1KWOB 1Y1UA 1OOGA 1FW4A 1WLZA 1A03A 1MXLC 2KYCA 1CLBA 1K9PA 1OOJA 2Y1MA 1IRJA 3SS3A 1B4CA 1TRFA 3PM2A 3PM8A 2KDHA 4FQTA 1ZUZA 4INXA 3TDZA 3A4UB 1M46A 4I5KA 3UNWA 2K7CA 2JWWA 2KQ6A 1OMVA 1RJVA 3IVTA 4ORCB 1EJ3A 2M7NA 3FE8A 3VRRA 1OQPA 1PVAA 2BNXA 2KBIA 2M9GA 4PHMA 4FQOA 1CLMA 2KFGA 2HQWA 2JXCA 1WRZA 2EC6C 2JPTA 1TNPA 2WCKA 3H4SE 3PN7B 3SG4A 3I5IC 3C1VA 2WC6A 2PALA 1F54A 3R72A 4PALA 1RTP1 4OZDA 1S1EA 4ZCVA 2WCMA 1E8AA 3DF0B 2H8VA 4YI8A 4YGBB 1TCOB 3SS5A 4YRUA 3CR4X 2OS8B 2ZN9A 1SL7A 1LKJA 2OPOA 1M63B 2BE6A 1AJ5A 2QEBA 3LCPC 3BOWA 1SKTA 1SY9A 4N1FA 3WXAA 1R6PA 4MZKA 1SSEB 1C3YA 2HPSA 4KYNA 1QV0A 5G08A 5CSJA 1DJYA 1DJXA 2ZKMX 3KF9A 4CFRA 1LA3A 3CR2A 4DUQA 1GJYA 3RZSA 4ZCUA 3CLNA 1NP8A 2SCPA 2EC6B 3BFAA 3TDUA 2MLFC 3BUMB 3I5IB 3LK0A 4YGAA 3TS5C 1A75B 5ER4X 2LVKA 2F3YA 4PCWA 2P70A 1WDCC 1M45A 2HQ8A 2P71A 2WOSA 3OB2B 3BFBA 3VRQA 1SNLA 1HQVA 3PALA 3S0BA 4ICBA 2CXJA 1DVIA 1J1DA 1ZMZA 5HKYA 2I18A 2L4HA 1UWOA 4XJKA 1CFPA 1YVLA 1KQMC 2H61A 2KAYA 2MLEC 2L2CA 4AOMA 1IKUA 2WCLA 3V2LA 1T14A 3MSEB 2MJWB 1XYDA 2NXQA 4Q04A 1JFJA 1SK6D 1YURA 5HYDA 3L4AA 3DVKA 1BMOA 4IL1A 3RM1A 1YRTB 1IG5A 2PSRA 3WHUB 2H61C 1BU3A 3CGAA 1G4YR 1WDCB 1JFKA 4GUKA 5HLOA 3DYEA 4ORAB 1DELA 1LS8A 1PALA 1MHOA 3DZTA 3O4YA 2D8NA 1NX0A 1Y6WA 4GFTA 4TNCA 1A2XA 3GOFA 1ZACA 1CFFA 4YGDB 1SL9A 1KFXS 5K89A 3FWCA 1TUZA 3NXAA 2RGIA 3B88A 2M97A 1SPYA 3JVTC 4OVNF 1TUJA 2FJUB 3EK7A 5D7FA 1SRAA 1K93D 2ZN8A 2ZNEA 1DTLA 3CZTX 4P5OE 1XA5A 1QX7A 2DOQA 4JQ0D 1NPQA 5I8NA 4NQGA 4I5LB 4HRGA 4HRHA 1H4BA 1KWOC 1K2HA 1DT7B 5I2QA 4N1GA 4INWA 1M39A 1KFUL 4F0ZB 2GTEA 2PRUA 2M1KB 3AKBA 2F8PA 1F8HA 1TTXA 3NSLA 3EKHA 3AAJA 4GNKB 2O5GA 4HREE 2L2EA 1AK8A 3O4XA 3TUYC 4WRIA 5FI2A 1QIVA 2KYFA 1TIZA 1SW8A 2AUCA 3PFVA 1F4OA 1K9UA 3JVTB 4JPZB 1EL4A 1DEKA 1DJHA 2JU0A 1YTZC 1NSHA 2EHBA 2LP3A 2BAPA 2K2AA
chains in the Genus database with same CATH topology
1SBJA 3DF0A 3EVRA 2SASA 2COLB 3EVUA 2LHLA 1IQ5A 1VRKA 1PSBA 3BYAA 4PE0A 1B8RA 4A4CA 2WCFA 2BCAA 2LCPA 4I5JA 3PN7C 1EH2A 2I2RE 2NZ0A 1TNQA 1A4PA 1EG4A 1RECA 1RROA 5CSNA 2OTGB 3EVVA 1YUSA 1MUXA 4MSPA 1JF0A 2CNPA 2ZRSA 2OS8C 4XYNA 2NCPA 4GGFC 3TUYB 3HX4A 1TCFA 1B8LA 1XFUO 4C0JA 1XFYO 5CPVA 1J7OA 1IJ6A 3WNXB 1NUBA 2KI4B 1CLLA 5CSIA 1Y1AA 2LVJA 3SIAA 1QJTA 4AQJA 4P2YB 2AAOA 2BL0C 3D0YA 3TZ1A 1TN4A 5B8IB 1SMGA 1K90D 3IQOA 1K8UA 2Q91A 1OE9B 3I5HB 4WQ2A 1S3PA 1B1GA 2LAPA 2IS9A 2PMYA 1F55A 1J7PA 5AERA 1FI6A 1IH0A 2HF5A 2M7LA 2JC2A 1UP5A 4MVFA 1LA0A 4ETOA 3SG6A 3CTNA 3VGOA 2LNKA 1BT6A 1C7WA 1G33A 2LV7A 1KSOA 2WCEA 5HKWA 2KAVA 1QVIZ 3WHTB 5PALA 1LINA 2BBMA 2LLTA 2JOJA 4BY5A 4M2QA 3D10A 2KBMA 2Y5IA 3ZNIA 1V1GA 2BL0B 4PE7A 1F4QA 1DF0B 3F45A 4M2OA 1TNWA 3O2PA 1L2OB 2EGDA 1SCMB 2BE4A 2WORA 4N5XA 3OX6A 4NDCA 1MQ1A 3OP0A 4QJ5B 1D1OA 1AJ4A 1QVIY 2HETA 3CWGA 1CNPA 2GGZA 2JT8A 5AXIA 2I7AA 1BR4B 2V53A 1YUTA 4MBEA 2QACA 3ICBA 3EK4A 1FPWA 2JTZA 3BUOB 1NX3A 1SCVA 2KNEA 1LVCD 1C7VA 4DIRA 1K95A 1SR6B 2CBLA 1CMFA 5JJGA 2E6WA 1KSMA 3KEVA 3PATA 4MZJA 1PRWA 4MRYA 3IQQA 4YGEB 2BKIB 1KK7Z 2FCDA 1GGWA 3EKJA 2LANA 4MLWA 1J7QA 2G9BA 1UURA 1CDLA 2R2IA 2BKHB 4GBAA 4YI9A 1AUIB 2WNDA 1K96A 2BECA 1S5GZ 1QX5B 1UHKA 1XK4C 1JSAA 2LMUA 3FWBA 1XFWO 3CS1A 1EG3A 2LVVA 5BPJA 1QS7A 1M31A 1S36A 1OZOA 1DJWA 5IBWA 2KFHA 1KK7Y 1S6JA 2KGBC 2Y1NA 2A4JA 3FIAA 3OHMB 4DS7A 1WLMA 2B1UA 3SG7A 3BOWB 3KPXA 4QJ3B 1U5IA 2KI6C 1PSRA 2GGMA 1UHIA 2M49B 2LHIA 1S5GY 1TOPA 1QATA 1F70A 4QJ4B 1PULA 2F33A 1YX7A 1JF2A 1AVSA 1ZFSA 2TN4A 2F2OA 4DCKA 5DKRA 2Y4QA 5KSZA 1LXFC 3DVEA 1MWNA 1KFUS 1K9KA 2OTGC 1IQ3A 4MRXA 2L0PA 3DVJA 1CDMA 5JOLA 1CKKA 5I2LA 2KGRA 2LUCA 3OB1B 1IJ5A 2FCEA 2L51A 2E30A 2KSPA 2MAZA 2F2PA 2M8UA 2O60A 3I5FB 5I2OA 4XJKB 2KI4C 2P6BB 1OMRA 2ISDA 1J7RA 1DJZA 2NCOA 2MRDA 4YBHB 1CDNA 2M3WA 1OMDA 2PVBA 4OKHA 1KK8B 3O6BA 4GGFA 3I5HC 3BUNB 1DMOA 1J55A 4GAOA 3AAKA 1EXRA 1SYMA 1WRLA 1AHRA 1IGVA 2L4IA 1XVJA 2FOTA 1N2DA 2JULA 2PASA 1N65A 1YUUA 2KFFA 3RLZA 1BG1A 5DKNA 3VRPA 1S26D 2KAXA 3SJSA 1DF0A 1MXEA 1ZOTB 1BOCA 2QPTA 1JBAA 4PHKA 2LMVA 1NIWA 4MEWA 4CFQA 1QASA 1S6CA 1A75A 1JC2A 4PE1A 1R2UA 5AFPA 3A8RA 4DRWA 3NSKA 1B8CA 3KO0A 5D69A 1BJFA 3I5GC 2VRGA 1KQVA 1L2OC 3O78A 1SCMC 1BODA 4A4BA 1GGZA 5J3XA 1WRKA 4PHJA 5FYXA 2JRFA 1CDPA 3BXKA 2JNFA 1JWDA 2M29A 1FBVA 2CT9A 1Q80A 1Y0VH 4USLA 2KOTA 3DVMA 1DJIA 2K2FA 1XFVO 2K7OA 4HSZA 2LP2A 3JTDB 4C0KA 2JNXA 2WC8A 2JTTA 1SR6C 2F3ZA 3GK1A 3SIBA 2CTNA 4AQIA 1CM1A 2K7BA 1DJGA 2ZRTA 3I5GB 1YX8A 2GV5A 1FF1A 1GQMA 1PK0D 1NWDA 3GK4X 3GK2A 2MA2A 5GQQC 1RFJA 5KTYA 1NX1A 4GPLB 4BY4A 3BUXB 2M1UA 1QX2A 3VROA 1K94A 1UHJA 2LE9B 3KHEA 1TNXA 3OX5A 1XFZO 1CB1A 2L50A 1CFCA 3VRNA 1MF8B 2JT3A 2WCBA 2BCBA 2K0JA 2LUXA 3CR5X 1CTRA 1XK4A 4FTGA 1AP4A 1BR1B 2JT0A 4NDBA 3HCMA 1PVBA 1CMGA 3K21A 3M0WA 3ZWHA 4PHNA 4NDDA 3D0YB 4D1EA 2M0RA 5HLVA 1CM4A 2BBNA 1MR8A 1J1EA 3DD4A 2L5XB 1CFDA 4U8DA 3LL8B 1UHHA 1QIWA 1QLSA 1ODBA 1JUOA 4MN0A 1H8BA 2L98A 5HKZA 1OSAA 1ALVA 4YGCB 1NCZA 2KI6D 5F6TA 2KQYA 1HT9A 1WY9A 1B7TZ 2K8MB 2NLNA 3I5FC 1BLQA 4PE4A 3TS5B 4JWQA 3PLFB 1UHNA 1BF5A 2K61A 1F71A 1RK9A 4C0LA 3BUWB 1G8IA 1KK8C 3NSOA 4ORBB 1NCYA 2I94A 2MHHA 3AKAA 1NYAA 1SL8A 3QRXA 1V1FA 4R1EA 1W7JB 1B7TY 1KFXL 1KQMB 4UPGA 1YVHA 2LLSA 1IWQA 1B47A 1FI5A 2LLUA 3SG2A 4MZLA 5ER5A 2LVIA 1KCYA 1RWYA 3BQ3A 3IF7A 3LK1A 3LLEA 1X02A 3EK8A 4CLNA 3PSRA 1ALWA 2K7DA 2LMTA 5DKQA 2G2BA 5AEQA 1B9AA 3TDIA 2BCXA 1DGVA 1A29A 4OV2A 3NSIA 5KU1A 1L7ZA 1Y1XA 2CCMA 4GGNA 1S6IA 2LC5A 1NCXA 4L9MA 1W7IB 4OCIA 4PDZA 1C07A 1NX2A 2JXLA 2AMIA 4CIDA 2ZNDA 2H2KA 1OZSA 1XO5A 1YR5A 4M2PA 2JZIA 1QV1A 1QXPA 5AANA 2Q4UA 3E3RA 2KHNA 1XFXO 2LM5A 4I5NB 2MBXA 3FS7A 1UUSA 3JTDC 4WQ3A 1QLKA 3SG3A 1N0YA 4OR9B 3SG5A 1YRUB 4CPVA 1DGUA 5TNCA 4E68A 1U5IB 2JQ6A 2ZFDA 5CSFA 1QTXA 1KWOB 1Y1UA 1A03A 1FW4A 1WLZA 1MXLC 2KYCA 1CLBA 1K9PA 1OOJA 2Y1MA 1IRJA 1B4CA 1TRFA 3PM8A 2KDHA 1ZUZA 3TDZA 3A4UB 1M46A 4I5KA 2K7CA 2JWWA 2KQ6A 1OMVA 1RJVA 4ORCB 1EJ3A 2M7NA 3VRRA 1OQPA 1PVAA 2KBIA 2M9GA 4PHMA 4FQOA 1CLMA 2KFGA 2HQWA 2JXCA 1WRZA 2EC6C 2JPTA 1TNPA 3H4SE 3PN7B 3SG4A 3I5IC 3C1VA 2PALA 1F54A 4PALA 1RTP1 1S1EA 4ZCVA 1E8AA 3DF0B 4YI8A 4YGBB 1TCOB 4YRUA 3CR4X 2OS8B 2ZN9A 1SL7A 1LKJA 2OPOA 1M63B 2BE6A 1AJ5A 3LCPC 3BOWA 1SKTA 1SY9A 4N1FA 3WXAA 1R6PA 4MZKA 2HPSA 1QV0A 5G08A 5CSJA 1DJYA 1DJXA 2ZKMX 3KF9A 4CFRA 1LA3A 3CR2A 4DUQA 1GJYA 4ZCUA 3CLNA 1NP8A 2SCPA 2EC6B 3TDUA 2MLFC 3BUMB 3I5IB 3LK0A 4YGAA 3TS5C 1A75B 5ER4X 2LVKA 2F3YA 4PCWA 1WDCC 1M45A 2HQ8A 2WOSA 3OB2B 3VRQA 1SNLA 1HQVA 3PALA 4ICBA 2CXJA 1DVIA 1J1DA 1ZMZA 5HKYA 2I18A 2L4HA 1UWOA 4XJKA 1CFPA 1YVLA 1KQMC 2H61A 2KAYA 2MLEC 4AOMA 1IKUA 3MSEB 2MJWB 1XYDA 2NXQA 4Q04A 1JFJA 1SK6D 1YURA 5HYDA 3DVKA 1BMOA 4IL1A 3RM1A 1YRTB 1IG5A 2PSRA 3WHUB 2H61C 1BU3A 3CGAA 1G4YR 1WDCB 1JFKA 4GUKA 5HLOA 4ORAB 1PALA 1MHOA 3O4YA 2D8NA 1NX0A 1Y6WA 4GFTA 4TNCA 1A2XA 3GOFA 1ZACA 1CFFA 4YGDB 1SL9A 1KFXS 5K89A 3FWCA 3NXAA 2RGIA 2M97A 1SPYA 3JVTC 4OVNF 2FJUB 3EK7A 5D7FA 1SRAA 1K93D 2ZN8A 2ZNEA 1DTLA 3CZTX 4P5OE 1XA5A 1QX7A 2DOQA 4JQ0D 1NPQA 5I8NA 4NQGA 4I5LB 4HRGA 4HRHA 1H4BA 1KWOC 1K2HA 1DT7B 5I2QA 4N1GA 1M39A 1KFUL 4F0ZB 2PRUA 2M1KB 3AKBA 2F8PA 1F8HA 1TTXA 3NSLA 3EKHA 3AAJA 4GNKB 2O5GA 4HREE 2L2EA 1AK8A 3TUYC 4WRIA 1QIVA 2KYFA 1TIZA 1SW8A 2AUCA 3PFVA 1F4OA 1K9UA 3JVTB 4JPZB 1EL4A 1DJHA 2JU0A 1YTZC 1NSHA 2EHBA 2LP3A 2K2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SBJ A;  3DF0 A;  3EVR A;  2SAS A;  2COL B;  3EVU A;  2LHL A;  1IQ5 A;  1VRK A;  1PSB A;  3BYA A;  4PE0 A;  1B8R A;  4A4C A;  2WCF A;  2BCA A;  2LCP A;  4I5J A;  3PN7 C;  1EH2 A;  2I2R E;  2NZ0 A;  1TNQ A;  1A4P A;  1EG4 A;  1REC A;  1RRO A;  5CSN A;  2OTG B;  3EVV A;  1YUS A;  1MUX A;  4MSP A;  1JF0 A;  2CNP A;  2ZRS A;  2OS8 C;  4XYN A;  2NCP A;  4GGF C;  3TUY B;  3HX4 A;  1TCF A;  1B8L A;  1XFU O;  4C0J A;  1XFY O;  5CPV A;  1J7O A;  1IJ6 A;  3WNX B;  1NUB A;  2KI4 B;  1CLL A;  5CSI A;  1Y1A A;  2LVJ A;  3SIA A;  1QJT A;  4AQJ A;  4P2Y B;  2AAO A;  2BL0 C;  3D0Y A;  3TZ1 A;  1TN4 A;  5B8I B;  1SMG A;  1K90 D;  3IQO A;  1K8U A;  2Q91 A;  1OE9 B;  3I5H B;  4WQ2 A;  1S3P A;  1B1G A;  2LAP A;  2IS9 A;  2PMY A;  1F55 A;  1J7P A;  5AER A;  1FI6 A;  1IH0 A;  2HF5 A;  2M7L A;  2JC2 A;  1UP5 A;  4MVF A;  1LA0 A;  4ETO A;  3SG6 A;  3CTN A;  3VGO A;  2LNK A;  1BT6 A;  1C7W A;  1G33 A;  2LV7 A;  1KSO A;  2WCE A;  5HKW A;  2KAV A;  1QVI Z;  3WHT B;  5PAL A;  1LIN A;  2BBM A;  2LLT A;  2JOJ A;  4BY5 A;  4M2Q A;  3D10 A;  2KBM A;  2Y5I A;  3ZNI A;  1V1G A;  2BL0 B;  4PE7 A;  1F4Q A;  1DF0 B;  3F45 A;  4M2O A;  1TNW A;  3O2P A;  1L2O B;  2EGD A;  1SCM B;  2BE4 A;  2WOR A;  4N5X A;  3OX6 A;  4NDC A;  1MQ1 A;  3OP0 A;  4QJ5 B;  1D1O A;  1AJ4 A;  1QVI Y;  2HET A;  3CWG A;  1CNP A;  2GGZ A;  2JT8 A;  5AXI A;  2I7A A;  1BR4 B;  2V53 A;  1YUT A;  4MBE A;  2QAC A;  3ICB A;  3EK4 A;  1FPW A;  2JTZ A;  3BUO B;  1NX3 A;  1SCV A;  2KNE A;  1LVC D;  1C7V A;  4DIR A;  1K95 A;  1SR6 B;  2CBL A;  1CMF A;  5JJG A;  2E6W A;  1KSM A;  3KEV A;  3PAT A;  4MZJ A;  1PRW A;  4MRY A;  3IQQ A;  4YGE B;  2BKI B;  1KK7 Z;  2FCD A;  1GGW A;  3EKJ A;  2LAN A;  4MLW A;  1J7Q A;  2G9B A;  1UUR A;  1CDL A;  2R2I A;  2BKH B;  4GBA A;  4YI9 A;  1AUI B;  2WND A;  1K96 A;  2BEC A;  1S5G Z;  1QX5 B;  1UHK A;  1XK4 C;  1JSA A;  2LMU A;  3FWB A;  1XFW O;  3CS1 A;  1EG3 A;  2LVV A;  5BPJ A;  1QS7 A;  1M31 A;  1S36 A;  1OZO A;  1DJW A;  5IBW A;  2KFH A;  1KK7 Y;  1S6J A;  2KGB C;  2Y1N A;  2A4J A;  3FIA A;  3OHM B;  4DS7 A;  1WLM A;  2B1U A;  3SG7 A;  3BOW B;  3KPX A;  4QJ3 B;  1U5I A;  2KI6 C;  1PSR A;  2GGM A;  1UHI A;  2M49 B;  2LHI A;  1S5G Y;  1TOP A;  1QAT A;  1F70 A;  4QJ4 B;  1PUL A;  2F33 A;  1YX7 A;  1JF2 A;  1AVS A;  1ZFS A;  2TN4 A;  2F2O A;  4DCK A;  5DKR A;  2Y4Q A;  5KSZ A;  1LXF C;  3DVE A;  1MWN A;  1KFU S;  1K9K A;  2OTG C;  1IQ3 A;  4MRX A;  2L0P A;  3DVJ A;  1CDM A;  5JOL A;  1CKK A;  5I2L A;  2KGR A;  2LUC A;  3OB1 B;  1IJ5 A;  2FCE A;  2L51 A;  2E30 A;  2KSP A;  2MAZ A;  2F2P A;  2M8U A;  2O60 A;  3I5F B;  5I2O A;  4XJK B;  2KI4 C;  2P6B B;  1OMR A;  2ISD A;  1J7R A;  1DJZ A;  2NCO A;  2MRD A;  4YBH B;  1CDN A;  2M3W A;  1OMD A;  2PVB A;  4OKH A;  1KK8 B;  3O6B A;  4GGF A;  3I5H C;  3BUN B;  1DMO A;  1J55 A;  4GAO A;  3AAK A;  1EXR A;  1SYM A;  1WRL A;  1AHR A;  1IGV A;  2L4I A;  1XVJ A;  2FOT A;  1N2D A;  2JUL A;  2PAS A;  1N65 A;  1YUU A;  2KFF A;  3RLZ A;  1BG1 A;  5DKN A;  3VRP A;  1S26 D;  2KAX A;  3SJS A;  1DF0 A;  1MXE A;  1ZOT B;  1BOC A;  2QPT A;  1JBA A;  4PHK A;  2LMV A;  1NIW A;  4MEW A;  4CFQ A;  1QAS A;  1S6C A;  1A75 A;  1JC2 A;  4PE1 A;  1R2U A;  5AFP A;  3A8R A;  4DRW A;  3NSK A;  1B8C A;  3KO0 A;  5D69 A;  1BJF A;  3I5G C;  2VRG A;  1KQV A;  1L2O C;  3O78 A;  1SCM C;  1BOD A;  4A4B A;  1GGZ A;  5J3X A;  1WRK A;  4PHJ A;  5FYX A;  2JRF A;  1CDP A;  3BXK A;  2JNF A;  1JWD A;  2M29 A;  1FBV A;  2CT9 A;  1Q80 A;  1Y0V H;  4USL A;  2KOT A;  3DVM A;  1DJI A;  2K2F A;  1XFV O;  2K7O A;  4HSZ A;  2LP2 A;  3JTD B;  4C0K A;  2JNX A;  2WC8 A;  2JTT A;  1SR6 C;  2F3Z A;  3GK1 A;  3SIB A;  2CTN A;  4AQI A;  1CM1 A;  2K7B A;  1DJG A;  2ZRT A;  3I5G B;  1YX8 A;  2GV5 A;  1FF1 A;  1GQM A;  1PK0 D;  1NWD A;  3GK4 X;  3GK2 A;  2MA2 A;  5GQQ C;  1RFJ A;  5KTY A;  1NX1 A;  4GPL B;  4BY4 A;  3BUX B;  2M1U A;  1QX2 A;  3VRO A;  1K94 A;  1UHJ A;  2LE9 B;  3KHE A;  1TNX A;  3OX5 A;  1XFZ O;  1CB1 A;  2L50 A;  1CFC A;  3VRN A;  1MF8 B;  2JT3 A;  2WCB A;  2BCB A;  2K0J A;  2LUX A;  3CR5 X;  1CTR A;  1XK4 A;  4FTG A;  1AP4 A;  1BR1 B;  2JT0 A;  4NDB A;  3HCM A;  1PVB A;  1CMG A;  3K21 A;  3M0W A;  3ZWH A;  4PHN A;  4NDD A;  3D0Y B;  4D1E A;  2M0R A;  5HLV A;  1CM4 A;  2BBN A;  1MR8 A;  1J1E A;  3DD4 A;  2L5X B;  1CFD A;  4U8D A;  3LL8 B;  1UHH A;  1QIW A;  1QLS A;  1ODB A;  1JUO A;  4MN0 A;  1H8B A;  2L98 A;  5HKZ A;  1OSA A;  1ALV A;  4YGC B;  1NCZ A;  2KI6 D;  5F6T A;  2KQY A;  1HT9 A;  1WY9 A;  1B7T Z;  2K8M B;  2NLN A;  3I5F C;  1BLQ A;  4PE4 A;  3TS5 B;  4JWQ A;  3PLF B;  1UHN A;  1BF5 A;  2K61 A;  1F71 A;  1RK9 A;  4C0L A;  3BUW B;  1G8I A;  1KK8 C;  3NSO A;  4ORB B;  1NCY A;  2I94 A;  2MHH A;  3AKA A;  1NYA A;  1SL8 A;  3QRX A;  1V1F A;  4R1E A;  1W7J B;  1B7T Y;  1KFX L;  1KQM B;  4UPG A;  1YVH A;  2LLS A;  1IWQ A;  1B47 A;  1FI5 A;  2LLU A;  3SG2 A;  4MZL A;  5ER5 A;  2LVI A;  1KCY A;  1RWY A;  3BQ3 A;  3IF7 A;  3LK1 A;  3LLE A;  1X02 A;  3EK8 A;  4CLN A;  3PSR A;  1ALW A;  2K7D A;  2LMT A;  5DKQ A;  2G2B A;  5AEQ A;  1B9A A;  3TDI A;  2BCX A;  1DGV A;  1A29 A;  4OV2 A;  3NSI A;  5KU1 A;  1L7Z A;  1Y1X A;  2CCM A;  4GGN A;  1S6I A;  2LC5 A;  1NCX A;  4L9M A;  1W7I B;  4OCI A;  4PDZ A;  1C07 A;  1NX2 A;  2JXL A;  2AMI A;  4CID A;  2ZND A;  2H2K A;  1OZS A;  1XO5 A;  1YR5 A;  4M2P A;  2JZI A;  1QV1 A;  1QXP A;  5AAN A;  2Q4U A;  3E3R A;  2KHN A;  1XFX O;  2LM5 A;  4I5N B;  2MBX A;  3FS7 A;  1UUS A;  3JTD C;  4WQ3 A;  1QLK A;  3SG3 A;  1N0Y A;  4OR9 B;  3SG5 A;  1YRU B;  4CPV A;  1DGU A;  5TNC A;  4E68 A;  1U5I B;  2JQ6 A;  2ZFD A;  5CSF A;  1QTX A;  1KWO B;  1Y1U A;  1A03 A;  1FW4 A;  1WLZ A;  1MXL C;  2KYC A;  1CLB A;  1K9P A;  1OOJ A;  2Y1M A;  1IRJ A;  1B4C A;  1TRF A;  3PM8 A;  2KDH A;  1ZUZ A;  3TDZ A;  3A4U B;  1M46 A;  4I5K A;  2K7C A;  2JWW A;  2KQ6 A;  1OMV A;  1RJV A;  4ORC B;  1EJ3 A;  2M7N A;  3VRR A;  1OQP A;  1PVA A;  2KBI A;  2M9G A;  4PHM A;  4FQO A;  1CLM A;  2KFG A;  2HQW A;  2JXC A;  1WRZ A;  2EC6 C;  2JPT A;  1TNP A;  3H4S E;  3PN7 B;  3SG4 A;  3I5I C;  3C1V A;  2PAL A;  1F54 A;  4PAL A;  1RTP 1;  1S1E A;  4ZCV A;  1E8A A;  3DF0 B;  4YI8 A;  4YGB B;  1TCO B;  4YRU A;  3CR4 X;  2OS8 B;  2ZN9 A;  1SL7 A;  1LKJ A;  2OPO A;  1M63 B;  2BE6 A;  1AJ5 A;  3LCP C;  3BOW A;  1SKT A;  1SY9 A;  4N1F A;  3WXA A;  1R6P A;  4MZK A;  2HPS A;  1QV0 A;  5G08 A;  5CSJ A;  1DJY A;  1DJX A;  2ZKM X;  3KF9 A;  4CFR A;  1LA3 A;  3CR2 A;  4DUQ A;  1GJY A;  4ZCU A;  3CLN A;  1NP8 A;  2SCP A;  2EC6 B;  3TDU A;  2MLF C;  3BUM B;  3I5I B;  3LK0 A;  4YGA A;  3TS5 C;  1A75 B;  5ER4 X;  2LVK A;  2F3Y A;  4PCW A;  1WDC C;  1M45 A;  2HQ8 A;  2WOS A;  3OB2 B;  3VRQ A;  1SNL A;  1HQV A;  3PAL A;  4ICB A;  2CXJ A;  1DVI A;  1J1D A;  1ZMZ A;  5HKY A;  2I18 A;  2L4H A;  1UWO A;  4XJK A;  1CFP A;  1YVL A;  1KQM C;  2H61 A;  2KAY A;  2MLE C;  4AOM A;  1IKU A;  3MSE B;  2MJW B;  1XYD A;  2NXQ A;  4Q04 A;  1JFJ A;  1SK6 D;  1YUR A;  5HYD A;  3DVK A;  1BMO A;  4IL1 A;  3RM1 A;  1YRT B;  1IG5 A;  2PSR A;  3WHU B;  2H61 C;  1BU3 A;  3CGA A;  1G4Y R;  1WDC B;  1JFK A;  4GUK A;  5HLO A;  4ORA B;  1PAL A;  1MHO A;  3O4Y A;  2D8N A;  1NX0 A;  1Y6W A;  4GFT A;  4TNC A;  1A2X A;  3GOF A;  1ZAC A;  1CFF A;  4YGD B;  1SL9 A;  1KFX S;  5K89 A;  3FWC A;  3NXA A;  2RGI A;  2M97 A;  1SPY A;  3JVT C;  4OVN F;  2FJU B;  3EK7 A;  5D7F A;  1SRA A;  1K93 D;  2ZN8 A;  2ZNE A;  1DTL A;  3CZT X;  4P5O E;  1XA5 A;  1QX7 A;  2DOQ A;  4JQ0 D;  1NPQ A;  5I8N A;  4NQG A;  4I5L B;  4HRG A;  4HRH A;  1H4B A;  1KWO C;  1K2H A;  1DT7 B;  5I2Q A;  4N1G A;  1M39 A;  1KFU L;  4F0Z B;  2PRU A;  2M1K B;  3AKB A;  2F8P A;  1F8H A;  1TTX A;  3NSL A;  3EKH A;  3AAJ A;  4GNK B;  2O5G A;  4HRE E;  2L2E A;  1AK8 A;  3TUY C;  4WRI A;  1QIV A;  2KYF A;  1TIZ A;  1SW8 A;  2AUC A;  3PFV A;  1F4O A;  1K9U A;  3JVT B;  4JPZ B;  1EL4 A;  1DJH A;  2JU0 A;  1YTZ C;  1NSH A;  2EHB A;  2LP3 A;  2K2A A; 
#chains in the Genus database with same CATH topology
 1SBJ A;  3DF0 A;  3EVR A;  2SAS A;  1TWO A;  2COL B;  3EVU A;  2LHL A;  1IQ5 A;  1VRK A;  1PSB A;  3BYA A;  4PE0 A;  1B8R A;  4A4C A;  2WCF A;  2BCA A;  2KLD A;  2LCP A;  4I5J A;  3PN7 C;  1EH2 A;  2I2R E;  2NZ0 A;  1TNQ A;  1A4P A;  1EG4 A;  1REC A;  1RRO A;  5CSN A;  2OTG B;  3EVV A;  1YUS A;  1MUX A;  4MSP A;  1JF0 A;  2CNP A;  2ZRS A;  2OS8 C;  4XYN A;  3R1P A;  2NCP A;  3L4L A;  4GGF C;  3TUY B;  3HX4 A;  1TCF A;  1B8L A;  1XFU O;  1Z4H A;  4C0J A;  1XFY O;  5CPV A;  1J7O A;  1IJ6 A;  3WNX B;  1NUB A;  2KI4 B;  1CLL A;  5CSI A;  1Y1A A;  2LVJ A;  5FI7 A;  3SIA A;  1QJT A;  1P28 A;  4AQJ A;  4P2Y B;  2AAO A;  2BL0 C;  3D0Y A;  3TZ1 A;  1TN4 A;  5B8I B;  1SMG A;  1K90 D;  3IQO A;  1K8U A;  2Q91 A;  1OE9 B;  3OGN A;  3I5H B;  2ERB A;  4WQ2 A;  1S3P A;  1B1G A;  5FI6 A;  2LAP A;  2IS9 A;  2PMY A;  1F55 A;  1J7P A;  5AER A;  1FI6 A;  1IH0 A;  2HF5 A;  2M7L A;  2JC2 A;  1UP5 A;  4MVF A;  1LA0 A;  4ETO A;  1IIO A;  3SG6 A;  3CTN A;  3VGO A;  2LNK A;  1BT6 A;  1C7W A;  1G33 A;  2LV7 A;  1KSO A;  2WCE A;  1W9Z A;  5HKW A;  2KAV A;  1QVI Z;  3WHT B;  5PAL A;  1LIN A;  2BBM A;  2LLT A;  2JOJ A;  4BY5 A;  4M2Q A;  3D10 A;  2KBM A;  2Y5I A;  3ZNI A;  1V1G A;  2BL0 B;  4PE7 A;  1F4Q A;  1DF0 B;  3F45 A;  4M2O A;  1TNW A;  3O2P A;  3D75 A;  1L2O B;  2EGD A;  1SCM B;  2BE4 A;  2WOR A;  4N5X A;  3OX6 A;  4NDC A;  1MQ1 A;  2FJY A;  3S0E A;  3OP0 A;  4QJ5 B;  1D1O A;  1AJ4 A;  1QVI Y;  2HET A;  3CWG A;  3R1V A;  2GGZ A;  2JT8 A;  1CNP A;  3N7H A;  5AXI A;  2I7A A;  1BR4 B;  2V53 A;  1YUT A;  4MBE A;  2QAC A;  3ICB A;  3EK4 A;  3Q8I A;  2JTZ A;  1FPW A;  3BUO B;  1NX3 A;  1SCV A;  2KNE A;  1LVC D;  3NGV A;  1C7V A;  4DIR A;  1K95 A;  1DC1 A;  1SR6 B;  2CBL A;  2L5Y A;  1CMF A;  5JJG A;  2E6W A;  1KSM A;  3KEV A;  3PAT A;  4JD9 A;  4MZJ A;  1PRW A;  4MRY A;  3IQQ A;  3FE9 A;  4YGE B;  2BKI B;  5DIC A;  1KK7 Z;  2FCD A;  1GGW A;  3EKJ A;  2LAN A;  3DY9 A;  4MLW A;  1J7Q A;  2G9B A;  1C3Z A;  1UUR A;  1CDL A;  2R2I A;  2BKH B;  4GBA A;  4YI9 A;  1AUI B;  2WND A;  1K96 A;  2BEC A;  1S5G Z;  1QX5 B;  1UHK A;  1XK4 C;  2QEH A;  1JSA A;  2LMU A;  2WC5 A;  3FWB A;  1XFW O;  3CS1 A;  1EG3 A;  2LVV A;  5BPJ A;  1QS7 A;  1M31 A;  1S36 A;  1OZO A;  1DJW A;  5IBW A;  2KFH A;  1KK7 Y;  1S6J A;  2KGB C;  2Y1N A;  1DQE A;  2A4J A;  3FIA A;  3OHM B;  4DS7 A;  1WLM A;  2B1U A;  3SG7 A;  3BOW B;  3KPX A;  4QJ3 B;  1U5I A;  2KI6 C;  3CZ1 A;  1PSR A;  1XFR A;  2GGM A;  1UHI A;  2M49 B;  2LHI A;  1S5G Y;  1TOP A;  1QAT A;  1F70 A;  4QJ4 B;  1PUL A;  2F33 A;  1YX7 A;  1JF2 A;  1AVS A;  1ZFS A;  2TN4 A;  2F2O A;  4DCK A;  2K60 A;  5DKR A;  2Y4Q A;  5KSZ A;  3S0A A;  1LXF C;  3DVE A;  1MWN A;  1KFU S;  1K9K A;  2OTG C;  1IQ3 A;  4MRX A;  2L0P A;  3DVJ A;  3D74 A;  1CDM A;  5JOL A;  1CKK A;  5I2L A;  2KGR A;  2LUC A;  3SS4 A;  3OB1 B;  1IJ5 A;  2FCE A;  2L51 A;  2E30 A;  2KSP A;  2MAZ A;  2F2P A;  2M8U A;  2O60 A;  3I5F B;  3L47 A;  5I2O A;  4XJK B;  2KI4 C;  2P6B B;  1OMR A;  2ISD A;  1J7R A;  1DJZ A;  2NCO A;  2MRD A;  4YBH B;  1OOI X;  1CDN A;  3CZ0 A;  2M3W A;  1QWV A;  1OMD A;  2PVB A;  3OBV A;  4OKH A;  1KK8 B;  3O6B A;  4GGF A;  3D73 A;  3I5H C;  2WCJ A;  3BUN B;  1DMO A;  1J55 A;  4GAO A;  3AAK A;  1EXR A;  1SYM A;  1WRL A;  1AHR A;  1IGV A;  2L4I A;  1XVJ A;  2FOT A;  1N2D A;  2JUL A;  2PAS A;  1N65 A;  1YUU A;  2KFF A;  2KPH A;  3RLZ A;  1BG1 A;  5DKN A;  4IJ7 A;  3VRP A;  1S26 D;  2KAX A;  1Z2C B;  3SJS A;  1DF0 A;  1MXE A;  1ZOT B;  1BOC A;  2QPT A;  1JBA A;  4PHK A;  2LMV A;  1NIW A;  4MEW A;  4CFQ A;  1QAS A;  4PT1 A;  1S6C A;  3UO9 A;  1A75 A;  1JC2 A;  4PE1 A;  1R2U A;  5AFP A;  3A8R A;  4DRW A;  3NSK A;  1B8C A;  3D77 A;  3KO0 A;  1BJF A;  3I5G C;  5D69 A;  5HL1 A;  2VRG A;  1KQV A;  3S0G A;  1L2O C;  3O78 A;  1SCM C;  1BOD A;  4A4B A;  1GGZ A;  5J3X A;  1WRK A;  4PHJ A;  5FYX A;  2JRF A;  1CDP A;  3BXK A;  2JNF A;  1JWD A;  2M29 A;  1FBV A;  1ORG A;  1Q80 A;  1Y0V H;  2CT9 A;  2KOT A;  3NHI A;  3DVM A;  3DXL A;  1DJI A;  4USL A;  2K2F A;  1XFV O;  2K7O A;  4HSZ A;  2LP2 A;  3JTD B;  4C0K A;  2JNX A;  2WC8 A;  2JTT A;  3NHT A;  1SR6 C;  2F3Z A;  3GK1 A;  5D3O A;  3SIB A;  3S0D A;  2CTN A;  4AQI A;  1CM1 A;  2K7B A;  1DJG A;  2ZRT A;  3I5G B;  1YX8 A;  2GV5 A;  1FF1 A;  1GQM A;  1PK0 D;  1NWD A;  3GK4 X;  3B6X A;  3GK2 A;  2MA2 A;  3B87 A;  5GQQ C;  1RFJ A;  5KTY A;  1NX1 A;  4GPL B;  2KLE A;  3BUX B;  4BY4 A;  4JKT A;  2JPO A;  2M1U A;  1QX2 A;  3VRO A;  3CZ2 A;  1K94 A;  1UHJ A;  2LE9 B;  3CAB A;  3EG5 B;  3KHE A;  1OW4 A;  1TNX A;  5I94 A;  3OX5 A;  1XFZ O;  2QDI A;  1CB1 A;  2L50 A;  1CFC A;  3VRN A;  1MF8 B;  2JT3 A;  2WCB A;  2BCB A;  2K0J A;  2LUX A;  3CR5 X;  1CTR A;  1XK4 A;  4FTG A;  1AP4 A;  1BR1 B;  2JT0 A;  4NDB A;  3HCM A;  3CDN A;  1PVB A;  1CMG A;  3K21 A;  3M0W A;  3ZWH A;  4PHN A;  4NDD A;  3D0Y B;  4D1E A;  2M0R A;  5HLV A;  1CM4 A;  2BBN A;  1MR8 A;  4F7F A;  1J1E A;  3DD4 A;  1OOF A;  2L5X B;  1CFD A;  4U8D A;  3LL8 B;  1UHH A;  1QIW A;  1QLS A;  3R1O A;  3PJI A;  1ODB A;  1JUO A;  4MN0 A;  1H8B A;  2L98 A;  3D76 A;  5HKZ A;  1OSA A;  1ALV A;  4YGC B;  1NCZ A;  2KI6 D;  5F6T A;  2KQY A;  1HT9 A;  1WY9 A;  1B7T Z;  2K8M B;  2NLN A;  3B86 A;  3I5F C;  1BLQ A;  4PE4 A;  2PYQ A;  2WCH A;  3TS5 B;  4JWQ A;  5EL2 A;  3PLF B;  1UHN A;  1BF5 A;  2K61 A;  1F71 A;  1RK9 A;  2QEO A;  4C0L A;  3BUW B;  1G8I A;  1KK8 C;  3NSO A;  4ORB B;  1NCY A;  2I94 A;  2MHH A;  3AKA A;  1NYA A;  1SL8 A;  3QRX A;  3VB1 A;  1V1F A;  4R1E A;  1W7J B;  1B7T Y;  1KFX L;  1KQM B;  4UPG A;  1YVH A;  2LLS A;  1IWQ A;  3B7A A;  1B47 A;  1FI5 A;  2LLU A;  3SG2 A;  4MZL A;  3CYZ A;  5ER5 A;  2LVI A;  3S0F A;  1KCY A;  1RWY A;  3BQ3 A;  3IF7 A;  3LK1 A;  3LLE A;  1X02 A;  3EK8 A;  4CLN A;  3PSR A;  1ALW A;  2K7D A;  2LMT A;  1GM0 A;  5DKQ A;  2G2B A;  5AEQ A;  1B9A A;  3BJH A;  3TDI A;  2YGU A;  2BCX A;  1DGV A;  1A29 A;  4OV2 A;  3NSI A;  5KU1 A;  1L7Z A;  1Y1X A;  2CCM A;  4GGN A;  3K1E A;  1S6I A;  2LC5 A;  1NCX A;  4L9M A;  1W7I B;  4OCI A;  2QEV A;  4PDZ A;  1C07 A;  1NX2 A;  2JXL A;  2AMI A;  4CID A;  3QME A;  2ZND A;  2H2K A;  1OZS A;  1OOH A;  1XO5 A;  1YR5 A;  2JZI A;  1QV1 A;  1QXP A;  4M2P A;  5AAN A;  2Q4U A;  3E3R A;  2KHN A;  1XFX O;  2PQL A;  2LM5 A;  4I5N B;  2MBX A;  3FS7 A;  1UUS A;  3JTD C;  3FE6 A;  1QLK A;  4WQ3 A;  1N0Y A;  3SG3 A;  4OR9 B;  3SG5 A;  1YRU B;  4CPV A;  1DGU A;  5TNC A;  3BFH A;  4E68 A;  3D78 A;  1U5I B;  2JQ6 A;  2ZFD A;  5CSF A;  1QTX A;  1KWO B;  1Y1U A;  1OOG A;  1FW4 A;  1WLZ A;  1A03 A;  1MXL C;  2KYC A;  1CLB A;  1K9P A;  1OOJ A;  2Y1M A;  1IRJ A;  3SS3 A;  1B4C A;  1TRF A;  3PM2 A;  3PM8 A;  2KDH A;  4FQT A;  1ZUZ A;  4INX A;  3TDZ A;  3A4U B;  1M46 A;  4I5K A;  3UNW A;  2K7C A;  2JWW A;  2KQ6 A;  1OMV A;  1RJV A;  3IVT A;  4ORC B;  1EJ3 A;  2M7N A;  3FE8 A;  3VRR A;  1OQP A;  1PVA A;  2BNX A;  2KBI A;  2M9G A;  4PHM A;  4FQO A;  1CLM A;  2KFG A;  2HQW A;  2JXC A;  1WRZ A;  2EC6 C;  2JPT A;  1TNP A;  2WCK A;  3H4S E;  3PN7 B;  3SG4 A;  3I5I C;  3C1V A;  2WC6 A;  2PAL A;  1F54 A;  3R72 A;  4PAL A;  1RTP 1;  4OZD A;  1S1E A;  4ZCV A;  2WCM A;  1E8A A;  3DF0 B;  2H8V A;  4YI8 A;  4YGB B;  1TCO B;  3SS5 A;  4YRU A;  3CR4 X;  2OS8 B;  2ZN9 A;  1SL7 A;  1LKJ A;  2OPO A;  1M63 B;  2BE6 A;  1AJ5 A;  2QEB A;  3LCP C;  3BOW A;  1SKT A;  1SY9 A;  4N1F A;  3WXA A;  1R6P A;  4MZK A;  1SSE B;  1C3Y A;  2HPS A;  4KYN A;  1QV0 A;  5G08 A;  5CSJ A;  1DJY A;  1DJX A;  2ZKM X;  3KF9 A;  4CFR A;  1LA3 A;  3CR2 A;  4DUQ A;  1GJY A;  3RZS A;  4ZCU A;  3CLN A;  1NP8 A;  2SCP A;  2EC6 B;  3BFA A;  3TDU A;  2MLF C;  3BUM B;  3I5I B;  3LK0 A;  4YGA A;  3TS5 C;  1A75 B;  5ER4 X;  2LVK A;  2F3Y A;  4PCW A;  2P70 A;  1WDC C;  1M45 A;  2HQ8 A;  2P71 A;  2WOS A;  3OB2 B;  3BFB A;  3VRQ A;  1SNL A;  1HQV A;  3PAL A;  3S0B A;  4ICB A;  2CXJ A;  1DVI A;  1J1D A;  1ZMZ A;  5HKY A;  2I18 A;  2L4H A;  1UWO A;  4XJK A;  1CFP A;  1YVL A;  1KQM C;  2H61 A;  2KAY A;  2MLE C;  2L2C A;  4AOM A;  1IKU A;  2WCL A;  3V2L A;  1T14 A;  3MSE B;  2MJW B;  1XYD A;  2NXQ A;  4Q04 A;  1JFJ A;  1SK6 D;  1YUR A;  5HYD A;  3L4A A;  3DVK A;  1BMO A;  4IL1 A;  3RM1 A;  1YRT B;  1IG5 A;  2PSR A;  3WHU B;  2H61 C;  1BU3 A;  3CGA A;  1G4Y R;  1WDC B;  1JFK A;  4GUK A;  5HLO A;  3DYE A;  4ORA B;  1DEL A;  1LS8 A;  1PAL A;  1MHO A;  3DZT A;  3O4Y A;  2D8N A;  1NX0 A;  1Y6W A;  4GFT A;  4TNC A;  1A2X A;  3GOF A;  1ZAC A;  1CFF A;  4YGD B;  1SL9 A;  1KFX S;  5K89 A;  3FWC A;  1TUZ A;  3NXA A;  2RGI A;  3B88 A;  2M97 A;  1SPY A;  3JVT C;  4OVN F;  1TUJ A;  2FJU B;  3EK7 A;  5D7F A;  1SRA A;  1K93 D;  2ZN8 A;  2ZNE A;  1DTL A;  3CZT X;  4P5O E;  1XA5 A;  1QX7 A;  2DOQ A;  4JQ0 D;  1NPQ A;  5I8N A;  4NQG A;  4I5L B;  4HRG A;  4HRH A;  1H4B A;  1KWO C;  1K2H A;  1DT7 B;  5I2Q A;  4N1G A;  4INW A;  1M39 A;  1KFU L;  4F0Z B;  2GTE A;  2PRU A;  2M1K B;  3AKB A;  2F8P A;  1F8H A;  1TTX A;  3NSL A;  3EKH A;  3AAJ A;  4GNK B;  2O5G A;  4HRE E;  2L2E A;  1AK8 A;  3O4X A;  3TUY C;  4WRI A;  5FI2 A;  1QIV A;  2KYF A;  1TIZ A;  1SW8 A;  2AUC A;  3PFV A;  1F4O A;  1K9U A;  3JVT B;  4JPZ B;  1EL4 A;  1DEK A;  1DJH A;  2JU0 A;  1YTZ C;  1NSH A;  2EHB A;  2LP3 A;  2BAP A;  2K2A A; 
#chains in the Genus database with same CATH homology
 1SBJ A;  3DF0 A;  3EVR A;  2SAS A;  2COL B;  3EVU A;  2LHL A;  1IQ5 A;  1VRK A;  1PSB A;  3BYA A;  4PE0 A;  1B8R A;  4A4C A;  2WCF A;  2BCA A;  2LCP A;  4I5J A;  3PN7 C;  1EH2 A;  2I2R E;  2NZ0 A;  1TNQ A;  1A4P A;  1EG4 A;  1REC A;  1RRO A;  5CSN A;  2OTG B;  3EVV A;  1YUS A;  1MUX A;  4MSP A;  1JF0 A;  2CNP A;  2ZRS A;  2OS8 C;  4XYN A;  2NCP A;  4GGF C;  3TUY B;  3HX4 A;  1TCF A;  1B8L A;  1XFU O;  4C0J A;  1XFY O;  5CPV A;  1J7O A;  1IJ6 A;  3WNX B;  1NUB A;  2KI4 B;  1CLL A;  5CSI A;  1Y1A A;  2LVJ A;  3SIA A;  1QJT A;  4AQJ A;  4P2Y B;  2AAO A;  2BL0 C;  3D0Y A;  3TZ1 A;  1TN4 A;  5B8I B;  1SMG A;  1K90 D;  3IQO A;  1K8U A;  2Q91 A;  1OE9 B;  3I5H B;  4WQ2 A;  1S3P A;  1B1G A;  2LAP A;  2IS9 A;  2PMY A;  1F55 A;  1J7P A;  5AER A;  1FI6 A;  1IH0 A;  2HF5 A;  2M7L A;  2JC2 A;  1UP5 A;  4MVF A;  1LA0 A;  4ETO A;  3SG6 A;  3CTN A;  3VGO A;  2LNK A;  1BT6 A;  1C7W A;  1G33 A;  2LV7 A;  1KSO A;  2WCE A;  5HKW A;  2KAV A;  1QVI Z;  3WHT B;  5PAL A;  1LIN A;  2BBM A;  2LLT A;  2JOJ A;  4BY5 A;  4M2Q A;  3D10 A;  2KBM A;  2Y5I A;  3ZNI A;  1V1G A;  2BL0 B;  4PE7 A;  1F4Q A;  1DF0 B;  3F45 A;  4M2O A;  1TNW A;  3O2P A;  1L2O B;  2EGD A;  1SCM B;  2BE4 A;  2WOR A;  4N5X A;  3OX6 A;  4NDC A;  1MQ1 A;  3OP0 A;  4QJ5 B;  1D1O A;  1AJ4 A;  1QVI Y;  2HET A;  3CWG A;  1CNP A;  2GGZ A;  2JT8 A;  5AXI A;  2I7A A;  1BR4 B;  2V53 A;  1YUT A;  4MBE A;  2QAC A;  3ICB A;  3EK4 A;  1FPW A;  2JTZ A;  3BUO B;  1NX3 A;  1SCV A;  2KNE A;  1LVC D;  1C7V A;  4DIR A;  1K95 A;  1SR6 B;  2CBL A;  1CMF A;  5JJG A;  2E6W A;  1KSM A;  3KEV A;  3PAT A;  4MZJ A;  1PRW A;  4MRY A;  3IQQ A;  4YGE B;  2BKI B;  1KK7 Z;  2FCD A;  1GGW A;  3EKJ A;  2LAN A;  4MLW A;  1J7Q A;  2G9B A;  1UUR A;  1CDL A;  2R2I A;  2BKH B;  4GBA A;  4YI9 A;  1AUI B;  2WND A;  1K96 A;  2BEC A;  1S5G Z;  1QX5 B;  1UHK A;  1XK4 C;  1JSA A;  2LMU A;  3FWB A;  1XFW O;  3CS1 A;  1EG3 A;  2LVV A;  5BPJ A;  1QS7 A;  1M31 A;  1S36 A;  1OZO A;  1DJW A;  5IBW A;  2KFH A;  1KK7 Y;  1S6J A;  2KGB C;  2Y1N A;  2A4J A;  3FIA A;  3OHM B;  4DS7 A;  1WLM A;  2B1U A;  3SG7 A;  3BOW B;  3KPX A;  4QJ3 B;  1U5I A;  2KI6 C;  1PSR A;  2GGM A;  1UHI A;  2M49 B;  2LHI A;  1S5G Y;  1TOP A;  1QAT A;  1F70 A;  4QJ4 B;  1PUL A;  2F33 A;  1YX7 A;  1JF2 A;  1AVS A;  1ZFS A;  2TN4 A;  2F2O A;  4DCK A;  5DKR A;  2Y4Q A;  5KSZ A;  1LXF C;  3DVE A;  1MWN A;  1KFU S;  1K9K A;  2OTG C;  1IQ3 A;  4MRX A;  2L0P A;  3DVJ A;  1CDM A;  5JOL A;  1CKK A;  5I2L A;  2KGR A;  2LUC A;  3OB1 B;  1IJ5 A;  2FCE A;  2L51 A;  2E30 A;  2KSP A;  2MAZ A;  2F2P A;  2M8U A;  2O60 A;  3I5F B;  5I2O A;  4XJK B;  2KI4 C;  2P6B B;  1OMR A;  2ISD A;  1J7R A;  1DJZ A;  2NCO A;  2MRD A;  4YBH B;  1CDN A;  2M3W A;  1OMD A;  2PVB A;  4OKH A;  1KK8 B;  3O6B A;  4GGF A;  3I5H C;  3BUN B;  1DMO A;  1J55 A;  4GAO A;  3AAK A;  1EXR A;  1SYM A;  1WRL A;  1AHR A;  1IGV A;  2L4I A;  1XVJ A;  2FOT A;  1N2D A;  2JUL A;  2PAS A;  1N65 A;  1YUU A;  2KFF A;  3RLZ A;  1BG1 A;  5DKN A;  3VRP A;  1S26 D;  2KAX A;  3SJS A;  1DF0 A;  1MXE A;  1ZOT B;  1BOC A;  2QPT A;  1JBA A;  4PHK A;  2LMV A;  1NIW A;  4MEW A;  4CFQ A;  1QAS A;  1S6C A;  1A75 A;  1JC2 A;  4PE1 A;  1R2U A;  5AFP A;  3A8R A;  4DRW A;  3NSK A;  1B8C A;  3KO0 A;  5D69 A;  1BJF A;  3I5G C;  2VRG A;  1KQV A;  1L2O C;  3O78 A;  1SCM C;  1BOD A;  4A4B A;  1GGZ A;  5J3X A;  1WRK A;  4PHJ A;  5FYX A;  2JRF A;  1CDP A;  3BXK A;  2JNF A;  1JWD A;  2M29 A;  1FBV A;  2CT9 A;  1Q80 A;  1Y0V H;  4USL A;  2KOT A;  3DVM A;  1DJI A;  2K2F A;  1XFV O;  2K7O A;  4HSZ A;  2LP2 A;  3JTD B;  4C0K A;  2JNX A;  2WC8 A;  2JTT A;  1SR6 C;  2F3Z A;  3GK1 A;  3SIB A;  2CTN A;  4AQI A;  1CM1 A;  2K7B A;  1DJG A;  2ZRT A;  3I5G B;  1YX8 A;  2GV5 A;  1FF1 A;  1GQM A;  1PK0 D;  1NWD A;  3GK4 X;  3GK2 A;  2MA2 A;  5GQQ C;  1RFJ A;  5KTY A;  1NX1 A;  4GPL B;  4BY4 A;  3BUX B;  2M1U A;  1QX2 A;  3VRO A;  1K94 A;  1UHJ A;  2LE9 B;  3KHE A;  1TNX A;  3OX5 A;  1XFZ O;  1CB1 A;  2L50 A;  1CFC A;  3VRN A;  1MF8 B;  2JT3 A;  2WCB A;  2BCB A;  2K0J A;  2LUX A;  3CR5 X;  1CTR A;  1XK4 A;  4FTG A;  1AP4 A;  1BR1 B;  2JT0 A;  4NDB A;  3HCM A;  1PVB A;  1CMG A;  3K21 A;  3M0W A;  3ZWH A;  4PHN A;  4NDD A;  3D0Y B;  4D1E A;  2M0R A;  5HLV A;  1CM4 A;  2BBN A;  1MR8 A;  1J1E A;  3DD4 A;  2L5X B;  1CFD A;  4U8D A;  3LL8 B;  1UHH A;  1QIW A;  1QLS A;  1ODB A;  1JUO A;  4MN0 A;  1H8B A;  2L98 A;  5HKZ A;  1OSA A;  1ALV A;  4YGC B;  1NCZ A;  2KI6 D;  5F6T A;  2KQY A;  1HT9 A;  1WY9 A;  1B7T Z;  2K8M B;  2NLN A;  3I5F C;  1BLQ A;  4PE4 A;  3TS5 B;  4JWQ A;  3PLF B;  1UHN A;  1BF5 A;  2K61 A;  1F71 A;  1RK9 A;  4C0L A;  3BUW B;  1G8I A;  1KK8 C;  3NSO A;  4ORB B;  1NCY A;  2I94 A;  2MHH A;  3AKA A;  1NYA A;  1SL8 A;  3QRX A;  1V1F A;  4R1E A;  1W7J B;  1B7T Y;  1KFX L;  1KQM B;  4UPG A;  1YVH A;  2LLS A;  1IWQ A;  1B47 A;  1FI5 A;  2LLU A;  3SG2 A;  4MZL A;  5ER5 A;  2LVI A;  1KCY A;  1RWY A;  3BQ3 A;  3IF7 A;  3LK1 A;  3LLE A;  1X02 A;  3EK8 A;  4CLN A;  3PSR A;  1ALW A;  2K7D A;  2LMT A;  5DKQ A;  2G2B A;  5AEQ A;  1B9A A;  3TDI A;  2BCX A;  1DGV A;  1A29 A;  4OV2 A;  3NSI A;  5KU1 A;  1L7Z A;  1Y1X A;  2CCM A;  4GGN A;  1S6I A;  2LC5 A;  1NCX A;  4L9M A;  1W7I B;  4OCI A;  4PDZ A;  1C07 A;  1NX2 A;  2JXL A;  2AMI A;  4CID A;  2ZND A;  2H2K A;  1OZS A;  1XO5 A;  1YR5 A;  4M2P A;  2JZI A;  1QV1 A;  1QXP A;  5AAN A;  2Q4U A;  3E3R A;  2KHN A;  1XFX O;  2LM5 A;  4I5N B;  2MBX A;  3FS7 A;  1UUS A;  3JTD C;  4WQ3 A;  1QLK A;  3SG3 A;  1N0Y A;  4OR9 B;  3SG5 A;  1YRU B;  4CPV A;  1DGU A;  5TNC A;  4E68 A;  1U5I B;  2JQ6 A;  2ZFD A;  5CSF A;  1QTX A;  1KWO B;  1Y1U A;  1A03 A;  1FW4 A;  1WLZ A;  1MXL C;  2KYC A;  1CLB A;  1K9P A;  1OOJ A;  2Y1M A;  1IRJ A;  1B4C A;  1TRF A;  3PM8 A;  2KDH A;  1ZUZ A;  3TDZ A;  3A4U B;  1M46 A;  4I5K A;  2K7C A;  2JWW A;  2KQ6 A;  1OMV A;  1RJV A;  4ORC B;  1EJ3 A;  2M7N A;  3VRR A;  1OQP A;  1PVA A;  2KBI A;  2M9G A;  4PHM A;  4FQO A;  1CLM A;  2KFG A;  2HQW A;  2JXC A;  1WRZ A;  2EC6 C;  2JPT A;  1TNP A;  3H4S E;  3PN7 B;  3SG4 A;  3I5I C;  3C1V A;  2PAL A;  1F54 A;  4PAL A;  1RTP 1;  1S1E A;  4ZCV A;  1E8A A;  3DF0 B;  4YI8 A;  4YGB B;  1TCO B;  4YRU A;  3CR4 X;  2OS8 B;  2ZN9 A;  1SL7 A;  1LKJ A;  2OPO A;  1M63 B;  2BE6 A;  1AJ5 A;  3LCP C;  3BOW A;  1SKT A;  1SY9 A;  4N1F A;  3WXA A;  1R6P A;  4MZK A;  2HPS A;  1QV0 A;  5G08 A;  5CSJ A;  1DJY A;  1DJX A;  2ZKM X;  3KF9 A;  4CFR A;  1LA3 A;  3CR2 A;  4DUQ A;  1GJY A;  4ZCU A;  3CLN A;  1NP8 A;  2SCP A;  2EC6 B;  3TDU A;  2MLF C;  3BUM B;  3I5I B;  3LK0 A;  4YGA A;  3TS5 C;  1A75 B;  5ER4 X;  2LVK A;  2F3Y A;  4PCW A;  1WDC C;  1M45 A;  2HQ8 A;  2WOS A;  3OB2 B;  3VRQ A;  1SNL A;  1HQV A;  3PAL A;  4ICB A;  2CXJ A;  1DVI A;  1J1D A;  1ZMZ A;  5HKY A;  2I18 A;  2L4H A;  1UWO A;  4XJK A;  1CFP A;  1YVL A;  1KQM C;  2H61 A;  2KAY A;  2MLE C;  4AOM A;  1IKU A;  3MSE B;  2MJW B;  1XYD A;  2NXQ A;  4Q04 A;  1JFJ A;  1SK6 D;  1YUR A;  5HYD A;  3DVK A;  1BMO A;  4IL1 A;  3RM1 A;  1YRT B;  1IG5 A;  2PSR A;  3WHU B;  2H61 C;  1BU3 A;  3CGA A;  1G4Y R;  1WDC B;  1JFK A;  4GUK A;  5HLO A;  4ORA B;  1PAL A;  1MHO A;  3O4Y A;  2D8N A;  1NX0 A;  1Y6W A;  4GFT A;  4TNC A;  1A2X A;  3GOF A;  1ZAC A;  1CFF A;  4YGD B;  1SL9 A;  1KFX S;  5K89 A;  3FWC A;  3NXA A;  2RGI A;  2M97 A;  1SPY A;  3JVT C;  4OVN F;  2FJU B;  3EK7 A;  5D7F A;  1SRA A;  1K93 D;  2ZN8 A;  2ZNE A;  1DTL A;  3CZT X;  4P5O E;  1XA5 A;  1QX7 A;  2DOQ A;  4JQ0 D;  1NPQ A;  5I8N A;  4NQG A;  4I5L B;  4HRG A;  4HRH A;  1H4B A;  1KWO C;  1K2H A;  1DT7 B;  5I2Q A;  4N1G A;  1M39 A;  1KFU L;  4F0Z B;  2PRU A;  2M1K B;  3AKB A;  2F8P A;  1F8H A;  1TTX A;  3NSL A;  3EKH A;  3AAJ A;  4GNK B;  2O5G A;  4HRE E;  2L2E A;  1AK8 A;  3TUY C;  4WRI A;  1QIV A;  2KYF A;  1TIZ A;  1SW8 A;  2AUC A;  3PFV A;  1F4O A;  1K9U A;  3JVT B;  4JPZ B;  1EL4 A;  1DJH A;  2JU0 A;  1YTZ C;  1NSH A;  2EHB A;  2LP3 A;  2K2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...