1FI6A

Solution structure of the reps1 eh domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
92
structure length
92
Chain Sequence
WKITDEQRQYYVNQFKTIQPDLNGFIPGSAAKEFFTKSKLPILELSHIWELSDFDKDGALTLDEFCAAFHLVVARKNGYDLPEKLPESLMPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EH DOMAIN PROTEIN REPS1
publication title Solution structure of the Reps1 EH domain and characterization of its binding to NPF target sequences.
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis/exocytosis
total genus 21
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2000-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1fi6A00
3ZWHA 1IJ5A 3FIAA 4NDCA 1RROA 3BUNB 2KQ6A 5PALA 4JWQA 1B8RA 1EXRA 1MXEA 2I18A 2L2EA 2LUCA 3KO0A 1QATA 1DT7B 2ISDA 2MJWB 3IQOA 3LLEA 2KDHA 1YURA 4GFTA 4ICBA 1F70A 1KWOC 3DVJA 5I8NA 1F71A 3GOFA 1RTP1 1DJYA 3LL8B 3VRNA 2K7DA 4YI8A 4M2OA 2MLEC 4DUQA 1F4QA 4PHMA 4N1FA 2F3ZA 1TNQA 1CDMA 5ER4X 4HRGA 3SG7A 1PALA 3BXKA 5F6TA 1IJ6A 1B7TY 1YTZC 2K8MB 3CR4X 2KAXA 1KFXS 1JSAA 2KNEA 1IRJA 1M63B 4OV2A 1G8IA 2I7AA 3DVMA 3OX6A 2LLUA 4NDBA 3SIBA 4P2YB 4FTGA 5CSFA 2TN4A 1OMDA 1DMOA 1YVLA 1K8UA 1XFYO 2KGBC 3IF7A 3BOWA 2COLB 5KU1A 1JF0A 3LK0A 2WCEA 1DJZA 2F33A 2KGRA 3D0YB 4YI9A 5CSNA 2MHHA 1SW8A 2L98A 3EVVA 1QVIY 1J7OA 1XFXO 1S6CA 1B47A 3WNXB 1C07A 2E30A 1S1EA 3SG2A 1Y0VH 1K9UA 2JRFA 2JXLA 2KAVA 3JTDC 3HCMA 5JOLA 4HREE 4PE7A 2WC8A 4CIDA 4ZCVA 1J1EA 1AJ5A 1ZMZA 4YRUA 2ZN8A 4ETOA 3JVTC 1IG5A 1NYAA 3H4SE 3NXAA 3SG6A 1Y6WA 1JFJA 4MLWA 1QIVA 1AP4A 5TNCA 2CTNA 2KBIA 4M2QA 1SL7A 1CMFA 5KTYA 3I5HB 1SY9A 3D0YA 1F54A 1LKJA 1MWNA 2L4HA 1F4OA 2H61A 1B9AA 4CFRA 1JBAA 4I5NB 4WRIA 2G9BA 1KWOB 1L2OB 3VROA 2LV7A 4UPGA 1S6JA 1NCYA 1KK8C 4HRHA 4C0KA 4GGFC 1M31A 1WRZA 1UP5A 1PSBA 2OPOA 3ICBA 3SIAA 2HETA 3LK1A 4YGCB 1PRWA 2ZNEA 1SMGA 1QTXA 2EC6B 2EGDA 3SJSA 1KFUL 1S5GZ 2BCAA 3K21A 1QS7A 2L5XB 3AAJA 2JOJA 1AVSA 1CKKA 3AKBA 4YGEB 1R6PA 2K7OA 1QX5B 2L50A 1NCZA 3PN7C 2LUXA 1B8CA 2O5GA 3I5IC 5CPVA 3VRPA 2BBMA 2ZFDA 1DF0B 4DRWA 2KOTA 4YGDB 3OHMB 3M0WA 3IQQA 2LMVA 1K9PA 1LINA 2PSRA 5B8IB 2JT0A 3NSLA 1RK9A 2BE6A 1CFFA 1JC2A 4WQ3A 2KFGA 4PHNA 3EKJA 1J7PA 1DTLA 1XK4A 1AK8A 2K0JA 2M29A 4PALA 3SG4A 1K2HA 1UUSA 2KAYA 1QV1A 1CM1A 3TUYC 1BR4B 2MAZA 1M45A 2LANA 2P6BB 3C1VA 4HSZA 4I5LB 2KYCA 1YUUA 1DF0A 3FWBA 1RWYA 3JVTB 1UHJA 1G4YR 1MR8A 2JNXA 4I5KA 5DKQA 2LNKA 3WXAA 3BUXB 5AXIA 3BYAA 4XJKB 2CXJA 1DJHA 1MHOA 3KPXA 1YR5A 2JU0A 3OB2B 2BL0B 1G33A 1YRUB 2LP2A 2QPTA 3PM8A 4L9MA 2K7BA 2Q91A 2MLFC 2WCBA 2KQYA 2BKIB 5AANA 1NP8A 1KQMB 1OQPA 1SBJA 1A4PA 5AFPA 1FBVA 2KYFA 4BY5A 1BOCA 1SK6D 5HLOA 2L0PA 2FOTA 1NX1A 2V53A 4GUKA 1Q80A 3BOWB 2F2OA 1QV0A 3NSIA 2A4JA 1XA5A 1CLLA 2KBMA 1K90D 1UHHA 4USLA 2M1UA 3TDZA 1JFKA 4XJKA 4YGAA 1VRKA 4WQ2A 4AOMA 1BLQA 2JZIA 2O60A 1N2DA 3TS5C 1CDLA 1ALWA 2F3YA 2SCPA 1NIWA 5I2OA 3I5GC 4XYNA 3HX4A 4JQ0D 2OS8C 3PN7B 1KFUS 1WRLA 2PASA 4A4BA 3TDUA 4F0ZB 1GGWA 2LVKA 1CTRA 1KQVA 3DF0A 1ZUZA 1XFZO 1A29A 2LC5A 4GGFA 4AQJA 2KI4C 1V1GA 2JT3A 3FS7A 4ZCUA 4E68A 1SR6C 1Y1XA 1AJ4A 1PULA 5DKNA 3I5FC 1D1OA 1XYDA 2E6WA 4JPZB 5DKRA 2NLNA 1WDCC 3PLFB 1DVIA 3CTNA 2M8UA 2OTGC 1K9KA 2AAOA 3CR2A 2M1KB 1BR1B 3CR5X 4TNCA 2K7CA 3BUOB 1DGVA 3EK8A 1FF1A 3CWGA 1BG1A 4MRYA 2JT8A 1C7WA 2PALA 1AHRA 4MRXA 3O2PA 3OX5A 1IQ5A 3A4UB 1XO5A 1CDPA 3PATA 1K95A 2NXQA 1CFPA 2ZNDA 5HYDA 4YBHB 1PVAA 1SPYA 5AEQA 1QLSA 3QRXA 1LA0A 1K93D 4NQGA 2HPSA 1LA3A 3BUWB 1QIWA 1WY9A 2KFFA 2LMUA 3WHTB 1KSOA 1SL8A 1UHIA 4PDZA 1NCXA 4QJ3B 5AERA 1OE9B 1SYMA 2WCFA 4M2PA 2BE4A 1Y1AA 4D1EA 3FWCA 1IKUA 1SCMC 1UHKA 2HF5A 3DVEA 1NSHA 1IWQA 2M97A 5I2LA 1B8LA 2L4IA 3F45A 3I5GB 1TN4A 2MBXA 1LXFC 2JTTA 2BCBA 1NX2A 1TRFA 2LHIA 5G08A 1YX8A 1KFXL 1FPWA 2H2KA 3LCPC 4N1GA 2LLTA 4Q04A 2BKHB 3PSRA 4MBEA 1R2UA 2FCDA 4MVFA 4R1EA 1GGZA 2R2IA 1FI5A 1A75A 1SRAA 2I2RE 1YRTB 2L51A 1BF5A 3JTDB 1MF8B 1EG4A 2NCOA 5BPJA 2FCEA 1DJGA 2GV5A 1W7JB 1F55A 1QASA 1XFUO 1B7TZ 1N65A 1CLMA 4PCWA 1ZOTB 1S36A 1JF2A 4MEWA 3RM1A 1JWDA 1J7RA 4DIRA 1QX7A 4QJ5B 2RGIA 1EL4A 1ZACA 1IGVA 3TDIA 2LVJA 3OP0A 1JUOA 1TCFA 2PMYA 2LHLA 2PRUA 1TNXA 1K96A 2WNDA 2KSPA 5ER5A 1PK0D 1RFJA 4IL1A 1CB1A 1S5GY 1NPQA 2K61A 4GNKB 3DF0B 1FW4A 1KK8B 1PVBA 1CDNA 2IS9A 3O4YA 1UWOA 1NX0A 2M3WA 4YGBB 1DJXA 2FJUB 3CS1A 3DVKA 1QVIZ 2GGMA 2JNFA 4PE0A 3SG3A 4C0LA 2PVBA 2Q4UA 4PHKA 3D10A 3ZNIA 1GJYA 4MN0A 1B4CA 3OB1B 5HKWA 4P5OE 1DGUA 1Y1UA 3I5HC 1J7QA 2LE9B 1ODBA 2AUCA 1CLBA 1SCVA 1NWDA 3EK4A 2JULA 4ORBB 3I5IB 5IBWA 2LMTA 3EVRA 1L2OC 3BQ3A 3VRQA 3TZ1A 2F2PA 2JPTA 3NSOA 1UHNA 1F8HA 1KSMA 2JXCA 1QX2A 2CCMA 4I5JA 2DOQA 3KHEA 1RJVA 2EC6C 2LVIA 4OR9B 3E3RA 5JJGA 1IQ3A 1EG3A 1HT9A 3O78A 1WRKA 2VRGA 1K94A 1WLMA 1XK4C 2JTZA 1YVHA 1OMRA 3SG5A 1AUIB 4CFQA 3AKAA 1UURA 2F8PA 2JQ6A 5D69A 3WHUB 3TUYB 1OZSA 3PALA 1LVCD 2KHNA 1H8BA 1U5IB 1J55A 5CSIA 2BBNA 4C0JA 1B1GA 2CT9A 5KSZA 3AAKA 5K89A 1S3PA 2B1UA 2QACA 1PSRA 4NDDA 1S26D 4ORCB 1CNPA 3KEVA 1RECA 2ZN9A 3DD4A 1DJWA 1OSAA 1H4BA 1CM4A 5I2QA 5HLVA 2M7LA 2LCPA 4MZLA 4DCKA 1BMOA 3RLZA 2ZKMX 3VRRA 2M9GA 1OMVA 1MQ1A 4MSPA 4OVNF 1EH2A 1XFWO 5J3XA 1CFDA 5HKYA 1ALVA 1J1DA 2K2FA 1KK7Z 3VGOA 4QJ4B 1OOJA 2KFHA 1N0YA 2Y1MA 1U5IA 1GQMA 2AMIA 2WORA 1A03A 1CMGA 2M49B 1M39A 1M46A 1YX7A 1A75B 1NUBA 2BL0C 2MRDA 4N5XA 3TS5B 2LP3A 3EKHA 3NSKA 2I94A 1TOPA 1BJFA 4PE4A 2Y5IA 2OS8B 3CZTX 2M7NA 1KQMC 3GK2A 2KI6D 2JC2A 2KI4B 3MSEB 1QJTA 2WOSA 4ORAB 1SKTA 1SR6B 1TTXA 1XVJA 1E8AA 1WLZA 4OKHA 2M0RA 3I5FB 1SNLA 4MZKA 2ZRSA 5CSJA 1MXLC 1SL9A 4U8DA 1ZFSA 2LAPA 1BU3A 1WDCB 3CGAA 1KCYA 4AQIA 3CLNA 4A4CA 1TNPA 2OTGB 5D7FA 1IH0A 3KF9A 4GBAA 1QXPA 2D8NA 2CBLA 4MZJA 4GGNA 1QLKA 5GQQC 4DS7A 2HQWA 1YUTA 2EHBA 2LLSA 1YUSA 3A8RA 2LVVA 2Y1NA 3EK7A 4GPLB 1C7VA 2JWWA 3GK1A 3BUMB 2G2BA 1L7ZA 2BECA 1V1FA 2CNPA 1BT6A 1KK7Y 1X02A 1TCOB 1TIZA 1CFCA 4PE1A 5HKZA 2K2AA 1S6IA 1MUXA 1EJ3A 3PFVA 2GGZA 4OCIA 1DJIA 3GK4X 2H61C 2HQ8A 2NZ0A 4GAOA 1BODA 2KI6C 2NCPA 2MA2A 1NX3A 2Y4QA 4PHJA 1A2XA 1HQVA 1TNWA 4CLNA 2LM5A 2SASA 1OZOA 1W7IB 4BY4A 5FYXA 1XFVO 2BCXA 3EVUA 4FQOA 1FI6A 4CPVA 1SCMB 3O6BA 2ZRTA
chains in the Genus database with same CATH superfamily
3ZWHA 3RZSA 1IJ5A 3FIAA 4NDCA 1RROA 3BUNB 3IVTA 2KQ6A 5PALA 4JWQA 1B8RA 1EXRA 1MXEA 2I18A 2L2EA 2LUCA 3KO0A 1QATA 1DT7B 2ISDA 2MJWB 3IQOA 3LLEA 2KDHA 3DZTA 1YURA 4GFTA 4ICBA 1F70A 1KWOC 3DVJA 5I8NA 1F71A 3GOFA 3CZ0A 3B87A 1RTP1 1DJYA 3LL8B 3VRNA 2K7DA 4YI8A 4M2OA 2MLEC 4DUQA 1F4QA 4PHMA 4N1FA 2F3ZA 1TNQA 1CDMA 5ER4X 4HRGA 3SG7A 3B7AA 1PALA 3BXKA 5F6TA 1IJ6A 1B7TY 1YTZC 2K8MB 3CR4X 2KAXA 1KFXS 3CYZA 3S0AA 1JSAA 1W9ZA 2KNEA 3DY9A 1IRJA 3N7HA 1M63B 4OV2A 1G8IA 2I7AA 3V2LA 3DVMA 3OX6A 2LLUA 4NDBA 3SIBA 4P2YB 4FTGA 5CSFA 2TN4A 1OMDA 3VB1A 1DMOA 5FI7A 1YVLA 1K8UA 1XFYO 2KGBC 3IF7A 3BOWA 2COLB 5KU1A 1JF0A 3LK0A 1C3ZA 3R1OA 2WCEA 1DJZA 2F33A 2KGRA 3D0YB 4YI9A 5CSNA 2MHHA 1SW8A 2L98A 3EVVA 3CABA 3S0EA 1QVIY 1J7OA 1XFXO 1S6CA 1B47A 3WNXB 1C07A 2E30A 1S1EA 3SG2A 1Y0VH 1DELA 1K9UA 2JRFA 2JXLA 3FE6A 2KAVA 3JTDC 3HCMA 5JOLA 4HREE 4PE7A 2WC8A 4CIDA 3S0GA 4ZCVA 1J1EA 1AJ5A 1ZMZA 4YRUA 2ZN8A 4ETOA 3JVTC 1IG5A 1NYAA 3H4SE 3NXAA 3SG6A 1Y6WA 3BFAA 1JFJA 4MLWA 1QIVA 1AP4A 5TNCA 2CTNA 2KBIA 4M2QA 1SL7A 1CMFA 5KTYA 3I5HB 1SY9A 3D0YA 3D77A 1LKJA 1MWNA 1F54A 2L4HA 1F4OA 2H61A 5HL1A 1B9AA 4CFRA 3UNWA 3QMEA 1JBAA 4I5NB 4WRIA 2G9BA 1KWOB 1L2OB 3VROA 3K1EA 2LV7A 4UPGA 1S6JA 1NCYA 1KK8C 4HRHA 4C0KA 4GGFC 1M31A 1WRZA 1UP5A 1PSBA 2OPOA 3ICBA 3SIAA 3D73A 2HETA 3LK1A 1P28A 4YGCB 1PRWA 2ZNEA 1SMGA 1QTXA 2EC6B 2EGDA 3SJSA 1KFUL 3O4XA 4OZDA 1S5GZ 3NHIA 2BCAA 3K21A 1QS7A 2L5XB 1DQEA 1QWVA 3AAJA 2JOJA 1AVSA 1CKKA 3AKBA 4YGEB 1R6PA 2K7OA 1QX5B 2L50A 1NCZA 1C3YA 3PN7C 2LUXA 1B8CA 2O5GA 3I5IC 5CPVA 3VRPA 2BBMA 2ZFDA 1DF0B 4DRWA 4FQTA 2KOTA 3OBVA 4YGDB 3OHMB 3M0WA 3IQQA 2LMVA 1K9PA 1LINA 2PSRA 3B6XA 2QEHA 5B8IB 2JT0A 3NSLA 1RK9A 2BE6A 1CFFA 1JC2A 4WQ3A 2KFGA 4PHNA 3EKJA 1J7PA 2P70A 1DTLA 1XK4A 1AK8A 2WC5A 2K0JA 2M29A 4PALA 3SG4A 1DC1A 1K2HA 1UUSA 2KAYA 1QV1A 1CM1A 3TUYC 3D75A 3DYEA 1BR4B 2MAZA 1M45A 2LANA 2P6BB 3C1VA 4HSZA 4I5LB 2KYCA 1YUUA 1DF0A 3FWBA 1RWYA 3JVTB 1UHJA 3CZ2A 1G4YR 1MR8A 2JNXA 4I5KA 5DKQA 2LNKA 3WXAA 4JD9A 3BUXB 5AXIA 3BYAA 4INWA 4XJKB 2CXJA 1DJHA 1MHOA 3KPXA 1YR5A 2JU0A 3D74A 2BL0B 1G33A 1YRUB 2LP2A 2QPTA 3PM8A 4L9MA 5DICA 2K7BA 2Q91A 4JKTA 2MLFC 2WCBA 3SS3A 3EG5B 2KQYA 2BKIB 5AANA 1NP8A 1KQMB 1OQPA 1SBJA 1A4PA 5AFPA 1FBVA 2KYFA 4BY5A 1BOCA 1SK6D 5HLOA 2L0PA 2FOTA 1NX1A 2V53A 4GUKA 1Q80A 3BOWB 2F2OA 1QV0A 2FJYA 3NSIA 2A4JA 1XA5A 1CLLA 2KBMA 1K90D 1UHHA 4USLA 2M1UA 3TDZA 1JFKA 4XJKA 4YGAA 1VRKA 4WQ2A 4AOMA 1BLQA 2JZIA 2O60A 1N2DA 3TS5C 1CDLA 1ALWA 2F3YA 2SCPA 1NIWA 5I2OA 3I5GC 4XYNA 3HX4A 4JQ0D 2OS8C 3PN7B 1KFUS 1WRLA 2PASA 1XFRA 3TDUA 4A4BA 4F0ZB 2LVKA 1CTRA 1GGWA 1KQVA 3DF0A 1ZUZA 1XFZO 1A29A 2LC5A 4GGFA 4AQJA 2KI4C 1V1GA 2JT3A 3FS7A 5FI2A 4ZCUA 4E68A 1SR6C 1Y1XA 1AJ4A 1PULA 5DKNA 1OOIX 3I5FC 1D1OA 1XYDA 2E6WA 4JPZB 5DKRA 3SS5A 2NLNA 1WDCC 3PLFB 1DVIA 2H8VA 3CTNA 2M8UA 2OTGC 1K9KA 2AAOA 3CR2A 2M1KB 1BR1B 3CR5X 4TNCA 3BJHA 2P71A 2GTEA 2K7CA 3BUOB 1DGVA 3EK8A 1FF1A 3CWGA 2K60A 1BG1A 4MRYA 2JT8A 1C7WA 2PALA 1AHRA 4MRXA 3O2PA 3OX5A 1IQ5A 3A4UB 1XO5A 1CDPA 3PATA 1K95A 2NXQA 1CFPA 2ZNDA 5HYDA 4YBHB 1PVAA 1SPYA 5AEQA 1QLSA 3QRXA 1LA0A 1K93D 4NQGA 2HPSA 1LA3A 2L2CA 3BUWB 1QIWA 1WY9A 2KFFA 2LMUA 1LS8A 3WHTB 1KSOA 1SL8A 1UHIA 4PDZA 2PYQA 1NCXA 4QJ3B 5AERA 3PM2A 1OE9B 1SYMA 2WCFA 4M2PA 2BE4A 1Y1AA 4D1EA 3FWCA 1IKUA 1SCMC 1UHKA 2HF5A 3DVEA 3L47A 1NSHA 1IWQA 2M97A 5I2LA 3UO9A 1B8LA 2L4IA 3F45A 3I5GB 1TUJA 1TN4A 3NHTA 1LXFC 2JTTA 2MBXA 2BCBA 1NX2A 1TRFA 2LHIA 5G08A 1YX8A 1KFXL 1FPWA 2H2KA 3LCPC 4N1GA 2LLTA 4Q04A 2BKHB 3PSRA 4MBEA 1DEKA 1T14A 1R2UA 2FCDA 4MVFA 4R1EA 2QDIA 1GGZA 2R2IA 1FI5A 1A75A 1SRAA 2I2RE 1YRTB 4IJ7A 2L51A 1BF5A 3JTDB 1MF8B 1EG4A 2NCOA 5BPJA 2FCEA 1DJGA 2GV5A 1W7JB 1F55A 1QASA 5FI6A 1XFUO 1B7TZ 1N65A 1CLMA 3S0BA 3R1PA 4PCWA 1ZOTB 2QEOA 1S36A 1JF2A 4MEWA 3RM1A 1JWDA 1J7RA 2WCMA 4DIRA 1QX7A 4QJ5B 1IIOA 2RGIA 1EL4A 1ZACA 1IGVA 3TDIA 2LVJA 3OP0A 1JUOA 1TCFA 2PMYA 2LHLA 2PRUA 1TNXA 1K96A 2WNDA 2KSPA 5ER5A 1PK0D 1RFJA 4IL1A 1CB1A 3D76A 1S5GY 1NPQA 2K61A 4GNKB 3DF0B 1FW4A 1KK8B 1PVBA 1CDNA 2IS9A 3O4YA 1UWOA 1NX0A 1OOHA 2M3WA 4YGBB 1DJXA 1OOGA 1Z2CB 2FJUB 3CS1A 3DVKA 1QVIZ 2BAPA 2GGMA 2JNFA 4PE0A 5EL2A 3SG3A 4C0LA 2PVBA 2Q4UA 4PHKA 3D10A 3ZNIA 1GJYA 3R72A 4MN0A 1B4CA 3OB1B 5HKWA 3CDNA 4P5OE 1DGUA 1Y1UA 3I5HC 1J7QA 2LE9B 1ODBA 2AUCA 1CLBA 1SCVA 2BNXA 1NWDA 3BFHA 3EK4A 2JULA 4ORBB 3I5IB 5IBWA 2LMTA 3EVRA 1L2OC 3BQ3A 3VRQA 3TZ1A 2F2PA 2JPTA 2WCJA 3NSOA 1Z4HA 1UHNA 1F8HA 1KSMA 2JXCA 1QX2A 2CCMA 4I5JA 3D78A 2DOQA 3KHEA 1RJVA 2EC6C 2LVIA 4OR9B 3E3RA 5JJGA 1IQ3A 1EG3A 1HT9A 3O78A 1WRKA 2VRGA 1K94A 1WLMA 1XK4C 2JTZA 1YVHA 1OMRA 2YGUA 1SSEB 3SG5A 1AUIB 4CFQA 3AKAA 1UURA 2F8PA 2JQ6A 2KLDA 5D69A 3WHUB 3TUYB 1OZSA 2L5YA 1LVCD 3PALA 2KHNA 1H8BA 1U5IB 1J55A 5CSIA 1GM0A 2BBNA 4C0JA 2JPOA 2CT9A 1B1GA 5KSZA 3AAKA 5K89A 1S3PA 2B1UA 1ORGA 2QACA 1PSRA 4NDDA 1S26D 4ORCB 1CNPA 3KEVA 4KYNA 3B86A 1RECA 1OOFA 2ZN9A 3DD4A 3OGNA 4INXA 1DJWA 1OSAA 1H4BA 1CM4A 5I2QA 5HLVA 2M7LA 2LCPA 4MZLA 4DCKA 1BMOA 3RLZA 2ZKMX 3VRRA 2M9GA 1OMVA 1MQ1A 3OB2B 4MSPA 4OVNF 1XFWO 1EH2A 5J3XA 1CFDA 5HKYA 3NGVA 1ALVA 1J1DA 2K2FA 1KK7Z 3VGOA 4QJ4B 1OOJA 1TWOA 2KFHA 1N0YA 2WC6A 3DXLA 3S0DA 2WCHA 2Y1MA 1U5IA 1GQMA 2AMIA 2WORA 1A03A 1CMGA 2M49B 1M39A 1M46A 1YX7A 4PT1A 1A75B 1NUBA 2BL0C 2MRDA 4N5XA 3TS5B 2LP3A 3EKHA 3CZ1A 3NSKA 2I94A 3BFBA 1TOPA 1BJFA 4PE4A 2Y5IA 2OS8B 3CZTX 2M7NA 1KQMC 3L4LA 3GK2A 2KI6D 2JC2A 2KI4B 3MSEB 1QJTA 2WOSA 4ORAB 5D3OA 1SKTA 3B88A 1SR6B 1TTXA 1XVJA 1E8AA 1WLZA 4OKHA 2M0RA 3I5FB 1SNLA 4MZKA 2ZRSA 5CSJA 1MXLC 1SL9A 1TUZA 4U8DA 1ZFSA 2LAPA 3SS4A 2ERBA 1BU3A 1WDCB 3CGAA 3Q8IA 1KCYA 4AQIA 3CLNA 4A4CA 1TNPA 2PQLA 2WCKA 2OTGB 5D7FA 2WCLA 3KF9A 1IH0A 4GBAA 1QXPA 2D8NA 2CBLA 4MZJA 4GGNA 1OW4A 1QLKA 5GQQC 2HQWA 4DS7A 2QEBA 1YUTA 2EHBA 2LLSA 1YUSA 3A8RA 2LVVA 2QEVA 2Y1NA 3EK7A 4GPLB 2JWWA 3S0FA 5I94A 1C7VA 3L4AA 3GK1A 3BUMB 2G2BA 1L7ZA 2BECA 1V1FA 2CNPA 1BT6A 1KK7Y 3PJIA 1X02A 1TCOB 1TIZA 1CFCA 4PE1A 5HKZA 2K2AA 3FE8A 1S6IA 1MUXA 1EJ3A 3PFVA 2GGZA 4OCIA 1DJIA 3GK4X 2H61C 2HQ8A 2KLEA 2NZ0A 4GAOA 2KPHA 1BODA 2KI6C 2NCPA 2MA2A 1NX3A 2Y4QA 4PHJA 1A2XA 1HQVA 1TNWA 4CLNA 2LM5A 2SASA 1OZOA 1W7IB 4BY4A 5FYXA 1XFVO 2BCXA 3EVUA 3FE9A 4FQOA 1FI6A 4CPVA 4F7FA 1SCMB 3O6BA 2ZRTA 3R1VA
chains in the Genus database with same CATH topology
3ZWHA 1IJ5A 3FIAA 4NDCA 1RROA 3BUNB 2KQ6A 5PALA 4JWQA 1B8RA 1EXRA 1MXEA 2I18A 2L2EA 2LUCA 3KO0A 1QATA 1DT7B 2ISDA 2MJWB 3IQOA 3LLEA 2KDHA 1YURA 4GFTA 4ICBA 1F70A 1KWOC 3DVJA 5I8NA 1F71A 3GOFA 1RTP1 1DJYA 3LL8B 3VRNA 2K7DA 4YI8A 4M2OA 2MLEC 4DUQA 1F4QA 4PHMA 4N1FA 2F3ZA 1TNQA 1CDMA 5ER4X 4HRGA 3SG7A 1PALA 3BXKA 5F6TA 1IJ6A 1B7TY 1YTZC 2K8MB 3CR4X 2KAXA 1KFXS 1JSAA 2KNEA 1IRJA 1M63B 4OV2A 1G8IA 2I7AA 3DVMA 3OX6A 2LLUA 4NDBA 3SIBA 4P2YB 4FTGA 5CSFA 2TN4A 1OMDA 1DMOA 1YVLA 1K8UA 1XFYO 2KGBC 3IF7A 3BOWA 2COLB 5KU1A 1JF0A 3LK0A 2WCEA 1DJZA 2F33A 2KGRA 3D0YB 4YI9A 5CSNA 2MHHA 1SW8A 2L98A 3EVVA 1QVIY 1J7OA 1XFXO 1S6CA 1B47A 3WNXB 1C07A 2E30A 1S1EA 3SG2A 1Y0VH 1K9UA 2JRFA 2JXLA 2KAVA 3JTDC 3HCMA 5JOLA 4HREE 4PE7A 2WC8A 4CIDA 4ZCVA 1J1EA 1AJ5A 1ZMZA 4YRUA 2ZN8A 4ETOA 3JVTC 1IG5A 1NYAA 3H4SE 3NXAA 3SG6A 1Y6WA 1JFJA 4MLWA 1QIVA 1AP4A 5TNCA 2CTNA 2KBIA 4M2QA 1SL7A 1CMFA 5KTYA 3I5HB 1SY9A 3D0YA 1F54A 1LKJA 1MWNA 2L4HA 1F4OA 2H61A 1B9AA 4CFRA 1JBAA 4I5NB 4WRIA 2G9BA 1KWOB 1L2OB 3VROA 2LV7A 4UPGA 1S6JA 1NCYA 1KK8C 4HRHA 4C0KA 4GGFC 1M31A 1WRZA 1UP5A 1PSBA 2OPOA 3ICBA 3SIAA 2HETA 3LK1A 4YGCB 1PRWA 2ZNEA 1SMGA 1QTXA 2EC6B 2EGDA 3SJSA 1KFUL 1S5GZ 2BCAA 3K21A 1QS7A 2L5XB 3AAJA 2JOJA 1AVSA 1CKKA 3AKBA 4YGEB 1R6PA 2K7OA 1QX5B 2L50A 1NCZA 3PN7C 2LUXA 1B8CA 2O5GA 3I5IC 5CPVA 3VRPA 2BBMA 2ZFDA 1DF0B 4DRWA 2KOTA 4YGDB 3OHMB 3M0WA 3IQQA 2LMVA 1K9PA 1LINA 2PSRA 5B8IB 2JT0A 3NSLA 1RK9A 2BE6A 1CFFA 1JC2A 4WQ3A 2KFGA 4PHNA 3EKJA 1J7PA 1DTLA 1XK4A 1AK8A 2K0JA 2M29A 4PALA 3SG4A 1K2HA 1UUSA 2KAYA 1QV1A 1CM1A 3TUYC 1BR4B 2MAZA 1M45A 2LANA 2P6BB 3C1VA 4HSZA 4I5LB 2KYCA 1YUUA 1DF0A 3FWBA 1RWYA 3JVTB 1UHJA 1G4YR 1MR8A 2JNXA 4I5KA 5DKQA 2LNKA 3WXAA 3BUXB 5AXIA 3BYAA 4XJKB 2CXJA 1DJHA 1MHOA 3KPXA 1YR5A 2JU0A 3OB2B 2BL0B 1G33A 1YRUB 2LP2A 2QPTA 3PM8A 4L9MA 2K7BA 2Q91A 2MLFC 2WCBA 2KQYA 2BKIB 5AANA 1NP8A 1KQMB 1OQPA 1SBJA 1A4PA 5AFPA 1FBVA 2KYFA 4BY5A 1BOCA 1SK6D 5HLOA 2L0PA 2FOTA 1NX1A 2V53A 4GUKA 1Q80A 3BOWB 2F2OA 1QV0A 3NSIA 2A4JA 1XA5A 1CLLA 2KBMA 1K90D 1UHHA 4USLA 2M1UA 3TDZA 1JFKA 4XJKA 4YGAA 1VRKA 4WQ2A 4AOMA 1BLQA 2JZIA 2O60A 1N2DA 3TS5C 1CDLA 1ALWA 2F3YA 2SCPA 1NIWA 5I2OA 3I5GC 4XYNA 3HX4A 4JQ0D 2OS8C 3PN7B 1KFUS 1WRLA 2PASA 4A4BA 3TDUA 4F0ZB 1GGWA 2LVKA 1CTRA 1KQVA 3DF0A 1ZUZA 1XFZO 1A29A 2LC5A 4GGFA 4AQJA 2KI4C 1V1GA 2JT3A 3FS7A 4ZCUA 4E68A 1SR6C 1Y1XA 1AJ4A 1PULA 5DKNA 3I5FC 1D1OA 1XYDA 2E6WA 4JPZB 5DKRA 2NLNA 1WDCC 3PLFB 1DVIA 3CTNA 2M8UA 2OTGC 1K9KA 2AAOA 3CR2A 2M1KB 1BR1B 3CR5X 4TNCA 2K7CA 3BUOB 1DGVA 3EK8A 1FF1A 3CWGA 1BG1A 4MRYA 2JT8A 1C7WA 2PALA 1AHRA 4MRXA 3O2PA 3OX5A 1IQ5A 3A4UB 1XO5A 1CDPA 3PATA 1K95A 2NXQA 1CFPA 2ZNDA 5HYDA 4YBHB 1PVAA 1SPYA 5AEQA 1QLSA 3QRXA 1LA0A 1K93D 4NQGA 2HPSA 1LA3A 3BUWB 1QIWA 1WY9A 2KFFA 2LMUA 3WHTB 1KSOA 1SL8A 1UHIA 4PDZA 1NCXA 4QJ3B 5AERA 1OE9B 1SYMA 2WCFA 4M2PA 2BE4A 1Y1AA 4D1EA 3FWCA 1IKUA 1SCMC 1UHKA 2HF5A 3DVEA 1NSHA 1IWQA 2M97A 5I2LA 1B8LA 2L4IA 3F45A 3I5GB 1TN4A 2MBXA 1LXFC 2JTTA 2BCBA 1NX2A 1TRFA 2LHIA 5G08A 1YX8A 1KFXL 1FPWA 2H2KA 3LCPC 4N1GA 2LLTA 4Q04A 2BKHB 3PSRA 4MBEA 1R2UA 2FCDA 4MVFA 4R1EA 1GGZA 2R2IA 1FI5A 1A75A 1SRAA 2I2RE 1YRTB 2L51A 1BF5A 3JTDB 1MF8B 1EG4A 2NCOA 5BPJA 2FCEA 1DJGA 2GV5A 1W7JB 1F55A 1QASA 1XFUO 1B7TZ 1N65A 1CLMA 4PCWA 1ZOTB 1S36A 1JF2A 4MEWA 3RM1A 1JWDA 1J7RA 4DIRA 1QX7A 4QJ5B 2RGIA 1EL4A 1ZACA 1IGVA 3TDIA 2LVJA 3OP0A 1JUOA 1TCFA 2PMYA 2LHLA 2PRUA 1TNXA 1K96A 2WNDA 2KSPA 5ER5A 1PK0D 1RFJA 4IL1A 1CB1A 1S5GY 1NPQA 2K61A 4GNKB 3DF0B 1FW4A 1KK8B 1PVBA 1CDNA 2IS9A 3O4YA 1UWOA 1NX0A 2M3WA 4YGBB 1DJXA 2FJUB 3CS1A 3DVKA 1QVIZ 2GGMA 2JNFA 4PE0A 3SG3A 4C0LA 2PVBA 2Q4UA 4PHKA 3D10A 3ZNIA 1GJYA 4MN0A 1B4CA 3OB1B 5HKWA 4P5OE 1DGUA 1Y1UA 3I5HC 1J7QA 2LE9B 1ODBA 2AUCA 1CLBA 1SCVA 1NWDA 3EK4A 2JULA 4ORBB 3I5IB 5IBWA 2LMTA 3EVRA 1L2OC 3BQ3A 3VRQA 3TZ1A 2F2PA 2JPTA 3NSOA 1UHNA 1F8HA 1KSMA 2JXCA 1QX2A 2CCMA 4I5JA 2DOQA 3KHEA 1RJVA 2EC6C 2LVIA 4OR9B 3E3RA 5JJGA 1IQ3A 1EG3A 1HT9A 3O78A 1WRKA 2VRGA 1K94A 1WLMA 1XK4C 2JTZA 1YVHA 1OMRA 3SG5A 1AUIB 4CFQA 3AKAA 1UURA 2F8PA 2JQ6A 5D69A 3WHUB 3TUYB 1OZSA 3PALA 1LVCD 2KHNA 1H8BA 1U5IB 1J55A 5CSIA 2BBNA 4C0JA 1B1GA 2CT9A 5KSZA 3AAKA 5K89A 1S3PA 2B1UA 2QACA 1PSRA 4NDDA 1S26D 4ORCB 1CNPA 3KEVA 1RECA 2ZN9A 3DD4A 1DJWA 1OSAA 1H4BA 1CM4A 5I2QA 5HLVA 2M7LA 2LCPA 4MZLA 4DCKA 1BMOA 3RLZA 2ZKMX 3VRRA 2M9GA 1OMVA 1MQ1A 4MSPA 4OVNF 1EH2A 1XFWO 5J3XA 1CFDA 5HKYA 1ALVA 1J1DA 2K2FA 1KK7Z 3VGOA 4QJ4B 1OOJA 2KFHA 1N0YA 2Y1MA 1U5IA 1GQMA 2AMIA 2WORA 1A03A 1CMGA 2M49B 1M39A 1M46A 1YX7A 1A75B 1NUBA 2BL0C 2MRDA 4N5XA 3TS5B 2LP3A 3EKHA 3NSKA 2I94A 1TOPA 1BJFA 4PE4A 2Y5IA 2OS8B 3CZTX 2M7NA 1KQMC 3GK2A 2KI6D 2JC2A 2KI4B 3MSEB 1QJTA 2WOSA 4ORAB 1SKTA 1SR6B 1TTXA 1XVJA 1E8AA 1WLZA 4OKHA 2M0RA 3I5FB 1SNLA 4MZKA 2ZRSA 5CSJA 1MXLC 1SL9A 4U8DA 1ZFSA 2LAPA 1BU3A 1WDCB 3CGAA 1KCYA 4AQIA 3CLNA 4A4CA 1TNPA 2OTGB 5D7FA 1IH0A 3KF9A 4GBAA 1QXPA 2D8NA 2CBLA 4MZJA 4GGNA 1QLKA 5GQQC 4DS7A 2HQWA 1YUTA 2EHBA 2LLSA 1YUSA 3A8RA 2LVVA 2Y1NA 3EK7A 4GPLB 1C7VA 2JWWA 3GK1A 3BUMB 2G2BA 1L7ZA 2BECA 1V1FA 2CNPA 1BT6A 1KK7Y 1X02A 1TCOB 1TIZA 1CFCA 4PE1A 5HKZA 2K2AA 1S6IA 1MUXA 1EJ3A 3PFVA 2GGZA 4OCIA 1DJIA 3GK4X 2H61C 2HQ8A 2NZ0A 4GAOA 1BODA 2KI6C 2NCPA 2MA2A 1NX3A 2Y4QA 4PHJA 1A2XA 1HQVA 1TNWA 4CLNA 2LM5A 2SASA 1OZOA 1W7IB 4BY4A 5FYXA 1XFVO 2BCXA 3EVUA 4FQOA 1FI6A 4CPVA 1SCMB 3O6BA 2ZRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZWH A;  1IJ5 A;  3FIA A;  4NDC A;  1RRO A;  3BUN B;  2KQ6 A;  5PAL A;  4JWQ A;  1B8R A;  1EXR A;  1MXE A;  2I18 A;  2L2E A;  2LUC A;  3KO0 A;  1QAT A;  1DT7 B;  2ISD A;  2MJW B;  3IQO A;  3LLE A;  2KDH A;  1YUR A;  4GFT A;  4ICB A;  1F70 A;  1KWO C;  3DVJ A;  5I8N A;  1F71 A;  3GOF A;  1RTP 1;  1DJY A;  3LL8 B;  3VRN A;  2K7D A;  4YI8 A;  4M2O A;  2MLE C;  4DUQ A;  1F4Q A;  4PHM A;  4N1F A;  2F3Z A;  1TNQ A;  1CDM A;  5ER4 X;  4HRG A;  3SG7 A;  1PAL A;  3BXK A;  5F6T A;  1IJ6 A;  1B7T Y;  1YTZ C;  2K8M B;  3CR4 X;  2KAX A;  1KFX S;  1JSA A;  2KNE A;  1IRJ A;  1M63 B;  4OV2 A;  1G8I A;  2I7A A;  3DVM A;  3OX6 A;  2LLU A;  4NDB A;  3SIB A;  4P2Y B;  4FTG A;  5CSF A;  2TN4 A;  1OMD A;  1DMO A;  1YVL A;  1K8U A;  1XFY O;  2KGB C;  3IF7 A;  3BOW A;  2COL B;  5KU1 A;  1JF0 A;  3LK0 A;  2WCE A;  1DJZ A;  2F33 A;  2KGR A;  3D0Y B;  4YI9 A;  5CSN A;  2MHH A;  1SW8 A;  2L98 A;  3EVV A;  1QVI Y;  1J7O A;  1XFX O;  1S6C A;  1B47 A;  3WNX B;  1C07 A;  2E30 A;  1S1E A;  3SG2 A;  1Y0V H;  1K9U A;  2JRF A;  2JXL A;  2KAV A;  3JTD C;  3HCM A;  5JOL A;  4HRE E;  4PE7 A;  2WC8 A;  4CID A;  4ZCV A;  1J1E A;  1AJ5 A;  1ZMZ A;  4YRU A;  2ZN8 A;  4ETO A;  3JVT C;  1IG5 A;  1NYA A;  3H4S E;  3NXA A;  3SG6 A;  1Y6W A;  1JFJ A;  4MLW A;  1QIV A;  1AP4 A;  5TNC A;  2CTN A;  2KBI A;  4M2Q A;  1SL7 A;  1CMF A;  5KTY A;  3I5H B;  1SY9 A;  3D0Y A;  1F54 A;  1LKJ A;  1MWN A;  2L4H A;  1F4O A;  2H61 A;  1B9A A;  4CFR A;  1JBA A;  4I5N B;  4WRI A;  2G9B A;  1KWO B;  1L2O B;  3VRO A;  2LV7 A;  4UPG A;  1S6J A;  1NCY A;  1KK8 C;  4HRH A;  4C0K A;  4GGF C;  1M31 A;  1WRZ A;  1UP5 A;  1PSB A;  2OPO A;  3ICB A;  3SIA A;  2HET A;  3LK1 A;  4YGC B;  1PRW A;  2ZNE A;  1SMG A;  1QTX A;  2EC6 B;  2EGD A;  3SJS A;  1KFU L;  1S5G Z;  2BCA A;  3K21 A;  1QS7 A;  2L5X B;  3AAJ A;  2JOJ A;  1AVS A;  1CKK A;  3AKB A;  4YGE B;  1R6P A;  2K7O A;  1QX5 B;  2L50 A;  1NCZ A;  3PN7 C;  2LUX A;  1B8C A;  2O5G A;  3I5I C;  5CPV A;  3VRP A;  2BBM A;  2ZFD A;  1DF0 B;  4DRW A;  2KOT A;  4YGD B;  3OHM B;  3M0W A;  3IQQ A;  2LMV A;  1K9P A;  1LIN A;  2PSR A;  5B8I B;  2JT0 A;  3NSL A;  1RK9 A;  2BE6 A;  1CFF A;  1JC2 A;  4WQ3 A;  2KFG A;  4PHN A;  3EKJ A;  1J7P A;  1DTL A;  1XK4 A;  1AK8 A;  2K0J A;  2M29 A;  4PAL A;  3SG4 A;  1K2H A;  1UUS A;  2KAY A;  1QV1 A;  1CM1 A;  3TUY C;  1BR4 B;  2MAZ A;  1M45 A;  2LAN A;  2P6B B;  3C1V A;  4HSZ A;  4I5L B;  2KYC A;  1YUU A;  1DF0 A;  3FWB A;  1RWY A;  3JVT B;  1UHJ A;  1G4Y R;  1MR8 A;  2JNX A;  4I5K A;  5DKQ A;  2LNK A;  3WXA A;  3BUX B;  5AXI A;  3BYA A;  4XJK B;  2CXJ A;  1DJH A;  1MHO A;  3KPX A;  1YR5 A;  2JU0 A;  3OB2 B;  2BL0 B;  1G33 A;  1YRU B;  2LP2 A;  2QPT A;  3PM8 A;  4L9M A;  2K7B A;  2Q91 A;  2MLF C;  2WCB A;  2KQY A;  2BKI B;  5AAN A;  1NP8 A;  1KQM B;  1OQP A;  1SBJ A;  1A4P A;  5AFP A;  1FBV A;  2KYF A;  4BY5 A;  1BOC A;  1SK6 D;  5HLO A;  2L0P A;  2FOT A;  1NX1 A;  2V53 A;  4GUK A;  1Q80 A;  3BOW B;  2F2O A;  1QV0 A;  3NSI A;  2A4J A;  1XA5 A;  1CLL A;  2KBM A;  1K90 D;  1UHH A;  4USL A;  2M1U A;  3TDZ A;  1JFK A;  4XJK A;  4YGA A;  1VRK A;  4WQ2 A;  4AOM A;  1BLQ A;  2JZI A;  2O60 A;  1N2D A;  3TS5 C;  1CDL A;  1ALW A;  2F3Y A;  2SCP A;  1NIW A;  5I2O A;  3I5G C;  4XYN A;  3HX4 A;  4JQ0 D;  2OS8 C;  3PN7 B;  1KFU S;  1WRL A;  2PAS A;  4A4B A;  3TDU A;  4F0Z B;  1GGW A;  2LVK A;  1CTR A;  1KQV A;  3DF0 A;  1ZUZ A;  1XFZ O;  1A29 A;  2LC5 A;  4GGF A;  4AQJ A;  2KI4 C;  1V1G A;  2JT3 A;  3FS7 A;  4ZCU A;  4E68 A;  1SR6 C;  1Y1X A;  1AJ4 A;  1PUL A;  5DKN A;  3I5F C;  1D1O A;  1XYD A;  2E6W A;  4JPZ B;  5DKR A;  2NLN A;  1WDC C;  3PLF B;  1DVI A;  3CTN A;  2M8U A;  2OTG C;  1K9K A;  2AAO A;  3CR2 A;  2M1K B;  1BR1 B;  3CR5 X;  4TNC A;  2K7C A;  3BUO B;  1DGV A;  3EK8 A;  1FF1 A;  3CWG A;  1BG1 A;  4MRY A;  2JT8 A;  1C7W A;  2PAL A;  1AHR A;  4MRX A;  3O2P A;  3OX5 A;  1IQ5 A;  3A4U B;  1XO5 A;  1CDP A;  3PAT A;  1K95 A;  2NXQ A;  1CFP A;  2ZND A;  5HYD A;  4YBH B;  1PVA A;  1SPY A;  5AEQ A;  1QLS A;  3QRX A;  1LA0 A;  1K93 D;  4NQG A;  2HPS A;  1LA3 A;  3BUW B;  1QIW A;  1WY9 A;  2KFF A;  2LMU A;  3WHT B;  1KSO A;  1SL8 A;  1UHI A;  4PDZ A;  1NCX A;  4QJ3 B;  5AER A;  1OE9 B;  1SYM A;  2WCF A;  4M2P A;  2BE4 A;  1Y1A A;  4D1E A;  3FWC A;  1IKU A;  1SCM C;  1UHK A;  2HF5 A;  3DVE A;  1NSH A;  1IWQ A;  2M97 A;  5I2L A;  1B8L A;  2L4I A;  3F45 A;  3I5G B;  1TN4 A;  2MBX A;  1LXF C;  2JTT A;  2BCB A;  1NX2 A;  1TRF A;  2LHI A;  5G08 A;  1YX8 A;  1KFX L;  1FPW A;  2H2K A;  3LCP C;  4N1G A;  2LLT A;  4Q04 A;  2BKH B;  3PSR A;  4MBE A;  1R2U A;  2FCD A;  4MVF A;  4R1E A;  1GGZ A;  2R2I A;  1FI5 A;  1A75 A;  1SRA A;  2I2R E;  1YRT B;  2L51 A;  1BF5 A;  3JTD B;  1MF8 B;  1EG4 A;  2NCO A;  5BPJ A;  2FCE A;  1DJG A;  2GV5 A;  1W7J B;  1F55 A;  1QAS A;  1XFU O;  1B7T Z;  1N65 A;  1CLM A;  4PCW A;  1ZOT B;  1S36 A;  1JF2 A;  4MEW A;  3RM1 A;  1JWD A;  1J7R A;  4DIR A;  1QX7 A;  4QJ5 B;  2RGI A;  1EL4 A;  1ZAC A;  1IGV A;  3TDI A;  2LVJ A;  3OP0 A;  1JUO A;  1TCF A;  2PMY A;  2LHL A;  2PRU A;  1TNX A;  1K96 A;  2WND A;  2KSP A;  5ER5 A;  1PK0 D;  1RFJ A;  4IL1 A;  1CB1 A;  1S5G Y;  1NPQ A;  2K61 A;  4GNK B;  3DF0 B;  1FW4 A;  1KK8 B;  1PVB A;  1CDN A;  2IS9 A;  3O4Y A;  1UWO A;  1NX0 A;  2M3W A;  4YGB B;  1DJX A;  2FJU B;  3CS1 A;  3DVK A;  1QVI Z;  2GGM A;  2JNF A;  4PE0 A;  3SG3 A;  4C0L A;  2PVB A;  2Q4U A;  4PHK A;  3D10 A;  3ZNI A;  1GJY A;  4MN0 A;  1B4C A;  3OB1 B;  5HKW A;  4P5O E;  1DGU A;  1Y1U A;  3I5H C;  1J7Q A;  2LE9 B;  1ODB A;  2AUC A;  1CLB A;  1SCV A;  1NWD A;  3EK4 A;  2JUL A;  4ORB B;  3I5I B;  5IBW A;  2LMT A;  3EVR A;  1L2O C;  3BQ3 A;  3VRQ A;  3TZ1 A;  2F2P A;  2JPT A;  3NSO A;  1UHN A;  1F8H A;  1KSM A;  2JXC A;  1QX2 A;  2CCM A;  4I5J A;  2DOQ A;  3KHE A;  1RJV A;  2EC6 C;  2LVI A;  4OR9 B;  3E3R A;  5JJG A;  1IQ3 A;  1EG3 A;  1HT9 A;  3O78 A;  1WRK A;  2VRG A;  1K94 A;  1WLM A;  1XK4 C;  2JTZ A;  1YVH A;  1OMR A;  3SG5 A;  1AUI B;  4CFQ A;  3AKA A;  1UUR A;  2F8P A;  2JQ6 A;  5D69 A;  3WHU B;  3TUY B;  1OZS A;  3PAL A;  1LVC D;  2KHN A;  1H8B A;  1U5I B;  1J55 A;  5CSI A;  2BBN A;  4C0J A;  1B1G A;  2CT9 A;  5KSZ A;  3AAK A;  5K89 A;  1S3P A;  2B1U A;  2QAC A;  1PSR A;  4NDD A;  1S26 D;  4ORC B;  1CNP A;  3KEV A;  1REC A;  2ZN9 A;  3DD4 A;  1DJW A;  1OSA A;  1H4B A;  1CM4 A;  5I2Q A;  5HLV A;  2M7L A;  2LCP A;  4MZL A;  4DCK A;  1BMO A;  3RLZ A;  2ZKM X;  3VRR A;  2M9G A;  1OMV A;  1MQ1 A;  4MSP A;  4OVN F;  1EH2 A;  1XFW O;  5J3X A;  1CFD A;  5HKY A;  1ALV A;  1J1D A;  2K2F A;  1KK7 Z;  3VGO A;  4QJ4 B;  1OOJ A;  2KFH A;  1N0Y A;  2Y1M A;  1U5I A;  1GQM A;  2AMI A;  2WOR A;  1A03 A;  1CMG A;  2M49 B;  1M39 A;  1M46 A;  1YX7 A;  1A75 B;  1NUB A;  2BL0 C;  2MRD A;  4N5X A;  3TS5 B;  2LP3 A;  3EKH A;  3NSK A;  2I94 A;  1TOP A;  1BJF A;  4PE4 A;  2Y5I A;  2OS8 B;  3CZT X;  2M7N A;  1KQM C;  3GK2 A;  2KI6 D;  2JC2 A;  2KI4 B;  3MSE B;  1QJT A;  2WOS A;  4ORA B;  1SKT A;  1SR6 B;  1TTX A;  1XVJ A;  1E8A A;  1WLZ A;  4OKH A;  2M0R A;  3I5F B;  1SNL A;  4MZK A;  2ZRS A;  5CSJ A;  1MXL C;  1SL9 A;  4U8D A;  1ZFS A;  2LAP A;  1BU3 A;  1WDC B;  3CGA A;  1KCY A;  4AQI A;  3CLN A;  4A4C A;  1TNP A;  2OTG B;  5D7F A;  1IH0 A;  3KF9 A;  4GBA A;  1QXP A;  2D8N A;  2CBL A;  4MZJ A;  4GGN A;  1QLK A;  5GQQ C;  4DS7 A;  2HQW A;  1YUT A;  2EHB A;  2LLS A;  1YUS A;  3A8R A;  2LVV A;  2Y1N A;  3EK7 A;  4GPL B;  1C7V A;  2JWW A;  3GK1 A;  3BUM B;  2G2B A;  1L7Z A;  2BEC A;  1V1F A;  2CNP A;  1BT6 A;  1KK7 Y;  1X02 A;  1TCO B;  1TIZ A;  1CFC A;  4PE1 A;  5HKZ A;  2K2A A;  1S6I A;  1MUX A;  1EJ3 A;  3PFV A;  2GGZ A;  4OCI A;  1DJI A;  3GK4 X;  2H61 C;  2HQ8 A;  2NZ0 A;  4GAO A;  1BOD A;  2KI6 C;  2NCP A;  2MA2 A;  1NX3 A;  2Y4Q A;  4PHJ A;  1A2X A;  1HQV A;  1TNW A;  4CLN A;  2LM5 A;  2SAS A;  1OZO A;  1W7I B;  4BY4 A;  5FYX A;  1XFV O;  2BCX A;  3EVU A;  4FQO A;  1FI6 A;  4CPV A;  1SCM B;  3O6B A;  2ZRT A; 
#chains in the Genus database with same CATH topology
 3ZWH A;  3RZS A;  1IJ5 A;  3FIA A;  4NDC A;  1RRO A;  3BUN B;  3IVT A;  2KQ6 A;  5PAL A;  4JWQ A;  1B8R A;  1EXR A;  1MXE A;  2I18 A;  2L2E A;  2LUC A;  3KO0 A;  1QAT A;  1DT7 B;  2ISD A;  2MJW B;  3IQO A;  3LLE A;  2KDH A;  3DZT A;  1YUR A;  4GFT A;  4ICB A;  1F70 A;  1KWO C;  3DVJ A;  5I8N A;  1F71 A;  3GOF A;  3CZ0 A;  3B87 A;  1RTP 1;  1DJY A;  3LL8 B;  3VRN A;  2K7D A;  4YI8 A;  4M2O A;  2MLE C;  4DUQ A;  1F4Q A;  4PHM A;  4N1F A;  2F3Z A;  1TNQ A;  1CDM A;  5ER4 X;  4HRG A;  3SG7 A;  3B7A A;  1PAL A;  3BXK A;  5F6T A;  1IJ6 A;  1B7T Y;  1YTZ C;  2K8M B;  3CR4 X;  2KAX A;  1KFX S;  3CYZ A;  3S0A A;  1JSA A;  1W9Z A;  2KNE A;  3DY9 A;  1IRJ A;  3N7H A;  1M63 B;  4OV2 A;  1G8I A;  2I7A A;  3V2L A;  3DVM A;  3OX6 A;  2LLU A;  4NDB A;  3SIB A;  4P2Y B;  4FTG A;  5CSF A;  2TN4 A;  1OMD A;  3VB1 A;  1DMO A;  5FI7 A;  1YVL A;  1K8U A;  1XFY O;  2KGB C;  3IF7 A;  3BOW A;  2COL B;  5KU1 A;  1JF0 A;  3LK0 A;  1C3Z A;  3R1O A;  2WCE A;  1DJZ A;  2F33 A;  2KGR A;  3D0Y B;  4YI9 A;  5CSN A;  2MHH A;  1SW8 A;  2L98 A;  3EVV A;  3CAB A;  3S0E A;  1QVI Y;  1J7O A;  1XFX O;  1S6C A;  1B47 A;  3WNX B;  1C07 A;  2E30 A;  1S1E A;  3SG2 A;  1Y0V H;  1DEL A;  1K9U A;  2JRF A;  2JXL A;  3FE6 A;  2KAV A;  3JTD C;  3HCM A;  5JOL A;  4HRE E;  4PE7 A;  2WC8 A;  4CID A;  3S0G A;  4ZCV A;  1J1E A;  1AJ5 A;  1ZMZ A;  4YRU A;  2ZN8 A;  4ETO A;  3JVT C;  1IG5 A;  1NYA A;  3H4S E;  3NXA A;  3SG6 A;  1Y6W A;  3BFA A;  1JFJ A;  4MLW A;  1QIV A;  1AP4 A;  5TNC A;  2CTN A;  2KBI A;  4M2Q A;  1SL7 A;  1CMF A;  5KTY A;  3I5H B;  1SY9 A;  3D0Y A;  3D77 A;  1LKJ A;  1MWN A;  1F54 A;  2L4H A;  1F4O A;  2H61 A;  5HL1 A;  1B9A A;  4CFR A;  3UNW A;  3QME A;  1JBA A;  4I5N B;  4WRI A;  2G9B A;  1KWO B;  1L2O B;  3VRO A;  3K1E A;  2LV7 A;  4UPG A;  1S6J A;  1NCY A;  1KK8 C;  4HRH A;  4C0K A;  4GGF C;  1M31 A;  1WRZ A;  1UP5 A;  1PSB A;  2OPO A;  3ICB A;  3SIA A;  3D73 A;  2HET A;  3LK1 A;  1P28 A;  4YGC B;  1PRW A;  2ZNE A;  1SMG A;  1QTX A;  2EC6 B;  2EGD A;  3SJS A;  1KFU L;  3O4X A;  4OZD A;  1S5G Z;  3NHI A;  2BCA A;  3K21 A;  1QS7 A;  2L5X B;  1DQE A;  1QWV A;  3AAJ A;  2JOJ A;  1AVS A;  1CKK A;  3AKB A;  4YGE B;  1R6P A;  2K7O A;  1QX5 B;  2L50 A;  1NCZ A;  1C3Y A;  3PN7 C;  2LUX A;  1B8C A;  2O5G A;  3I5I C;  5CPV A;  3VRP A;  2BBM A;  2ZFD A;  1DF0 B;  4DRW A;  4FQT A;  2KOT A;  3OBV A;  4YGD B;  3OHM B;  3M0W A;  3IQQ A;  2LMV A;  1K9P A;  1LIN A;  2PSR A;  3B6X A;  2QEH A;  5B8I B;  2JT0 A;  3NSL A;  1RK9 A;  2BE6 A;  1CFF A;  1JC2 A;  4WQ3 A;  2KFG A;  4PHN A;  3EKJ A;  1J7P A;  2P70 A;  1DTL A;  1XK4 A;  1AK8 A;  2WC5 A;  2K0J A;  2M29 A;  4PAL A;  3SG4 A;  1DC1 A;  1K2H A;  1UUS A;  2KAY A;  1QV1 A;  1CM1 A;  3TUY C;  3D75 A;  3DYE A;  1BR4 B;  2MAZ A;  1M45 A;  2LAN A;  2P6B B;  3C1V A;  4HSZ A;  4I5L B;  2KYC A;  1YUU A;  1DF0 A;  3FWB A;  1RWY A;  3JVT B;  1UHJ A;  3CZ2 A;  1G4Y R;  1MR8 A;  2JNX A;  4I5K A;  5DKQ A;  2LNK A;  3WXA A;  4JD9 A;  3BUX B;  5AXI A;  3BYA A;  4INW A;  4XJK B;  2CXJ A;  1DJH A;  1MHO A;  3KPX A;  1YR5 A;  2JU0 A;  3D74 A;  2BL0 B;  1G33 A;  1YRU B;  2LP2 A;  2QPT A;  3PM8 A;  4L9M A;  5DIC A;  2K7B A;  2Q91 A;  4JKT A;  2MLF C;  2WCB A;  3SS3 A;  3EG5 B;  2KQY A;  2BKI B;  5AAN A;  1NP8 A;  1KQM B;  1OQP A;  1SBJ A;  1A4P A;  5AFP A;  1FBV A;  2KYF A;  4BY5 A;  1BOC A;  1SK6 D;  5HLO A;  2L0P A;  2FOT A;  1NX1 A;  2V53 A;  4GUK A;  1Q80 A;  3BOW B;  2F2O A;  1QV0 A;  2FJY A;  3NSI A;  2A4J A;  1XA5 A;  1CLL A;  2KBM A;  1K90 D;  1UHH A;  4USL A;  2M1U A;  3TDZ A;  1JFK A;  4XJK A;  4YGA A;  1VRK A;  4WQ2 A;  4AOM A;  1BLQ A;  2JZI A;  2O60 A;  1N2D A;  3TS5 C;  1CDL A;  1ALW A;  2F3Y A;  2SCP A;  1NIW A;  5I2O A;  3I5G C;  4XYN A;  3HX4 A;  4JQ0 D;  2OS8 C;  3PN7 B;  1KFU S;  1WRL A;  2PAS A;  1XFR A;  3TDU A;  4A4B A;  4F0Z B;  2LVK A;  1CTR A;  1GGW A;  1KQV A;  3DF0 A;  1ZUZ A;  1XFZ O;  1A29 A;  2LC5 A;  4GGF A;  4AQJ A;  2KI4 C;  1V1G A;  2JT3 A;  3FS7 A;  5FI2 A;  4ZCU A;  4E68 A;  1SR6 C;  1Y1X A;  1AJ4 A;  1PUL A;  5DKN A;  1OOI X;  3I5F C;  1D1O A;  1XYD A;  2E6W A;  4JPZ B;  5DKR A;  3SS5 A;  2NLN A;  1WDC C;  3PLF B;  1DVI A;  2H8V A;  3CTN A;  2M8U A;  2OTG C;  1K9K A;  2AAO A;  3CR2 A;  2M1K B;  1BR1 B;  3CR5 X;  4TNC A;  3BJH A;  2P71 A;  2GTE A;  2K7C A;  3BUO B;  1DGV A;  3EK8 A;  1FF1 A;  3CWG A;  2K60 A;  1BG1 A;  4MRY A;  2JT8 A;  1C7W A;  2PAL A;  1AHR A;  4MRX A;  3O2P A;  3OX5 A;  1IQ5 A;  3A4U B;  1XO5 A;  1CDP A;  3PAT A;  1K95 A;  2NXQ A;  1CFP A;  2ZND A;  5HYD A;  4YBH B;  1PVA A;  1SPY A;  5AEQ A;  1QLS A;  3QRX A;  1LA0 A;  1K93 D;  4NQG A;  2HPS A;  1LA3 A;  2L2C A;  3BUW B;  1QIW A;  1WY9 A;  2KFF A;  2LMU A;  1LS8 A;  3WHT B;  1KSO A;  1SL8 A;  1UHI A;  4PDZ A;  2PYQ A;  1NCX A;  4QJ3 B;  5AER A;  3PM2 A;  1OE9 B;  1SYM A;  2WCF A;  4M2P A;  2BE4 A;  1Y1A A;  4D1E A;  3FWC A;  1IKU A;  1SCM C;  1UHK A;  2HF5 A;  3DVE A;  3L47 A;  1NSH A;  1IWQ A;  2M97 A;  5I2L A;  3UO9 A;  1B8L A;  2L4I A;  3F45 A;  3I5G B;  1TUJ A;  1TN4 A;  3NHT A;  1LXF C;  2JTT A;  2MBX A;  2BCB A;  1NX2 A;  1TRF A;  2LHI A;  5G08 A;  1YX8 A;  1KFX L;  1FPW A;  2H2K A;  3LCP C;  4N1G A;  2LLT A;  4Q04 A;  2BKH B;  3PSR A;  4MBE A;  1DEK A;  1T14 A;  1R2U A;  2FCD A;  4MVF A;  4R1E A;  2QDI A;  1GGZ A;  2R2I A;  1FI5 A;  1A75 A;  1SRA A;  2I2R E;  1YRT B;  4IJ7 A;  2L51 A;  1BF5 A;  3JTD B;  1MF8 B;  1EG4 A;  2NCO A;  5BPJ A;  2FCE A;  1DJG A;  2GV5 A;  1W7J B;  1F55 A;  1QAS A;  5FI6 A;  1XFU O;  1B7T Z;  1N65 A;  1CLM A;  3S0B A;  3R1P A;  4PCW A;  1ZOT B;  2QEO A;  1S36 A;  1JF2 A;  4MEW A;  3RM1 A;  1JWD A;  1J7R A;  2WCM A;  4DIR A;  1QX7 A;  4QJ5 B;  1IIO A;  2RGI A;  1EL4 A;  1ZAC A;  1IGV A;  3TDI A;  2LVJ A;  3OP0 A;  1JUO A;  1TCF A;  2PMY A;  2LHL A;  2PRU A;  1TNX A;  1K96 A;  2WND A;  2KSP A;  5ER5 A;  1PK0 D;  1RFJ A;  4IL1 A;  1CB1 A;  3D76 A;  1S5G Y;  1NPQ A;  2K61 A;  4GNK B;  3DF0 B;  1FW4 A;  1KK8 B;  1PVB A;  1CDN A;  2IS9 A;  3O4Y A;  1UWO A;  1NX0 A;  1OOH A;  2M3W A;  4YGB B;  1DJX A;  1OOG A;  1Z2C B;  2FJU B;  3CS1 A;  3DVK A;  1QVI Z;  2BAP A;  2GGM A;  2JNF A;  4PE0 A;  5EL2 A;  3SG3 A;  4C0L A;  2PVB A;  2Q4U A;  4PHK A;  3D10 A;  3ZNI A;  1GJY A;  3R72 A;  4MN0 A;  1B4C A;  3OB1 B;  5HKW A;  3CDN A;  4P5O E;  1DGU A;  1Y1U A;  3I5H C;  1J7Q A;  2LE9 B;  1ODB A;  2AUC A;  1CLB A;  1SCV A;  2BNX A;  1NWD A;  3BFH A;  3EK4 A;  2JUL A;  4ORB B;  3I5I B;  5IBW A;  2LMT A;  3EVR A;  1L2O C;  3BQ3 A;  3VRQ A;  3TZ1 A;  2F2P A;  2JPT A;  2WCJ A;  3NSO A;  1Z4H A;  1UHN A;  1F8H A;  1KSM A;  2JXC A;  1QX2 A;  2CCM A;  4I5J A;  3D78 A;  2DOQ A;  3KHE A;  1RJV A;  2EC6 C;  2LVI A;  4OR9 B;  3E3R A;  5JJG A;  1IQ3 A;  1EG3 A;  1HT9 A;  3O78 A;  1WRK A;  2VRG A;  1K94 A;  1WLM A;  1XK4 C;  2JTZ A;  1YVH A;  1OMR A;  2YGU A;  1SSE B;  3SG5 A;  1AUI B;  4CFQ A;  3AKA A;  1UUR A;  2F8P A;  2JQ6 A;  2KLD A;  5D69 A;  3WHU B;  3TUY B;  1OZS A;  2L5Y A;  1LVC D;  3PAL A;  2KHN A;  1H8B A;  1U5I B;  1J55 A;  5CSI A;  1GM0 A;  2BBN A;  4C0J A;  2JPO A;  2CT9 A;  1B1G A;  5KSZ A;  3AAK A;  5K89 A;  1S3P A;  2B1U A;  1ORG A;  2QAC A;  1PSR A;  4NDD A;  1S26 D;  4ORC B;  1CNP A;  3KEV A;  4KYN A;  3B86 A;  1REC A;  1OOF A;  2ZN9 A;  3DD4 A;  3OGN A;  4INX A;  1DJW A;  1OSA A;  1H4B A;  1CM4 A;  5I2Q A;  5HLV A;  2M7L A;  2LCP A;  4MZL A;  4DCK A;  1BMO A;  3RLZ A;  2ZKM X;  3VRR A;  2M9G A;  1OMV A;  1MQ1 A;  3OB2 B;  4MSP A;  4OVN F;  1XFW O;  1EH2 A;  5J3X A;  1CFD A;  5HKY A;  3NGV A;  1ALV A;  1J1D A;  2K2F A;  1KK7 Z;  3VGO A;  4QJ4 B;  1OOJ A;  1TWO A;  2KFH A;  1N0Y A;  2WC6 A;  3DXL A;  3S0D A;  2WCH A;  2Y1M A;  1U5I A;  1GQM A;  2AMI A;  2WOR A;  1A03 A;  1CMG A;  2M49 B;  1M39 A;  1M46 A;  1YX7 A;  4PT1 A;  1A75 B;  1NUB A;  2BL0 C;  2MRD A;  4N5X A;  3TS5 B;  2LP3 A;  3EKH A;  3CZ1 A;  3NSK A;  2I94 A;  3BFB A;  1TOP A;  1BJF A;  4PE4 A;  2Y5I A;  2OS8 B;  3CZT X;  2M7N A;  1KQM C;  3L4L A;  3GK2 A;  2KI6 D;  2JC2 A;  2KI4 B;  3MSE B;  1QJT A;  2WOS A;  4ORA B;  5D3O A;  1SKT A;  3B88 A;  1SR6 B;  1TTX A;  1XVJ A;  1E8A A;  1WLZ A;  4OKH A;  2M0R A;  3I5F B;  1SNL A;  4MZK A;  2ZRS A;  5CSJ A;  1MXL C;  1SL9 A;  1TUZ A;  4U8D A;  1ZFS A;  2LAP A;  3SS4 A;  2ERB A;  1BU3 A;  1WDC B;  3CGA A;  3Q8I A;  1KCY A;  4AQI A;  3CLN A;  4A4C A;  1TNP A;  2PQL A;  2WCK A;  2OTG B;  5D7F A;  2WCL A;  3KF9 A;  1IH0 A;  4GBA A;  1QXP A;  2D8N A;  2CBL A;  4MZJ A;  4GGN A;  1OW4 A;  1QLK A;  5GQQ C;  2HQW A;  4DS7 A;  2QEB A;  1YUT A;  2EHB A;  2LLS A;  1YUS A;  3A8R A;  2LVV A;  2QEV A;  2Y1N A;  3EK7 A;  4GPL B;  2JWW A;  3S0F A;  5I94 A;  1C7V A;  3L4A A;  3GK1 A;  3BUM B;  2G2B A;  1L7Z A;  2BEC A;  1V1F A;  2CNP A;  1BT6 A;  1KK7 Y;  3PJI A;  1X02 A;  1TCO B;  1TIZ A;  1CFC A;  4PE1 A;  5HKZ A;  2K2A A;  3FE8 A;  1S6I A;  1MUX A;  1EJ3 A;  3PFV A;  2GGZ A;  4OCI A;  1DJI A;  3GK4 X;  2H61 C;  2HQ8 A;  2KLE A;  2NZ0 A;  4GAO A;  2KPH A;  1BOD A;  2KI6 C;  2NCP A;  2MA2 A;  1NX3 A;  2Y4Q A;  4PHJ A;  1A2X A;  1HQV A;  1TNW A;  4CLN A;  2LM5 A;  2SAS A;  1OZO A;  1W7I B;  4BY4 A;  5FYX A;  1XFV O;  2BCX A;  3EVU A;  3FE9 A;  4FQO A;  1FI6 A;  4CPV A;  4F7F A;  1SCM B;  3O6B A;  2ZRT A;  3R1V A; 
#chains in the Genus database with same CATH homology
 3ZWH A;  1IJ5 A;  3FIA A;  4NDC A;  1RRO A;  3BUN B;  2KQ6 A;  5PAL A;  4JWQ A;  1B8R A;  1EXR A;  1MXE A;  2I18 A;  2L2E A;  2LUC A;  3KO0 A;  1QAT A;  1DT7 B;  2ISD A;  2MJW B;  3IQO A;  3LLE A;  2KDH A;  1YUR A;  4GFT A;  4ICB A;  1F70 A;  1KWO C;  3DVJ A;  5I8N A;  1F71 A;  3GOF A;  1RTP 1;  1DJY A;  3LL8 B;  3VRN A;  2K7D A;  4YI8 A;  4M2O A;  2MLE C;  4DUQ A;  1F4Q A;  4PHM A;  4N1F A;  2F3Z A;  1TNQ A;  1CDM A;  5ER4 X;  4HRG A;  3SG7 A;  1PAL A;  3BXK A;  5F6T A;  1IJ6 A;  1B7T Y;  1YTZ C;  2K8M B;  3CR4 X;  2KAX A;  1KFX S;  1JSA A;  2KNE A;  1IRJ A;  1M63 B;  4OV2 A;  1G8I A;  2I7A A;  3DVM A;  3OX6 A;  2LLU A;  4NDB A;  3SIB A;  4P2Y B;  4FTG A;  5CSF A;  2TN4 A;  1OMD A;  1DMO A;  1YVL A;  1K8U A;  1XFY O;  2KGB C;  3IF7 A;  3BOW A;  2COL B;  5KU1 A;  1JF0 A;  3LK0 A;  2WCE A;  1DJZ A;  2F33 A;  2KGR A;  3D0Y B;  4YI9 A;  5CSN A;  2MHH A;  1SW8 A;  2L98 A;  3EVV A;  1QVI Y;  1J7O A;  1XFX O;  1S6C A;  1B47 A;  3WNX B;  1C07 A;  2E30 A;  1S1E A;  3SG2 A;  1Y0V H;  1K9U A;  2JRF A;  2JXL A;  2KAV A;  3JTD C;  3HCM A;  5JOL A;  4HRE E;  4PE7 A;  2WC8 A;  4CID A;  4ZCV A;  1J1E A;  1AJ5 A;  1ZMZ A;  4YRU A;  2ZN8 A;  4ETO A;  3JVT C;  1IG5 A;  1NYA A;  3H4S E;  3NXA A;  3SG6 A;  1Y6W A;  1JFJ A;  4MLW A;  1QIV A;  1AP4 A;  5TNC A;  2CTN A;  2KBI A;  4M2Q A;  1SL7 A;  1CMF A;  5KTY A;  3I5H B;  1SY9 A;  3D0Y A;  1F54 A;  1LKJ A;  1MWN A;  2L4H A;  1F4O A;  2H61 A;  1B9A A;  4CFR A;  1JBA A;  4I5N B;  4WRI A;  2G9B A;  1KWO B;  1L2O B;  3VRO A;  2LV7 A;  4UPG A;  1S6J A;  1NCY A;  1KK8 C;  4HRH A;  4C0K A;  4GGF C;  1M31 A;  1WRZ A;  1UP5 A;  1PSB A;  2OPO A;  3ICB A;  3SIA A;  2HET A;  3LK1 A;  4YGC B;  1PRW A;  2ZNE A;  1SMG A;  1QTX A;  2EC6 B;  2EGD A;  3SJS A;  1KFU L;  1S5G Z;  2BCA A;  3K21 A;  1QS7 A;  2L5X B;  3AAJ A;  2JOJ A;  1AVS A;  1CKK A;  3AKB A;  4YGE B;  1R6P A;  2K7O A;  1QX5 B;  2L50 A;  1NCZ A;  3PN7 C;  2LUX A;  1B8C A;  2O5G A;  3I5I C;  5CPV A;  3VRP A;  2BBM A;  2ZFD A;  1DF0 B;  4DRW A;  2KOT A;  4YGD B;  3OHM B;  3M0W A;  3IQQ A;  2LMV A;  1K9P A;  1LIN A;  2PSR A;  5B8I B;  2JT0 A;  3NSL A;  1RK9 A;  2BE6 A;  1CFF A;  1JC2 A;  4WQ3 A;  2KFG A;  4PHN A;  3EKJ A;  1J7P A;  1DTL A;  1XK4 A;  1AK8 A;  2K0J A;  2M29 A;  4PAL A;  3SG4 A;  1K2H A;  1UUS A;  2KAY A;  1QV1 A;  1CM1 A;  3TUY C;  1BR4 B;  2MAZ A;  1M45 A;  2LAN A;  2P6B B;  3C1V A;  4HSZ A;  4I5L B;  2KYC A;  1YUU A;  1DF0 A;  3FWB A;  1RWY A;  3JVT B;  1UHJ A;  1G4Y R;  1MR8 A;  2JNX A;  4I5K A;  5DKQ A;  2LNK A;  3WXA A;  3BUX B;  5AXI A;  3BYA A;  4XJK B;  2CXJ A;  1DJH A;  1MHO A;  3KPX A;  1YR5 A;  2JU0 A;  3OB2 B;  2BL0 B;  1G33 A;  1YRU B;  2LP2 A;  2QPT A;  3PM8 A;  4L9M A;  2K7B A;  2Q91 A;  2MLF C;  2WCB A;  2KQY A;  2BKI B;  5AAN A;  1NP8 A;  1KQM B;  1OQP A;  1SBJ A;  1A4P A;  5AFP A;  1FBV A;  2KYF A;  4BY5 A;  1BOC A;  1SK6 D;  5HLO A;  2L0P A;  2FOT A;  1NX1 A;  2V53 A;  4GUK A;  1Q80 A;  3BOW B;  2F2O A;  1QV0 A;  3NSI A;  2A4J A;  1XA5 A;  1CLL A;  2KBM A;  1K90 D;  1UHH A;  4USL A;  2M1U A;  3TDZ A;  1JFK A;  4XJK A;  4YGA A;  1VRK A;  4WQ2 A;  4AOM A;  1BLQ A;  2JZI A;  2O60 A;  1N2D A;  3TS5 C;  1CDL A;  1ALW A;  2F3Y A;  2SCP A;  1NIW A;  5I2O A;  3I5G C;  4XYN A;  3HX4 A;  4JQ0 D;  2OS8 C;  3PN7 B;  1KFU S;  1WRL A;  2PAS A;  4A4B A;  3TDU A;  4F0Z B;  1GGW A;  2LVK A;  1CTR A;  1KQV A;  3DF0 A;  1ZUZ A;  1XFZ O;  1A29 A;  2LC5 A;  4GGF A;  4AQJ A;  2KI4 C;  1V1G A;  2JT3 A;  3FS7 A;  4ZCU A;  4E68 A;  1SR6 C;  1Y1X A;  1AJ4 A;  1PUL A;  5DKN A;  3I5F C;  1D1O A;  1XYD A;  2E6W A;  4JPZ B;  5DKR A;  2NLN A;  1WDC C;  3PLF B;  1DVI A;  3CTN A;  2M8U A;  2OTG C;  1K9K A;  2AAO A;  3CR2 A;  2M1K B;  1BR1 B;  3CR5 X;  4TNC A;  2K7C A;  3BUO B;  1DGV A;  3EK8 A;  1FF1 A;  3CWG A;  1BG1 A;  4MRY A;  2JT8 A;  1C7W A;  2PAL A;  1AHR A;  4MRX A;  3O2P A;  3OX5 A;  1IQ5 A;  3A4U B;  1XO5 A;  1CDP A;  3PAT A;  1K95 A;  2NXQ A;  1CFP A;  2ZND A;  5HYD A;  4YBH B;  1PVA A;  1SPY A;  5AEQ A;  1QLS A;  3QRX A;  1LA0 A;  1K93 D;  4NQG A;  2HPS A;  1LA3 A;  3BUW B;  1QIW A;  1WY9 A;  2KFF A;  2LMU A;  3WHT B;  1KSO A;  1SL8 A;  1UHI A;  4PDZ A;  1NCX A;  4QJ3 B;  5AER A;  1OE9 B;  1SYM A;  2WCF A;  4M2P A;  2BE4 A;  1Y1A A;  4D1E A;  3FWC A;  1IKU A;  1SCM C;  1UHK A;  2HF5 A;  3DVE A;  1NSH A;  1IWQ A;  2M97 A;  5I2L A;  1B8L A;  2L4I A;  3F45 A;  3I5G B;  1TN4 A;  2MBX A;  1LXF C;  2JTT A;  2BCB A;  1NX2 A;  1TRF A;  2LHI A;  5G08 A;  1YX8 A;  1KFX L;  1FPW A;  2H2K A;  3LCP C;  4N1G A;  2LLT A;  4Q04 A;  2BKH B;  3PSR A;  4MBE A;  1R2U A;  2FCD A;  4MVF A;  4R1E A;  1GGZ A;  2R2I A;  1FI5 A;  1A75 A;  1SRA A;  2I2R E;  1YRT B;  2L51 A;  1BF5 A;  3JTD B;  1MF8 B;  1EG4 A;  2NCO A;  5BPJ A;  2FCE A;  1DJG A;  2GV5 A;  1W7J B;  1F55 A;  1QAS A;  1XFU O;  1B7T Z;  1N65 A;  1CLM A;  4PCW A;  1ZOT B;  1S36 A;  1JF2 A;  4MEW A;  3RM1 A;  1JWD A;  1J7R A;  4DIR A;  1QX7 A;  4QJ5 B;  2RGI A;  1EL4 A;  1ZAC A;  1IGV A;  3TDI A;  2LVJ A;  3OP0 A;  1JUO A;  1TCF A;  2PMY A;  2LHL A;  2PRU A;  1TNX A;  1K96 A;  2WND A;  2KSP A;  5ER5 A;  1PK0 D;  1RFJ A;  4IL1 A;  1CB1 A;  1S5G Y;  1NPQ A;  2K61 A;  4GNK B;  3DF0 B;  1FW4 A;  1KK8 B;  1PVB A;  1CDN A;  2IS9 A;  3O4Y A;  1UWO A;  1NX0 A;  2M3W A;  4YGB B;  1DJX A;  2FJU B;  3CS1 A;  3DVK A;  1QVI Z;  2GGM A;  2JNF A;  4PE0 A;  3SG3 A;  4C0L A;  2PVB A;  2Q4U A;  4PHK A;  3D10 A;  3ZNI A;  1GJY A;  4MN0 A;  1B4C A;  3OB1 B;  5HKW A;  4P5O E;  1DGU A;  1Y1U A;  3I5H C;  1J7Q A;  2LE9 B;  1ODB A;  2AUC A;  1CLB A;  1SCV A;  1NWD A;  3EK4 A;  2JUL A;  4ORB B;  3I5I B;  5IBW A;  2LMT A;  3EVR A;  1L2O C;  3BQ3 A;  3VRQ A;  3TZ1 A;  2F2P A;  2JPT A;  3NSO A;  1UHN A;  1F8H A;  1KSM A;  2JXC A;  1QX2 A;  2CCM A;  4I5J A;  2DOQ A;  3KHE A;  1RJV A;  2EC6 C;  2LVI A;  4OR9 B;  3E3R A;  5JJG A;  1IQ3 A;  1EG3 A;  1HT9 A;  3O78 A;  1WRK A;  2VRG A;  1K94 A;  1WLM A;  1XK4 C;  2JTZ A;  1YVH A;  1OMR A;  3SG5 A;  1AUI B;  4CFQ A;  3AKA A;  1UUR A;  2F8P A;  2JQ6 A;  5D69 A;  3WHU B;  3TUY B;  1OZS A;  3PAL A;  1LVC D;  2KHN A;  1H8B A;  1U5I B;  1J55 A;  5CSI A;  2BBN A;  4C0J A;  1B1G A;  2CT9 A;  5KSZ A;  3AAK A;  5K89 A;  1S3P A;  2B1U A;  2QAC A;  1PSR A;  4NDD A;  1S26 D;  4ORC B;  1CNP A;  3KEV A;  1REC A;  2ZN9 A;  3DD4 A;  1DJW A;  1OSA A;  1H4B A;  1CM4 A;  5I2Q A;  5HLV A;  2M7L A;  2LCP A;  4MZL A;  4DCK A;  1BMO A;  3RLZ A;  2ZKM X;  3VRR A;  2M9G A;  1OMV A;  1MQ1 A;  4MSP A;  4OVN F;  1EH2 A;  1XFW O;  5J3X A;  1CFD A;  5HKY A;  1ALV A;  1J1D A;  2K2F A;  1KK7 Z;  3VGO A;  4QJ4 B;  1OOJ A;  2KFH A;  1N0Y A;  2Y1M A;  1U5I A;  1GQM A;  2AMI A;  2WOR A;  1A03 A;  1CMG A;  2M49 B;  1M39 A;  1M46 A;  1YX7 A;  1A75 B;  1NUB A;  2BL0 C;  2MRD A;  4N5X A;  3TS5 B;  2LP3 A;  3EKH A;  3NSK A;  2I94 A;  1TOP A;  1BJF A;  4PE4 A;  2Y5I A;  2OS8 B;  3CZT X;  2M7N A;  1KQM C;  3GK2 A;  2KI6 D;  2JC2 A;  2KI4 B;  3MSE B;  1QJT A;  2WOS A;  4ORA B;  1SKT A;  1SR6 B;  1TTX A;  1XVJ A;  1E8A A;  1WLZ A;  4OKH A;  2M0R A;  3I5F B;  1SNL A;  4MZK A;  2ZRS A;  5CSJ A;  1MXL C;  1SL9 A;  4U8D A;  1ZFS A;  2LAP A;  1BU3 A;  1WDC B;  3CGA A;  1KCY A;  4AQI A;  3CLN A;  4A4C A;  1TNP A;  2OTG B;  5D7F A;  1IH0 A;  3KF9 A;  4GBA A;  1QXP A;  2D8N A;  2CBL A;  4MZJ A;  4GGN A;  1QLK A;  5GQQ C;  4DS7 A;  2HQW A;  1YUT A;  2EHB A;  2LLS A;  1YUS A;  3A8R A;  2LVV A;  2Y1N A;  3EK7 A;  4GPL B;  1C7V A;  2JWW A;  3GK1 A;  3BUM B;  2G2B A;  1L7Z A;  2BEC A;  1V1F A;  2CNP A;  1BT6 A;  1KK7 Y;  1X02 A;  1TCO B;  1TIZ A;  1CFC A;  4PE1 A;  5HKZ A;  2K2A A;  1S6I A;  1MUX A;  1EJ3 A;  3PFV A;  2GGZ A;  4OCI A;  1DJI A;  3GK4 X;  2H61 C;  2HQ8 A;  2NZ0 A;  4GAO A;  1BOD A;  2KI6 C;  2NCP A;  2MA2 A;  1NX3 A;  2Y4Q A;  4PHJ A;  1A2X A;  1HQV A;  1TNW A;  4CLN A;  2LM5 A;  2SAS A;  1OZO A;  1W7I B;  4BY4 A;  5FYX A;  1XFV O;  2BCX A;  3EVU A;  4FQO A;  1FI6 A;  4CPV A;  1SCM B;  3O6B A;  2ZRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...