2E6WA

Solution structure and calcium binding properties of ef-hands 3 and 4 of calsenilin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
96
structure length
96
Chain Sequence
GTVHEKLKWAFNLYDINKDGYITKEEMLAIMKSIYDMMGRHTYPILREDAPAEHVERFFEKMDRNQDGVVTIEEFLEACQKDENIMSSMQLFENVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords Calsenilin
publication title Solution structure and calcium-binding properties of EF-hands 3 and 4 of calsenilin.
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2e6wA00
3GK2A 1TNXA 4XYNA 4JWQA 1V1FA 1PVAA 1VRKA 4GFTA 4A4BA 2F33A 4DRWA 3NSKA 2KAXA 2M49B 1KQVA 2KI4B 4R1EA 1M39A 2BKHB 3CR4X 3RM1A 5BPJA 1OSAA 3I5GB 3KHEA 1PK0D 4P2YB 2CBLA 2Y1NA 4USLA 4E68A 4YI9A 2G2BA 2L4HA 1CFDA 3SG4A 1S6JA 1W7IB 2LCPA 2ZNDA 1CFPA 3I5HB 5CSIA 1XK4A 2JOJA 3AAJA 4PE1A 3BUOB 2L98A 4PHJA 2KNEA 5ER4X 4PCWA 4QJ3B 4M2PA 1JFJA 1A03A 3BUXB 1Q80A 5I2LA 1FI5A 3JVTC 2ZFDA 1DF0A 2BKIB 5KSZA 4M2OA 3DF0A 3TUYC 5F6TA 4PALA 1Y1AA 1CB1A 3HCMA 4WRIA 1JF2A 4YGEB 5AEQA 2KI6C 1BMOA 3DD4A 3SG5A 2R2IA 1SCMC 2KYFA 4OV2A 2PALA 1FI6A 1F4QA 1L2OB 2K61A 2M1KB 4PHNA 2K2AA 4F0ZB 3MSEB 1PRWA 2JT3A 1OZSA 2L5XB 4ETOA 4IL1A 3NSOA 1NCXA 4C0KA 2LLTA 2M0RA 2H2KA 1SKTA 3O4YA 5CSFA 4I5LB 1WRLA 3JTDC 5ER5A 1GGZA 1NX1A 3NXAA 4HRHA 2LV7A 5I2OA 1NCYA 3SIBA 2I2RE 2HETA 3LK1A 3D10A 5PALA 2ISDA 1CM1A 2KFGA 1YR5A 1GJYA 2M7NA 2BE4A 4NQGA 1J1DA 2AAOA 3SG7A 3AKAA 5HLVA 2M1UA 1K90D 1U5IA 1UHIA 1IWQA 4Q04A 4L9MA 3C1VA 3LL8B 2MJWB 2QPTA 2LMVA 1KWOB 1XFWO 1RTP1 1ALWA 1UP5A 1MWNA 3BOWB 1R6PA 2CCMA 4QJ4B 2KBMA 1MR8A 1XK4C 2KAVA 3TS5C 2M8UA 2HQWA 1SCVA 3PN7B 1CDNA 1B7TZ 1MUXA 3O2PA 1EXRA 5JJGA 1SL8A 3EKJA 4HRGA 2BBMA 3FWBA 4NDCA 3TDZA 2AUCA 3A8RA 3CTNA 1D1OA 1V1GA 3I5IC 3KO0A 2PRUA 2EGDA 1CLLA 4HREE 3TS5B 4CFRA 1CLMA 1JF0A 1F55A 1NWDA 1XA5A 2LM5A 5KTYA 3I5FB 1F8HA 1J7OA 1G8IA 4N5XA 1XVJA 1MHOA 1UURA 1IQ3A 1SL7A 1IG5A 1DGUA 2KFHA 4CLNA 2BE6A 1M46A 3EVUA 1SK6D 2KDHA 1DVIA 2BL0C 3OB1B 2V53A 2WNDA 1QASA 1F71A 3VGOA 2EC6C 2JU0A 2Y5IA 1A29A 1CMFA 4MRYA 1B47A 4XJKA 1WDCB 5HLOA 2IS9A 3RLZA 3TDIA 1LXFC 1TRFA 4GAOA 3SG6A 1N65A 1AJ4A 2F2OA 1S6IA 4UPGA 3NSIA 1C7WA 2NXQA 1EG4A 2KI4C 2LLUA 2LC5A 3TZ1A 3PATA 3CR2A 1J7QA 1SR6B 3VRPA 2Y4QA 3I5GC 4PE7A 4GGFA 4BY5A 1B8CA 1NX0A 3PFVA 3KEVA 5CSJA 1K94A 3I5HC 4N1GA 3VRRA 1CMGA 1QXPA 4MBEA 3GK4X 4YGBB 4PDZA 1WLMA 1XFUO 4ORCB 3SIAA 3F45A 5HKWA 1CFCA 1B7TY 2JQ6A 1KK8B 3IQOA 1LINA 1S36A 2D8NA 2K0JA 2VRGA 1RROA 1S1EA 2L2EA 4PHKA 2FCEA 5J3XA 2O60A 2K7BA 3WNXB 1CLBA 1DJIA 2B1UA 2O5GA 4ORAB 4PE0A 2K2FA 1OE9B 3SG3A 3LLEA 1B4CA 1M63B 3OX6A 4MSPA 3D0YA 1XYDA 2ZN9A 3SG2A 5D69A 1DT7B 1DJWA 1L2OC 4CPVA 2NCPA 5IBWA 3BQ3A 1RECA 1TIZA 1EL4A 2BECA 2G9BA 1BR1B 1BOCA 1QS7A 1QVIZ 3KPXA 4AQJA 2M9GA 1YURA 3CLNA 3O6BA 1YUUA 1PVBA 1BJFA 1BU3A 2JTZA 1K2HA 1CDLA 3PSRA 5HKZA 2MHHA 1GGWA 1ZMZA 3BXKA 2BBNA 4JPZB 2KGRA 2L50A 1FW4A 2OTGB 2JNXA 1WRKA 3WHTB 2JRFA 2NLNA 1WY9A 2Y1MA 1BG1A 1LA0A 1KFXL 1B8RA 1LA3A 3ZNIA 4MZKA 1S3PA 1SRAA 2BCXA 4BY4A 1EH2A 1CNPA 3FIAA 4GBAA 3OHMB 1J55A 2SCPA 3HX4A 1WRZA 2M29A 4U8DA 2OPOA 2JC2A 2K8MB 3VRNA 1N2DA 5HYDA 3VROA 3CWGA 3GK1A 4GGFC 1KWOC 2KAYA 5AXIA 1KSMA 2M3WA 4QJ5B 1S26D 3BUMB 1YX7A 1KFXS 1QIVA 3OX5A 3PN7C 4ORBB 3TDUA 2AMIA 2LE9B 1JC2A 2F3ZA 1C7VA 4PHMA 2FJUB 2MBXA 5B8IB 4WQ3A 4GPLB 5I2QA 1IGVA 4MN0A 2FOTA 2JTTA 3DVMA 5CPVA 1K93D 1SNLA 1TNQA 2A4JA 2TN4A 3PALA 4I5KA 3QRXA 2MA2A 3LCPC 2E30A 3A4UB 3H4SE 3I5FC 1AUIB 1QVIY 1TNPA 4FTGA 2DOQA 2Q91A 4C0JA 1UUSA 2MLFC 1KK7Z 3KF9A 5HKYA 1YTZC 1J7PA 2ZN8A 1QLKA 3EK4A 5AANA 1NX2A 3FS7A 1A2XA 1S5GZ 3O78A 1K9KA 4OR9B 1YVHA 3ICBA 1MF8B 3CGAA 1JSAA 1R2UA 5D7FA 2HQ8A 2PVBA 1ODBA 3AAKA 3CS1A 5G08A 1LVCD 1WDCC 1FF1A 1K9UA 1K96A 2CNPA 1YUSA 1LKJA 1B8LA 1XFXO 1OOJA 4DUQA 4YBHB 1AP4A 2L0PA 2BCAA 1SR6C 1JWDA 2SASA 1GQMA 5JOLA 1TTXA 1CTRA 1AK8A 1QX2A 1TCOB 1SPYA 1YRUB 2M97A 4C0LA 5KU1A 3DVKA 1DMOA 5TNCA 1A75B 2KOTA 1K9PA 2JULA 4YGCB 2KFFA 2KYCA 4HSZA 2LP2A 4OCIA 1NX3A 1KK8C 1X02A 1NYAA 2LHLA 1DF0B 1QTXA 1B9AA 4DCKA 2WOSA 1KFUL 3BOWA 4ZCUA 1UHKA 4NDDA 1AVSA 4CFQA 1KSOA 1KCYA 2MRDA 3OP0A 2OS8B 1M45A 1ZOTB 1TNWA 2CXJA 1XO5A 1KK7Y 1PSBA 1XFYO 1DJHA 1HT9A 2JPTA 2CTNA 1YVLA 4ZCVA 1S5GY 2LVKA 2LVIA 2PASA 1CDPA 5AERA 1E8AA 1KFUS 2LUXA 4DS7A 1W7JB 1CDMA 1SL9A 2PMYA 4GGNA 4GNKB 1A4PA 4A4CA 1TN4A 2GV5A 2EHBA 3GOFA 1OZOA 1EG3A 4MZLA 3BYAA 2KHNA 1YUTA 1HQVA 1RFJA 2JWWA 4MLWA 2OTGC 4I5JA 2JXCA 1U5IB 1OQPA 1IJ6A 2F2PA 2ZNEA 4N1FA 2HPSA 2JNFA 2WC8A 1NUBA 1S6CA 1QATA 1YX8A 1AHRA 3EK8A 1JBAA 1XFZO 2I7AA 2JT8A 1FPWA 2LNKA 4I5NB 3K21A 2I94A 4P5OE 5FYXA 4JQ0D 1C07A 2WORA 1DJYA 1A75A 1SW8A 1MQ1A 2PSRA 1JUOA 1H4BA 1TOPA 1Y1XA 2RGIA 1PULA 2L4IA 1BT6A 1OMDA 2E6WA 1MXLC 1CKKA 3EKHA 2CT9A 2ZKMX 1DJXA 1NIWA 2LLSA 2K7CA 4YGAA 3WXAA 3OB2B 3M0WA 2MAZA 3IQQA 2NCOA 4AOMA 3CR5X 3JVTB 1JFKA 3LK0A 2MLEC 1KQMC 4FQOA 1PALA 5GQQC 1J1EA 1BLQA 3TUYB 1DJZA 1RWYA 2K7DA 3BUWB 1ALVA 1WLZA 1Y0VH 1UHNA 2LP3A 1UHJA 4MRXA 1SCMB 2JT0A 5DKQA 1J7RA 4WQ2A 2GGMA 1KQMB 3FWCA 4YI8A 1IQ5A 2FCDA 3PM8A 1BR4B 1Y1UA 1NSHA 1MXEA 1ZFSA 2LANA 3IF7A 1IKUA 2P6BB 3DVJA 1OMVA 1ZACA 2H61C 1BF5A 2F3YA 4DIRA 4OKHA 4TNCA 1G4YR 3JTDB 4M2QA 3SJSA 3AKBA 4GUKA 4XJKB 2ZRSA 1F54A 5DKRA 1FBVA 1UHHA 2QACA 2Q4UA 1YRTB 1Y6WA 2KQ6A 2LMUA 3PLFB 1AJ5A 5DKNA 2JXLA 1CM4A 2GGZA 1NPQA 3EK7A 4CIDA 1K8UA 2ZRTA 1EJ3A 4MZJA 1F4OA 2KI6D 4OVNF 2NZ0A 2KBIA 3E3RA 1B1GA 1DTLA 2JZIA 1PSRA 5I8NA 1QLSA 3EVVA 1CFFA 3CZTX 1L7ZA 1BODA 4YGDB 1QV0A 1XFVO 1SMGA 2KQYA 1F70A 1N0YA 1ZUZA 2F8PA 2WCFA 4D1EA 2I18A 1QX7A 1H8BA 2HF5A 1IRJA 1SYMA 2LMTA 2COLB 2M7LA 2K7OA 2LUCA 3WHUB 3ZWHA 1QIWA 3D0YB 4AQIA 1SBJA 5AFPA 1RJVA 1QX5B 1SY9A 2KGBC 3I5IB 1IJ5A 2LVVA 1NP8A 2OS8C 5K89A 1TCFA 2LHIA 2WCEA 4ICBA 3DF0B 2L51A 3NSLA 4NDBA 2BCBA 1IH0A 2LAPA 3BUNB 4MEWA 1RK9A 3DVEA 4MVFA 3VRQA 1QV1A 2WCBA 1OMRA 1K95A 1QJTA 1UWOA 2BL0B 2LVJA 1G33A 1DJGA 4PE4A 4YRUA 2KSPA 3EVRA 2EC6B 2H61A 1NCZA 5CSNA 1M31A 1DGVA
chains in the Genus database with same CATH superfamily
3GK2A 1TNXA 4XYNA 4JWQA 1V1FA 1PVAA 1VRKA 4GFTA 4A4BA 2F33A 4DRWA 3NSKA 2KAXA 3DZTA 2M49B 1KQVA 2KI4B 4R1EA 2WC6A 1M39A 2BKHB 3CR4X 3RM1A 5BPJA 1OSAA 3I5GB 3KHEA 1PK0D 4P2YB 2CBLA 2Y1NA 4USLA 4E68A 4YI9A 2G2BA 2L4HA 1CFDA 3SG4A 1S6JA 1W7IB 2LCPA 3L4LA 2ZNDA 1CFPA 3I5HB 5CSIA 1XK4A 3CZ2A 2JOJA 3AAJA 4PE1A 3BUOB 2L98A 4PHJA 2KNEA 5ER4X 4PCWA 4QJ3B 4M2PA 3CZ0A 1JFJA 1A03A 3BUXB 1Q80A 5I2LA 3RZSA 3Q8IA 1FI5A 3JVTC 2ZFDA 5FI7A 1DF0A 2BKIB 5KSZA 4M2OA 3DF0A 3TUYC 5F6TA 4PALA 1Y1AA 1CB1A 3HCMA 4WRIA 1JF2A 4YGEB 5AEQA 2KI6C 1BMOA 3DD4A 4OZDA 3SG5A 2R2IA 1SCMC 5D3OA 2KYFA 4OV2A 2PALA 1FI6A 1F4QA 1L2OB 2K61A 2M1KB 4PHNA 2K2AA 4F0ZB 3MSEB 1PRWA 3CZ1A 2JT3A 1OZSA 2L5XB 4ETOA 4IL1A 3NSOA 1NCXA 4C0KA 2LLTA 2M0RA 2H2KA 1SKTA 3O4YA 2QEOA 5FI6A 5CSFA 4I5LB 1WRLA 3JTDC 5ER5A 1GGZA 1NX1A 3NXAA 4HRHA 2LV7A 5I2OA 1NCYA 1TUJA 3SIBA 2I2RE 2HETA 3LK1A 3D10A 5PALA 2ISDA 1CM1A 2KFGA 1YR5A 1GJYA 2M7NA 3D78A 2BE4A 3NHTA 4NQGA 1J1DA 2AAOA 2WCLA 3SG7A 3AKAA 3VB1A 5HLVA 2M1UA 1K90D 1U5IA 1UHIA 1IWQA 4Q04A 4L9MA 3C1VA 3LL8B 2MJWB 2QPTA 3O4XA 2LMVA 1KWOB 1XFWO 1RTP1 1ALWA 1UP5A 1MWNA 3BOWB 3L47A 1R6PA 2CCMA 4QJ4B 2KBMA 1MR8A 1XK4C 2KAVA 3TS5C 3K1EA 2L5YA 2M8UA 2HQWA 1SCVA 1OOFA 3PN7B 1CDNA 1B7TZ 2GTEA 1MUXA 3O2PA 1EXRA 5JJGA 1SL8A 3EKJA 4HRGA 2BBMA 3FWBA 4NDCA 3TDZA 2AUCA 3A8RA 3CTNA 1D1OA 1V1GA 3I5IC 3KO0A 5HL1A 2PRUA 2EGDA 1CLLA 4HREE 3TS5B 4CFRA 1CLMA 1JF0A 3R1VA 1F55A 3DXLA 1NWDA 1XA5A 2LM5A 3B87A 3PJIA 3I5FB 5KTYA 1F8HA 1J7OA 1G8IA 4N5XA 3S0FA 1XVJA 1MHOA 1UURA 1DEKA 1SL7A 1IQ3A 1IG5A 1DGUA 2KFHA 4CLNA 2BE6A 1M46A 3EVUA 1SK6D 3B88A 2H8VA 1DVIA 2KDHA 2BL0C 2P70A 2WCJA 3OB1B 3QMEA 2V53A 2WNDA 1QASA 1W9ZA 1F71A 2P71A 3VGOA 2EC6C 2JU0A 2L2CA 1A29A 2Y5IA 1CMFA 3FE9A 4MRYA 3SS4A 1B47A 4XJKA 1WDCB 5HLOA 2IS9A 3RLZA 3TDIA 1LXFC 1TRFA 4GAOA 3SG6A 3SS5A 1N65A 1AJ4A 2F2OA 1S6IA 4UPGA 4KYNA 1C3ZA 3NSIA 1C7WA 2NXQA 1EG4A 2KI4C 2LLUA 2LC5A 3TZ1A 3PATA 3CR2A 1J7QA 1SR6B 3VRPA 1OOGA 2Y4QA 3D77A 3I5GC 4PE7A 4GGFA 3B86A 1B8CA 1NX0A 3PFVA 4BY5A 2WCKA 3KEVA 5CSJA 3L4AA 1K94A 3I5HC 4N1GA 3VRRA 1CMGA 1P28A 1QXPA 4MBEA 3GK4X 4YGBB 4PDZA 1WLMA 1XFUO 4ORCB 3SIAA 3F45A 5HKWA 1CFCA 1B7TY 2JQ6A 1KK8B 3IQOA 1LINA 1S36A 2D8NA 2K0JA 1T14A 2VRGA 1RROA 1S1EA 2L2EA 4PHKA 2FCEA 5J3XA 2O60A 2K7BA 3WNXB 1CLBA 1DJIA 2ERBA 2B1UA 2O5GA 2BNXA 4ORAB 4PE0A 2K2FA 3OBVA 1OE9B 3SG3A 3LLEA 1B4CA 1M63B 3OX6A 3CDNA 1QWVA 4MSPA 3D0YA 1XYDA 4JD9A 2ZN9A 1ORGA 3SG2A 5D69A 1DT7B 1DJWA 2QEBA 1L2OC 4CPVA 2NCPA 5IBWA 3BQ3A 1RECA 1TIZA 1EL4A 2BECA 2G9BA 1BR1B 3NHIA 1QS7A 1BOCA 1QVIZ 3KPXA 4AQJA 2M9GA 1YURA 3CLNA 3O6BA 1YUUA 1PVBA 1BJFA 3UO9A 1BU3A 2JTZA 1K2HA 1CDLA 3PSRA 5HKZA 2MHHA 1GGWA 1ZMZA 3BXKA 2BBNA 3BJHA 1Z4HA 4IJ7A 2KGRA 2L50A 4JPZB 2JPOA 1FW4A 2OTGB 2JNXA 1WRKA 3WHTB 2JRFA 2NLNA 1WY9A 3NGVA 2Y1MA 1BG1A 1LA0A 1KFXL 1B8RA 1LA3A 3ZNIA 4MZKA 1S3PA 1SRAA 2BCXA 4BY4A 1EH2A 1CNPA 3FIAA 4GBAA 3OHMB 3R1OA 3S0EA 1J55A 1OW4A 2SCPA 3HX4A 1WRZA 2M29A 4U8DA 2OPOA 4F7FA 2JC2A 2K8MB 3VRNA 1N2DA 5HYDA 3VROA 3CWGA 3GK1A 4GGFC 1KWOC 2KAYA 4JKTA 5AXIA 1KSMA 2M3WA 4QJ5B 1S26D 3BUMB 2BAPA 1YX7A 1KFXS 1QIVA 3OX5A 3PN7C 4ORBB 3TDUA 2AMIA 2LE9B 1JC2A 2F3ZA 3FE6A 1C7VA 4PHMA 2FJUB 2MBXA 5B8IB 3S0GA 4WQ3A 4GPLB 5I2QA 1IGVA 4MN0A 4PT1A 2FOTA 2JTTA 3DVMA 5CPVA 1DC1A 1K93D 1SNLA 1TNQA 2A4JA 2TN4A 3PALA 4I5KA 2KLDA 3QRXA 2K60A 2MA2A 3LCPC 2E30A 3A4UB 3H4SE 2FJYA 1IIOA 3I5FC 1AUIB 1QVIY 1TNPA 1XFRA 4FTGA 2DOQA 2Q91A 4C0JA 1UUSA 2MLFC 1KK7Z 3KF9A 5HKYA 1YTZC 1J7PA 2ZN8A 1QLKA 3EK4A 2WCHA 5AANA 5I94A 1NX2A 3FS7A 1A2XA 1S5GZ 3O78A 1K9KA 4OR9B 1TWOA 1YVHA 2QEVA 3ICBA 1MF8B 3CGAA 1JSAA 1R2UA 5D7FA 2HQ8A 2PVBA 1ODBA 3AAKA 3S0AA 3CS1A 5G08A 1LVCD 1WDCC 1FF1A 3S0BA 1K9UA 3OGNA 1K96A 2CNPA 1YUSA 1LKJA 1B8LA 1XFXO 1OOJA 4DUQA 3CABA 4YBHB 1AP4A 3PM2A 2L0PA 2BCAA 1SR6C 1DQEA 1JWDA 2SASA 1GQMA 5JOLA 1TTXA 1CTRA 1AK8A 1QX2A 1TCOB 1SPYA 1YRUB 2M97A 4C0LA 5KU1A 3DVKA 1DMOA 5TNCA 1A75B 2KOTA 1K9PA 2JULA 4YGCB 2KFFA 2KYCA 1LS8A 4HSZA 2LP2A 4OCIA 1NX3A 1KK8C 1X02A 1NYAA 2LHLA 1DF0B 1QTXA 1B9AA 4DCKA 2WOSA 1KFUL 3BOWA 4ZCUA 1UHKA 4NDDA 1AVSA 2WCMA 4CFQA 1KSOA 1KCYA 2MRDA 3OP0A 2OS8B 1M45A 1ZOTB 1TNWA 1SSEB 3B7AA 2CXJA 3DY9A 1XO5A 1KK7Y 1PSBA 3D73A 1XFYO 1DELA 1DJHA 1HT9A 2JPTA 2CTNA 5DICA 1YVLA 4INWA 4ZCVA 1S5GY 2KLEA 2LVIA 2LVKA 3N7HA 2PASA 1CDPA 5AERA 1E8AA 1KFUS 2LUXA 4DS7A 1W7JB 1CDMA 1SL9A 2PMYA 4GGNA 4GNKB 1A4PA 4A4CA 1TN4A 2GV5A 2EHBA 3CYZA 3GOFA 1OZOA 1EG3A 4MZLA 5EL2A 3BYAA 2KHNA 2KPHA 1YUTA 1HQVA 1RFJA 2JWWA 4MLWA 2OTGC 4I5JA 2JXCA 1U5IB 3BFBA 1OQPA 1IJ6A 2F2PA 2ZNEA 4N1FA 2HPSA 2JNFA 2WC8A 1NUBA 1S6CA 1QATA 1YX8A 1AHRA 3EK8A 1JBAA 1XFZO 2I7AA 2JT8A 1FPWA 2LNKA 4I5NB 3K21A 2I94A 4P5OE 5FYXA 4JQ0D 1C07A 2WORA 1DJYA 1A75A 1SW8A 1MQ1A 2PSRA 3EG5B 1JUOA 1H4BA 1TOPA 1Y1XA 2RGIA 1PULA 2L4IA 4INXA 1BT6A 1OMDA 2E6WA 1MXLC 3DYEA 1CKKA 3EKHA 2CT9A 2ZKMX 1DJXA 1NIWA 2LLSA 2K7CA 4YGAA 3WXAA 3OB2B 3M0WA 2MAZA 3FE8A 3IQQA 2NCOA 4AOMA 3CR5X 3R72A 3JVTB 1JFKA 3LK0A 2MLEC 2QDIA 1KQMC 4FQOA 1PALA 5GQQC 1J1EA 1BLQA 3TUYB 1DJZA 1RWYA 2K7DA 3BUWB 1ALVA 1WLZA 1Y0VH 3D76A 1UHNA 2LP3A 1UHJA 4MRXA 1SCMB 2JT0A 5DKQA 1J7RA 4WQ2A 2GGMA 1KQMB 3FWCA 4YI8A 1IQ5A 2FCDA 3PM8A 1BR4B 1Y1UA 1NSHA 1MXEA 1ZFSA 2LANA 3IF7A 1IKUA 2P6BB 3DVJA 1OMVA 1ZACA 2H61C 1BF5A 2F3YA 4DIRA 4OKHA 4TNCA 1G4YR 3JTDB 4M2QA 3SJSA 3AKBA 4GUKA 4XJKB 3UNWA 2ZRSA 2QEHA 5DKRA 1TUZA 1F54A 1FBVA 3S0DA 1UHHA 3D74A 2QACA 3R1PA 2Q4UA 1GM0A 1YRTB 1Y6WA 2YGUA 2KQ6A 2LMUA 4FQTA 3PLFB 1AJ5A 5DKNA 2JXLA 1CM4A 2GGZA 1NPQA 3EK7A 4CIDA 1K8UA 2ZRTA 1EJ3A 4MZJA 1F4OA 2KI6D 5FI2A 4OVNF 2PQLA 2NZ0A 2KBIA 3E3RA 1B1GA 3BFAA 1DTLA 2JZIA 1PSRA 5I8NA 1QLSA 3EVVA 1CFFA 3CZTX 1C3YA 1Z2CB 1L7ZA 1OOHA 3B6XA 1BODA 4YGDB 1QV0A 1XFVO 3IVTA 1SMGA 2KQYA 1F70A 1N0YA 1ZUZA 2F8PA 2PYQA 2WCFA 3D75A 4D1EA 2I18A 1QX7A 1H8BA 2HF5A 1IRJA 1SYMA 2LMTA 2COLB 2M7LA 2K7OA 2LUCA 3WHUB 3ZWHA 1QIWA 3D0YB 4AQIA 1SBJA 5AFPA 1RJVA 3BFHA 1QX5B 1SY9A 2KGBC 3I5IB 3SS3A 1IJ5A 2LVVA 1NP8A 2OS8C 5K89A 1TCFA 2LHIA 2WCEA 4ICBA 3DF0B 2L51A 3NSLA 4NDBA 2BCBA 1IH0A 2LAPA 3BUNB 4MEWA 1RK9A 3DVEA 4MVFA 3VRQA 1QV1A 2WCBA 1OMRA 1K95A 1OOIX 1QJTA 1UWOA 2WC5A 2BL0B 2LVJA 1G33A 1DJGA 4PE4A 4YRUA 2KSPA 3EVRA 2EC6B 2H61A 1NCZA 5CSNA 1M31A 3V2LA 1DGVA
chains in the Genus database with same CATH topology
3GK2A 1TNXA 4XYNA 4JWQA 1V1FA 1PVAA 1VRKA 4GFTA 4A4BA 2F33A 4DRWA 3NSKA 2KAXA 2M49B 1KQVA 2KI4B 4R1EA 1M39A 2BKHB 3CR4X 3RM1A 5BPJA 1OSAA 3I5GB 3KHEA 1PK0D 4P2YB 2CBLA 2Y1NA 4USLA 4E68A 4YI9A 2G2BA 2L4HA 1CFDA 3SG4A 1S6JA 1W7IB 2LCPA 2ZNDA 1CFPA 3I5HB 5CSIA 1XK4A 2JOJA 3AAJA 4PE1A 3BUOB 2L98A 4PHJA 2KNEA 5ER4X 4PCWA 4QJ3B 4M2PA 1JFJA 1A03A 3BUXB 1Q80A 5I2LA 1FI5A 3JVTC 2ZFDA 1DF0A 2BKIB 5KSZA 4M2OA 3DF0A 3TUYC 5F6TA 4PALA 1Y1AA 1CB1A 3HCMA 4WRIA 1JF2A 4YGEB 5AEQA 2KI6C 1BMOA 3DD4A 3SG5A 2R2IA 1SCMC 2KYFA 4OV2A 2PALA 1FI6A 1F4QA 1L2OB 2K61A 2M1KB 4PHNA 2K2AA 4F0ZB 3MSEB 1PRWA 2JT3A 1OZSA 2L5XB 4ETOA 4IL1A 3NSOA 1NCXA 4C0KA 2LLTA 2M0RA 2H2KA 1SKTA 3O4YA 5CSFA 4I5LB 1WRLA 3JTDC 5ER5A 1GGZA 1NX1A 3NXAA 4HRHA 2LV7A 5I2OA 1NCYA 3SIBA 2I2RE 2HETA 3LK1A 3D10A 5PALA 2ISDA 1CM1A 2KFGA 1YR5A 1GJYA 2M7NA 2BE4A 4NQGA 1J1DA 2AAOA 3SG7A 3AKAA 5HLVA 2M1UA 1K90D 1U5IA 1UHIA 1IWQA 4Q04A 4L9MA 3C1VA 3LL8B 2MJWB 2QPTA 2LMVA 1KWOB 1XFWO 1RTP1 1ALWA 1UP5A 1MWNA 3BOWB 1R6PA 2CCMA 4QJ4B 2KBMA 1MR8A 1XK4C 2KAVA 3TS5C 2M8UA 2HQWA 1SCVA 3PN7B 1CDNA 1B7TZ 1MUXA 3O2PA 1EXRA 5JJGA 1SL8A 3EKJA 4HRGA 2BBMA 3FWBA 4NDCA 3TDZA 2AUCA 3A8RA 3CTNA 1D1OA 1V1GA 3I5IC 3KO0A 2PRUA 2EGDA 1CLLA 4HREE 3TS5B 4CFRA 1CLMA 1JF0A 1F55A 1NWDA 1XA5A 2LM5A 5KTYA 3I5FB 1F8HA 1J7OA 1G8IA 4N5XA 1XVJA 1MHOA 1UURA 1IQ3A 1SL7A 1IG5A 1DGUA 2KFHA 4CLNA 2BE6A 1M46A 3EVUA 1SK6D 2KDHA 1DVIA 2BL0C 3OB1B 2V53A 2WNDA 1QASA 1F71A 3VGOA 2EC6C 2JU0A 2Y5IA 1A29A 1CMFA 4MRYA 1B47A 4XJKA 1WDCB 5HLOA 2IS9A 3RLZA 3TDIA 1LXFC 1TRFA 4GAOA 3SG6A 1N65A 1AJ4A 2F2OA 1S6IA 4UPGA 3NSIA 1C7WA 2NXQA 1EG4A 2KI4C 2LLUA 2LC5A 3TZ1A 3PATA 3CR2A 1J7QA 1SR6B 3VRPA 2Y4QA 3I5GC 4PE7A 4GGFA 4BY5A 1B8CA 1NX0A 3PFVA 3KEVA 5CSJA 1K94A 3I5HC 4N1GA 3VRRA 1CMGA 1QXPA 4MBEA 3GK4X 4YGBB 4PDZA 1WLMA 1XFUO 4ORCB 3SIAA 3F45A 5HKWA 1CFCA 1B7TY 2JQ6A 1KK8B 3IQOA 1LINA 1S36A 2D8NA 2K0JA 2VRGA 1RROA 1S1EA 2L2EA 4PHKA 2FCEA 5J3XA 2O60A 2K7BA 3WNXB 1CLBA 1DJIA 2B1UA 2O5GA 4ORAB 4PE0A 2K2FA 1OE9B 3SG3A 3LLEA 1B4CA 1M63B 3OX6A 4MSPA 3D0YA 1XYDA 2ZN9A 3SG2A 5D69A 1DT7B 1DJWA 1L2OC 4CPVA 2NCPA 5IBWA 3BQ3A 1RECA 1TIZA 1EL4A 2BECA 2G9BA 1BR1B 1BOCA 1QS7A 1QVIZ 3KPXA 4AQJA 2M9GA 1YURA 3CLNA 3O6BA 1YUUA 1PVBA 1BJFA 1BU3A 2JTZA 1K2HA 1CDLA 3PSRA 5HKZA 2MHHA 1GGWA 1ZMZA 3BXKA 2BBNA 4JPZB 2KGRA 2L50A 1FW4A 2OTGB 2JNXA 1WRKA 3WHTB 2JRFA 2NLNA 1WY9A 2Y1MA 1BG1A 1LA0A 1KFXL 1B8RA 1LA3A 3ZNIA 4MZKA 1S3PA 1SRAA 2BCXA 4BY4A 1EH2A 1CNPA 3FIAA 4GBAA 3OHMB 1J55A 2SCPA 3HX4A 1WRZA 2M29A 4U8DA 2OPOA 2JC2A 2K8MB 3VRNA 1N2DA 5HYDA 3VROA 3CWGA 3GK1A 4GGFC 1KWOC 2KAYA 5AXIA 1KSMA 2M3WA 4QJ5B 1S26D 3BUMB 1YX7A 1KFXS 1QIVA 3OX5A 3PN7C 4ORBB 3TDUA 2AMIA 2LE9B 1JC2A 2F3ZA 1C7VA 4PHMA 2FJUB 2MBXA 5B8IB 4WQ3A 4GPLB 5I2QA 1IGVA 4MN0A 2FOTA 2JTTA 3DVMA 5CPVA 1K93D 1SNLA 1TNQA 2A4JA 2TN4A 3PALA 4I5KA 3QRXA 2MA2A 3LCPC 2E30A 3A4UB 3H4SE 3I5FC 1AUIB 1QVIY 1TNPA 4FTGA 2DOQA 2Q91A 4C0JA 1UUSA 2MLFC 1KK7Z 3KF9A 5HKYA 1YTZC 1J7PA 2ZN8A 1QLKA 3EK4A 5AANA 1NX2A 3FS7A 1A2XA 1S5GZ 3O78A 1K9KA 4OR9B 1YVHA 3ICBA 1MF8B 3CGAA 1JSAA 1R2UA 5D7FA 2HQ8A 2PVBA 1ODBA 3AAKA 3CS1A 5G08A 1LVCD 1WDCC 1FF1A 1K9UA 1K96A 2CNPA 1YUSA 1LKJA 1B8LA 1XFXO 1OOJA 4DUQA 4YBHB 1AP4A 2L0PA 2BCAA 1SR6C 1JWDA 2SASA 1GQMA 5JOLA 1TTXA 1CTRA 1AK8A 1QX2A 1TCOB 1SPYA 1YRUB 2M97A 4C0LA 5KU1A 3DVKA 1DMOA 5TNCA 1A75B 2KOTA 1K9PA 2JULA 4YGCB 2KFFA 2KYCA 4HSZA 2LP2A 4OCIA 1NX3A 1KK8C 1X02A 1NYAA 2LHLA 1DF0B 1QTXA 1B9AA 4DCKA 2WOSA 1KFUL 3BOWA 4ZCUA 1UHKA 4NDDA 1AVSA 4CFQA 1KSOA 1KCYA 2MRDA 3OP0A 2OS8B 1M45A 1ZOTB 1TNWA 2CXJA 1XO5A 1KK7Y 1PSBA 1XFYO 1DJHA 1HT9A 2JPTA 2CTNA 1YVLA 4ZCVA 1S5GY 2LVKA 2LVIA 2PASA 1CDPA 5AERA 1E8AA 1KFUS 2LUXA 4DS7A 1W7JB 1CDMA 1SL9A 2PMYA 4GGNA 4GNKB 1A4PA 4A4CA 1TN4A 2GV5A 2EHBA 3GOFA 1OZOA 1EG3A 4MZLA 3BYAA 2KHNA 1YUTA 1HQVA 1RFJA 2JWWA 4MLWA 2OTGC 4I5JA 2JXCA 1U5IB 1OQPA 1IJ6A 2F2PA 2ZNEA 4N1FA 2HPSA 2JNFA 2WC8A 1NUBA 1S6CA 1QATA 1YX8A 1AHRA 3EK8A 1JBAA 1XFZO 2I7AA 2JT8A 1FPWA 2LNKA 4I5NB 3K21A 2I94A 4P5OE 5FYXA 4JQ0D 1C07A 2WORA 1DJYA 1A75A 1SW8A 1MQ1A 2PSRA 1JUOA 1H4BA 1TOPA 1Y1XA 2RGIA 1PULA 2L4IA 1BT6A 1OMDA 2E6WA 1MXLC 1CKKA 3EKHA 2CT9A 2ZKMX 1DJXA 1NIWA 2LLSA 2K7CA 4YGAA 3WXAA 3OB2B 3M0WA 2MAZA 3IQQA 2NCOA 4AOMA 3CR5X 3JVTB 1JFKA 3LK0A 2MLEC 1KQMC 4FQOA 1PALA 5GQQC 1J1EA 1BLQA 3TUYB 1DJZA 1RWYA 2K7DA 3BUWB 1ALVA 1WLZA 1Y0VH 1UHNA 2LP3A 1UHJA 4MRXA 1SCMB 2JT0A 5DKQA 1J7RA 4WQ2A 2GGMA 1KQMB 3FWCA 4YI8A 1IQ5A 2FCDA 3PM8A 1BR4B 1Y1UA 1NSHA 1MXEA 1ZFSA 2LANA 3IF7A 1IKUA 2P6BB 3DVJA 1OMVA 1ZACA 2H61C 1BF5A 2F3YA 4DIRA 4OKHA 4TNCA 1G4YR 3JTDB 4M2QA 3SJSA 3AKBA 4GUKA 4XJKB 2ZRSA 1F54A 5DKRA 1FBVA 1UHHA 2QACA 2Q4UA 1YRTB 1Y6WA 2KQ6A 2LMUA 3PLFB 1AJ5A 5DKNA 2JXLA 1CM4A 2GGZA 1NPQA 3EK7A 4CIDA 1K8UA 2ZRTA 1EJ3A 4MZJA 1F4OA 2KI6D 4OVNF 2NZ0A 2KBIA 3E3RA 1B1GA 1DTLA 2JZIA 1PSRA 5I8NA 1QLSA 3EVVA 1CFFA 3CZTX 1L7ZA 1BODA 4YGDB 1QV0A 1XFVO 1SMGA 2KQYA 1F70A 1N0YA 1ZUZA 2F8PA 2WCFA 4D1EA 2I18A 1QX7A 1H8BA 2HF5A 1IRJA 1SYMA 2LMTA 2COLB 2M7LA 2K7OA 2LUCA 3WHUB 3ZWHA 1QIWA 3D0YB 4AQIA 1SBJA 5AFPA 1RJVA 1QX5B 1SY9A 2KGBC 3I5IB 1IJ5A 2LVVA 1NP8A 2OS8C 5K89A 1TCFA 2LHIA 2WCEA 4ICBA 3DF0B 2L51A 3NSLA 4NDBA 2BCBA 1IH0A 2LAPA 3BUNB 4MEWA 1RK9A 3DVEA 4MVFA 3VRQA 1QV1A 2WCBA 1OMRA 1K95A 1QJTA 1UWOA 2BL0B 2LVJA 1G33A 1DJGA 4PE4A 4YRUA 2KSPA 3EVRA 2EC6B 2H61A 1NCZA 5CSNA 1M31A 1DGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GK2 A;  1TNX A;  4XYN A;  4JWQ A;  1V1F A;  1PVA A;  1VRK A;  4GFT A;  4A4B A;  2F33 A;  4DRW A;  3NSK A;  2KAX A;  2M49 B;  1KQV A;  2KI4 B;  4R1E A;  1M39 A;  2BKH B;  3CR4 X;  3RM1 A;  5BPJ A;  1OSA A;  3I5G B;  3KHE A;  1PK0 D;  4P2Y B;  2CBL A;  2Y1N A;  4USL A;  4E68 A;  4YI9 A;  2G2B A;  2L4H A;  1CFD A;  3SG4 A;  1S6J A;  1W7I B;  2LCP A;  2ZND A;  1CFP A;  3I5H B;  5CSI A;  1XK4 A;  2JOJ A;  3AAJ A;  4PE1 A;  3BUO B;  2L98 A;  4PHJ A;  2KNE A;  5ER4 X;  4PCW A;  4QJ3 B;  4M2P A;  1JFJ A;  1A03 A;  3BUX B;  1Q80 A;  5I2L A;  1FI5 A;  3JVT C;  2ZFD A;  1DF0 A;  2BKI B;  5KSZ A;  4M2O A;  3DF0 A;  3TUY C;  5F6T A;  4PAL A;  1Y1A A;  1CB1 A;  3HCM A;  4WRI A;  1JF2 A;  4YGE B;  5AEQ A;  2KI6 C;  1BMO A;  3DD4 A;  3SG5 A;  2R2I A;  1SCM C;  2KYF A;  4OV2 A;  2PAL A;  1FI6 A;  1F4Q A;  1L2O B;  2K61 A;  2M1K B;  4PHN A;  2K2A A;  4F0Z B;  3MSE B;  1PRW A;  2JT3 A;  1OZS A;  2L5X B;  4ETO A;  4IL1 A;  3NSO A;  1NCX A;  4C0K A;  2LLT A;  2M0R A;  2H2K A;  1SKT A;  3O4Y A;  5CSF A;  4I5L B;  1WRL A;  3JTD C;  5ER5 A;  1GGZ A;  1NX1 A;  3NXA A;  4HRH A;  2LV7 A;  5I2O A;  1NCY A;  3SIB A;  2I2R E;  2HET A;  3LK1 A;  3D10 A;  5PAL A;  2ISD A;  1CM1 A;  2KFG A;  1YR5 A;  1GJY A;  2M7N A;  2BE4 A;  4NQG A;  1J1D A;  2AAO A;  3SG7 A;  3AKA A;  5HLV A;  2M1U A;  1K90 D;  1U5I A;  1UHI A;  1IWQ A;  4Q04 A;  4L9M A;  3C1V A;  3LL8 B;  2MJW B;  2QPT A;  2LMV A;  1KWO B;  1XFW O;  1RTP 1;  1ALW A;  1UP5 A;  1MWN A;  3BOW B;  1R6P A;  2CCM A;  4QJ4 B;  2KBM A;  1MR8 A;  1XK4 C;  2KAV A;  3TS5 C;  2M8U A;  2HQW A;  1SCV A;  3PN7 B;  1CDN A;  1B7T Z;  1MUX A;  3O2P A;  1EXR A;  5JJG A;  1SL8 A;  3EKJ A;  4HRG A;  2BBM A;  3FWB A;  4NDC A;  3TDZ A;  2AUC A;  3A8R A;  3CTN A;  1D1O A;  1V1G A;  3I5I C;  3KO0 A;  2PRU A;  2EGD A;  1CLL A;  4HRE E;  3TS5 B;  4CFR A;  1CLM A;  1JF0 A;  1F55 A;  1NWD A;  1XA5 A;  2LM5 A;  5KTY A;  3I5F B;  1F8H A;  1J7O A;  1G8I A;  4N5X A;  1XVJ A;  1MHO A;  1UUR A;  1IQ3 A;  1SL7 A;  1IG5 A;  1DGU A;  2KFH A;  4CLN A;  2BE6 A;  1M46 A;  3EVU A;  1SK6 D;  2KDH A;  1DVI A;  2BL0 C;  3OB1 B;  2V53 A;  2WND A;  1QAS A;  1F71 A;  3VGO A;  2EC6 C;  2JU0 A;  2Y5I A;  1A29 A;  1CMF A;  4MRY A;  1B47 A;  4XJK A;  1WDC B;  5HLO A;  2IS9 A;  3RLZ A;  3TDI A;  1LXF C;  1TRF A;  4GAO A;  3SG6 A;  1N65 A;  1AJ4 A;  2F2O A;  1S6I A;  4UPG A;  3NSI A;  1C7W A;  2NXQ A;  1EG4 A;  2KI4 C;  2LLU A;  2LC5 A;  3TZ1 A;  3PAT A;  3CR2 A;  1J7Q A;  1SR6 B;  3VRP A;  2Y4Q A;  3I5G C;  4PE7 A;  4GGF A;  4BY5 A;  1B8C A;  1NX0 A;  3PFV A;  3KEV A;  5CSJ A;  1K94 A;  3I5H C;  4N1G A;  3VRR A;  1CMG A;  1QXP A;  4MBE A;  3GK4 X;  4YGB B;  4PDZ A;  1WLM A;  1XFU O;  4ORC B;  3SIA A;  3F45 A;  5HKW A;  1CFC A;  1B7T Y;  2JQ6 A;  1KK8 B;  3IQO A;  1LIN A;  1S36 A;  2D8N A;  2K0J A;  2VRG A;  1RRO A;  1S1E A;  2L2E A;  4PHK A;  2FCE A;  5J3X A;  2O60 A;  2K7B A;  3WNX B;  1CLB A;  1DJI A;  2B1U A;  2O5G A;  4ORA B;  4PE0 A;  2K2F A;  1OE9 B;  3SG3 A;  3LLE A;  1B4C A;  1M63 B;  3OX6 A;  4MSP A;  3D0Y A;  1XYD A;  2ZN9 A;  3SG2 A;  5D69 A;  1DT7 B;  1DJW A;  1L2O C;  4CPV A;  2NCP A;  5IBW A;  3BQ3 A;  1REC A;  1TIZ A;  1EL4 A;  2BEC A;  2G9B A;  1BR1 B;  1BOC A;  1QS7 A;  1QVI Z;  3KPX A;  4AQJ A;  2M9G A;  1YUR A;  3CLN A;  3O6B A;  1YUU A;  1PVB A;  1BJF A;  1BU3 A;  2JTZ A;  1K2H A;  1CDL A;  3PSR A;  5HKZ A;  2MHH A;  1GGW A;  1ZMZ A;  3BXK A;  2BBN A;  4JPZ B;  2KGR A;  2L50 A;  1FW4 A;  2OTG B;  2JNX A;  1WRK A;  3WHT B;  2JRF A;  2NLN A;  1WY9 A;  2Y1M A;  1BG1 A;  1LA0 A;  1KFX L;  1B8R A;  1LA3 A;  3ZNI A;  4MZK A;  1S3P A;  1SRA A;  2BCX A;  4BY4 A;  1EH2 A;  1CNP A;  3FIA A;  4GBA A;  3OHM B;  1J55 A;  2SCP A;  3HX4 A;  1WRZ A;  2M29 A;  4U8D A;  2OPO A;  2JC2 A;  2K8M B;  3VRN A;  1N2D A;  5HYD A;  3VRO A;  3CWG A;  3GK1 A;  4GGF C;  1KWO C;  2KAY A;  5AXI A;  1KSM A;  2M3W A;  4QJ5 B;  1S26 D;  3BUM B;  1YX7 A;  1KFX S;  1QIV A;  3OX5 A;  3PN7 C;  4ORB B;  3TDU A;  2AMI A;  2LE9 B;  1JC2 A;  2F3Z A;  1C7V A;  4PHM A;  2FJU B;  2MBX A;  5B8I B;  4WQ3 A;  4GPL B;  5I2Q A;  1IGV A;  4MN0 A;  2FOT A;  2JTT A;  3DVM A;  5CPV A;  1K93 D;  1SNL A;  1TNQ A;  2A4J A;  2TN4 A;  3PAL A;  4I5K A;  3QRX A;  2MA2 A;  3LCP C;  2E30 A;  3A4U B;  3H4S E;  3I5F C;  1AUI B;  1QVI Y;  1TNP A;  4FTG A;  2DOQ A;  2Q91 A;  4C0J A;  1UUS A;  2MLF C;  1KK7 Z;  3KF9 A;  5HKY A;  1YTZ C;  1J7P A;  2ZN8 A;  1QLK A;  3EK4 A;  5AAN A;  1NX2 A;  3FS7 A;  1A2X A;  1S5G Z;  3O78 A;  1K9K A;  4OR9 B;  1YVH A;  3ICB A;  1MF8 B;  3CGA A;  1JSA A;  1R2U A;  5D7F A;  2HQ8 A;  2PVB A;  1ODB A;  3AAK A;  3CS1 A;  5G08 A;  1LVC D;  1WDC C;  1FF1 A;  1K9U A;  1K96 A;  2CNP A;  1YUS A;  1LKJ A;  1B8L A;  1XFX O;  1OOJ A;  4DUQ A;  4YBH B;  1AP4 A;  2L0P A;  2BCA A;  1SR6 C;  1JWD A;  2SAS A;  1GQM A;  5JOL A;  1TTX A;  1CTR A;  1AK8 A;  1QX2 A;  1TCO B;  1SPY A;  1YRU B;  2M97 A;  4C0L A;  5KU1 A;  3DVK A;  1DMO A;  5TNC A;  1A75 B;  2KOT A;  1K9P A;  2JUL A;  4YGC B;  2KFF A;  2KYC A;  4HSZ A;  2LP2 A;  4OCI A;  1NX3 A;  1KK8 C;  1X02 A;  1NYA A;  2LHL A;  1DF0 B;  1QTX A;  1B9A A;  4DCK A;  2WOS A;  1KFU L;  3BOW A;  4ZCU A;  1UHK A;  4NDD A;  1AVS A;  4CFQ A;  1KSO A;  1KCY A;  2MRD A;  3OP0 A;  2OS8 B;  1M45 A;  1ZOT B;  1TNW A;  2CXJ A;  1XO5 A;  1KK7 Y;  1PSB A;  1XFY O;  1DJH A;  1HT9 A;  2JPT A;  2CTN A;  1YVL A;  4ZCV A;  1S5G Y;  2LVK A;  2LVI A;  2PAS A;  1CDP A;  5AER A;  1E8A A;  1KFU S;  2LUX A;  4DS7 A;  1W7J B;  1CDM A;  1SL9 A;  2PMY A;  4GGN A;  4GNK B;  1A4P A;  4A4C A;  1TN4 A;  2GV5 A;  2EHB A;  3GOF A;  1OZO A;  1EG3 A;  4MZL A;  3BYA A;  2KHN A;  1YUT A;  1HQV A;  1RFJ A;  2JWW A;  4MLW A;  2OTG C;  4I5J A;  2JXC A;  1U5I B;  1OQP A;  1IJ6 A;  2F2P A;  2ZNE A;  4N1F A;  2HPS A;  2JNF A;  2WC8 A;  1NUB A;  1S6C A;  1QAT A;  1YX8 A;  1AHR A;  3EK8 A;  1JBA A;  1XFZ O;  2I7A A;  2JT8 A;  1FPW A;  2LNK A;  4I5N B;  3K21 A;  2I94 A;  4P5O E;  5FYX A;  4JQ0 D;  1C07 A;  2WOR A;  1DJY A;  1A75 A;  1SW8 A;  1MQ1 A;  2PSR A;  1JUO A;  1H4B A;  1TOP A;  1Y1X A;  2RGI A;  1PUL A;  2L4I A;  1BT6 A;  1OMD A;  2E6W A;  1MXL C;  1CKK A;  3EKH A;  2CT9 A;  2ZKM X;  1DJX A;  1NIW A;  2LLS A;  2K7C A;  4YGA A;  3WXA A;  3OB2 B;  3M0W A;  2MAZ A;  3IQQ A;  2NCO A;  4AOM A;  3CR5 X;  3JVT B;  1JFK A;  3LK0 A;  2MLE C;  1KQM C;  4FQO A;  1PAL A;  5GQQ C;  1J1E A;  1BLQ A;  3TUY B;  1DJZ A;  1RWY A;  2K7D A;  3BUW B;  1ALV A;  1WLZ A;  1Y0V H;  1UHN A;  2LP3 A;  1UHJ A;  4MRX A;  1SCM B;  2JT0 A;  5DKQ A;  1J7R A;  4WQ2 A;  2GGM A;  1KQM B;  3FWC A;  4YI8 A;  1IQ5 A;  2FCD A;  3PM8 A;  1BR4 B;  1Y1U A;  1NSH A;  1MXE A;  1ZFS A;  2LAN A;  3IF7 A;  1IKU A;  2P6B B;  3DVJ A;  1OMV A;  1ZAC A;  2H61 C;  1BF5 A;  2F3Y A;  4DIR A;  4OKH A;  4TNC A;  1G4Y R;  3JTD B;  4M2Q A;  3SJS A;  3AKB A;  4GUK A;  4XJK B;  2ZRS A;  1F54 A;  5DKR A;  1FBV A;  1UHH A;  2QAC A;  2Q4U A;  1YRT B;  1Y6W A;  2KQ6 A;  2LMU A;  3PLF B;  1AJ5 A;  5DKN A;  2JXL A;  1CM4 A;  2GGZ A;  1NPQ A;  3EK7 A;  4CID A;  1K8U A;  2ZRT A;  1EJ3 A;  4MZJ A;  1F4O A;  2KI6 D;  4OVN F;  2NZ0 A;  2KBI A;  3E3R A;  1B1G A;  1DTL A;  2JZI A;  1PSR A;  5I8N A;  1QLS A;  3EVV A;  1CFF A;  3CZT X;  1L7Z A;  1BOD A;  4YGD B;  1QV0 A;  1XFV O;  1SMG A;  2KQY A;  1F70 A;  1N0Y A;  1ZUZ A;  2F8P A;  2WCF A;  4D1E A;  2I18 A;  1QX7 A;  1H8B A;  2HF5 A;  1IRJ A;  1SYM A;  2LMT A;  2COL B;  2M7L A;  2K7O A;  2LUC A;  3WHU B;  3ZWH A;  1QIW A;  3D0Y B;  4AQI A;  1SBJ A;  5AFP A;  1RJV A;  1QX5 B;  1SY9 A;  2KGB C;  3I5I B;  1IJ5 A;  2LVV A;  1NP8 A;  2OS8 C;  5K89 A;  1TCF A;  2LHI A;  2WCE A;  4ICB A;  3DF0 B;  2L51 A;  3NSL A;  4NDB A;  2BCB A;  1IH0 A;  2LAP A;  3BUN B;  4MEW A;  1RK9 A;  3DVE A;  4MVF A;  3VRQ A;  1QV1 A;  2WCB A;  1OMR A;  1K95 A;  1QJT A;  1UWO A;  2BL0 B;  2LVJ A;  1G33 A;  1DJG A;  4PE4 A;  4YRU A;  2KSP A;  3EVR A;  2EC6 B;  2H61 A;  1NCZ A;  5CSN A;  1M31 A;  1DGV A; 
#chains in the Genus database with same CATH topology
 3GK2 A;  1TNX A;  4XYN A;  4JWQ A;  1V1F A;  1PVA A;  1VRK A;  4GFT A;  4A4B A;  2F33 A;  4DRW A;  3NSK A;  2KAX A;  3DZT A;  2M49 B;  1KQV A;  2KI4 B;  4R1E A;  2WC6 A;  1M39 A;  2BKH B;  3CR4 X;  3RM1 A;  5BPJ A;  1OSA A;  3I5G B;  3KHE A;  1PK0 D;  4P2Y B;  2CBL A;  2Y1N A;  4USL A;  4E68 A;  4YI9 A;  2G2B A;  2L4H A;  1CFD A;  3SG4 A;  1S6J A;  1W7I B;  2LCP A;  3L4L A;  2ZND A;  1CFP A;  3I5H B;  5CSI A;  1XK4 A;  3CZ2 A;  2JOJ A;  3AAJ A;  4PE1 A;  3BUO B;  2L98 A;  4PHJ A;  2KNE A;  5ER4 X;  4PCW A;  4QJ3 B;  4M2P A;  3CZ0 A;  1JFJ A;  1A03 A;  3BUX B;  1Q80 A;  5I2L A;  3RZS A;  3Q8I A;  1FI5 A;  3JVT C;  2ZFD A;  5FI7 A;  1DF0 A;  2BKI B;  5KSZ A;  4M2O A;  3DF0 A;  3TUY C;  5F6T A;  4PAL A;  1Y1A A;  1CB1 A;  3HCM A;  4WRI A;  1JF2 A;  4YGE B;  5AEQ A;  2KI6 C;  1BMO A;  3DD4 A;  4OZD A;  3SG5 A;  2R2I A;  1SCM C;  5D3O A;  2KYF A;  4OV2 A;  2PAL A;  1FI6 A;  1F4Q A;  1L2O B;  2K61 A;  2M1K B;  4PHN A;  2K2A A;  4F0Z B;  3MSE B;  1PRW A;  3CZ1 A;  2JT3 A;  1OZS A;  2L5X B;  4ETO A;  4IL1 A;  3NSO A;  1NCX A;  4C0K A;  2LLT A;  2M0R A;  2H2K A;  1SKT A;  3O4Y A;  2QEO A;  5FI6 A;  5CSF A;  4I5L B;  1WRL A;  3JTD C;  5ER5 A;  1GGZ A;  1NX1 A;  3NXA A;  4HRH A;  2LV7 A;  5I2O A;  1NCY A;  1TUJ A;  3SIB A;  2I2R E;  2HET A;  3LK1 A;  3D10 A;  5PAL A;  2ISD A;  1CM1 A;  2KFG A;  1YR5 A;  1GJY A;  2M7N A;  3D78 A;  2BE4 A;  3NHT A;  4NQG A;  1J1D A;  2AAO A;  2WCL A;  3SG7 A;  3AKA A;  3VB1 A;  5HLV A;  2M1U A;  1K90 D;  1U5I A;  1UHI A;  1IWQ A;  4Q04 A;  4L9M A;  3C1V A;  3LL8 B;  2MJW B;  2QPT A;  3O4X A;  2LMV A;  1KWO B;  1XFW O;  1RTP 1;  1ALW A;  1UP5 A;  1MWN A;  3BOW B;  3L47 A;  1R6P A;  2CCM A;  4QJ4 B;  2KBM A;  1MR8 A;  1XK4 C;  2KAV A;  3TS5 C;  3K1E A;  2L5Y A;  2M8U A;  2HQW A;  1SCV A;  1OOF A;  3PN7 B;  1CDN A;  1B7T Z;  2GTE A;  1MUX A;  3O2P A;  1EXR A;  5JJG A;  1SL8 A;  3EKJ A;  4HRG A;  2BBM A;  3FWB A;  4NDC A;  3TDZ A;  2AUC A;  3A8R A;  3CTN A;  1D1O A;  1V1G A;  3I5I C;  3KO0 A;  5HL1 A;  2PRU A;  2EGD A;  1CLL A;  4HRE E;  3TS5 B;  4CFR A;  1CLM A;  1JF0 A;  3R1V A;  1F55 A;  3DXL A;  1NWD A;  1XA5 A;  2LM5 A;  3B87 A;  3PJI A;  3I5F B;  5KTY A;  1F8H A;  1J7O A;  1G8I A;  4N5X A;  3S0F A;  1XVJ A;  1MHO A;  1UUR A;  1DEK A;  1SL7 A;  1IQ3 A;  1IG5 A;  1DGU A;  2KFH A;  4CLN A;  2BE6 A;  1M46 A;  3EVU A;  1SK6 D;  3B88 A;  2H8V A;  1DVI A;  2KDH A;  2BL0 C;  2P70 A;  2WCJ A;  3OB1 B;  3QME A;  2V53 A;  2WND A;  1QAS A;  1W9Z A;  1F71 A;  2P71 A;  3VGO A;  2EC6 C;  2JU0 A;  2L2C A;  1A29 A;  2Y5I A;  1CMF A;  3FE9 A;  4MRY A;  3SS4 A;  1B47 A;  4XJK A;  1WDC B;  5HLO A;  2IS9 A;  3RLZ A;  3TDI A;  1LXF C;  1TRF A;  4GAO A;  3SG6 A;  3SS5 A;  1N65 A;  1AJ4 A;  2F2O A;  1S6I A;  4UPG A;  4KYN A;  1C3Z A;  3NSI A;  1C7W A;  2NXQ A;  1EG4 A;  2KI4 C;  2LLU A;  2LC5 A;  3TZ1 A;  3PAT A;  3CR2 A;  1J7Q A;  1SR6 B;  3VRP A;  1OOG A;  2Y4Q A;  3D77 A;  3I5G C;  4PE7 A;  4GGF A;  3B86 A;  1B8C A;  1NX0 A;  3PFV A;  4BY5 A;  2WCK A;  3KEV A;  5CSJ A;  3L4A A;  1K94 A;  3I5H C;  4N1G A;  3VRR A;  1CMG A;  1P28 A;  1QXP A;  4MBE A;  3GK4 X;  4YGB B;  4PDZ A;  1WLM A;  1XFU O;  4ORC B;  3SIA A;  3F45 A;  5HKW A;  1CFC A;  1B7T Y;  2JQ6 A;  1KK8 B;  3IQO A;  1LIN A;  1S36 A;  2D8N A;  2K0J A;  1T14 A;  2VRG A;  1RRO A;  1S1E A;  2L2E A;  4PHK A;  2FCE A;  5J3X A;  2O60 A;  2K7B A;  3WNX B;  1CLB A;  1DJI A;  2ERB A;  2B1U A;  2O5G A;  2BNX A;  4ORA B;  4PE0 A;  2K2F A;  3OBV A;  1OE9 B;  3SG3 A;  3LLE A;  1B4C A;  1M63 B;  3OX6 A;  3CDN A;  1QWV A;  4MSP A;  3D0Y A;  1XYD A;  4JD9 A;  2ZN9 A;  1ORG A;  3SG2 A;  5D69 A;  1DT7 B;  1DJW A;  2QEB A;  1L2O C;  4CPV A;  2NCP A;  5IBW A;  3BQ3 A;  1REC A;  1TIZ A;  1EL4 A;  2BEC A;  2G9B A;  1BR1 B;  3NHI A;  1QS7 A;  1BOC A;  1QVI Z;  3KPX A;  4AQJ A;  2M9G A;  1YUR A;  3CLN A;  3O6B A;  1YUU A;  1PVB A;  1BJF A;  3UO9 A;  1BU3 A;  2JTZ A;  1K2H A;  1CDL A;  3PSR A;  5HKZ A;  2MHH A;  1GGW A;  1ZMZ A;  3BXK A;  2BBN A;  3BJH A;  1Z4H A;  4IJ7 A;  2KGR A;  2L50 A;  4JPZ B;  2JPO A;  1FW4 A;  2OTG B;  2JNX A;  1WRK A;  3WHT B;  2JRF A;  2NLN A;  1WY9 A;  3NGV A;  2Y1M A;  1BG1 A;  1LA0 A;  1KFX L;  1B8R A;  1LA3 A;  3ZNI A;  4MZK A;  1S3P A;  1SRA A;  2BCX A;  4BY4 A;  1EH2 A;  1CNP A;  3FIA A;  4GBA A;  3OHM B;  3R1O A;  3S0E A;  1J55 A;  1OW4 A;  2SCP A;  3HX4 A;  1WRZ A;  2M29 A;  4U8D A;  2OPO A;  4F7F A;  2JC2 A;  2K8M B;  3VRN A;  1N2D A;  5HYD A;  3VRO A;  3CWG A;  3GK1 A;  4GGF C;  1KWO C;  2KAY A;  4JKT A;  5AXI A;  1KSM A;  2M3W A;  4QJ5 B;  1S26 D;  3BUM B;  2BAP A;  1YX7 A;  1KFX S;  1QIV A;  3OX5 A;  3PN7 C;  4ORB B;  3TDU A;  2AMI A;  2LE9 B;  1JC2 A;  2F3Z A;  3FE6 A;  1C7V A;  4PHM A;  2FJU B;  2MBX A;  5B8I B;  3S0G A;  4WQ3 A;  4GPL B;  5I2Q A;  1IGV A;  4MN0 A;  4PT1 A;  2FOT A;  2JTT A;  3DVM A;  5CPV A;  1DC1 A;  1K93 D;  1SNL A;  1TNQ A;  2A4J A;  2TN4 A;  3PAL A;  4I5K A;  2KLD A;  3QRX A;  2K60 A;  2MA2 A;  3LCP C;  2E30 A;  3A4U B;  3H4S E;  2FJY A;  1IIO A;  3I5F C;  1AUI B;  1QVI Y;  1TNP A;  1XFR A;  4FTG A;  2DOQ A;  2Q91 A;  4C0J A;  1UUS A;  2MLF C;  1KK7 Z;  3KF9 A;  5HKY A;  1YTZ C;  1J7P A;  2ZN8 A;  1QLK A;  3EK4 A;  2WCH A;  5AAN A;  5I94 A;  1NX2 A;  3FS7 A;  1A2X A;  1S5G Z;  3O78 A;  1K9K A;  4OR9 B;  1TWO A;  1YVH A;  2QEV A;  3ICB A;  1MF8 B;  3CGA A;  1JSA A;  1R2U A;  5D7F A;  2HQ8 A;  2PVB A;  1ODB A;  3AAK A;  3S0A A;  3CS1 A;  5G08 A;  1LVC D;  1WDC C;  1FF1 A;  3S0B A;  1K9U A;  3OGN A;  1K96 A;  2CNP A;  1YUS A;  1LKJ A;  1B8L A;  1XFX O;  1OOJ A;  4DUQ A;  3CAB A;  4YBH B;  1AP4 A;  3PM2 A;  2L0P A;  2BCA A;  1SR6 C;  1DQE A;  1JWD A;  2SAS A;  1GQM A;  5JOL A;  1TTX A;  1CTR A;  1AK8 A;  1QX2 A;  1TCO B;  1SPY A;  1YRU B;  2M97 A;  4C0L A;  5KU1 A;  3DVK A;  1DMO A;  5TNC A;  1A75 B;  2KOT A;  1K9P A;  2JUL A;  4YGC B;  2KFF A;  2KYC A;  1LS8 A;  4HSZ A;  2LP2 A;  4OCI A;  1NX3 A;  1KK8 C;  1X02 A;  1NYA A;  2LHL A;  1DF0 B;  1QTX A;  1B9A A;  4DCK A;  2WOS A;  1KFU L;  3BOW A;  4ZCU A;  1UHK A;  4NDD A;  1AVS A;  2WCM A;  4CFQ A;  1KSO A;  1KCY A;  2MRD A;  3OP0 A;  2OS8 B;  1M45 A;  1ZOT B;  1TNW A;  1SSE B;  3B7A A;  2CXJ A;  3DY9 A;  1XO5 A;  1KK7 Y;  1PSB A;  3D73 A;  1XFY O;  1DEL A;  1DJH A;  1HT9 A;  2JPT A;  2CTN A;  5DIC A;  1YVL A;  4INW A;  4ZCV A;  1S5G Y;  2KLE A;  2LVI A;  2LVK A;  3N7H A;  2PAS A;  1CDP A;  5AER A;  1E8A A;  1KFU S;  2LUX A;  4DS7 A;  1W7J B;  1CDM A;  1SL9 A;  2PMY A;  4GGN A;  4GNK B;  1A4P A;  4A4C A;  1TN4 A;  2GV5 A;  2EHB A;  3CYZ A;  3GOF A;  1OZO A;  1EG3 A;  4MZL A;  5EL2 A;  3BYA A;  2KHN A;  2KPH A;  1YUT A;  1HQV A;  1RFJ A;  2JWW A;  4MLW A;  2OTG C;  4I5J A;  2JXC A;  1U5I B;  3BFB A;  1OQP A;  1IJ6 A;  2F2P A;  2ZNE A;  4N1F A;  2HPS A;  2JNF A;  2WC8 A;  1NUB A;  1S6C A;  1QAT A;  1YX8 A;  1AHR A;  3EK8 A;  1JBA A;  1XFZ O;  2I7A A;  2JT8 A;  1FPW A;  2LNK A;  4I5N B;  3K21 A;  2I94 A;  4P5O E;  5FYX A;  4JQ0 D;  1C07 A;  2WOR A;  1DJY A;  1A75 A;  1SW8 A;  1MQ1 A;  2PSR A;  3EG5 B;  1JUO A;  1H4B A;  1TOP A;  1Y1X A;  2RGI A;  1PUL A;  2L4I A;  4INX A;  1BT6 A;  1OMD A;  2E6W A;  1MXL C;  3DYE A;  1CKK A;  3EKH A;  2CT9 A;  2ZKM X;  1DJX A;  1NIW A;  2LLS A;  2K7C A;  4YGA A;  3WXA A;  3OB2 B;  3M0W A;  2MAZ A;  3FE8 A;  3IQQ A;  2NCO A;  4AOM A;  3CR5 X;  3R72 A;  3JVT B;  1JFK A;  3LK0 A;  2MLE C;  2QDI A;  1KQM C;  4FQO A;  1PAL A;  5GQQ C;  1J1E A;  1BLQ A;  3TUY B;  1DJZ A;  1RWY A;  2K7D A;  3BUW B;  1ALV A;  1WLZ A;  1Y0V H;  3D76 A;  1UHN A;  2LP3 A;  1UHJ A;  4MRX A;  1SCM B;  2JT0 A;  5DKQ A;  1J7R A;  4WQ2 A;  2GGM A;  1KQM B;  3FWC A;  4YI8 A;  1IQ5 A;  2FCD A;  3PM8 A;  1BR4 B;  1Y1U A;  1NSH A;  1MXE A;  1ZFS A;  2LAN A;  3IF7 A;  1IKU A;  2P6B B;  3DVJ A;  1OMV A;  1ZAC A;  2H61 C;  1BF5 A;  2F3Y A;  4DIR A;  4OKH A;  4TNC A;  1G4Y R;  3JTD B;  4M2Q A;  3SJS A;  3AKB A;  4GUK A;  4XJK B;  3UNW A;  2ZRS A;  2QEH A;  5DKR A;  1TUZ A;  1F54 A;  1FBV A;  3S0D A;  1UHH A;  3D74 A;  2QAC A;  3R1P A;  2Q4U A;  1GM0 A;  1YRT B;  1Y6W A;  2YGU A;  2KQ6 A;  2LMU A;  4FQT A;  3PLF B;  1AJ5 A;  5DKN A;  2JXL A;  1CM4 A;  2GGZ A;  1NPQ A;  3EK7 A;  4CID A;  1K8U A;  2ZRT A;  1EJ3 A;  4MZJ A;  1F4O A;  2KI6 D;  5FI2 A;  4OVN F;  2PQL A;  2NZ0 A;  2KBI A;  3E3R A;  1B1G A;  3BFA A;  1DTL A;  2JZI A;  1PSR A;  5I8N A;  1QLS A;  3EVV A;  1CFF A;  3CZT X;  1C3Y A;  1Z2C B;  1L7Z A;  1OOH A;  3B6X A;  1BOD A;  4YGD B;  1QV0 A;  1XFV O;  3IVT A;  1SMG A;  2KQY A;  1F70 A;  1N0Y A;  1ZUZ A;  2F8P A;  2PYQ A;  2WCF A;  3D75 A;  4D1E A;  2I18 A;  1QX7 A;  1H8B A;  2HF5 A;  1IRJ A;  1SYM A;  2LMT A;  2COL B;  2M7L A;  2K7O A;  2LUC A;  3WHU B;  3ZWH A;  1QIW A;  3D0Y B;  4AQI A;  1SBJ A;  5AFP A;  1RJV A;  3BFH A;  1QX5 B;  1SY9 A;  2KGB C;  3I5I B;  3SS3 A;  1IJ5 A;  2LVV A;  1NP8 A;  2OS8 C;  5K89 A;  1TCF A;  2LHI A;  2WCE A;  4ICB A;  3DF0 B;  2L51 A;  3NSL A;  4NDB A;  2BCB A;  1IH0 A;  2LAP A;  3BUN B;  4MEW A;  1RK9 A;  3DVE A;  4MVF A;  3VRQ A;  1QV1 A;  2WCB A;  1OMR A;  1K95 A;  1OOI X;  1QJT A;  1UWO A;  2WC5 A;  2BL0 B;  2LVJ A;  1G33 A;  1DJG A;  4PE4 A;  4YRU A;  2KSP A;  3EVR A;  2EC6 B;  2H61 A;  1NCZ A;  5CSN A;  1M31 A;  3V2L A;  1DGV A; 
#chains in the Genus database with same CATH homology
 3GK2 A;  1TNX A;  4XYN A;  4JWQ A;  1V1F A;  1PVA A;  1VRK A;  4GFT A;  4A4B A;  2F33 A;  4DRW A;  3NSK A;  2KAX A;  2M49 B;  1KQV A;  2KI4 B;  4R1E A;  1M39 A;  2BKH B;  3CR4 X;  3RM1 A;  5BPJ A;  1OSA A;  3I5G B;  3KHE A;  1PK0 D;  4P2Y B;  2CBL A;  2Y1N A;  4USL A;  4E68 A;  4YI9 A;  2G2B A;  2L4H A;  1CFD A;  3SG4 A;  1S6J A;  1W7I B;  2LCP A;  2ZND A;  1CFP A;  3I5H B;  5CSI A;  1XK4 A;  2JOJ A;  3AAJ A;  4PE1 A;  3BUO B;  2L98 A;  4PHJ A;  2KNE A;  5ER4 X;  4PCW A;  4QJ3 B;  4M2P A;  1JFJ A;  1A03 A;  3BUX B;  1Q80 A;  5I2L A;  1FI5 A;  3JVT C;  2ZFD A;  1DF0 A;  2BKI B;  5KSZ A;  4M2O A;  3DF0 A;  3TUY C;  5F6T A;  4PAL A;  1Y1A A;  1CB1 A;  3HCM A;  4WRI A;  1JF2 A;  4YGE B;  5AEQ A;  2KI6 C;  1BMO A;  3DD4 A;  3SG5 A;  2R2I A;  1SCM C;  2KYF A;  4OV2 A;  2PAL A;  1FI6 A;  1F4Q A;  1L2O B;  2K61 A;  2M1K B;  4PHN A;  2K2A A;  4F0Z B;  3MSE B;  1PRW A;  2JT3 A;  1OZS A;  2L5X B;  4ETO A;  4IL1 A;  3NSO A;  1NCX A;  4C0K A;  2LLT A;  2M0R A;  2H2K A;  1SKT A;  3O4Y A;  5CSF A;  4I5L B;  1WRL A;  3JTD C;  5ER5 A;  1GGZ A;  1NX1 A;  3NXA A;  4HRH A;  2LV7 A;  5I2O A;  1NCY A;  3SIB A;  2I2R E;  2HET A;  3LK1 A;  3D10 A;  5PAL A;  2ISD A;  1CM1 A;  2KFG A;  1YR5 A;  1GJY A;  2M7N A;  2BE4 A;  4NQG A;  1J1D A;  2AAO A;  3SG7 A;  3AKA A;  5HLV A;  2M1U A;  1K90 D;  1U5I A;  1UHI A;  1IWQ A;  4Q04 A;  4L9M A;  3C1V A;  3LL8 B;  2MJW B;  2QPT A;  2LMV A;  1KWO B;  1XFW O;  1RTP 1;  1ALW A;  1UP5 A;  1MWN A;  3BOW B;  1R6P A;  2CCM A;  4QJ4 B;  2KBM A;  1MR8 A;  1XK4 C;  2KAV A;  3TS5 C;  2M8U A;  2HQW A;  1SCV A;  3PN7 B;  1CDN A;  1B7T Z;  1MUX A;  3O2P A;  1EXR A;  5JJG A;  1SL8 A;  3EKJ A;  4HRG A;  2BBM A;  3FWB A;  4NDC A;  3TDZ A;  2AUC A;  3A8R A;  3CTN A;  1D1O A;  1V1G A;  3I5I C;  3KO0 A;  2PRU A;  2EGD A;  1CLL A;  4HRE E;  3TS5 B;  4CFR A;  1CLM A;  1JF0 A;  1F55 A;  1NWD A;  1XA5 A;  2LM5 A;  5KTY A;  3I5F B;  1F8H A;  1J7O A;  1G8I A;  4N5X A;  1XVJ A;  1MHO A;  1UUR A;  1IQ3 A;  1SL7 A;  1IG5 A;  1DGU A;  2KFH A;  4CLN A;  2BE6 A;  1M46 A;  3EVU A;  1SK6 D;  2KDH A;  1DVI A;  2BL0 C;  3OB1 B;  2V53 A;  2WND A;  1QAS A;  1F71 A;  3VGO A;  2EC6 C;  2JU0 A;  2Y5I A;  1A29 A;  1CMF A;  4MRY A;  1B47 A;  4XJK A;  1WDC B;  5HLO A;  2IS9 A;  3RLZ A;  3TDI A;  1LXF C;  1TRF A;  4GAO A;  3SG6 A;  1N65 A;  1AJ4 A;  2F2O A;  1S6I A;  4UPG A;  3NSI A;  1C7W A;  2NXQ A;  1EG4 A;  2KI4 C;  2LLU A;  2LC5 A;  3TZ1 A;  3PAT A;  3CR2 A;  1J7Q A;  1SR6 B;  3VRP A;  2Y4Q A;  3I5G C;  4PE7 A;  4GGF A;  4BY5 A;  1B8C A;  1NX0 A;  3PFV A;  3KEV A;  5CSJ A;  1K94 A;  3I5H C;  4N1G A;  3VRR A;  1CMG A;  1QXP A;  4MBE A;  3GK4 X;  4YGB B;  4PDZ A;  1WLM A;  1XFU O;  4ORC B;  3SIA A;  3F45 A;  5HKW A;  1CFC A;  1B7T Y;  2JQ6 A;  1KK8 B;  3IQO A;  1LIN A;  1S36 A;  2D8N A;  2K0J A;  2VRG A;  1RRO A;  1S1E A;  2L2E A;  4PHK A;  2FCE A;  5J3X A;  2O60 A;  2K7B A;  3WNX B;  1CLB A;  1DJI A;  2B1U A;  2O5G A;  4ORA B;  4PE0 A;  2K2F A;  1OE9 B;  3SG3 A;  3LLE A;  1B4C A;  1M63 B;  3OX6 A;  4MSP A;  3D0Y A;  1XYD A;  2ZN9 A;  3SG2 A;  5D69 A;  1DT7 B;  1DJW A;  1L2O C;  4CPV A;  2NCP A;  5IBW A;  3BQ3 A;  1REC A;  1TIZ A;  1EL4 A;  2BEC A;  2G9B A;  1BR1 B;  1BOC A;  1QS7 A;  1QVI Z;  3KPX A;  4AQJ A;  2M9G A;  1YUR A;  3CLN A;  3O6B A;  1YUU A;  1PVB A;  1BJF A;  1BU3 A;  2JTZ A;  1K2H A;  1CDL A;  3PSR A;  5HKZ A;  2MHH A;  1GGW A;  1ZMZ A;  3BXK A;  2BBN A;  4JPZ B;  2KGR A;  2L50 A;  1FW4 A;  2OTG B;  2JNX A;  1WRK A;  3WHT B;  2JRF A;  2NLN A;  1WY9 A;  2Y1M A;  1BG1 A;  1LA0 A;  1KFX L;  1B8R A;  1LA3 A;  3ZNI A;  4MZK A;  1S3P A;  1SRA A;  2BCX A;  4BY4 A;  1EH2 A;  1CNP A;  3FIA A;  4GBA A;  3OHM B;  1J55 A;  2SCP A;  3HX4 A;  1WRZ A;  2M29 A;  4U8D A;  2OPO A;  2JC2 A;  2K8M B;  3VRN A;  1N2D A;  5HYD A;  3VRO A;  3CWG A;  3GK1 A;  4GGF C;  1KWO C;  2KAY A;  5AXI A;  1KSM A;  2M3W A;  4QJ5 B;  1S26 D;  3BUM B;  1YX7 A;  1KFX S;  1QIV A;  3OX5 A;  3PN7 C;  4ORB B;  3TDU A;  2AMI A;  2LE9 B;  1JC2 A;  2F3Z A;  1C7V A;  4PHM A;  2FJU B;  2MBX A;  5B8I B;  4WQ3 A;  4GPL B;  5I2Q A;  1IGV A;  4MN0 A;  2FOT A;  2JTT A;  3DVM A;  5CPV A;  1K93 D;  1SNL A;  1TNQ A;  2A4J A;  2TN4 A;  3PAL A;  4I5K A;  3QRX A;  2MA2 A;  3LCP C;  2E30 A;  3A4U B;  3H4S E;  3I5F C;  1AUI B;  1QVI Y;  1TNP A;  4FTG A;  2DOQ A;  2Q91 A;  4C0J A;  1UUS A;  2MLF C;  1KK7 Z;  3KF9 A;  5HKY A;  1YTZ C;  1J7P A;  2ZN8 A;  1QLK A;  3EK4 A;  5AAN A;  1NX2 A;  3FS7 A;  1A2X A;  1S5G Z;  3O78 A;  1K9K A;  4OR9 B;  1YVH A;  3ICB A;  1MF8 B;  3CGA A;  1JSA A;  1R2U A;  5D7F A;  2HQ8 A;  2PVB A;  1ODB A;  3AAK A;  3CS1 A;  5G08 A;  1LVC D;  1WDC C;  1FF1 A;  1K9U A;  1K96 A;  2CNP A;  1YUS A;  1LKJ A;  1B8L A;  1XFX O;  1OOJ A;  4DUQ A;  4YBH B;  1AP4 A;  2L0P A;  2BCA A;  1SR6 C;  1JWD A;  2SAS A;  1GQM A;  5JOL A;  1TTX A;  1CTR A;  1AK8 A;  1QX2 A;  1TCO B;  1SPY A;  1YRU B;  2M97 A;  4C0L A;  5KU1 A;  3DVK A;  1DMO A;  5TNC A;  1A75 B;  2KOT A;  1K9P A;  2JUL A;  4YGC B;  2KFF A;  2KYC A;  4HSZ A;  2LP2 A;  4OCI A;  1NX3 A;  1KK8 C;  1X02 A;  1NYA A;  2LHL A;  1DF0 B;  1QTX A;  1B9A A;  4DCK A;  2WOS A;  1KFU L;  3BOW A;  4ZCU A;  1UHK A;  4NDD A;  1AVS A;  4CFQ A;  1KSO A;  1KCY A;  2MRD A;  3OP0 A;  2OS8 B;  1M45 A;  1ZOT B;  1TNW A;  2CXJ A;  1XO5 A;  1KK7 Y;  1PSB A;  1XFY O;  1DJH A;  1HT9 A;  2JPT A;  2CTN A;  1YVL A;  4ZCV A;  1S5G Y;  2LVK A;  2LVI A;  2PAS A;  1CDP A;  5AER A;  1E8A A;  1KFU S;  2LUX A;  4DS7 A;  1W7J B;  1CDM A;  1SL9 A;  2PMY A;  4GGN A;  4GNK B;  1A4P A;  4A4C A;  1TN4 A;  2GV5 A;  2EHB A;  3GOF A;  1OZO A;  1EG3 A;  4MZL A;  3BYA A;  2KHN A;  1YUT A;  1HQV A;  1RFJ A;  2JWW A;  4MLW A;  2OTG C;  4I5J A;  2JXC A;  1U5I B;  1OQP A;  1IJ6 A;  2F2P A;  2ZNE A;  4N1F A;  2HPS A;  2JNF A;  2WC8 A;  1NUB A;  1S6C A;  1QAT A;  1YX8 A;  1AHR A;  3EK8 A;  1JBA A;  1XFZ O;  2I7A A;  2JT8 A;  1FPW A;  2LNK A;  4I5N B;  3K21 A;  2I94 A;  4P5O E;  5FYX A;  4JQ0 D;  1C07 A;  2WOR A;  1DJY A;  1A75 A;  1SW8 A;  1MQ1 A;  2PSR A;  1JUO A;  1H4B A;  1TOP A;  1Y1X A;  2RGI A;  1PUL A;  2L4I A;  1BT6 A;  1OMD A;  2E6W A;  1MXL C;  1CKK A;  3EKH A;  2CT9 A;  2ZKM X;  1DJX A;  1NIW A;  2LLS A;  2K7C A;  4YGA A;  3WXA A;  3OB2 B;  3M0W A;  2MAZ A;  3IQQ A;  2NCO A;  4AOM A;  3CR5 X;  3JVT B;  1JFK A;  3LK0 A;  2MLE C;  1KQM C;  4FQO A;  1PAL A;  5GQQ C;  1J1E A;  1BLQ A;  3TUY B;  1DJZ A;  1RWY A;  2K7D A;  3BUW B;  1ALV A;  1WLZ A;  1Y0V H;  1UHN A;  2LP3 A;  1UHJ A;  4MRX A;  1SCM B;  2JT0 A;  5DKQ A;  1J7R A;  4WQ2 A;  2GGM A;  1KQM B;  3FWC A;  4YI8 A;  1IQ5 A;  2FCD A;  3PM8 A;  1BR4 B;  1Y1U A;  1NSH A;  1MXE A;  1ZFS A;  2LAN A;  3IF7 A;  1IKU A;  2P6B B;  3DVJ A;  1OMV A;  1ZAC A;  2H61 C;  1BF5 A;  2F3Y A;  4DIR A;  4OKH A;  4TNC A;  1G4Y R;  3JTD B;  4M2Q A;  3SJS A;  3AKB A;  4GUK A;  4XJK B;  2ZRS A;  1F54 A;  5DKR A;  1FBV A;  1UHH A;  2QAC A;  2Q4U A;  1YRT B;  1Y6W A;  2KQ6 A;  2LMU A;  3PLF B;  1AJ5 A;  5DKN A;  2JXL A;  1CM4 A;  2GGZ A;  1NPQ A;  3EK7 A;  4CID A;  1K8U A;  2ZRT A;  1EJ3 A;  4MZJ A;  1F4O A;  2KI6 D;  4OVN F;  2NZ0 A;  2KBI A;  3E3R A;  1B1G A;  1DTL A;  2JZI A;  1PSR A;  5I8N A;  1QLS A;  3EVV A;  1CFF A;  3CZT X;  1L7Z A;  1BOD A;  4YGD B;  1QV0 A;  1XFV O;  1SMG A;  2KQY A;  1F70 A;  1N0Y A;  1ZUZ A;  2F8P A;  2WCF A;  4D1E A;  2I18 A;  1QX7 A;  1H8B A;  2HF5 A;  1IRJ A;  1SYM A;  2LMT A;  2COL B;  2M7L A;  2K7O A;  2LUC A;  3WHU B;  3ZWH A;  1QIW A;  3D0Y B;  4AQI A;  1SBJ A;  5AFP A;  1RJV A;  1QX5 B;  1SY9 A;  2KGB C;  3I5I B;  1IJ5 A;  2LVV A;  1NP8 A;  2OS8 C;  5K89 A;  1TCF A;  2LHI A;  2WCE A;  4ICB A;  3DF0 B;  2L51 A;  3NSL A;  4NDB A;  2BCB A;  1IH0 A;  2LAP A;  3BUN B;  4MEW A;  1RK9 A;  3DVE A;  4MVF A;  3VRQ A;  1QV1 A;  2WCB A;  1OMR A;  1K95 A;  1QJT A;  1UWO A;  2BL0 B;  2LVJ A;  1G33 A;  1DJG A;  4PE4 A;  4YRU A;  2KSP A;  3EVR A;  2EC6 B;  2H61 A;  1NCZ A;  5CSN A;  1M31 A;  1DGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...