2E6WA

Solution structure and calcium binding properties of ef-hands 3 and 4 of calsenilin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
96
structure length
96
Chain Sequence
GTVHEKLKWAFNLYDINKDGYITKEEMLAIMKSIYDMMGRHTYPILREDAPAEHVERFFEKMDRNQDGVVTIEEFLEACQKDENIMSSMQLFENVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Calsenilin
publication title Solution structure and calcium-binding properties of EF-hands 3 and 4 of calsenilin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 21
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2e6wA00
4A4CA 3WNXB 2JRFA 3FWCA 1SK6D 3TDUA 1NIWA 1H4BA 1QXPA 2KQ6A 3VRPA 1V1FA 1M31A 2MA2A 2WCFA 2K7DA 4P5OE 4M2PA 4XYNA 5DKRA 2JT8A 1Q80A 1YR5A 4GPLB 2G9BA 2MAZA 3GK2A 1B47A 3OX6A 1J7OA 4MZJA 3I5IB 3PN7B 1EL4A 2HPSA 4ZCUA 2QACA 1K93D 1SL7A 1BODA 2KOTA 1BOCA 3BUNB 1KQMC 1NP8A 2AAOA 4ICBA 4DCKA 4F0ZB 2NCOA 1CMFA 4BY4A 2L4HA 3I5GC 4IL1A 3VGOA 2F2PA 1BT6A 5DKQA 1F4QA 1F8HA 4YI8A 4ZCVA 1S5GY 4CPVA 1XFZO 3WHUB 2F3YA 2FCDA 1ALWA 1LA0A 3K21A 1BU3A 2FOTA 1NPQA 4PE0A 4MLWA 2KGBC 2LAPA 1XFUO 3CR5X 4U8DA 1DF0B 4I5JA 3O4YA 5AANA 1QX5B 3TUYB 2K2AA 4ORAB 2AUCA 2O60A 3FIAA 1DT7B 2NLNA 1F4OA 3BOWB 1B8RA 2COLB 1UHJA 2JPTA 1DJHA 3CS1A 1KFUL 3DF0B 1SL8A 2Y5IA 4CFQA 1SR6B 3TZ1A 2Y1MA 4JPZB 1B7TY 2ZRTA 2WNDA 1KK8B 1L7ZA 1NSHA 3BXKA 4WQ3A 1XK4C 5AFPA 1IQ5A 2I7AA 2LUXA 5J3XA 1FF1A 1UHKA 3WXAA 1S6CA 3HX4A 2ZN8A 1CDMA 2BKHB 1KWOC 4AQIA 3D0YA 1UURA 5B8IB 1CFFA 1WDCB 3I5FC 2K2FA 2GGMA 1K90D 1MHOA 5HKZA 1J7PA 1KSMA 1NX3A 2MLFC 2KBMA 2G2BA 1JFKA 1KSOA 3LK1A 2RGIA 2LHIA 1H8BA 1QS7A 1EG3A 1K9UA 4DIRA 3RM1A 1SKTA 4YGDB 1AJ5A 1AP4A 2KFGA 2PRUA 1YUUA 2K7OA 1PK0D 1BR1B 5HKYA 4MRYA 3VRRA 3EK7A 1ZMZA 2OS8B 3CGAA 2KYFA 3KHEA 4QJ4B 1L2OB 1MF8B 1DGUA 2L98A 1F71A 2KI4B 1J7QA 4PCWA 1M46A 3EVUA 1IJ6A 1AJ4A 1DGVA 2M9GA 1SMGA 1YURA 4AOMA 2B1UA 2M8UA 2JT0A 4GGFC 2SASA 4GFTA 1N0YA 2K7BA 2M3WA 1TCFA 1A75A 1IGVA 1SCMB 2JWWA 2LHLA 3E3RA 2M7NA 3O78A 4GGNA 4OV2A 1DJZA 2JQ6A 2SCPA 1QX2A 3PLFB 4CLNA 1OE9B 1QASA 1XFVO 2EC6C 2KGRA 3SG4A 4PHKA 5K89A 2GGZA 1XFXO 3NSOA 1CDLA 2LMTA 1ZACA 2JC2A 2ZFDA 1RTP1 2PASA 3IQOA 5KSZA 1J55A 2L4IA 1GQMA 4FTGA 1G33A 3KPXA 5CSJA 1EJ3A 1AVSA 1BMOA 3EVVA 2GV5A 4UPGA 3CLNA 2M97A 4OCIA 2TN4A 2LLSA 1UHNA 2EGDA 1RFJA 1CFPA 4MSPA 1PVBA 3AAKA 1TTXA 1UHIA 3CTNA 2F3ZA 2L2EA 1K9PA 1K9KA 2KQYA 3FWBA 4MZKA 3BYAA 1EXRA 2BL0B 1WRZA 1BLQA 3D0YB 3EK4A 2ZNEA 3SIBA 2KYCA 4HRHA 1PALA 1JBAA 2JT3A 1ZOTB 1AUIB 1NUBA 1WRLA 5JJGA 4ORBB 3I5IC 4OR9B 4NDBA 3PN7C 2H61A 5F6TA 2KAYA 2KSPA 5FYXA 1TNQA 1FW4A 1B9AA 2KI6D 2LUCA 1KFXL 4M2OA 5AEQA 1X02A 1ZFSA 2I18A 1IRJA 3OB1B 5I2QA 2A4JA 1CM4A 1B8LA 1SCVA 3DVEA 2ISDA 1LKJA 3PFVA 2CNPA 1YTZC 4QJ5B 3LLEA 5KTYA 2KDHA 2O5GA 2BE6A 4C0JA 2AMIA 4YGAA 1MQ1A 1SY9A 3SJSA 1QVIZ 1K2HA 1XFYO 5BPJA 2WOSA 1J1EA 1S1EA 3BUWB 2JNFA 3TDZA 4XJKA 4USLA 3WHTB 1TRFA 1TCOB 3TUYC 1XVJA 3TS5B 1AK8A 1K94A 1A75B 2I94A 1TIZA 1KFUS 3BUMB 2WCEA 1CTRA 2KNEA 1VRKA 4C0KA 2JOJA 4MZLA 1CLMA 1CFDA 1SR6C 1KK8C 1SL9A 2MBXA 2M0RA 4GBAA 3GK4X 1WLZA 1YRTB 1ZUZA 3F45A 4N1GA 1WDCC 1SYMA 1G4YR 4HSZA 2LP2A 1A2XA 5HKWA 3DVMA 4HREE 1CKKA 1QV0A 1YVLA 4MVFA 4PE1A 3DVJA 3CWGA 1FI6A 2M7LA 2JXLA 3KF9A 2DOQA 2BBMA 4CFRA 2LLTA 3PATA 1RWYA 4YGBB 4AQJA 1N65A 3OX5A 1TNPA 1LA3A 3I5HB 1BF5A 2PALA 2L50A 2ZN9A 2JZIA 4A4BA 2OPOA 2JXCA 2OS8C 1IG5A 4N5XA 1GJYA 3D10A 1L2OC 2NXQA 3JTDB 3NSIA 4OVNF 3EKJA 2ZNDA 2KI4C 1DJGA 1TN4A 1DJXA 1N2DA 4DS7A 2HETA 1J1DA 1S26D 4JWQA 1XYDA 1CNPA 1PRWA 4ORCB 1D1OA 3EVRA 1OOJA 2R2IA 2K8MB 5ER4X 2M49B 5PALA 1SCMC 3MSEB 1DJWA 3ZWHA 2JNXA 1EH2A 2V53A 1QJTA 1XO5A 2WCBA 1JC2A 2F8PA 1BR4B 1OSAA 3KO0A 3CR2A 1GGWA 5KU1A 2KAXA 1IKUA 4NDCA 1S3PA 4XJKB 1PVAA 1G8IA 1FBVA 5CPVA 2H2KA 4YGCB 1QVIY 2KAVA 1WLMA 3SG2A 1NX0A 3AKAA 4JQ0D 1RROA 1NCZA 2Y4QA 3BUXB 4GAOA 3QRXA 5ER5A 1MUXA 1QLKA 4FQOA 1YVHA 3SG6A 1QIVA 4PE4A 1CFCA 2P6BB 2KFHA 3SG5A 1S6JA 4E68A 4MN0A 1NX2A 4PALA 4PE7A 2BL0C 1CM1A 1OZSA 4HRGA 2OTGB 1XK4A 5IBWA 1RECA 3IQQA 4MBEA 3NSLA 2E6WA 2HF5A 1F55A 1TNWA 2L51A 3A4UB 4DUQA 2FJUB 1TOPA 1UWOA 4YGEB 1OMRA 4TNCA 1C7WA 3A8RA 1AHRA 1FI5A 3SIAA 1SRAA 2IS9A 5AERA 1BG1A 1KCYA 1Y1AA 3JVTB 1UP5A 4I5LB 3OP0A 1IJ5A 2Q4UA 1WY9A 1NYAA 1Y1XA 1YX7A 1NCXA 4BY5A 2BCAA 2FCEA 3PALA 5I2LA 3CR4X 3AAJA 5CSFA 5G08A 1CMGA 1U5IA 1RK9A 2M29A 1JUOA 1F54A 3NXAA 1PULA 3AKBA 3KEVA 2CCMA 2CTNA 1OZOA 3SG7A 2EHBA 3SG3A 4PHNA 3TS5C 2LVVA 4WQ2A 5CSIA 2QPTA 3VROA 3RLZA 2BCBA 2BCXA 4YBHB 1DTLA 1KQMB 2MHHA 1PSRA 1EG4A 4GGFA 1QIWA 2K61A 3I5GB 5HLOA 3IF7A 4M2QA 2PMYA 2LE9B 1B8CA 2KHNA 1DMOA 2LP3A 3O2PA 4DRWA 2ZRSA 2D8NA 1KK7Z 1LINA 1QX7A 1UHHA 1QV1A 1QTXA 2L5XB 1SNLA 4Q04A 1J7RA 1R6PA 2K7CA 2LMVA 1XFWO 1HQVA 1HT9A 2LVIA 2M1UA 1MR8A 3DD4A 2LVJA 4MEWA 1JF2A 1QATA 3PSRA 4NQGA 1SBJA 1A29A 1PSBA 5TNCA 4QJ3B 2MJWB 1GGZA 3ICBA 3BQ3A 1DJYA 2K0JA 3PM8A 2LLUA 1K8UA 1NCYA 1IH0A 1NX1A 1OMVA 3EKHA 2LVKA 1RJVA 3M0WA 2E30A 4PHMA 4R1EA 1JWDA 2HQ8A 1C07A 2JTZA 1K95A 3I5HC 1A4PA 3H4SE 5JOLA 1JSAA 1CDPA 1YRUB 5I2OA 4GUKA 2ZKMX 3OHMB 4YI9A 2KBIA 3JTDC 3O6BA 1KWOB 2LNKA 1TNXA 1QLSA 2H61C 2LC5A 2HQWA 1DVIA 1B1GA 3I5FB 5GQQC 1A03A 3NSKA 2JU0A 2MRDA 1ODBA 4CIDA 3LCPC 1UUSA 1S5GZ 3GK1A 1V1GA 4I5KA 2MLEC 1OQPA 5HYDA 4I5NB 2LANA 2BE4A 1C7VA 1LXFC 3GOFA 4NDDA 4PDZA 3DVKA 1CB1A 3C1VA 1OMDA 1F70A 4MRXA 1U5IB 2F2OA 2VRGA 1NWDA 2CT9A 5CSNA 1Y1UA 5HLVA 1YUSA 1WRKA 3TDIA 2LMUA 1W7IB 1CLBA 1M63B 2I2RE 1XA5A 2NCPA 2L0PA 1DF0A 2PVBA 1R2UA 2BECA 3VRQA 1FPWA 1CDNA 1B7TZ 1DJIA 1SW8A 4ETOA 4P2YB 1E8AA 2M1KB 1IWQA 3BOWA 2WC8A 2Q91A 5AXIA 5I8NA 3EK8A 2LCPA 2CXJA 1LVCD 3CZTX 3BUOB 1S6IA 2EC6B 5D7FA 3HCMA 1MWNA 1ALVA 1Y0VH 3DF0A 1SPYA 4D1EA 1YX8A 1BJFA 5D69A 1MXLC 2JTTA 2LM5A 1M39A 2OTGC 1S36A 1W7JB 4C0LA 4YRUA 3OB2B 2WORA 1KK7Y 1JFJA 2KI6C 2Y1NA 3VRNA 1JF0A 2NZ0A 2PSRA 1KFXS 2BBNA 2LV7A 4OKHA 4WRIA 2CBLA 2KFFA 1Y6WA 1KQVA 1B4CA 3LL8B 3JVTC 2BKIB 4PHJA 1YUTA 1M45A 1K96A 5DKNA 1CLLA 4L9MA 3FS7A 4N1FA 3ZNIA 1MXEA 4GNKB 2JULA 3LK0A 1IQ3A 2F33A
chains in the Genus database with same CATH superfamily
4A4CA 3WNXB 2JRFA 3FWCA 1SK6D 3TDUA 1NIWA 1H4BA 1QXPA 2KQ6A 3VRPA 1V1FA 1M31A 2MA2A 2WCFA 2K7DA 4P5OE 4M2PA 4XYNA 5DKRA 2JT8A 1Q80A 1YR5A 4GPLB 2G9BA 2MAZA 3GK2A 1B47A 3OX6A 1J7OA 4MZJA 3I5IB 1TUJA 3PN7B 1EL4A 2HPSA 4ZCUA 2QACA 1K93D 1SL7A 1BODA 2KOTA 3QMEA 1BOCA 3BUNB 1KQMC 2L2CA 3L47A 1NP8A 2AAOA 4ICBA 4DCKA 4F0ZB 2NCOA 1CMFA 4BY4A 2L4HA 3I5GC 4IL1A 3VGOA 2F2PA 1BT6A 5DKQA 5EL2A 1F4QA 1F8HA 4YI8A 4ZCVA 1S5GY 4CPVA 1XFZO 3WHUB 2F3YA 2FCDA 1ALWA 1LA0A 2QEBA 3K21A 1BU3A 3S0EA 2FOTA 1NPQA 4PE0A 4MLWA 2KGBC 1DQEA 2LAPA 1XFUO 3CR5X 4U8DA 1DF0B 4I5JA 3O4YA 4JKTA 5AANA 1QX5B 3TUYB 2K2AA 4ORAB 2AUCA 2O60A 3FIAA 1DT7B 2NLNA 1F4OA 3BOWB 1B8RA 2COLB 1UHJA 2JPTA 3R1VA 1DJHA 3B6XA 3CS1A 1KFUL 3DF0B 1SL8A 2Y5IA 4CFQA 1SR6B 3TZ1A 2Y1MA 4JPZB 1B7TY 2ZRTA 2WNDA 1KK8B 1L7ZA 1NSHA 3BXKA 4WQ3A 1XK4C 5AFPA 1IQ5A 2I7AA 2LUXA 5J3XA 1FF1A 3FE8A 1UHKA 3WXAA 1S6CA 3SS5A 2PQLA 3D76A 3HX4A 2ZN8A 1CDMA 3SS4A 2BKHB 1KWOC 4AQIA 2BAPA 1UURA 3D0YA 5B8IB 1CFFA 1WDCB 3NHTA 3I5FC 2K2FA 2GGMA 1K90D 1MHOA 3BFAA 5HKZA 1J7PA 1KSMA 1NX3A 4INWA 2MLFC 2KBMA 2G2BA 2K60A 1JFKA 1KSOA 3O4XA 3LK1A 2RGIA 2LHIA 1H8BA 1QS7A 1EG3A 1K9UA 4DIRA 3RM1A 2PYQA 1SKTA 4YGDB 1AJ5A 1AP4A 2KFGA 2KLDA 2PRUA 1YUUA 2K7OA 1PK0D 1BR1B 5HKYA 4MRYA 3VRRA 3EK7A 3DYEA 1ZMZA 2OS8B 3CGAA 3DY9A 2KYFA 3KHEA 4QJ4B 1L2OB 1MF8B 1DGUA 2L98A 1F71A 2KI4B 1J7QA 2GTEA 4PCWA 1M46A 3EVUA 1IJ6A 1AJ4A 1DGVA 2M9GA 1SMGA 1YURA 3D75A 2B1UA 2M8UA 4AOMA 2JT0A 4GGFC 2SASA 4GFTA 1N0YA 2K7BA 2M3WA 1TCFA 1A75A 1IGVA 1SCMB 2JWWA 2LHLA 3E3RA 2M7NA 3O78A 4GGNA 4OV2A 1DJZA 2JQ6A 2SCPA 1QX2A 3PLFB 4CLNA 1OE9B 1QASA 1XFVO 2EC6C 2KGRA 3SG4A 2P71A 4PHKA 5K89A 2GGZA 1XFXO 3NSOA 1CDLA 2LMTA 1ZACA 2JC2A 2ZFDA 1RTP1 2PASA 3IQOA 5KSZA 1J55A 2L4IA 1GQMA 4FTGA 1G33A 2WCKA 3KPXA 5CSJA 1EJ3A 1AVSA 1BMOA 3EVVA 2GV5A 4UPGA 2WCLA 3CLNA 2M97A 4OCIA 2TN4A 2LLSA 1UHNA 2EGDA 1RFJA 1CFPA 3K1EA 3S0GA 4MSPA 1PVBA 3AAKA 5FI7A 1TTXA 1UHIA 3CTNA 2F3ZA 2L2EA 1K9PA 1K9KA 2KQYA 3FWBA 3D74A 4MZKA 1LS8A 3BYAA 1EXRA 2BL0B 1WRZA 3L4AA 3D0YB 1BLQA 2WCHA 3EK4A 2ZNEA 3SIBA 2KYCA 2WCMA 4HRHA 1PALA 1JBAA 2KPHA 1Z2CB 2JT3A 1ZOTB 1AUIB 1NUBA 1WRLA 5JJGA 2KLEA 4ORBB 3I5IC 4OR9B 4NDBA 3PN7C 2H61A 5F6TA 2KAYA 2KSPA 5FYXA 1TNQA 1FW4A 1B9AA 2KI6D 2LUCA 1KFXL 4M2OA 5AEQA 1X02A 1ZFSA 3FE9A 2I18A 1IRJA 3OB1B 5I2QA 2A4JA 1CM4A 1B8LA 1SCVA 3D73A 3DVEA 2ISDA 1LKJA 3PFVA 2CNPA 1YTZC 4QJ5B 3LLEA 5KTYA 2KDHA 2O5GA 2BE6A 4C0JA 2AMIA 4YGAA 1MQ1A 3BFHA 1SY9A 3SJSA 1QVIZ 1K2HA 3S0BA 1XFYO 5BPJA 2WOSA 1J1EA 1S1EA 3BUWB 2JNFA 3N7HA 3TDZA 4XJKA 4USLA 3WHTB 1TRFA 1TCOB 3TUYC 1XVJA 3D77A 3TS5B 1AK8A 1K94A 1A75B 2I94A 3OBVA 3S0DA 1TIZA 1KFUS 3BUMB 3OGNA 2WCEA 1CTRA 2KNEA 3BFBA 1VRKA 2BNXA 4C0KA 2JOJA 4MZLA 1CLMA 3D78A 3PM2A 1CFDA 1SR6C 3B86A 1KK8C 3CDNA 1SL9A 2MBXA 2M0RA 4GBAA 3GK4X 1WLZA 2L5YA 3RZSA 1YRTB 1ZUZA 3F45A 4N1GA 1WDCC 1SYMA 1G4YR 2ERBA 4HSZA 2LP2A 1A2XA 5HKWA 3DVMA 4HREE 1CKKA 1QV0A 1YVLA 1TUZA 4MVFA 4PE1A 3DVJA 3CWGA 1FI6A 2M7LA 2JXLA 3KF9A 5FI6A 2DOQA 2BBMA 4CFRA 2LLTA 3PATA 1RWYA 4YGBB 4AQJA 1N65A 3OX5A 1QWVA 1TNPA 1TWOA 1LA3A 4JD9A 3I5HB 1BF5A 2PALA 2L50A 2ZN9A 2JZIA 4A4BA 2OPOA 2JXCA 2OS8C 1IG5A 4N5XA 1GJYA 3D10A 1L2OC 2NXQA 3JTDB 3NSIA 4OVNF 3EKJA 2ZNDA 2KI4C 1DJGA 1TN4A 1DJXA 1N2DA 4DS7A 2HETA 1J1DA 1S26D 4JWQA 1XYDA 1CNPA 1PRWA 4ORCB 1D1OA 3EVRA 1OOJA 2R2IA 2K8MB 5ER4X 1DEKA 2M49B 3V2LA 1DC1A 5PALA 2WC6A 1SCMC 3MSEB 1DJWA 3ZWHA 2JNXA 1EH2A 2V53A 1QJTA 1XO5A 2WCBA 1P28A 1JC2A 2F8PA 1BR4B 1OSAA 1SSEB 3KO0A 3CR2A 1GGWA 3PJIA 1W9ZA 5KU1A 2KAXA 1IKUA 4NDCA 1S3PA 4XJKB 1PVAA 1G8IA 1FBVA 5CPVA 2H2KA 4YGCB 1QVIY 2KAVA 1WLMA 3IVTA 1NX0A 3AKAA 4JQ0D 3SG2A 1RROA 1NCZA 2Y4QA 3BUXB 4GAOA 3QRXA 5ER5A 1MUXA 1QLKA 4FQOA 1YVHA 3SG6A 1QIVA 4PE4A 2JPOA 5HL1A 1CFCA 2P6BB 2KFHA 3SG5A 1S6JA 4E68A 4MN0A 3CZ2A 1NX2A 4PALA 4OZDA 4PE7A 2BL0C 1CM1A 1OZSA 3NHIA 4HRGA 2OTGB 4KYNA 1XK4A 1Z4HA 5IBWA 1RECA 3IQQA 4MBEA 3NSLA 3B7AA 2E6WA 2HF5A 1F55A 1TNWA 2L51A 3A4UB 4DUQA 3B87A 4INXA 2FJUB 1TOPA 2QEHA 1UWOA 4YGEB 1OMRA 4TNCA 1C7WA 3DZTA 3A8RA 1AHRA 1FI5A 3SIAA 1SRAA 2IS9A 5AERA 1BG1A 1KCYA 1Y1AA 3JVTB 1UP5A 4I5LB 3SS3A 3OP0A 1IJ5A 2Q4UA 1WY9A 1NYAA 1Y1XA 1YX7A 1NCXA 4BY5A 3Q8IA 2BCAA 2FCEA 2QEVA 3PALA 3CR4X 3AAJA 5CSFA 5I2LA 5G08A 3R1PA 1CMGA 1U5IA 1RK9A 2M29A 1JUOA 1F54A 3NXAA 1PULA 3AKBA 3KEVA 2CCMA 2CTNA 1OZOA 3SG7A 2EHBA 3SG3A 4PHNA 3TS5C 2LVVA 4WQ2A 4PT1A 2QPTA 5CSIA 5FI2A 3VROA 3RLZA 2BCBA 2BCXA 4YBHB 1DTLA 1KQMB 2MHHA 1PSRA 2P70A 1EG4A 4GGFA 1QIWA 2K61A 3I5GB 5HLOA 3IF7A 4M2QA 2PMYA 2LE9B 1B8CA 2KHNA 1DMOA 2LP3A 3O2PA 4DRWA 2ZRSA 2D8NA 1KK7Z 1LINA 1QX7A 2YGUA 1UHHA 3L4LA 1GM0A 1QV1A 1QTXA 2L5XB 1SNLA 4Q04A 1J7RA 1R6PA 2K7CA 2LMVA 1XFWO 1HQVA 1HT9A 2LVIA 2M1UA 1MR8A 3DD4A 2LVJA 4MEWA 1JF2A 1QATA 3PSRA 4NQGA 1SBJA 1A29A 5DICA 2WCJA 1IIOA 1OOFA 1OOHA 1ORGA 1PSBA 5D3OA 4FQTA 4QJ3B 2MJWB 1GGZA 5TNCA 3ICBA 3BQ3A 1DJYA 2K0JA 3PM8A 2LLUA 1K8UA 1NCYA 1IH0A 1NX1A 1OMVA 3EKHA 2LVKA 1RJVA 3M0WA 3UNWA 4F7FA 2E30A 4PHMA 4R1EA 1JWDA 2HQ8A 1C07A 2JTZA 1K95A 3I5HC 1A4PA 3CABA 3H4SE 5JOLA 1JSAA 1CDPA 1YRUB 5I2OA 4GUKA 2ZKMX 3OHMB 1OOIX 4YI9A 1OOGA 2KBIA 3JTDC 3CYZA 3O6BA 1KWOB 2LNKA 5I94A 1TNXA 1QLSA 2H61C 4IJ7A 2LC5A 2HQWA 1DVIA 3EG5B 1B1GA 3I5FB 5GQQC 1A03A 3NSKA 2JU0A 2MRDA 3S0FA 1ODBA 4CIDA 3LCPC 1UUSA 1S5GZ 3GK1A 1V1GA 4I5KA 2MLEC 1OQPA 5HYDA 4I5NB 2LANA 3S0AA 2BE4A 1C7VA 1LXFC 3GOFA 4NDDA 4PDZA 1DELA 3DVKA 1CB1A 1OW4A 1C3ZA 1OMDA 3C1VA 1F70A 4MRXA 1U5IB 2F2OA 2VRGA 1NWDA 2CT9A 5CSNA 1Y1UA 5HLVA 1YUSA 1WRKA 3TDIA 3FE6A 2H8VA 2LMUA 1W7IB 2QEOA 1M63B 2I2RE 1CLBA 1XA5A 3VB1A 2NCPA 2L0PA 1DF0A 3B88A 2PVBA 1R2UA 2BECA 3VRQA 1FPWA 3R1OA 1CDNA 1B7TZ 1DJIA 1SW8A 2WC5A 4ETOA 4P2YB 1E8AA 2M1KB 1IWQA 3BOWA 2WC8A 2Q91A 5AXIA 5I8NA 3EK8A 2LCPA 2CXJA 1LVCD 3CZTX 3BUOB 1S6IA 2EC6B 5D7FA 3HCMA 1MWNA 1ALVA 1Y0VH 3DF0A 1SPYA 2FJYA 3CZ0A 4D1EA 1YX8A 1BJFA 5D69A 1MXLC 2JTTA 2LM5A 1M39A 2OTGC 1S36A 1W7JB 3R72A 1XFRA 3OB2B 2WORA 4C0LA 4YRUA 1KK7Y 1JFJA 3DXLA 2QDIA 2KI6C 2Y1NA 3VRNA 3BJHA 1JF0A 2NZ0A 2PSRA 1KFXS 2BBNA 2LV7A 3NGVA 4OKHA 1T14A 4WRIA 2CBLA 2KFFA 1Y6WA 1KQVA 1B4CA 3LL8B 3JVTC 2BKIB 4PHJA 3CZ1A 1YUTA 1M45A 1K96A 5DKNA 1CLLA 4L9MA 3FS7A 1C3YA 3UO9A 4N1FA 3ZNIA 1MXEA 4GNKB 2JULA 3LK0A 1IQ3A 2F33A
chains in the Genus database with same CATH topology
4A4CA 3WNXB 2JRFA 3FWCA 1SK6D 3TDUA 1NIWA 1H4BA 1QXPA 2KQ6A 3VRPA 1V1FA 1M31A 2MA2A 2WCFA 2K7DA 4P5OE 4M2PA 4XYNA 5DKRA 2JT8A 1Q80A 1YR5A 4GPLB 2G9BA 2MAZA 3GK2A 1B47A 3OX6A 1J7OA 4MZJA 3I5IB 3PN7B 1EL4A 2HPSA 4ZCUA 2QACA 1K93D 1SL7A 1BODA 2KOTA 1BOCA 3BUNB 1KQMC 1NP8A 2AAOA 4ICBA 4DCKA 4F0ZB 2NCOA 1CMFA 4BY4A 2L4HA 3I5GC 4IL1A 3VGOA 2F2PA 1BT6A 5DKQA 1F4QA 1F8HA 4YI8A 4ZCVA 1S5GY 4CPVA 1XFZO 3WHUB 2F3YA 2FCDA 1ALWA 1LA0A 3K21A 1BU3A 2FOTA 1NPQA 4PE0A 4MLWA 2KGBC 2LAPA 1XFUO 3CR5X 4U8DA 1DF0B 4I5JA 3O4YA 5AANA 1QX5B 3TUYB 2K2AA 4ORAB 2AUCA 2O60A 3FIAA 1DT7B 2NLNA 1F4OA 3BOWB 1B8RA 2COLB 1UHJA 2JPTA 1DJHA 3CS1A 1KFUL 3DF0B 1SL8A 2Y5IA 4CFQA 1SR6B 3TZ1A 2Y1MA 4JPZB 1B7TY 2ZRTA 2WNDA 1KK8B 1L7ZA 1NSHA 3BXKA 4WQ3A 1XK4C 5AFPA 1IQ5A 2I7AA 2LUXA 5J3XA 1FF1A 1UHKA 3WXAA 1S6CA 3HX4A 2ZN8A 1CDMA 2BKHB 1KWOC 4AQIA 3D0YA 1UURA 5B8IB 1CFFA 1WDCB 3I5FC 2K2FA 2GGMA 1K90D 1MHOA 5HKZA 1J7PA 1KSMA 1NX3A 2MLFC 2KBMA 2G2BA 1JFKA 1KSOA 3LK1A 2RGIA 2LHIA 1H8BA 1QS7A 1EG3A 1K9UA 4DIRA 3RM1A 1SKTA 4YGDB 1AJ5A 1AP4A 2KFGA 2PRUA 1YUUA 2K7OA 1PK0D 1BR1B 5HKYA 4MRYA 3VRRA 3EK7A 1ZMZA 2OS8B 3CGAA 2KYFA 3KHEA 4QJ4B 1L2OB 1MF8B 1DGUA 2L98A 1F71A 2KI4B 1J7QA 4PCWA 1M46A 3EVUA 1IJ6A 1AJ4A 1DGVA 2M9GA 1SMGA 1YURA 4AOMA 2B1UA 2M8UA 2JT0A 4GGFC 2SASA 4GFTA 1N0YA 2K7BA 2M3WA 1TCFA 1A75A 1IGVA 1SCMB 2JWWA 2LHLA 3E3RA 2M7NA 3O78A 4GGNA 4OV2A 1DJZA 2JQ6A 2SCPA 1QX2A 3PLFB 4CLNA 1OE9B 1QASA 1XFVO 2EC6C 2KGRA 3SG4A 4PHKA 5K89A 2GGZA 1XFXO 3NSOA 1CDLA 2LMTA 1ZACA 2JC2A 2ZFDA 1RTP1 2PASA 3IQOA 5KSZA 1J55A 2L4IA 1GQMA 4FTGA 1G33A 3KPXA 5CSJA 1EJ3A 1AVSA 1BMOA 3EVVA 2GV5A 4UPGA 3CLNA 2M97A 4OCIA 2TN4A 2LLSA 1UHNA 2EGDA 1RFJA 1CFPA 4MSPA 1PVBA 3AAKA 1TTXA 1UHIA 3CTNA 2F3ZA 2L2EA 1K9PA 1K9KA 2KQYA 3FWBA 4MZKA 3BYAA 1EXRA 2BL0B 1WRZA 1BLQA 3D0YB 3EK4A 2ZNEA 3SIBA 2KYCA 4HRHA 1PALA 1JBAA 2JT3A 1ZOTB 1AUIB 1NUBA 1WRLA 5JJGA 4ORBB 3I5IC 4OR9B 4NDBA 3PN7C 2H61A 5F6TA 2KAYA 2KSPA 5FYXA 1TNQA 1FW4A 1B9AA 2KI6D 2LUCA 1KFXL 4M2OA 5AEQA 1X02A 1ZFSA 2I18A 1IRJA 3OB1B 5I2QA 2A4JA 1CM4A 1B8LA 1SCVA 3DVEA 2ISDA 1LKJA 3PFVA 2CNPA 1YTZC 4QJ5B 3LLEA 5KTYA 2KDHA 2O5GA 2BE6A 4C0JA 2AMIA 4YGAA 1MQ1A 1SY9A 3SJSA 1QVIZ 1K2HA 1XFYO 5BPJA 2WOSA 1J1EA 1S1EA 3BUWB 2JNFA 3TDZA 4XJKA 4USLA 3WHTB 1TRFA 1TCOB 3TUYC 1XVJA 3TS5B 1AK8A 1K94A 1A75B 2I94A 1TIZA 1KFUS 3BUMB 2WCEA 1CTRA 2KNEA 1VRKA 4C0KA 2JOJA 4MZLA 1CLMA 1CFDA 1SR6C 1KK8C 1SL9A 2MBXA 2M0RA 4GBAA 3GK4X 1WLZA 1YRTB 1ZUZA 3F45A 4N1GA 1WDCC 1SYMA 1G4YR 4HSZA 2LP2A 1A2XA 5HKWA 3DVMA 4HREE 1CKKA 1QV0A 1YVLA 4MVFA 4PE1A 3DVJA 3CWGA 1FI6A 2M7LA 2JXLA 3KF9A 2DOQA 2BBMA 4CFRA 2LLTA 3PATA 1RWYA 4YGBB 4AQJA 1N65A 3OX5A 1TNPA 1LA3A 3I5HB 1BF5A 2PALA 2L50A 2ZN9A 2JZIA 4A4BA 2OPOA 2JXCA 2OS8C 1IG5A 4N5XA 1GJYA 3D10A 1L2OC 2NXQA 3JTDB 3NSIA 4OVNF 3EKJA 2ZNDA 2KI4C 1DJGA 1TN4A 1DJXA 1N2DA 4DS7A 2HETA 1J1DA 1S26D 4JWQA 1XYDA 1CNPA 1PRWA 4ORCB 1D1OA 3EVRA 1OOJA 2R2IA 2K8MB 5ER4X 2M49B 5PALA 1SCMC 3MSEB 1DJWA 3ZWHA 2JNXA 1EH2A 2V53A 1QJTA 1XO5A 2WCBA 1JC2A 2F8PA 1BR4B 1OSAA 3KO0A 3CR2A 1GGWA 5KU1A 2KAXA 1IKUA 4NDCA 1S3PA 4XJKB 1PVAA 1G8IA 1FBVA 5CPVA 2H2KA 4YGCB 1QVIY 2KAVA 1WLMA 3SG2A 1NX0A 3AKAA 4JQ0D 1RROA 1NCZA 2Y4QA 3BUXB 4GAOA 3QRXA 5ER5A 1MUXA 1QLKA 4FQOA 1YVHA 3SG6A 1QIVA 4PE4A 1CFCA 2P6BB 2KFHA 3SG5A 1S6JA 4E68A 4MN0A 1NX2A 4PALA 4PE7A 2BL0C 1CM1A 1OZSA 4HRGA 2OTGB 1XK4A 5IBWA 1RECA 3IQQA 4MBEA 3NSLA 2E6WA 2HF5A 1F55A 1TNWA 2L51A 3A4UB 4DUQA 2FJUB 1TOPA 1UWOA 4YGEB 1OMRA 4TNCA 1C7WA 3A8RA 1AHRA 1FI5A 3SIAA 1SRAA 2IS9A 5AERA 1BG1A 1KCYA 1Y1AA 3JVTB 1UP5A 4I5LB 3OP0A 1IJ5A 2Q4UA 1WY9A 1NYAA 1Y1XA 1YX7A 1NCXA 4BY5A 2BCAA 2FCEA 3PALA 5I2LA 3CR4X 3AAJA 5CSFA 5G08A 1CMGA 1U5IA 1RK9A 2M29A 1JUOA 1F54A 3NXAA 1PULA 3AKBA 3KEVA 2CCMA 2CTNA 1OZOA 3SG7A 2EHBA 3SG3A 4PHNA 3TS5C 2LVVA 4WQ2A 5CSIA 2QPTA 3VROA 3RLZA 2BCBA 2BCXA 4YBHB 1DTLA 1KQMB 2MHHA 1PSRA 1EG4A 4GGFA 1QIWA 2K61A 3I5GB 5HLOA 3IF7A 4M2QA 2PMYA 2LE9B 1B8CA 2KHNA 1DMOA 2LP3A 3O2PA 4DRWA 2ZRSA 2D8NA 1KK7Z 1LINA 1QX7A 1UHHA 1QV1A 1QTXA 2L5XB 1SNLA 4Q04A 1J7RA 1R6PA 2K7CA 2LMVA 1XFWO 1HQVA 1HT9A 2LVIA 2M1UA 1MR8A 3DD4A 2LVJA 4MEWA 1JF2A 1QATA 3PSRA 4NQGA 1SBJA 1A29A 1PSBA 5TNCA 4QJ3B 2MJWB 1GGZA 3ICBA 3BQ3A 1DJYA 2K0JA 3PM8A 2LLUA 1K8UA 1NCYA 1IH0A 1NX1A 1OMVA 3EKHA 2LVKA 1RJVA 3M0WA 2E30A 4PHMA 4R1EA 1JWDA 2HQ8A 1C07A 2JTZA 1K95A 3I5HC 1A4PA 3H4SE 5JOLA 1JSAA 1CDPA 1YRUB 5I2OA 4GUKA 2ZKMX 3OHMB 4YI9A 2KBIA 3JTDC 3O6BA 1KWOB 2LNKA 1TNXA 1QLSA 2H61C 2LC5A 2HQWA 1DVIA 1B1GA 3I5FB 5GQQC 1A03A 3NSKA 2JU0A 2MRDA 1ODBA 4CIDA 3LCPC 1UUSA 1S5GZ 3GK1A 1V1GA 4I5KA 2MLEC 1OQPA 5HYDA 4I5NB 2LANA 2BE4A 1C7VA 1LXFC 3GOFA 4NDDA 4PDZA 3DVKA 1CB1A 3C1VA 1OMDA 1F70A 4MRXA 1U5IB 2F2OA 2VRGA 1NWDA 2CT9A 5CSNA 1Y1UA 5HLVA 1YUSA 1WRKA 3TDIA 2LMUA 1W7IB 1CLBA 1M63B 2I2RE 1XA5A 2NCPA 2L0PA 1DF0A 2PVBA 1R2UA 2BECA 3VRQA 1FPWA 1CDNA 1B7TZ 1DJIA 1SW8A 4ETOA 4P2YB 1E8AA 2M1KB 1IWQA 3BOWA 2WC8A 2Q91A 5AXIA 5I8NA 3EK8A 2LCPA 2CXJA 1LVCD 3CZTX 3BUOB 1S6IA 2EC6B 5D7FA 3HCMA 1MWNA 1ALVA 1Y0VH 3DF0A 1SPYA 4D1EA 1YX8A 1BJFA 5D69A 1MXLC 2JTTA 2LM5A 1M39A 2OTGC 1S36A 1W7JB 4C0LA 4YRUA 3OB2B 2WORA 1KK7Y 1JFJA 2KI6C 2Y1NA 3VRNA 1JF0A 2NZ0A 2PSRA 1KFXS 2BBNA 2LV7A 4OKHA 4WRIA 2CBLA 2KFFA 1Y6WA 1KQVA 1B4CA 3LL8B 3JVTC 2BKIB 4PHJA 1YUTA 1M45A 1K96A 5DKNA 1CLLA 4L9MA 3FS7A 4N1FA 3ZNIA 1MXEA 4GNKB 2JULA 3LK0A 1IQ3A 2F33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A4C A;  3WNX B;  2JRF A;  3FWC A;  1SK6 D;  3TDU A;  1NIW A;  1H4B A;  1QXP A;  2KQ6 A;  3VRP A;  1V1F A;  1M31 A;  2MA2 A;  2WCF A;  2K7D A;  4P5O E;  4M2P A;  4XYN A;  5DKR A;  2JT8 A;  1Q80 A;  1YR5 A;  4GPL B;  2G9B A;  2MAZ A;  3GK2 A;  1B47 A;  3OX6 A;  1J7O A;  4MZJ A;  3I5I B;  3PN7 B;  1EL4 A;  2HPS A;  4ZCU A;  2QAC A;  1K93 D;  1SL7 A;  1BOD A;  2KOT A;  1BOC A;  3BUN B;  1KQM C;  1NP8 A;  2AAO A;  4ICB A;  4DCK A;  4F0Z B;  2NCO A;  1CMF A;  4BY4 A;  2L4H A;  3I5G C;  4IL1 A;  3VGO A;  2F2P A;  1BT6 A;  5DKQ A;  1F4Q A;  1F8H A;  4YI8 A;  4ZCV A;  1S5G Y;  4CPV A;  1XFZ O;  3WHU B;  2F3Y A;  2FCD A;  1ALW A;  1LA0 A;  3K21 A;  1BU3 A;  2FOT A;  1NPQ A;  4PE0 A;  4MLW A;  2KGB C;  2LAP A;  1XFU O;  3CR5 X;  4U8D A;  1DF0 B;  4I5J A;  3O4Y A;  5AAN A;  1QX5 B;  3TUY B;  2K2A A;  4ORA B;  2AUC A;  2O60 A;  3FIA A;  1DT7 B;  2NLN A;  1F4O A;  3BOW B;  1B8R A;  2COL B;  1UHJ A;  2JPT A;  1DJH A;  3CS1 A;  1KFU L;  3DF0 B;  1SL8 A;  2Y5I A;  4CFQ A;  1SR6 B;  3TZ1 A;  2Y1M A;  4JPZ B;  1B7T Y;  2ZRT A;  2WND A;  1KK8 B;  1L7Z A;  1NSH A;  3BXK A;  4WQ3 A;  1XK4 C;  5AFP A;  1IQ5 A;  2I7A A;  2LUX A;  5J3X A;  1FF1 A;  1UHK A;  3WXA A;  1S6C A;  3HX4 A;  2ZN8 A;  1CDM A;  2BKH B;  1KWO C;  4AQI A;  3D0Y A;  1UUR A;  5B8I B;  1CFF A;  1WDC B;  3I5F C;  2K2F A;  2GGM A;  1K90 D;  1MHO A;  5HKZ A;  1J7P A;  1KSM A;  1NX3 A;  2MLF C;  2KBM A;  2G2B A;  1JFK A;  1KSO A;  3LK1 A;  2RGI A;  2LHI A;  1H8B A;  1QS7 A;  1EG3 A;  1K9U A;  4DIR A;  3RM1 A;  1SKT A;  4YGD B;  1AJ5 A;  1AP4 A;  2KFG A;  2PRU A;  1YUU A;  2K7O A;  1PK0 D;  1BR1 B;  5HKY A;  4MRY A;  3VRR A;  3EK7 A;  1ZMZ A;  2OS8 B;  3CGA A;  2KYF A;  3KHE A;  4QJ4 B;  1L2O B;  1MF8 B;  1DGU A;  2L98 A;  1F71 A;  2KI4 B;  1J7Q A;  4PCW A;  1M46 A;  3EVU A;  1IJ6 A;  1AJ4 A;  1DGV A;  2M9G A;  1SMG A;  1YUR A;  4AOM A;  2B1U A;  2M8U A;  2JT0 A;  4GGF C;  2SAS A;  4GFT A;  1N0Y A;  2K7B A;  2M3W A;  1TCF A;  1A75 A;  1IGV A;  1SCM B;  2JWW A;  2LHL A;  3E3R A;  2M7N A;  3O78 A;  4GGN A;  4OV2 A;  1DJZ A;  2JQ6 A;  2SCP A;  1QX2 A;  3PLF B;  4CLN A;  1OE9 B;  1QAS A;  1XFV O;  2EC6 C;  2KGR A;  3SG4 A;  4PHK A;  5K89 A;  2GGZ A;  1XFX O;  3NSO A;  1CDL A;  2LMT A;  1ZAC A;  2JC2 A;  2ZFD A;  1RTP 1;  2PAS A;  3IQO A;  5KSZ A;  1J55 A;  2L4I A;  1GQM A;  4FTG A;  1G33 A;  3KPX A;  5CSJ A;  1EJ3 A;  1AVS A;  1BMO A;  3EVV A;  2GV5 A;  4UPG A;  3CLN A;  2M97 A;  4OCI A;  2TN4 A;  2LLS A;  1UHN A;  2EGD A;  1RFJ A;  1CFP A;  4MSP A;  1PVB A;  3AAK A;  1TTX A;  1UHI A;  3CTN A;  2F3Z A;  2L2E A;  1K9P A;  1K9K A;  2KQY A;  3FWB A;  4MZK A;  3BYA A;  1EXR A;  2BL0 B;  1WRZ A;  1BLQ A;  3D0Y B;  3EK4 A;  2ZNE A;  3SIB A;  2KYC A;  4HRH A;  1PAL A;  1JBA A;  2JT3 A;  1ZOT B;  1AUI B;  1NUB A;  1WRL A;  5JJG A;  4ORB B;  3I5I C;  4OR9 B;  4NDB A;  3PN7 C;  2H61 A;  5F6T A;  2KAY A;  2KSP A;  5FYX A;  1TNQ A;  1FW4 A;  1B9A A;  2KI6 D;  2LUC A;  1KFX L;  4M2O A;  5AEQ A;  1X02 A;  1ZFS A;  2I18 A;  1IRJ A;  3OB1 B;  5I2Q A;  2A4J A;  1CM4 A;  1B8L A;  1SCV A;  3DVE A;  2ISD A;  1LKJ A;  3PFV A;  2CNP A;  1YTZ C;  4QJ5 B;  3LLE A;  5KTY A;  2KDH A;  2O5G A;  2BE6 A;  4C0J A;  2AMI A;  4YGA A;  1MQ1 A;  1SY9 A;  3SJS A;  1QVI Z;  1K2H A;  1XFY O;  5BPJ A;  2WOS A;  1J1E A;  1S1E A;  3BUW B;  2JNF A;  3TDZ A;  4XJK A;  4USL A;  3WHT B;  1TRF A;  1TCO B;  3TUY C;  1XVJ A;  3TS5 B;  1AK8 A;  1K94 A;  1A75 B;  2I94 A;  1TIZ A;  1KFU S;  3BUM B;  2WCE A;  1CTR A;  2KNE A;  1VRK A;  4C0K A;  2JOJ A;  4MZL A;  1CLM A;  1CFD A;  1SR6 C;  1KK8 C;  1SL9 A;  2MBX A;  2M0R A;  4GBA A;  3GK4 X;  1WLZ A;  1YRT B;  1ZUZ A;  3F45 A;  4N1G A;  1WDC C;  1SYM A;  1G4Y R;  4HSZ A;  2LP2 A;  1A2X A;  5HKW A;  3DVM A;  4HRE E;  1CKK A;  1QV0 A;  1YVL A;  4MVF A;  4PE1 A;  3DVJ A;  3CWG A;  1FI6 A;  2M7L A;  2JXL A;  3KF9 A;  2DOQ A;  2BBM A;  4CFR A;  2LLT A;  3PAT A;  1RWY A;  4YGB B;  4AQJ A;  1N65 A;  3OX5 A;  1TNP A;  1LA3 A;  3I5H B;  1BF5 A;  2PAL A;  2L50 A;  2ZN9 A;  2JZI A;  4A4B A;  2OPO A;  2JXC A;  2OS8 C;  1IG5 A;  4N5X A;  1GJY A;  3D10 A;  1L2O C;  2NXQ A;  3JTD B;  3NSI A;  4OVN F;  3EKJ A;  2ZND A;  2KI4 C;  1DJG A;  1TN4 A;  1DJX A;  1N2D A;  4DS7 A;  2HET A;  1J1D A;  1S26 D;  4JWQ A;  1XYD A;  1CNP A;  1PRW A;  4ORC B;  1D1O A;  3EVR A;  1OOJ A;  2R2I A;  2K8M B;  5ER4 X;  2M49 B;  5PAL A;  1SCM C;  3MSE B;  1DJW A;  3ZWH A;  2JNX A;  1EH2 A;  2V53 A;  1QJT A;  1XO5 A;  2WCB A;  1JC2 A;  2F8P A;  1BR4 B;  1OSA A;  3KO0 A;  3CR2 A;  1GGW A;  5KU1 A;  2KAX A;  1IKU A;  4NDC A;  1S3P A;  4XJK B;  1PVA A;  1G8I A;  1FBV A;  5CPV A;  2H2K A;  4YGC B;  1QVI Y;  2KAV A;  1WLM A;  3SG2 A;  1NX0 A;  3AKA A;  4JQ0 D;  1RRO A;  1NCZ A;  2Y4Q A;  3BUX B;  4GAO A;  3QRX A;  5ER5 A;  1MUX A;  1QLK A;  4FQO A;  1YVH A;  3SG6 A;  1QIV A;  4PE4 A;  1CFC A;  2P6B B;  2KFH A;  3SG5 A;  1S6J A;  4E68 A;  4MN0 A;  1NX2 A;  4PAL A;  4PE7 A;  2BL0 C;  1CM1 A;  1OZS A;  4HRG A;  2OTG B;  1XK4 A;  5IBW A;  1REC A;  3IQQ A;  4MBE A;  3NSL A;  2E6W A;  2HF5 A;  1F55 A;  1TNW A;  2L51 A;  3A4U B;  4DUQ A;  2FJU B;  1TOP A;  1UWO A;  4YGE B;  1OMR A;  4TNC A;  1C7W A;  3A8R A;  1AHR A;  1FI5 A;  3SIA A;  1SRA A;  2IS9 A;  5AER A;  1BG1 A;  1KCY A;  1Y1A A;  3JVT B;  1UP5 A;  4I5L B;  3OP0 A;  1IJ5 A;  2Q4U A;  1WY9 A;  1NYA A;  1Y1X A;  1YX7 A;  1NCX A;  4BY5 A;  2BCA A;  2FCE A;  3PAL A;  5I2L A;  3CR4 X;  3AAJ A;  5CSF A;  5G08 A;  1CMG A;  1U5I A;  1RK9 A;  2M29 A;  1JUO A;  1F54 A;  3NXA A;  1PUL A;  3AKB A;  3KEV A;  2CCM A;  2CTN A;  1OZO A;  3SG7 A;  2EHB A;  3SG3 A;  4PHN A;  3TS5 C;  2LVV A;  4WQ2 A;  5CSI A;  2QPT A;  3VRO A;  3RLZ A;  2BCB A;  2BCX A;  4YBH B;  1DTL A;  1KQM B;  2MHH A;  1PSR A;  1EG4 A;  4GGF A;  1QIW A;  2K61 A;  3I5G B;  5HLO A;  3IF7 A;  4M2Q A;  2PMY A;  2LE9 B;  1B8C A;  2KHN A;  1DMO A;  2LP3 A;  3O2P A;  4DRW A;  2ZRS A;  2D8N A;  1KK7 Z;  1LIN A;  1QX7 A;  1UHH A;  1QV1 A;  1QTX A;  2L5X B;  1SNL A;  4Q04 A;  1J7R A;  1R6P A;  2K7C A;  2LMV A;  1XFW O;  1HQV A;  1HT9 A;  2LVI A;  2M1U A;  1MR8 A;  3DD4 A;  2LVJ A;  4MEW A;  1JF2 A;  1QAT A;  3PSR A;  4NQG A;  1SBJ A;  1A29 A;  1PSB A;  5TNC A;  4QJ3 B;  2MJW B;  1GGZ A;  3ICB A;  3BQ3 A;  1DJY A;  2K0J A;  3PM8 A;  2LLU A;  1K8U A;  1NCY A;  1IH0 A;  1NX1 A;  1OMV A;  3EKH A;  2LVK A;  1RJV A;  3M0W A;  2E30 A;  4PHM A;  4R1E A;  1JWD A;  2HQ8 A;  1C07 A;  2JTZ A;  1K95 A;  3I5H C;  1A4P A;  3H4S E;  5JOL A;  1JSA A;  1CDP A;  1YRU B;  5I2O A;  4GUK A;  2ZKM X;  3OHM B;  4YI9 A;  2KBI A;  3JTD C;  3O6B A;  1KWO B;  2LNK A;  1TNX A;  1QLS A;  2H61 C;  2LC5 A;  2HQW A;  1DVI A;  1B1G A;  3I5F B;  5GQQ C;  1A03 A;  3NSK A;  2JU0 A;  2MRD A;  1ODB A;  4CID A;  3LCP C;  1UUS A;  1S5G Z;  3GK1 A;  1V1G A;  4I5K A;  2MLE C;  1OQP A;  5HYD A;  4I5N B;  2LAN A;  2BE4 A;  1C7V A;  1LXF C;  3GOF A;  4NDD A;  4PDZ A;  3DVK A;  1CB1 A;  3C1V A;  1OMD A;  1F70 A;  4MRX A;  1U5I B;  2F2O A;  2VRG A;  1NWD A;  2CT9 A;  5CSN A;  1Y1U A;  5HLV A;  1YUS A;  1WRK A;  3TDI A;  2LMU A;  1W7I B;  1CLB A;  1M63 B;  2I2R E;  1XA5 A;  2NCP A;  2L0P A;  1DF0 A;  2PVB A;  1R2U A;  2BEC A;  3VRQ A;  1FPW A;  1CDN A;  1B7T Z;  1DJI A;  1SW8 A;  4ETO A;  4P2Y B;  1E8A A;  2M1K B;  1IWQ A;  3BOW A;  2WC8 A;  2Q91 A;  5AXI A;  5I8N A;  3EK8 A;  2LCP A;  2CXJ A;  1LVC D;  3CZT X;  3BUO B;  1S6I A;  2EC6 B;  5D7F A;  3HCM A;  1MWN A;  1ALV A;  1Y0V H;  3DF0 A;  1SPY A;  4D1E A;  1YX8 A;  1BJF A;  5D69 A;  1MXL C;  2JTT A;  2LM5 A;  1M39 A;  2OTG C;  1S36 A;  1W7J B;  4C0L A;  4YRU A;  3OB2 B;  2WOR A;  1KK7 Y;  1JFJ A;  2KI6 C;  2Y1N A;  3VRN A;  1JF0 A;  2NZ0 A;  2PSR A;  1KFX S;  2BBN A;  2LV7 A;  4OKH A;  4WRI A;  2CBL A;  2KFF A;  1Y6W A;  1KQV A;  1B4C A;  3LL8 B;  3JVT C;  2BKI B;  4PHJ A;  1YUT A;  1M45 A;  1K96 A;  5DKN A;  1CLL A;  4L9M A;  3FS7 A;  4N1F A;  3ZNI A;  1MXE A;  4GNK B;  2JUL A;  3LK0 A;  1IQ3 A;  2F33 A; 
#chains in the Genus database with same CATH topology
 4A4C A;  3WNX B;  2JRF A;  3FWC A;  1SK6 D;  3TDU A;  1NIW A;  1H4B A;  1QXP A;  2KQ6 A;  3VRP A;  1V1F A;  1M31 A;  2MA2 A;  2WCF A;  2K7D A;  4P5O E;  4M2P A;  4XYN A;  5DKR A;  2JT8 A;  1Q80 A;  1YR5 A;  4GPL B;  2G9B A;  2MAZ A;  3GK2 A;  1B47 A;  3OX6 A;  1J7O A;  4MZJ A;  3I5I B;  1TUJ A;  3PN7 B;  1EL4 A;  2HPS A;  4ZCU A;  2QAC A;  1K93 D;  1SL7 A;  1BOD A;  2KOT A;  3QME A;  1BOC A;  3BUN B;  1KQM C;  2L2C A;  3L47 A;  1NP8 A;  2AAO A;  4ICB A;  4DCK A;  4F0Z B;  2NCO A;  1CMF A;  4BY4 A;  2L4H A;  3I5G C;  4IL1 A;  3VGO A;  2F2P A;  1BT6 A;  5DKQ A;  5EL2 A;  1F4Q A;  1F8H A;  4YI8 A;  4ZCV A;  1S5G Y;  4CPV A;  1XFZ O;  3WHU B;  2F3Y A;  2FCD A;  1ALW A;  1LA0 A;  2QEB A;  3K21 A;  1BU3 A;  3S0E A;  2FOT A;  1NPQ A;  4PE0 A;  4MLW A;  2KGB C;  1DQE A;  2LAP A;  1XFU O;  3CR5 X;  4U8D A;  1DF0 B;  4I5J A;  3O4Y A;  4JKT A;  5AAN A;  1QX5 B;  3TUY B;  2K2A A;  4ORA B;  2AUC A;  2O60 A;  3FIA A;  1DT7 B;  2NLN A;  1F4O A;  3BOW B;  1B8R A;  2COL B;  1UHJ A;  2JPT A;  3R1V A;  1DJH A;  3B6X A;  3CS1 A;  1KFU L;  3DF0 B;  1SL8 A;  2Y5I A;  4CFQ A;  1SR6 B;  3TZ1 A;  2Y1M A;  4JPZ B;  1B7T Y;  2ZRT A;  2WND A;  1KK8 B;  1L7Z A;  1NSH A;  3BXK A;  4WQ3 A;  1XK4 C;  5AFP A;  1IQ5 A;  2I7A A;  2LUX A;  5J3X A;  1FF1 A;  3FE8 A;  1UHK A;  3WXA A;  1S6C A;  3SS5 A;  2PQL A;  3D76 A;  3HX4 A;  2ZN8 A;  1CDM A;  3SS4 A;  2BKH B;  1KWO C;  4AQI A;  2BAP A;  1UUR A;  3D0Y A;  5B8I B;  1CFF A;  1WDC B;  3NHT A;  3I5F C;  2K2F A;  2GGM A;  1K90 D;  1MHO A;  3BFA A;  5HKZ A;  1J7P A;  1KSM A;  1NX3 A;  4INW A;  2MLF C;  2KBM A;  2G2B A;  2K60 A;  1JFK A;  1KSO A;  3O4X A;  3LK1 A;  2RGI A;  2LHI A;  1H8B A;  1QS7 A;  1EG3 A;  1K9U A;  4DIR A;  3RM1 A;  2PYQ A;  1SKT A;  4YGD B;  1AJ5 A;  1AP4 A;  2KFG A;  2KLD A;  2PRU A;  1YUU A;  2K7O A;  1PK0 D;  1BR1 B;  5HKY A;  4MRY A;  3VRR A;  3EK7 A;  3DYE A;  1ZMZ A;  2OS8 B;  3CGA A;  3DY9 A;  2KYF A;  3KHE A;  4QJ4 B;  1L2O B;  1MF8 B;  1DGU A;  2L98 A;  1F71 A;  2KI4 B;  1J7Q A;  2GTE A;  4PCW A;  1M46 A;  3EVU A;  1IJ6 A;  1AJ4 A;  1DGV A;  2M9G A;  1SMG A;  1YUR A;  3D75 A;  2B1U A;  2M8U A;  4AOM A;  2JT0 A;  4GGF C;  2SAS A;  4GFT A;  1N0Y A;  2K7B A;  2M3W A;  1TCF A;  1A75 A;  1IGV A;  1SCM B;  2JWW A;  2LHL A;  3E3R A;  2M7N A;  3O78 A;  4GGN A;  4OV2 A;  1DJZ A;  2JQ6 A;  2SCP A;  1QX2 A;  3PLF B;  4CLN A;  1OE9 B;  1QAS A;  1XFV O;  2EC6 C;  2KGR A;  3SG4 A;  2P71 A;  4PHK A;  5K89 A;  2GGZ A;  1XFX O;  3NSO A;  1CDL A;  2LMT A;  1ZAC A;  2JC2 A;  2ZFD A;  1RTP 1;  2PAS A;  3IQO A;  5KSZ A;  1J55 A;  2L4I A;  1GQM A;  4FTG A;  1G33 A;  2WCK A;  3KPX A;  5CSJ A;  1EJ3 A;  1AVS A;  1BMO A;  3EVV A;  2GV5 A;  4UPG A;  2WCL A;  3CLN A;  2M97 A;  4OCI A;  2TN4 A;  2LLS A;  1UHN A;  2EGD A;  1RFJ A;  1CFP A;  3K1E A;  3S0G A;  4MSP A;  1PVB A;  3AAK A;  5FI7 A;  1TTX A;  1UHI A;  3CTN A;  2F3Z A;  2L2E A;  1K9P A;  1K9K A;  2KQY A;  3FWB A;  3D74 A;  4MZK A;  1LS8 A;  3BYA A;  1EXR A;  2BL0 B;  1WRZ A;  3L4A A;  3D0Y B;  1BLQ A;  2WCH A;  3EK4 A;  2ZNE A;  3SIB A;  2KYC A;  2WCM A;  4HRH A;  1PAL A;  1JBA A;  2KPH A;  1Z2C B;  2JT3 A;  1ZOT B;  1AUI B;  1NUB A;  1WRL A;  5JJG A;  2KLE A;  4ORB B;  3I5I C;  4OR9 B;  4NDB A;  3PN7 C;  2H61 A;  5F6T A;  2KAY A;  2KSP A;  5FYX A;  1TNQ A;  1FW4 A;  1B9A A;  2KI6 D;  2LUC A;  1KFX L;  4M2O A;  5AEQ A;  1X02 A;  1ZFS A;  3FE9 A;  2I18 A;  1IRJ A;  3OB1 B;  5I2Q A;  2A4J A;  1CM4 A;  1B8L A;  1SCV A;  3D73 A;  3DVE A;  2ISD A;  1LKJ A;  3PFV A;  2CNP A;  1YTZ C;  4QJ5 B;  3LLE A;  5KTY A;  2KDH A;  2O5G A;  2BE6 A;  4C0J A;  2AMI A;  4YGA A;  1MQ1 A;  3BFH A;  1SY9 A;  3SJS A;  1QVI Z;  1K2H A;  3S0B A;  1XFY O;  5BPJ A;  2WOS A;  1J1E A;  1S1E A;  3BUW B;  2JNF A;  3N7H A;  3TDZ A;  4XJK A;  4USL A;  3WHT B;  1TRF A;  1TCO B;  3TUY C;  1XVJ A;  3D77 A;  3TS5 B;  1AK8 A;  1K94 A;  1A75 B;  2I94 A;  3OBV A;  3S0D A;  1TIZ A;  1KFU S;  3BUM B;  3OGN A;  2WCE A;  1CTR A;  2KNE A;  3BFB A;  1VRK A;  2BNX A;  4C0K A;  2JOJ A;  4MZL A;  1CLM A;  3D78 A;  3PM2 A;  1CFD A;  1SR6 C;  3B86 A;  1KK8 C;  3CDN A;  1SL9 A;  2MBX A;  2M0R A;  4GBA A;  3GK4 X;  1WLZ A;  2L5Y A;  3RZS A;  1YRT B;  1ZUZ A;  3F45 A;  4N1G A;  1WDC C;  1SYM A;  1G4Y R;  2ERB A;  4HSZ A;  2LP2 A;  1A2X A;  5HKW A;  3DVM A;  4HRE E;  1CKK A;  1QV0 A;  1YVL A;  1TUZ A;  4MVF A;  4PE1 A;  3DVJ A;  3CWG A;  1FI6 A;  2M7L A;  2JXL A;  3KF9 A;  5FI6 A;  2DOQ A;  2BBM A;  4CFR A;  2LLT A;  3PAT A;  1RWY A;  4YGB B;  4AQJ A;  1N65 A;  3OX5 A;  1QWV A;  1TNP A;  1TWO A;  1LA3 A;  4JD9 A;  3I5H B;  1BF5 A;  2PAL A;  2L50 A;  2ZN9 A;  2JZI A;  4A4B A;  2OPO A;  2JXC A;  2OS8 C;  1IG5 A;  4N5X A;  1GJY A;  3D10 A;  1L2O C;  2NXQ A;  3JTD B;  3NSI A;  4OVN F;  3EKJ A;  2ZND A;  2KI4 C;  1DJG A;  1TN4 A;  1DJX A;  1N2D A;  4DS7 A;  2HET A;  1J1D A;  1S26 D;  4JWQ A;  1XYD A;  1CNP A;  1PRW A;  4ORC B;  1D1O A;  3EVR A;  1OOJ A;  2R2I A;  2K8M B;  5ER4 X;  1DEK A;  2M49 B;  3V2L A;  1DC1 A;  5PAL A;  2WC6 A;  1SCM C;  3MSE B;  1DJW A;  3ZWH A;  2JNX A;  1EH2 A;  2V53 A;  1QJT A;  1XO5 A;  2WCB A;  1P28 A;  1JC2 A;  2F8P A;  1BR4 B;  1OSA A;  1SSE B;  3KO0 A;  3CR2 A;  1GGW A;  3PJI A;  1W9Z A;  5KU1 A;  2KAX A;  1IKU A;  4NDC A;  1S3P A;  4XJK B;  1PVA A;  1G8I A;  1FBV A;  5CPV A;  2H2K A;  4YGC B;  1QVI Y;  2KAV A;  1WLM A;  3IVT A;  1NX0 A;  3AKA A;  4JQ0 D;  3SG2 A;  1RRO A;  1NCZ A;  2Y4Q A;  3BUX B;  4GAO A;  3QRX A;  5ER5 A;  1MUX A;  1QLK A;  4FQO A;  1YVH A;  3SG6 A;  1QIV A;  4PE4 A;  2JPO A;  5HL1 A;  1CFC A;  2P6B B;  2KFH A;  3SG5 A;  1S6J A;  4E68 A;  4MN0 A;  3CZ2 A;  1NX2 A;  4PAL A;  4OZD A;  4PE7 A;  2BL0 C;  1CM1 A;  1OZS A;  3NHI A;  4HRG A;  2OTG B;  4KYN A;  1XK4 A;  1Z4H A;  5IBW A;  1REC A;  3IQQ A;  4MBE A;  3NSL A;  3B7A A;  2E6W A;  2HF5 A;  1F55 A;  1TNW A;  2L51 A;  3A4U B;  4DUQ A;  3B87 A;  4INX A;  2FJU B;  1TOP A;  2QEH A;  1UWO A;  4YGE B;  1OMR A;  4TNC A;  1C7W A;  3DZT A;  3A8R A;  1AHR A;  1FI5 A;  3SIA A;  1SRA A;  2IS9 A;  5AER A;  1BG1 A;  1KCY A;  1Y1A A;  3JVT B;  1UP5 A;  4I5L B;  3SS3 A;  3OP0 A;  1IJ5 A;  2Q4U A;  1WY9 A;  1NYA A;  1Y1X A;  1YX7 A;  1NCX A;  4BY5 A;  3Q8I A;  2BCA A;  2FCE A;  2QEV A;  3PAL A;  3CR4 X;  3AAJ A;  5CSF A;  5I2L A;  5G08 A;  3R1P A;  1CMG A;  1U5I A;  1RK9 A;  2M29 A;  1JUO A;  1F54 A;  3NXA A;  1PUL A;  3AKB A;  3KEV A;  2CCM A;  2CTN A;  1OZO A;  3SG7 A;  2EHB A;  3SG3 A;  4PHN A;  3TS5 C;  2LVV A;  4WQ2 A;  4PT1 A;  2QPT A;  5CSI A;  5FI2 A;  3VRO A;  3RLZ A;  2BCB A;  2BCX A;  4YBH B;  1DTL A;  1KQM B;  2MHH A;  1PSR A;  2P70 A;  1EG4 A;  4GGF A;  1QIW A;  2K61 A;  3I5G B;  5HLO A;  3IF7 A;  4M2Q A;  2PMY A;  2LE9 B;  1B8C A;  2KHN A;  1DMO A;  2LP3 A;  3O2P A;  4DRW A;  2ZRS A;  2D8N A;  1KK7 Z;  1LIN A;  1QX7 A;  2YGU A;  1UHH A;  3L4L A;  1GM0 A;  1QV1 A;  1QTX A;  2L5X B;  1SNL A;  4Q04 A;  1J7R A;  1R6P A;  2K7C A;  2LMV A;  1XFW O;  1HQV A;  1HT9 A;  2LVI A;  2M1U A;  1MR8 A;  3DD4 A;  2LVJ A;  4MEW A;  1JF2 A;  1QAT A;  3PSR A;  4NQG A;  1SBJ A;  1A29 A;  5DIC A;  2WCJ A;  1IIO A;  1OOF A;  1OOH A;  1ORG A;  1PSB A;  5D3O A;  4FQT A;  4QJ3 B;  2MJW B;  1GGZ A;  5TNC A;  3ICB A;  3BQ3 A;  1DJY A;  2K0J A;  3PM8 A;  2LLU A;  1K8U A;  1NCY A;  1IH0 A;  1NX1 A;  1OMV A;  3EKH A;  2LVK A;  1RJV A;  3M0W A;  3UNW A;  4F7F A;  2E30 A;  4PHM A;  4R1E A;  1JWD A;  2HQ8 A;  1C07 A;  2JTZ A;  1K95 A;  3I5H C;  1A4P A;  3CAB A;  3H4S E;  5JOL A;  1JSA A;  1CDP A;  1YRU B;  5I2O A;  4GUK A;  2ZKM X;  3OHM B;  1OOI X;  4YI9 A;  1OOG A;  2KBI A;  3JTD C;  3CYZ A;  3O6B A;  1KWO B;  2LNK A;  5I94 A;  1TNX A;  1QLS A;  2H61 C;  4IJ7 A;  2LC5 A;  2HQW A;  1DVI A;  3EG5 B;  1B1G A;  3I5F B;  5GQQ C;  1A03 A;  3NSK A;  2JU0 A;  2MRD A;  3S0F A;  1ODB A;  4CID A;  3LCP C;  1UUS A;  1S5G Z;  3GK1 A;  1V1G A;  4I5K A;  2MLE C;  1OQP A;  5HYD A;  4I5N B;  2LAN A;  3S0A A;  2BE4 A;  1C7V A;  1LXF C;  3GOF A;  4NDD A;  4PDZ A;  1DEL A;  3DVK A;  1CB1 A;  1OW4 A;  1C3Z A;  1OMD A;  3C1V A;  1F70 A;  4MRX A;  1U5I B;  2F2O A;  2VRG A;  1NWD A;  2CT9 A;  5CSN A;  1Y1U A;  5HLV A;  1YUS A;  1WRK A;  3TDI A;  3FE6 A;  2H8V A;  2LMU A;  1W7I B;  2QEO A;  1M63 B;  2I2R E;  1CLB A;  1XA5 A;  3VB1 A;  2NCP A;  2L0P A;  1DF0 A;  3B88 A;  2PVB A;  1R2U A;  2BEC A;  3VRQ A;  1FPW A;  3R1O A;  1CDN A;  1B7T Z;  1DJI A;  1SW8 A;  2WC5 A;  4ETO A;  4P2Y B;  1E8A A;  2M1K B;  1IWQ A;  3BOW A;  2WC8 A;  2Q91 A;  5AXI A;  5I8N A;  3EK8 A;  2LCP A;  2CXJ A;  1LVC D;  3CZT X;  3BUO B;  1S6I A;  2EC6 B;  5D7F A;  3HCM A;  1MWN A;  1ALV A;  1Y0V H;  3DF0 A;  1SPY A;  2FJY A;  3CZ0 A;  4D1E A;  1YX8 A;  1BJF A;  5D69 A;  1MXL C;  2JTT A;  2LM5 A;  1M39 A;  2OTG C;  1S36 A;  1W7J B;  3R72 A;  1XFR A;  3OB2 B;  2WOR A;  4C0L A;  4YRU A;  1KK7 Y;  1JFJ A;  3DXL A;  2QDI A;  2KI6 C;  2Y1N A;  3VRN A;  3BJH A;  1JF0 A;  2NZ0 A;  2PSR A;  1KFX S;  2BBN A;  2LV7 A;  3NGV A;  4OKH A;  1T14 A;  4WRI A;  2CBL A;  2KFF A;  1Y6W A;  1KQV A;  1B4C A;  3LL8 B;  3JVT C;  2BKI B;  4PHJ A;  3CZ1 A;  1YUT A;  1M45 A;  1K96 A;  5DKN A;  1CLL A;  4L9M A;  3FS7 A;  1C3Y A;  3UO9 A;  4N1F A;  3ZNI A;  1MXE A;  4GNK B;  2JUL A;  3LK0 A;  1IQ3 A;  2F33 A; 
#chains in the Genus database with same CATH homology
 4A4C A;  3WNX B;  2JRF A;  3FWC A;  1SK6 D;  3TDU A;  1NIW A;  1H4B A;  1QXP A;  2KQ6 A;  3VRP A;  1V1F A;  1M31 A;  2MA2 A;  2WCF A;  2K7D A;  4P5O E;  4M2P A;  4XYN A;  5DKR A;  2JT8 A;  1Q80 A;  1YR5 A;  4GPL B;  2G9B A;  2MAZ A;  3GK2 A;  1B47 A;  3OX6 A;  1J7O A;  4MZJ A;  3I5I B;  3PN7 B;  1EL4 A;  2HPS A;  4ZCU A;  2QAC A;  1K93 D;  1SL7 A;  1BOD A;  2KOT A;  1BOC A;  3BUN B;  1KQM C;  1NP8 A;  2AAO A;  4ICB A;  4DCK A;  4F0Z B;  2NCO A;  1CMF A;  4BY4 A;  2L4H A;  3I5G C;  4IL1 A;  3VGO A;  2F2P A;  1BT6 A;  5DKQ A;  1F4Q A;  1F8H A;  4YI8 A;  4ZCV A;  1S5G Y;  4CPV A;  1XFZ O;  3WHU B;  2F3Y A;  2FCD A;  1ALW A;  1LA0 A;  3K21 A;  1BU3 A;  2FOT A;  1NPQ A;  4PE0 A;  4MLW A;  2KGB C;  2LAP A;  1XFU O;  3CR5 X;  4U8D A;  1DF0 B;  4I5J A;  3O4Y A;  5AAN A;  1QX5 B;  3TUY B;  2K2A A;  4ORA B;  2AUC A;  2O60 A;  3FIA A;  1DT7 B;  2NLN A;  1F4O A;  3BOW B;  1B8R A;  2COL B;  1UHJ A;  2JPT A;  1DJH A;  3CS1 A;  1KFU L;  3DF0 B;  1SL8 A;  2Y5I A;  4CFQ A;  1SR6 B;  3TZ1 A;  2Y1M A;  4JPZ B;  1B7T Y;  2ZRT A;  2WND A;  1KK8 B;  1L7Z A;  1NSH A;  3BXK A;  4WQ3 A;  1XK4 C;  5AFP A;  1IQ5 A;  2I7A A;  2LUX A;  5J3X A;  1FF1 A;  1UHK A;  3WXA A;  1S6C A;  3HX4 A;  2ZN8 A;  1CDM A;  2BKH B;  1KWO C;  4AQI A;  3D0Y A;  1UUR A;  5B8I B;  1CFF A;  1WDC B;  3I5F C;  2K2F A;  2GGM A;  1K90 D;  1MHO A;  5HKZ A;  1J7P A;  1KSM A;  1NX3 A;  2MLF C;  2KBM A;  2G2B A;  1JFK A;  1KSO A;  3LK1 A;  2RGI A;  2LHI A;  1H8B A;  1QS7 A;  1EG3 A;  1K9U A;  4DIR A;  3RM1 A;  1SKT A;  4YGD B;  1AJ5 A;  1AP4 A;  2KFG A;  2PRU A;  1YUU A;  2K7O A;  1PK0 D;  1BR1 B;  5HKY A;  4MRY A;  3VRR A;  3EK7 A;  1ZMZ A;  2OS8 B;  3CGA A;  2KYF A;  3KHE A;  4QJ4 B;  1L2O B;  1MF8 B;  1DGU A;  2L98 A;  1F71 A;  2KI4 B;  1J7Q A;  4PCW A;  1M46 A;  3EVU A;  1IJ6 A;  1AJ4 A;  1DGV A;  2M9G A;  1SMG A;  1YUR A;  4AOM A;  2B1U A;  2M8U A;  2JT0 A;  4GGF C;  2SAS A;  4GFT A;  1N0Y A;  2K7B A;  2M3W A;  1TCF A;  1A75 A;  1IGV A;  1SCM B;  2JWW A;  2LHL A;  3E3R A;  2M7N A;  3O78 A;  4GGN A;  4OV2 A;  1DJZ A;  2JQ6 A;  2SCP A;  1QX2 A;  3PLF B;  4CLN A;  1OE9 B;  1QAS A;  1XFV O;  2EC6 C;  2KGR A;  3SG4 A;  4PHK A;  5K89 A;  2GGZ A;  1XFX O;  3NSO A;  1CDL A;  2LMT A;  1ZAC A;  2JC2 A;  2ZFD A;  1RTP 1;  2PAS A;  3IQO A;  5KSZ A;  1J55 A;  2L4I A;  1GQM A;  4FTG A;  1G33 A;  3KPX A;  5CSJ A;  1EJ3 A;  1AVS A;  1BMO A;  3EVV A;  2GV5 A;  4UPG A;  3CLN A;  2M97 A;  4OCI A;  2TN4 A;  2LLS A;  1UHN A;  2EGD A;  1RFJ A;  1CFP A;  4MSP A;  1PVB A;  3AAK A;  1TTX A;  1UHI A;  3CTN A;  2F3Z A;  2L2E A;  1K9P A;  1K9K A;  2KQY A;  3FWB A;  4MZK A;  3BYA A;  1EXR A;  2BL0 B;  1WRZ A;  1BLQ A;  3D0Y B;  3EK4 A;  2ZNE A;  3SIB A;  2KYC A;  4HRH A;  1PAL A;  1JBA A;  2JT3 A;  1ZOT B;  1AUI B;  1NUB A;  1WRL A;  5JJG A;  4ORB B;  3I5I C;  4OR9 B;  4NDB A;  3PN7 C;  2H61 A;  5F6T A;  2KAY A;  2KSP A;  5FYX A;  1TNQ A;  1FW4 A;  1B9A A;  2KI6 D;  2LUC A;  1KFX L;  4M2O A;  5AEQ A;  1X02 A;  1ZFS A;  2I18 A;  1IRJ A;  3OB1 B;  5I2Q A;  2A4J A;  1CM4 A;  1B8L A;  1SCV A;  3DVE A;  2ISD A;  1LKJ A;  3PFV A;  2CNP A;  1YTZ C;  4QJ5 B;  3LLE A;  5KTY A;  2KDH A;  2O5G A;  2BE6 A;  4C0J A;  2AMI A;  4YGA A;  1MQ1 A;  1SY9 A;  3SJS A;  1QVI Z;  1K2H A;  1XFY O;  5BPJ A;  2WOS A;  1J1E A;  1S1E A;  3BUW B;  2JNF A;  3TDZ A;  4XJK A;  4USL A;  3WHT B;  1TRF A;  1TCO B;  3TUY C;  1XVJ A;  3TS5 B;  1AK8 A;  1K94 A;  1A75 B;  2I94 A;  1TIZ A;  1KFU S;  3BUM B;  2WCE A;  1CTR A;  2KNE A;  1VRK A;  4C0K A;  2JOJ A;  4MZL A;  1CLM A;  1CFD A;  1SR6 C;  1KK8 C;  1SL9 A;  2MBX A;  2M0R A;  4GBA A;  3GK4 X;  1WLZ A;  1YRT B;  1ZUZ A;  3F45 A;  4N1G A;  1WDC C;  1SYM A;  1G4Y R;  4HSZ A;  2LP2 A;  1A2X A;  5HKW A;  3DVM A;  4HRE E;  1CKK A;  1QV0 A;  1YVL A;  4MVF A;  4PE1 A;  3DVJ A;  3CWG A;  1FI6 A;  2M7L A;  2JXL A;  3KF9 A;  2DOQ A;  2BBM A;  4CFR A;  2LLT A;  3PAT A;  1RWY A;  4YGB B;  4AQJ A;  1N65 A;  3OX5 A;  1TNP A;  1LA3 A;  3I5H B;  1BF5 A;  2PAL A;  2L50 A;  2ZN9 A;  2JZI A;  4A4B A;  2OPO A;  2JXC A;  2OS8 C;  1IG5 A;  4N5X A;  1GJY A;  3D10 A;  1L2O C;  2NXQ A;  3JTD B;  3NSI A;  4OVN F;  3EKJ A;  2ZND A;  2KI4 C;  1DJG A;  1TN4 A;  1DJX A;  1N2D A;  4DS7 A;  2HET A;  1J1D A;  1S26 D;  4JWQ A;  1XYD A;  1CNP A;  1PRW A;  4ORC B;  1D1O A;  3EVR A;  1OOJ A;  2R2I A;  2K8M B;  5ER4 X;  2M49 B;  5PAL A;  1SCM C;  3MSE B;  1DJW A;  3ZWH A;  2JNX A;  1EH2 A;  2V53 A;  1QJT A;  1XO5 A;  2WCB A;  1JC2 A;  2F8P A;  1BR4 B;  1OSA A;  3KO0 A;  3CR2 A;  1GGW A;  5KU1 A;  2KAX A;  1IKU A;  4NDC A;  1S3P A;  4XJK B;  1PVA A;  1G8I A;  1FBV A;  5CPV A;  2H2K A;  4YGC B;  1QVI Y;  2KAV A;  1WLM A;  3SG2 A;  1NX0 A;  3AKA A;  4JQ0 D;  1RRO A;  1NCZ A;  2Y4Q A;  3BUX B;  4GAO A;  3QRX A;  5ER5 A;  1MUX A;  1QLK A;  4FQO A;  1YVH A;  3SG6 A;  1QIV A;  4PE4 A;  1CFC A;  2P6B B;  2KFH A;  3SG5 A;  1S6J A;  4E68 A;  4MN0 A;  1NX2 A;  4PAL A;  4PE7 A;  2BL0 C;  1CM1 A;  1OZS A;  4HRG A;  2OTG B;  1XK4 A;  5IBW A;  1REC A;  3IQQ A;  4MBE A;  3NSL A;  2E6W A;  2HF5 A;  1F55 A;  1TNW A;  2L51 A;  3A4U B;  4DUQ A;  2FJU B;  1TOP A;  1UWO A;  4YGE B;  1OMR A;  4TNC A;  1C7W A;  3A8R A;  1AHR A;  1FI5 A;  3SIA A;  1SRA A;  2IS9 A;  5AER A;  1BG1 A;  1KCY A;  1Y1A A;  3JVT B;  1UP5 A;  4I5L B;  3OP0 A;  1IJ5 A;  2Q4U A;  1WY9 A;  1NYA A;  1Y1X A;  1YX7 A;  1NCX A;  4BY5 A;  2BCA A;  2FCE A;  3PAL A;  5I2L A;  3CR4 X;  3AAJ A;  5CSF A;  5G08 A;  1CMG A;  1U5I A;  1RK9 A;  2M29 A;  1JUO A;  1F54 A;  3NXA A;  1PUL A;  3AKB A;  3KEV A;  2CCM A;  2CTN A;  1OZO A;  3SG7 A;  2EHB A;  3SG3 A;  4PHN A;  3TS5 C;  2LVV A;  4WQ2 A;  5CSI A;  2QPT A;  3VRO A;  3RLZ A;  2BCB A;  2BCX A;  4YBH B;  1DTL A;  1KQM B;  2MHH A;  1PSR A;  1EG4 A;  4GGF A;  1QIW A;  2K61 A;  3I5G B;  5HLO A;  3IF7 A;  4M2Q A;  2PMY A;  2LE9 B;  1B8C A;  2KHN A;  1DMO A;  2LP3 A;  3O2P A;  4DRW A;  2ZRS A;  2D8N A;  1KK7 Z;  1LIN A;  1QX7 A;  1UHH A;  1QV1 A;  1QTX A;  2L5X B;  1SNL A;  4Q04 A;  1J7R A;  1R6P A;  2K7C A;  2LMV A;  1XFW O;  1HQV A;  1HT9 A;  2LVI A;  2M1U A;  1MR8 A;  3DD4 A;  2LVJ A;  4MEW A;  1JF2 A;  1QAT A;  3PSR A;  4NQG A;  1SBJ A;  1A29 A;  1PSB A;  5TNC A;  4QJ3 B;  2MJW B;  1GGZ A;  3ICB A;  3BQ3 A;  1DJY A;  2K0J A;  3PM8 A;  2LLU A;  1K8U A;  1NCY A;  1IH0 A;  1NX1 A;  1OMV A;  3EKH A;  2LVK A;  1RJV A;  3M0W A;  2E30 A;  4PHM A;  4R1E A;  1JWD A;  2HQ8 A;  1C07 A;  2JTZ A;  1K95 A;  3I5H C;  1A4P A;  3H4S E;  5JOL A;  1JSA A;  1CDP A;  1YRU B;  5I2O A;  4GUK A;  2ZKM X;  3OHM B;  4YI9 A;  2KBI A;  3JTD C;  3O6B A;  1KWO B;  2LNK A;  1TNX A;  1QLS A;  2H61 C;  2LC5 A;  2HQW A;  1DVI A;  1B1G A;  3I5F B;  5GQQ C;  1A03 A;  3NSK A;  2JU0 A;  2MRD A;  1ODB A;  4CID A;  3LCP C;  1UUS A;  1S5G Z;  3GK1 A;  1V1G A;  4I5K A;  2MLE C;  1OQP A;  5HYD A;  4I5N B;  2LAN A;  2BE4 A;  1C7V A;  1LXF C;  3GOF A;  4NDD A;  4PDZ A;  3DVK A;  1CB1 A;  3C1V A;  1OMD A;  1F70 A;  4MRX A;  1U5I B;  2F2O A;  2VRG A;  1NWD A;  2CT9 A;  5CSN A;  1Y1U A;  5HLV A;  1YUS A;  1WRK A;  3TDI A;  2LMU A;  1W7I B;  1CLB A;  1M63 B;  2I2R E;  1XA5 A;  2NCP A;  2L0P A;  1DF0 A;  2PVB A;  1R2U A;  2BEC A;  3VRQ A;  1FPW A;  1CDN A;  1B7T Z;  1DJI A;  1SW8 A;  4ETO A;  4P2Y B;  1E8A A;  2M1K B;  1IWQ A;  3BOW A;  2WC8 A;  2Q91 A;  5AXI A;  5I8N A;  3EK8 A;  2LCP A;  2CXJ A;  1LVC D;  3CZT X;  3BUO B;  1S6I A;  2EC6 B;  5D7F A;  3HCM A;  1MWN A;  1ALV A;  1Y0V H;  3DF0 A;  1SPY A;  4D1E A;  1YX8 A;  1BJF A;  5D69 A;  1MXL C;  2JTT A;  2LM5 A;  1M39 A;  2OTG C;  1S36 A;  1W7J B;  4C0L A;  4YRU A;  3OB2 B;  2WOR A;  1KK7 Y;  1JFJ A;  2KI6 C;  2Y1N A;  3VRN A;  1JF0 A;  2NZ0 A;  2PSR A;  1KFX S;  2BBN A;  2LV7 A;  4OKH A;  4WRI A;  2CBL A;  2KFF A;  1Y6W A;  1KQV A;  1B4C A;  3LL8 B;  3JVT C;  2BKI B;  4PHJ A;  1YUT A;  1M45 A;  1K96 A;  5DKN A;  1CLL A;  4L9M A;  3FS7 A;  4N1F A;  3ZNI A;  1MXE A;  4GNK B;  2JUL A;  3LK0 A;  1IQ3 A;  2F33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...