2E6WA

Solution structure and calcium binding properties of ef-hands 3 and 4 of calsenilin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
96
structure length
96
Chain Sequence
b'GTVHEKLKWAFNLYDINKDGYITKEEMLAIMKSIYDMMGRHTYPILREDAPAEHVERFFEKMDRNQDGVVTIEEFLEACQKDENIMSSMQLFENVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Calsenilin
publication title Solution structure and calcium-binding properties of EF-hands 3 and 4 of calsenilin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 21
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2e6wA00
2WC8A 1QV1A 1LA3A 1XO5A 2JU0A 1MR8A 5KTYA 1QV0A 3CR2A 5ER4X 5F6TA 1DVIA 1XA5A 1SCVA 4OKHA 5PALA 2ZRSA 1DGVA 2L0PA 5CSIA 3OB2B 5HLVA 1A29A 2KNEA 5IBWA 1QJTA 1K95A 2K7BA 2LMVA 1FW4A 1QX7A 4P5OE 5J3XA 1OMRA 2ZNDA 1RJVA 2WNDA 5CSNA 1UHJA 2LMUA 3KF9A 3MSEB 4BY4A 1CB1A 4MRXA 5D69A 1WRZA 3KPXA 1OQPA 4OV2A 1ALVA 4I5KA 2L98A 1L2OB 1TIZA 1NYAA 2KBIA 2LM5A 1UUSA 3EK7A 5FYXA 5KU1A 4WRIA 2KGRA 1NWDA 1WRKA 1UHKA 1YR5A 4AOMA 1J7OA 1SL8A 2M1UA 3CZTX 1J55A 1KK7Z 4MN0A 1F4OA 1QX5B 3DVEA 5B8IB 1RK9A 2KI4B 1K96A 1K8UA 5JOLA 3JTDB 2MAZA 4GGFC 1QXPA 4MEWA 2Y1MA 1SCMB 1RWYA 1GQMA 1XK4C 2MJWB 2MLFC 3PLFB 4ETOA 1F71A 4I5NB 2CT9A 1QVIY 3IQOA 2WORA 1HT9A 1TNWA 5DKRA 1SNLA 2BE4A 3I5FB 3F45A 4PHMA 1BODA 3BUWB 1NSHA 1RROA 1HQVA 2BCAA 3D0YA 3CTNA 3LL8B 1M63B 4OR9B 1WDCC 3BYAA 3DVKA 1S5GZ 2CTNA 5HLOA 1CLMA 2K7DA 1JUOA 1WLZA 2I18A 3OX5A 3CWGA 1QX2A 2L4IA 4Q04A 1CDPA 3I5HC 2BL0C 2FCEA 3OP0A 4E68A 1YURA 2JT3A 4PHNA 1QLKA 1AJ5A 4M2OA 2HQWA 3GK2A 3EK4A 1H4BA 2JT8A 1TTXA 2COLB 1NP8A 2F3ZA 1UHHA 2L2EA 2L50A 1QATA 1X02A 4MVFA 2PSRA 3SG7A 1CFPA 1CDLA 3ZNIA 3A8RA 1IJ5A 1CM4A 2F2OA 2VRGA 3BUOB 1N0YA 1TN4A 2LNKA 4C0KA 1SR6B 1KFXL 2NZ0A 2ZNEA 1CTRA 1J7QA 4PALA 5JJGA 2R2IA 1SPYA 3TDUA 3EVRA 2BECA 3SG6A 2B1UA 4C0JA 1YVHA 2BBNA 2I94A 2GGZA 2HETA 1KWOB 3CGAA 1J7RA 1H8BA 2LLTA 3CS1A 3SIAA 2LHIA 1JFJA 1CMFA 4CPVA 2JQ6A 2FCDA 1KFXS 4N5XA 2M97A 1G4YR 2CNPA 1NX0A 1OMDA 2SASA 1KQMC 2L5XB 3CLNA 3WXAA 2K8MB 1NX1A 3ICBA 5TNCA 4MRYA 4FQOA 4QJ5B 2F2PA 1KQVA 3SG5A 1CDMA 1OZOA 1JSAA 5BPJA 4ICBA 4YGEB 3RM1A 1ALWA 2LCPA 4PE0A 4AQJA 2ZN8A 2BKIB 4MZKA 1YUUA 1N65A 4USLA 4BY5A 4M2PA 4QJ4B 1A2XA 5K89A 4YGAA 2G9BA 3DVMA 3LK0A 1QVIZ 3GK4X 3OX6A 5HKWA 1IJ6A 4A4BA 3O4YA 5D7FA 1OOJA 1EG4A 1DMOA 2RGIA 5I8NA 3OB1B 3HX4A 1DJIA 4JWQA 1AVSA 1CLBA 3EVUA 3KO0A 2M9GA 4DUQA 1A03A 4WQ3A 1BT6A 1NCYA 3BUMB 1B1GA 2M3WA 2Y4QA 2K2FA 2NLNA 1IGVA 3PN7C 2MLEC 2WCBA 1BG1A 1M39A 1A75B 1JFKA 4N1GA 1B7TY 4CLNA 5AFPA 2O5GA 3FWBA 1K2HA 2FJUB 1DJGA 1QTXA 1TCFA 3BOWB 1OE9B 1G8IA 1CDNA 1GJYA 4CFRA 1NPQA 3I5IC 1KFUL 3TZ1A 3ZWHA 2LC5A 2KAYA 1J1EA 1MXLC 1RECA 2DOQA 2LLSA 2LV7A 3DVJA 1YTZC 3H4SE 2F33A 2ZFDA 3VRPA 2KI6C 1CFCA 1CFFA 2Q91A 1B9AA 3GK1A 1V1FA 4YRUA 1FI6A 5GQQC 1XVJA 1YX7A 4AQIA 1UP5A 3VROA 3SG4A 4MSPA 1Q80A 1DJWA 1PVAA 1MF8B 2KSPA 4ORCB 1ZFSA 3I5HB 2BL0B 2LVKA 5HKYA 2OTGC 2OS8C 2KBMA 1M46A 1C7VA 1DF0B 2K7OA 4GGNA 1TNQA 1SL9A 1IH0A 4OVNF 2H61C 4UPGA 4GBAA 2Y1NA 2ZN9A 1EL4A 1G33A 4HREE 4MLWA 2NXQA 4YBHB 2JWWA 1K9PA 2ISDA 1A75A 1OSAA 2BCBA 1UHNA 3D10A 2EGDA 3EK8A 5CPVA 2LE9B 1A4PA 2HQ8A 2JT0A 1ODBA 3BOWA 1ZOTB 1CLLA 1SW8A 1W7IB 2WOSA 4FTGA 1PRWA 1S6JA 4D1EA 2L4HA 1KK8B 4PE7A 1BR1B 2Q4UA 2EC6C 2O60A 1LA0A 2NCOA 2MBXA 1DJXA 1XK4A 2MHHA 4I5JA 4CFQA 1OZSA 4YGCB 1R6PA 4PDZA 5I2QA 3TDIA 3WHTB 2LVJA 1R2UA 1QIVA 4JQ0D 2LUCA 2NCPA 1UHIA 4CIDA 2KI6D 3TUYC 1BR4B 1FF1A 1XFZO 4DS7A 1IWQA 1CFDA 1B7TZ 1KQMB 1S3PA 1SKTA 2LAPA 2K2AA 3TDZA 1Y1AA 2K61A 5DKQA 4DCKA 3IF7A 1YUSA 2BBMA 1PVBA 1NCZA 4YGBB 3PATA 2BCXA 4M2QA 1C07A 2OPOA 4C0LA 1QASA 2PMYA 3BUXB 1IQ3A 2A4JA 1RFJA 2KDHA 3DD4A 2JRFA 2GGMA 4GUKA 4DRWA 1XFUO 1TRFA 2V53A 3E3RA 5CSFA 2TN4A 3HCMA 1MQ1A 2AUCA 1ZMZA 2KHNA 3TS5C 3BQ3A 3K21A 3QRXA 3M0WA 2AAOA 1U5IB 3AKBA 1BMOA 1F4QA 2D8NA 3PSRA 1F55A 1GGWA 4GFTA 3AAKA 4GNKB 1PULA 4ZCVA 2IS9A 1PALA 1ZACA 2H2KA 3PN7B 4I5LB 2G2BA 4OCIA 3NSKA 1AK8A 3SG2A 1FPWA 2QACA 1TCOB 2LVIA 2L51A 1D1OA 1TNXA 2KYFA 2M49B 1K9UA 1CKKA 1SRAA 4PE4A 5AXIA 4R1EA 1QLSA 4PHJA 1WY9A 3I5IB 1J7PA 1S1EA 4MBEA 4HRHA 1UWOA 2JC2A 1OMVA 3JVTC 1IQ5A 4GAOA 2LMTA 1JBAA 4PE1A 1YUTA 4P2YB 5I2OA 3EKJA 3EVVA 2HPSA 3NXAA 5G08A 1W7JB 3SJSA 4U8DA 3I5GC 3DF0B 3BUNB 1DT7B 4QJ3B 4GPLB 2P6BB 1PK0D 1JF0A 1S26D 1K93D 1FI5A 1DJZA 2JNXA 2KQ6A 3LCPC 4XJKB 4A4CA 5HKZA 1BF5A 3SIBA 2M7NA 2LP3A 1QIWA 2LHLA 1ZUZA 2OTGB 3D0YB 1U5IA 2FOTA 1XFVO 2OS8B 3LK1A 1MWNA 4F0ZB 1MUXA 2EHBA 3A4UB 1DTLA 1WRLA 1JC2A 2AMIA 1WDCB 1EXRA 2CXJA 1KFUS 2MA2A 1SK6D 1NUBA 3RLZA 1JF2A 1S36A 4IL1A 1SY9A 1SL7A 2PVBA 1PSRA 1F70A 5I2LA 1LVCD 3NSIA 1SBJA 1B4CA 4MZJA 1DJYA 5DKNA 3VGOA 1QS7A 1IRJA 1YX8A 2LVVA 2SCPA 3EKHA 4YI9A 1LINA 1BJFA 2BKHB 2EC6B 5AANA 1XFXO 3FS7A 1KCYA 1SYMA 2JOJA 3PM8A 1MXEA 3GOFA 2PALA 2E30A 1F8HA 1RTP1 1C7WA 4NQGA 3BXKA 4ORAB 2PASA 4ZCUA 1WLMA 3DF0A 4L9MA 1L2OC 3TUYB 4ORBB 4YI8A 3SG3A 1L7ZA 1LXFC 3NSOA 3VRNA 1B8LA 1Y6WA 1XFWO 3NSLA 2JXCA 2K7CA 2K0JA 1K94A 2I2RE 1AJ4A 4XJKA 4GGFA 1BLQA 3PFVA 5AERA 2M29A 1AUIB 2KI4C 1XFYO 1KSOA 1CMGA 1EH2A 4NDBA 1PSBA 3JTDC 2QPTA 4NDCA 1BOCA 2H61A 2M8UA 1E8AA 1SCMC 1UURA 2JXLA 3CR4X 4HRGA 4TNCA 1DGUA 2CBLA 2ZRTA 1DJHA 3TS5B 1K9KA 2HF5A 1AHRA 3I5FC 1NX2A 5HYDA 1Y0VH 3O78A 4WQ2A 1F54A 5ER5A 4MZLA 1Y1XA 3O2PA 1NCXA 4DIRA 1DF0A 2MRDA 2ZKMX 2BE6A 2F3YA 2M1KB 2PRUA 2JULA 1JWDA 1CNPA 2E6WA 4YGDB 2I7AA 1KSMA 1EG3A 4N1FA 5KSZA 1TOPA 1TNPA 1KK8C 1KK7Y 2WCFA 2KQYA 1M45A 1K90D 2KGBC 3CR5X 1BU3A 3AAJA 1MHOA 2JPTA 2KFGA 1B47A 2KOTA 4PHKA 2LUXA 3JVTB 1EJ3A 1Y1UA 1IG5A 3IQQA 1J1DA 1VRKA 2KAVA 2JNFA 1FBVA 1YVLA 3OHMB 1V1GA 1B8CA 1SR6C 1M31A 3I5GB 3O6BA 2WCEA 3VRRA 4PCWA 3WHUB 2KYCA 2M0RA 2F8PA 4NDDA 1CM1A 2Y5IA 2JTTA 1N2DA 1LKJA 1YRUB 1IKUA 3VRQA 1S5GY 1NX3A 2KAXA 3KEVA 3PALA 1S6CA 2LLUA 1S6IA 2KFFA 3KHEA 1SMGA 3FWCA 4XYNA 3WNXB 1KWOC 3FIAA 1AP4A 5AEQA 1GGZA 3C1VA 3AKAA 5CSJA 2LANA 2M7LA 2LP2A 4HSZA 1B8RA 1NIWA 4JPZB 3LLEA 2JZIA 1XYDA 1YRTB 2CCMA 2KFHA 2GV5A 2JTZA
chains in the Genus database with same CATH superfamily
1TUJA 2WC8A 1OOFA 1QV1A 1LA3A 1XO5A 2JU0A 1MR8A 5KTYA 1QV0A 3CR2A 5ER4X 5F6TA 1DVIA 1XA5A 1SCVA 3L47A 4OKHA 5PALA 2ZRSA 1DGVA 2L0PA 3B7AA 5CSIA 3OB2B 5HLVA 3R1PA 1A29A 2KNEA 5IBWA 1QJTA 1K95A 3S0GA 2K7BA 2LMVA 1FW4A 3SS3A 1QX7A 4P5OE 5J3XA 1OMRA 2ZNDA 1RJVA 2WNDA 5CSNA 1UHJA 2LMUA 3KF9A 3MSEB 4BY4A 1CB1A 4MRXA 5D69A 1WRZA 3KPXA 1OQPA 4OV2A 1ALVA 1TUZA 4I5KA 2L98A 1L2OB 1TIZA 2QEVA 1NYAA 1XFRA 2KBIA 1UUSA 2LM5A 3EK7A 3K1EA 4WRIA 5FYXA 5KU1A 2KGRA 1NWDA 1WRKA 1UHKA 1YR5A 3R72A 4AOMA 1J7OA 1SL8A 2M1UA 3CZTX 1J55A 1KK7Z 4MN0A 1F4OA 1QX5B 3DVEA 2QEOA 5B8IB 3CDNA 1RK9A 2KI4B 3OGNA 1K96A 3SS5A 3UO9A 1K8UA 4OZDA 3PM2A 5JOLA 3JTDB 2MAZA 4GGFC 1QXPA 4MEWA 2Y1MA 1SCMB 1RWYA 1GQMA 1XK4C 2MJWB 2MLFC 3PLFB 4ETOA 3BFAA 4I5NB 1F71A 4INXA 2CT9A 1QVIY 3IQOA 3N7HA 4FQTA 2WORA 1HT9A 1TNWA 5DKRA 1SNLA 2BE4A 3I5FB 3NGVA 3F45A 4PHMA 1BODA 4F7FA 3BUWB 1NSHA 1RROA 1HQVA 2BCAA 3D0YA 3CTNA 3LL8B 1M63B 4OR9B 3S0BA 1WDCC 3BYAA 3DVKA 1S5GZ 2CTNA 5HLOA 1CLMA 2K7DA 1JUOA 1WLZA 2I18A 3OX5A 3CWGA 2KLDA 1QX2A 2L4IA 4Q04A 1CDPA 3I5HC 2BL0C 2FCEA 3CZ0A 3OP0A 1YURA 2JT3A 4PHNA 1QLKA 4E68A 1AJ5A 4M2OA 2HQWA 3GK2A 3EK4A 1H4BA 2JT8A 1TTXA 2COLB 2BAPA 1NP8A 2F3ZA 1UHHA 2L2EA 2L50A 1QATA 1X02A 3FE9A 4MVFA 2PSRA 3SG7A 1CFPA 1CDLA 1OOIX 3ZNIA 3A8RA 1IJ5A 1CM4A 2F2OA 2VRGA 3BUOB 1N0YA 1TN4A 2LNKA 4C0KA 1SR6B 1KFXL 2NZ0A 2ZNEA 1CTRA 1J7QA 4PALA 5JJGA 2R2IA 1SPYA 3TDUA 3EVRA 2BECA 3SG6A 2B1UA 4C0JA 1YVHA 2BBNA 2I94A 2QEBA 1C3ZA 2GGZA 2HETA 1KWOB 3CGAA 1J7RA 1H8BA 2LLTA 3CS1A 3SIAA 2LHIA 1JFJA 1LS8A 1CMFA 4CPVA 2JQ6A 2FCDA 1KFXS 2JPOA 4N5XA 2M97A 1G4YR 4IJ7A 2CNPA 1NX0A 1OMDA 2SASA 1KQMC 2L5XB 3CLNA 2WC5A 3WXAA 2K8MB 1NX1A 3ICBA 2WCLA 5TNCA 3CZ1A 3B88A 4FQOA 4MRYA 2F2PA 4QJ5B 1KQVA 3SG5A 1CDMA 1OZOA 1JSAA 5BPJA 4ICBA 4YGEB 3RM1A 1ALWA 2LCPA 4PE0A 4AQJA 2ZN8A 2BKIB 4MZKA 1YUUA 1N65A 4USLA 3BJHA 4M2PA 4BY5A 4QJ4B 1A2XA 3OBVA 5K89A 4YGAA 2G9BA 3DVMA 3LK0A 1QVIZ 3GK4X 3OX6A 5D3OA 5HKWA 1IJ6A 4A4BA 3O4YA 5D7FA 1OOJA 1EG4A 1DMOA 2RGIA 5I8NA 3OB1B 3HX4A 1DJIA 4JWQA 1AVSA 3D74A 1CLBA 3EVUA 2GTEA 3KO0A 2M9GA 4DUQA 1A03A 4WQ3A 1BT6A 1NCYA 3BUMB 1B1GA 2M3WA 2Y4QA 2K2FA 2NLNA 1IGVA 3PN7C 2MLEC 2WCBA 1BG1A 2QDIA 1M39A 1A75B 1JFKA 4N1GA 1B7TY 4CLNA 5AFPA 2O5GA 3FWBA 1K2HA 2FJUB 1DJGA 1QTXA 1TCFA 3BOWB 1OE9B 1G8IA 3DZTA 1CDNA 5FI6A 1GJYA 4CFRA 1NPQA 3I5IC 1KFUL 3TZ1A 3ZWHA 2LC5A 2KAYA 2WC6A 1J1EA 1MXLC 1RECA 2DOQA 2LLSA 2LV7A 3DVJA 1YTZC 3H4SE 2F33A 2ZFDA 3VRPA 2KI6C 1CFCA 1CFFA 2Q91A 1B9AA 3GK1A 1V1FA 4YRUA 1FI6A 5GQQC 1XVJA 1YX7A 4AQIA 1UP5A 3D75A 3VROA 3SG4A 4MSPA 3R1OA 1Q80A 1DJWA 1PVAA 1MF8B 5DICA 2KSPA 4ORCB 1ZFSA 3I5HB 2BL0B 2LVKA 5HKYA 2OTGC 2OS8C 2KBMA 1M46A 1OOHA 1DF0B 2K7OA 2L2CA 4GGNA 1C7VA 1TNQA 1SL9A 1IH0A 4OVNF 2H61C 4UPGA 4GBAA 2Y1NA 2ZN9A 1EL4A 1G33A 4HREE 4MLWA 2NXQA 5FI2A 1GM0A 4YBHB 2JWWA 1K9PA 2ISDA 1A75A 1OSAA 2BCBA 3B86A 1UHNA 3D10A 2EGDA 3EK8A 5CPVA 2LE9B 3D76A 1A4PA 2HQ8A 4PT1A 2JT0A 1ODBA 3BOWA 2ERBA 2KLEA 1ZOTB 1CLLA 1SW8A 1W7IB 2WOSA 4FTGA 1PRWA 1S6JA 4D1EA 2L4HA 1KK8B 2WCHA 4PE7A 3S0AA 1BR1B 2Q4UA 2EC6C 2O60A 1LA0A 2WCJA 1T14A 2NCOA 2MBXA 1DJXA 1XK4A 2MHHA 3IVTA 4I5JA 3Q8IA 4CFQA 1OZSA 3RZSA 2K60A 4YGCB 1R6PA 4PDZA 3VB1A 5I2QA 1DEKA 3TDIA 1QWVA 2LVJA 3WHTB 3S0FA 1R2UA 1QIVA 4JQ0D 2LUCA 2NCPA 1UHIA 4CIDA 2KI6D 3TUYC 1BR4B 1FF1A 1XFZO 4DS7A 1IWQA 3SS4A 1CFDA 1B7TZ 1KQMB 1S3PA 1SKTA 2LAPA 2K2AA 5FI7A 3TDZA 1Y1AA 2K61A 5DKQA 4DCKA 3IF7A 1YUSA 2BBMA 1PVBA 5I94A 1NCZA 2PQLA 4YGBB 1W9ZA 3PATA 3PJIA 2BCXA 4M2QA 2P71A 3DY9A 2OPOA 4C0LA 1QASA 2PMYA 3BUXB 1IQ3A 1C07A 2A4JA 1RFJA 2KDHA 4KYNA 3DD4A 2JRFA 2GGMA 4GUKA 4DRWA 1XFUO 1TRFA 2V53A 4INWA 3E3RA 5CSFA 2TN4A 3L4LA 3HCMA 1MQ1A 1Z2CB 2AUCA 1ZMZA 2KHNA 3BFHA 3QMEA 3TS5C 3BQ3A 3K21A 3QRXA 3M0WA 2AAOA 1U5IB 3AKBA 1BMOA 1F4QA 2D8NA 3PSRA 1F55A 1GGWA 4GFTA 3AAKA 4GNKB 1PULA 4ZCVA 1DC1A 2IS9A 1PALA 1ZACA 2H2KA 3PN7B 4I5LB 2G2BA 4OCIA 3NSKA 1AK8A 3SG2A 3DXLA 1FPWA 2QACA 1TCOB 2LVIA 2L51A 1D1OA 1TNXA 2KYFA 2M49B 1K9UA 3D73A 3L4AA 1CKKA 1SRAA 4PE4A 5AXIA 4R1EA 1QLSA 4PHJA 1OW4A 1WY9A 3I5IB 1J7PA 3O4XA 1S1EA 4MBEA 4HRHA 1UWOA 2JC2A 1OMVA 3JVTC 2H8VA 1IQ5A 5HL1A 4GAOA 2LMTA 1JBAA 4PE1A 1YUTA 4P2YB 5I2OA 3EKJA 3EVVA 2HPSA 3NXAA 5G08A 1W7JB 3SJSA 4U8DA 3I5GC 3DF0B 1DQEA 2BNXA 3BUNB 4QJ3B 3D77A 1DT7B 4GPLB 2P6BB 1PK0D 1JF0A 1S26D 1K93D 1FI5A 1DJZA 2JNXA 2KQ6A 3CABA 3LCPC 4XJKB 4A4CA 5HKZA 1BF5A 3EG5B 3SIBA 3UNWA 2M7NA 2LP3A 1QIWA 3R1VA 2LHLA 1ZUZA 2OTGB 3D0YB 1U5IA 2FOTA 1XFVO 2OS8B 3CZ2A 3LK1A 1MWNA 4F0ZB 1MUXA 2EHBA 2FJYA 3A4UB 1DTLA 1WRLA 2PYQA 1JC2A 2AMIA 1WDCB 1EXRA 2CXJA 1KFUS 2MA2A 1C3YA 1SK6D 1NUBA 3RLZA 3FE6A 1JF2A 1S36A 4IL1A 1SY9A 1SL7A 2PVBA 1PSRA 1F70A 4JKTA 5I2LA 1LVCD 3NSIA 1SBJA 2L5YA 1B4CA 4MZJA 1DJYA 5DKNA 3VGOA 1QS7A 1IRJA 1YX8A 2LVVA 2SCPA 3EKHA 4YI9A 1LINA 1BJFA 2BKHB 2EC6B 5AANA 1XFXO 3FS7A 1KCYA 1SYMA 2JOJA 3PM8A 2QEHA 1TWOA 1MXEA 3BFBA 3GOFA 2PALA 2E30A 1F8HA 1RTP1 1C7WA 4NQGA 3BXKA 4ORAB 2PASA 4ZCUA 1P28A 1WLMA 3DF0A 4L9MA 1L2OC 3DYEA 3TUYB 4ORBB 4YI8A 3SG3A 1L7ZA 1LXFC 3NSOA 3VRNA 1B8LA 1Y6WA 1XFWO 3NSLA 2JXCA 2K7CA 2K0JA 1K94A 2I2RE 1AJ4A 3CYZA 4GGFA 4XJKA 1DELA 1BLQA 4JD9A 3PFVA 5AERA 2M29A 3NHTA 1AUIB 2KI4C 1XFYO 1KSOA 3V2LA 1CMGA 1EH2A 4NDBA 1PSBA 3JTDC 2QPTA 4NDCA 1BOCA 2H61A 2M8UA 1E8AA 3S0DA 1SCMC 1UURA 2JXLA 3CR4X 4HRGA 4TNCA 1DGUA 2CBLA 2ZRTA 1DJHA 3TS5B 1IIOA 1K9KA 2HF5A 1AHRA 3I5FC 1NX2A 5HYDA 1Y0VH 2KPHA 3O78A 4WQ2A 1F54A 5ER5A 4MZLA 1Y1XA 3O2PA 1NCXA 4DIRA 1DF0A 2MRDA 2P70A 2ZKMX 3FE8A 2BE6A 2F3YA 2M1KB 2PRUA 2JULA 1JWDA 1CNPA 2E6WA 4YGDB 2I7AA 5EL2A 3B6XA 1KSMA 1EG3A 2YGUA 4N1FA 5KSZA 1TOPA 1TNPA 1KK8C 1KK7Y 2WCFA 2KQYA 1M45A 1K90D 2KGBC 3B87A 3CR5X 1BU3A 1ORGA 3AAJA 1MHOA 2JPTA 2KFGA 1B47A 2KOTA 3D78A 2LUXA 4PHKA 3JVTB 1EJ3A 1Y1UA 1IG5A 3IQQA 1J1DA 1VRKA 2KAVA 2WCMA 2JNFA 1FBVA 1YVLA 3S0EA 3OHMB 1V1GA 1B8CA 1SR6C 1M31A 3I5GB 3O6BA 2WCEA 3NHIA 3VRRA 4PCWA 1SSEB 3WHUB 2KYCA 2WCKA 2M0RA 2F8PA 4NDDA 1CM1A 2Y5IA 2JTTA 1N2DA 1LKJA 1YRUB 1IKUA 3VRQA 1S5GY 1NX3A 2KAXA 3KEVA 3PALA 1S6CA 2LLUA 1S6IA 2KFFA 3KHEA 1SMGA 3FWCA 4XYNA 3WNXB 1KWOC 3FIAA 1AP4A 5AEQA 1GGZA 3C1VA 3AKAA 5CSJA 2LANA 2M7LA 2LP2A 1OOGA 4HSZA 1Z4HA 1B8RA 1NIWA 4JPZB 3LLEA 2JZIA 1XYDA 1YRTB 2CCMA 2KFHA 2GV5A 2JTZA
chains in the Genus database with same CATH topology
2WC8A 1QV1A 1LA3A 1XO5A 2JU0A 1MR8A 5KTYA 1QV0A 3CR2A 5ER4X 5F6TA 1DVIA 1XA5A 1SCVA 4OKHA 5PALA 2ZRSA 1DGVA 2L0PA 5CSIA 3OB2B 5HLVA 1A29A 2KNEA 5IBWA 1QJTA 1K95A 2K7BA 2LMVA 1FW4A 1QX7A 4P5OE 5J3XA 1OMRA 2ZNDA 1RJVA 2WNDA 5CSNA 1UHJA 2LMUA 3KF9A 3MSEB 4BY4A 1CB1A 4MRXA 5D69A 1WRZA 3KPXA 1OQPA 4OV2A 1ALVA 4I5KA 2L98A 1L2OB 1TIZA 1NYAA 2KBIA 2LM5A 1UUSA 3EK7A 5FYXA 5KU1A 4WRIA 2KGRA 1NWDA 1WRKA 1UHKA 1YR5A 4AOMA 1J7OA 1SL8A 2M1UA 3CZTX 1J55A 1KK7Z 4MN0A 1F4OA 1QX5B 3DVEA 5B8IB 1RK9A 2KI4B 1K96A 1K8UA 5JOLA 3JTDB 2MAZA 4GGFC 1QXPA 4MEWA 2Y1MA 1SCMB 1RWYA 1GQMA 1XK4C 2MJWB 2MLFC 3PLFB 4ETOA 1F71A 4I5NB 2CT9A 1QVIY 3IQOA 2WORA 1HT9A 1TNWA 5DKRA 1SNLA 2BE4A 3I5FB 3F45A 4PHMA 1BODA 3BUWB 1NSHA 1RROA 1HQVA 2BCAA 3D0YA 3CTNA 3LL8B 1M63B 4OR9B 1WDCC 3BYAA 3DVKA 1S5GZ 2CTNA 5HLOA 1CLMA 2K7DA 1JUOA 1WLZA 2I18A 3OX5A 3CWGA 1QX2A 2L4IA 4Q04A 1CDPA 3I5HC 2BL0C 2FCEA 3OP0A 4E68A 1YURA 2JT3A 4PHNA 1QLKA 1AJ5A 4M2OA 2HQWA 3GK2A 3EK4A 1H4BA 2JT8A 1TTXA 2COLB 1NP8A 2F3ZA 1UHHA 2L2EA 2L50A 1QATA 1X02A 4MVFA 2PSRA 3SG7A 1CFPA 1CDLA 3ZNIA 3A8RA 1IJ5A 1CM4A 2F2OA 2VRGA 3BUOB 1N0YA 1TN4A 2LNKA 4C0KA 1SR6B 1KFXL 2NZ0A 2ZNEA 1CTRA 1J7QA 4PALA 5JJGA 2R2IA 1SPYA 3TDUA 3EVRA 2BECA 3SG6A 2B1UA 4C0JA 1YVHA 2BBNA 2I94A 2GGZA 2HETA 1KWOB 3CGAA 1J7RA 1H8BA 2LLTA 3CS1A 3SIAA 2LHIA 1JFJA 1CMFA 4CPVA 2JQ6A 2FCDA 1KFXS 4N5XA 2M97A 1G4YR 2CNPA 1NX0A 1OMDA 2SASA 1KQMC 2L5XB 3CLNA 3WXAA 2K8MB 1NX1A 3ICBA 5TNCA 4MRYA 4FQOA 4QJ5B 2F2PA 1KQVA 3SG5A 1CDMA 1OZOA 1JSAA 5BPJA 4ICBA 4YGEB 3RM1A 1ALWA 2LCPA 4PE0A 4AQJA 2ZN8A 2BKIB 4MZKA 1YUUA 1N65A 4USLA 4BY5A 4M2PA 4QJ4B 1A2XA 5K89A 4YGAA 2G9BA 3DVMA 3LK0A 1QVIZ 3GK4X 3OX6A 5HKWA 1IJ6A 4A4BA 3O4YA 5D7FA 1OOJA 1EG4A 1DMOA 2RGIA 5I8NA 3OB1B 3HX4A 1DJIA 4JWQA 1AVSA 1CLBA 3EVUA 3KO0A 2M9GA 4DUQA 1A03A 4WQ3A 1BT6A 1NCYA 3BUMB 1B1GA 2M3WA 2Y4QA 2K2FA 2NLNA 1IGVA 3PN7C 2MLEC 2WCBA 1BG1A 1M39A 1A75B 1JFKA 4N1GA 1B7TY 4CLNA 5AFPA 2O5GA 3FWBA 1K2HA 2FJUB 1DJGA 1QTXA 1TCFA 3BOWB 1OE9B 1G8IA 1CDNA 1GJYA 4CFRA 1NPQA 3I5IC 1KFUL 3TZ1A 3ZWHA 2LC5A 2KAYA 1J1EA 1MXLC 1RECA 2DOQA 2LLSA 2LV7A 3DVJA 1YTZC 3H4SE 2F33A 2ZFDA 3VRPA 2KI6C 1CFCA 1CFFA 2Q91A 1B9AA 3GK1A 1V1FA 4YRUA 1FI6A 5GQQC 1XVJA 1YX7A 4AQIA 1UP5A 3VROA 3SG4A 4MSPA 1Q80A 1DJWA 1PVAA 1MF8B 2KSPA 4ORCB 1ZFSA 3I5HB 2BL0B 2LVKA 5HKYA 2OTGC 2OS8C 2KBMA 1M46A 1C7VA 1DF0B 2K7OA 4GGNA 1TNQA 1SL9A 1IH0A 4OVNF 2H61C 4UPGA 4GBAA 2Y1NA 2ZN9A 1EL4A 1G33A 4HREE 4MLWA 2NXQA 4YBHB 2JWWA 1K9PA 2ISDA 1A75A 1OSAA 2BCBA 1UHNA 3D10A 2EGDA 3EK8A 5CPVA 2LE9B 1A4PA 2HQ8A 2JT0A 1ODBA 3BOWA 1ZOTB 1CLLA 1SW8A 1W7IB 2WOSA 4FTGA 1PRWA 1S6JA 4D1EA 2L4HA 1KK8B 4PE7A 1BR1B 2Q4UA 2EC6C 2O60A 1LA0A 2NCOA 2MBXA 1DJXA 1XK4A 2MHHA 4I5JA 4CFQA 1OZSA 4YGCB 1R6PA 4PDZA 5I2QA 3TDIA 3WHTB 2LVJA 1R2UA 1QIVA 4JQ0D 2LUCA 2NCPA 1UHIA 4CIDA 2KI6D 3TUYC 1BR4B 1FF1A 1XFZO 4DS7A 1IWQA 1CFDA 1B7TZ 1KQMB 1S3PA 1SKTA 2LAPA 2K2AA 3TDZA 1Y1AA 2K61A 5DKQA 4DCKA 3IF7A 1YUSA 2BBMA 1PVBA 1NCZA 4YGBB 3PATA 2BCXA 4M2QA 1C07A 2OPOA 4C0LA 1QASA 2PMYA 3BUXB 1IQ3A 2A4JA 1RFJA 2KDHA 3DD4A 2JRFA 2GGMA 4GUKA 4DRWA 1XFUO 1TRFA 2V53A 3E3RA 5CSFA 2TN4A 3HCMA 1MQ1A 2AUCA 1ZMZA 2KHNA 3TS5C 3BQ3A 3K21A 3QRXA 3M0WA 2AAOA 1U5IB 3AKBA 1BMOA 1F4QA 2D8NA 3PSRA 1F55A 1GGWA 4GFTA 3AAKA 4GNKB 1PULA 4ZCVA 2IS9A 1PALA 1ZACA 2H2KA 3PN7B 4I5LB 2G2BA 4OCIA 3NSKA 1AK8A 3SG2A 1FPWA 2QACA 1TCOB 2LVIA 2L51A 1D1OA 1TNXA 2KYFA 2M49B 1K9UA 1CKKA 1SRAA 4PE4A 5AXIA 4R1EA 1QLSA 4PHJA 1WY9A 3I5IB 1J7PA 1S1EA 4MBEA 4HRHA 1UWOA 2JC2A 1OMVA 3JVTC 1IQ5A 4GAOA 2LMTA 1JBAA 4PE1A 1YUTA 4P2YB 5I2OA 3EKJA 3EVVA 2HPSA 3NXAA 5G08A 1W7JB 3SJSA 4U8DA 3I5GC 3DF0B 3BUNB 1DT7B 4QJ3B 4GPLB 2P6BB 1PK0D 1JF0A 1S26D 1K93D 1FI5A 1DJZA 2JNXA 2KQ6A 3LCPC 4XJKB 4A4CA 5HKZA 1BF5A 3SIBA 2M7NA 2LP3A 1QIWA 2LHLA 1ZUZA 2OTGB 3D0YB 1U5IA 2FOTA 1XFVO 2OS8B 3LK1A 1MWNA 4F0ZB 1MUXA 2EHBA 3A4UB 1DTLA 1WRLA 1JC2A 2AMIA 1WDCB 1EXRA 2CXJA 1KFUS 2MA2A 1SK6D 1NUBA 3RLZA 1JF2A 1S36A 4IL1A 1SY9A 1SL7A 2PVBA 1PSRA 1F70A 5I2LA 1LVCD 3NSIA 1SBJA 1B4CA 4MZJA 1DJYA 5DKNA 3VGOA 1QS7A 1IRJA 1YX8A 2LVVA 2SCPA 3EKHA 4YI9A 1LINA 1BJFA 2BKHB 2EC6B 5AANA 1XFXO 3FS7A 1KCYA 1SYMA 2JOJA 3PM8A 1MXEA 3GOFA 2PALA 2E30A 1F8HA 1RTP1 1C7WA 4NQGA 3BXKA 4ORAB 2PASA 4ZCUA 1WLMA 3DF0A 4L9MA 1L2OC 3TUYB 4ORBB 4YI8A 3SG3A 1L7ZA 1LXFC 3NSOA 3VRNA 1B8LA 1Y6WA 1XFWO 3NSLA 2JXCA 2K7CA 2K0JA 1K94A 2I2RE 1AJ4A 4XJKA 4GGFA 1BLQA 3PFVA 5AERA 2M29A 1AUIB 2KI4C 1XFYO 1KSOA 1CMGA 1EH2A 4NDBA 1PSBA 3JTDC 2QPTA 4NDCA 1BOCA 2H61A 2M8UA 1E8AA 1SCMC 1UURA 2JXLA 3CR4X 4HRGA 4TNCA 1DGUA 2CBLA 2ZRTA 1DJHA 3TS5B 1K9KA 2HF5A 1AHRA 3I5FC 1NX2A 5HYDA 1Y0VH 3O78A 4WQ2A 1F54A 5ER5A 4MZLA 1Y1XA 3O2PA 1NCXA 4DIRA 1DF0A 2MRDA 2ZKMX 2BE6A 2F3YA 2M1KB 2PRUA 2JULA 1JWDA 1CNPA 2E6WA 4YGDB 2I7AA 1KSMA 1EG3A 4N1FA 5KSZA 1TOPA 1TNPA 1KK8C 1KK7Y 2WCFA 2KQYA 1M45A 1K90D 2KGBC 3CR5X 1BU3A 3AAJA 1MHOA 2JPTA 2KFGA 1B47A 2KOTA 4PHKA 2LUXA 3JVTB 1EJ3A 1Y1UA 1IG5A 3IQQA 1J1DA 1VRKA 2KAVA 2JNFA 1FBVA 1YVLA 3OHMB 1V1GA 1B8CA 1SR6C 1M31A 3I5GB 3O6BA 2WCEA 3VRRA 4PCWA 3WHUB 2KYCA 2M0RA 2F8PA 4NDDA 1CM1A 2Y5IA 2JTTA 1N2DA 1LKJA 1YRUB 1IKUA 3VRQA 1S5GY 1NX3A 2KAXA 3KEVA 3PALA 1S6CA 2LLUA 1S6IA 2KFFA 3KHEA 1SMGA 3FWCA 4XYNA 3WNXB 1KWOC 3FIAA 1AP4A 5AEQA 1GGZA 3C1VA 3AKAA 5CSJA 2LANA 2M7LA 2LP2A 4HSZA 1B8RA 1NIWA 4JPZB 3LLEA 2JZIA 1XYDA 1YRTB 2CCMA 2KFHA 2GV5A 2JTZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WC8 A;  1QV1 A;  1LA3 A;  1XO5 A;  2JU0 A;  1MR8 A;  5KTY A;  1QV0 A;  3CR2 A;  5ER4 X;  5F6T A;  1DVI A;  1XA5 A;  1SCV A;  4OKH A;  5PAL A;  2ZRS A;  1DGV A;  2L0P A;  5CSI A;  3OB2 B;  5HLV A;  1A29 A;  2KNE A;  5IBW A;  1QJT A;  1K95 A;  2K7B A;  2LMV A;  1FW4 A;  1QX7 A;  4P5O E;  5J3X A;  1OMR A;  2ZND A;  1RJV A;  2WND A;  5CSN A;  1UHJ A;  2LMU A;  3KF9 A;  3MSE B;  4BY4 A;  1CB1 A;  4MRX A;  5D69 A;  1WRZ A;  3KPX A;  1OQP A;  4OV2 A;  1ALV A;  4I5K A;  2L98 A;  1L2O B;  1TIZ A;  1NYA A;  2KBI A;  2LM5 A;  1UUS A;  3EK7 A;  5FYX A;  5KU1 A;  4WRI A;  2KGR A;  1NWD A;  1WRK A;  1UHK A;  1YR5 A;  4AOM A;  1J7O A;  1SL8 A;  2M1U A;  3CZT X;  1J55 A;  1KK7 Z;  4MN0 A;  1F4O A;  1QX5 B;  3DVE A;  5B8I B;  1RK9 A;  2KI4 B;  1K96 A;  1K8U A;  5JOL A;  3JTD B;  2MAZ A;  4GGF C;  1QXP A;  4MEW A;  2Y1M A;  1SCM B;  1RWY A;  1GQM A;  1XK4 C;  2MJW B;  2MLF C;  3PLF B;  4ETO A;  1F71 A;  4I5N B;  2CT9 A;  1QVI Y;  3IQO A;  2WOR A;  1HT9 A;  1TNW A;  5DKR A;  1SNL A;  2BE4 A;  3I5F B;  3F45 A;  4PHM A;  1BOD A;  3BUW B;  1NSH A;  1RRO A;  1HQV A;  2BCA A;  3D0Y A;  3CTN A;  3LL8 B;  1M63 B;  4OR9 B;  1WDC C;  3BYA A;  3DVK A;  1S5G Z;  2CTN A;  5HLO A;  1CLM A;  2K7D A;  1JUO A;  1WLZ A;  2I18 A;  3OX5 A;  3CWG A;  1QX2 A;  2L4I A;  4Q04 A;  1CDP A;  3I5H C;  2BL0 C;  2FCE A;  3OP0 A;  4E68 A;  1YUR A;  2JT3 A;  4PHN A;  1QLK A;  1AJ5 A;  4M2O A;  2HQW A;  3GK2 A;  3EK4 A;  1H4B A;  2JT8 A;  1TTX A;  2COL B;  1NP8 A;  2F3Z A;  1UHH A;  2L2E A;  2L50 A;  1QAT A;  1X02 A;  4MVF A;  2PSR A;  3SG7 A;  1CFP A;  1CDL A;  3ZNI A;  3A8R A;  1IJ5 A;  1CM4 A;  2F2O A;  2VRG A;  3BUO B;  1N0Y A;  1TN4 A;  2LNK A;  4C0K A;  1SR6 B;  1KFX L;  2NZ0 A;  2ZNE A;  1CTR A;  1J7Q A;  4PAL A;  5JJG A;  2R2I A;  1SPY A;  3TDU A;  3EVR A;  2BEC A;  3SG6 A;  2B1U A;  4C0J A;  1YVH A;  2BBN A;  2I94 A;  2GGZ A;  2HET A;  1KWO B;  3CGA A;  1J7R A;  1H8B A;  2LLT A;  3CS1 A;  3SIA A;  2LHI A;  1JFJ A;  1CMF A;  4CPV A;  2JQ6 A;  2FCD A;  1KFX S;  4N5X A;  2M97 A;  1G4Y R;  2CNP A;  1NX0 A;  1OMD A;  2SAS A;  1KQM C;  2L5X B;  3CLN A;  3WXA A;  2K8M B;  1NX1 A;  3ICB A;  5TNC A;  4MRY A;  4FQO A;  4QJ5 B;  2F2P A;  1KQV A;  3SG5 A;  1CDM A;  1OZO A;  1JSA A;  5BPJ A;  4ICB A;  4YGE B;  3RM1 A;  1ALW A;  2LCP A;  4PE0 A;  4AQJ A;  2ZN8 A;  2BKI B;  4MZK A;  1YUU A;  1N65 A;  4USL A;  4BY5 A;  4M2P A;  4QJ4 B;  1A2X A;  5K89 A;  4YGA A;  2G9B A;  3DVM A;  3LK0 A;  1QVI Z;  3GK4 X;  3OX6 A;  5HKW A;  1IJ6 A;  4A4B A;  3O4Y A;  5D7F A;  1OOJ A;  1EG4 A;  1DMO A;  2RGI A;  5I8N A;  3OB1 B;  3HX4 A;  1DJI A;  4JWQ A;  1AVS A;  1CLB A;  3EVU A;  3KO0 A;  2M9G A;  4DUQ A;  1A03 A;  4WQ3 A;  1BT6 A;  1NCY A;  3BUM B;  1B1G A;  2M3W A;  2Y4Q A;  2K2F A;  2NLN A;  1IGV A;  3PN7 C;  2MLE C;  2WCB A;  1BG1 A;  1M39 A;  1A75 B;  1JFK A;  4N1G A;  1B7T Y;  4CLN A;  5AFP A;  2O5G A;  3FWB A;  1K2H A;  2FJU B;  1DJG A;  1QTX A;  1TCF A;  3BOW B;  1OE9 B;  1G8I A;  1CDN A;  1GJY A;  4CFR A;  1NPQ A;  3I5I C;  1KFU L;  3TZ1 A;  3ZWH A;  2LC5 A;  2KAY A;  1J1E A;  1MXL C;  1REC A;  2DOQ A;  2LLS A;  2LV7 A;  3DVJ A;  1YTZ C;  3H4S E;  2F33 A;  2ZFD A;  3VRP A;  2KI6 C;  1CFC A;  1CFF A;  2Q91 A;  1B9A A;  3GK1 A;  1V1F A;  4YRU A;  1FI6 A;  5GQQ C;  1XVJ A;  1YX7 A;  4AQI A;  1UP5 A;  3VRO A;  3SG4 A;  4MSP A;  1Q80 A;  1DJW A;  1PVA A;  1MF8 B;  2KSP A;  4ORC B;  1ZFS A;  3I5H B;  2BL0 B;  2LVK A;  5HKY A;  2OTG C;  2OS8 C;  2KBM A;  1M46 A;  1C7V A;  1DF0 B;  2K7O A;  4GGN A;  1TNQ A;  1SL9 A;  1IH0 A;  4OVN F;  2H61 C;  4UPG A;  4GBA A;  2Y1N A;  2ZN9 A;  1EL4 A;  1G33 A;  4HRE E;  4MLW A;  2NXQ A;  4YBH B;  2JWW A;  1K9P A;  2ISD A;  1A75 A;  1OSA A;  2BCB A;  1UHN A;  3D10 A;  2EGD A;  3EK8 A;  5CPV A;  2LE9 B;  1A4P A;  2HQ8 A;  2JT0 A;  1ODB A;  3BOW A;  1ZOT B;  1CLL A;  1SW8 A;  1W7I B;  2WOS A;  4FTG A;  1PRW A;  1S6J A;  4D1E A;  2L4H A;  1KK8 B;  4PE7 A;  1BR1 B;  2Q4U A;  2EC6 C;  2O60 A;  1LA0 A;  2NCO A;  2MBX A;  1DJX A;  1XK4 A;  2MHH A;  4I5J A;  4CFQ A;  1OZS A;  4YGC B;  1R6P A;  4PDZ A;  5I2Q A;  3TDI A;  3WHT B;  2LVJ A;  1R2U A;  1QIV A;  4JQ0 D;  2LUC A;  2NCP A;  1UHI A;  4CID A;  2KI6 D;  3TUY C;  1BR4 B;  1FF1 A;  1XFZ O;  4DS7 A;  1IWQ A;  1CFD A;  1B7T Z;  1KQM B;  1S3P A;  1SKT A;  2LAP A;  2K2A A;  3TDZ A;  1Y1A A;  2K61 A;  5DKQ A;  4DCK A;  3IF7 A;  1YUS A;  2BBM A;  1PVB A;  1NCZ A;  4YGB B;  3PAT A;  2BCX A;  4M2Q A;  1C07 A;  2OPO A;  4C0L A;  1QAS A;  2PMY A;  3BUX B;  1IQ3 A;  2A4J A;  1RFJ A;  2KDH A;  3DD4 A;  2JRF A;  2GGM A;  4GUK A;  4DRW A;  1XFU O;  1TRF A;  2V53 A;  3E3R A;  5CSF A;  2TN4 A;  3HCM A;  1MQ1 A;  2AUC A;  1ZMZ A;  2KHN A;  3TS5 C;  3BQ3 A;  3K21 A;  3QRX A;  3M0W A;  2AAO A;  1U5I B;  3AKB A;  1BMO A;  1F4Q A;  2D8N A;  3PSR A;  1F55 A;  1GGW A;  4GFT A;  3AAK A;  4GNK B;  1PUL A;  4ZCV A;  2IS9 A;  1PAL A;  1ZAC A;  2H2K A;  3PN7 B;  4I5L B;  2G2B A;  4OCI A;  3NSK A;  1AK8 A;  3SG2 A;  1FPW A;  2QAC A;  1TCO B;  2LVI A;  2L51 A;  1D1O A;  1TNX A;  2KYF A;  2M49 B;  1K9U A;  1CKK A;  1SRA A;  4PE4 A;  5AXI A;  4R1E A;  1QLS A;  4PHJ A;  1WY9 A;  3I5I B;  1J7P A;  1S1E A;  4MBE A;  4HRH A;  1UWO A;  2JC2 A;  1OMV A;  3JVT C;  1IQ5 A;  4GAO A;  2LMT A;  1JBA A;  4PE1 A;  1YUT A;  4P2Y B;  5I2O A;  3EKJ A;  3EVV A;  2HPS A;  3NXA A;  5G08 A;  1W7J B;  3SJS A;  4U8D A;  3I5G C;  3DF0 B;  3BUN B;  1DT7 B;  4QJ3 B;  4GPL B;  2P6B B;  1PK0 D;  1JF0 A;  1S26 D;  1K93 D;  1FI5 A;  1DJZ A;  2JNX A;  2KQ6 A;  3LCP C;  4XJK B;  4A4C A;  5HKZ A;  1BF5 A;  3SIB A;  2M7N A;  2LP3 A;  1QIW A;  2LHL A;  1ZUZ A;  2OTG B;  3D0Y B;  1U5I A;  2FOT A;  1XFV O;  2OS8 B;  3LK1 A;  1MWN A;  4F0Z B;  1MUX A;  2EHB A;  3A4U B;  1DTL A;  1WRL A;  1JC2 A;  2AMI A;  1WDC B;  1EXR A;  2CXJ A;  1KFU S;  2MA2 A;  1SK6 D;  1NUB A;  3RLZ A;  1JF2 A;  1S36 A;  4IL1 A;  1SY9 A;  1SL7 A;  2PVB A;  1PSR A;  1F70 A;  5I2L A;  1LVC D;  3NSI A;  1SBJ A;  1B4C A;  4MZJ A;  1DJY A;  5DKN A;  3VGO A;  1QS7 A;  1IRJ A;  1YX8 A;  2LVV A;  2SCP A;  3EKH A;  4YI9 A;  1LIN A;  1BJF A;  2BKH B;  2EC6 B;  5AAN A;  1XFX O;  3FS7 A;  1KCY A;  1SYM A;  2JOJ A;  3PM8 A;  1MXE A;  3GOF A;  2PAL A;  2E30 A;  1F8H A;  1RTP 1;  1C7W A;  4NQG A;  3BXK A;  4ORA B;  2PAS A;  4ZCU A;  1WLM A;  3DF0 A;  4L9M A;  1L2O C;  3TUY B;  4ORB B;  4YI8 A;  3SG3 A;  1L7Z A;  1LXF C;  3NSO A;  3VRN A;  1B8L A;  1Y6W A;  1XFW O;  3NSL A;  2JXC A;  2K7C A;  2K0J A;  1K94 A;  2I2R E;  1AJ4 A;  4XJK A;  4GGF A;  1BLQ A;  3PFV A;  5AER A;  2M29 A;  1AUI B;  2KI4 C;  1XFY O;  1KSO A;  1CMG A;  1EH2 A;  4NDB A;  1PSB A;  3JTD C;  2QPT A;  4NDC A;  1BOC A;  2H61 A;  2M8U A;  1E8A A;  1SCM C;  1UUR A;  2JXL A;  3CR4 X;  4HRG A;  4TNC A;  1DGU A;  2CBL A;  2ZRT A;  1DJH A;  3TS5 B;  1K9K A;  2HF5 A;  1AHR A;  3I5F C;  1NX2 A;  5HYD A;  1Y0V H;  3O78 A;  4WQ2 A;  1F54 A;  5ER5 A;  4MZL A;  1Y1X A;  3O2P A;  1NCX A;  4DIR A;  1DF0 A;  2MRD A;  2ZKM X;  2BE6 A;  2F3Y A;  2M1K B;  2PRU A;  2JUL A;  1JWD A;  1CNP A;  2E6W A;  4YGD B;  2I7A A;  1KSM A;  1EG3 A;  4N1F A;  5KSZ A;  1TOP A;  1TNP A;  1KK8 C;  1KK7 Y;  2WCF A;  2KQY A;  1M45 A;  1K90 D;  2KGB C;  3CR5 X;  1BU3 A;  3AAJ A;  1MHO A;  2JPT A;  2KFG A;  1B47 A;  2KOT A;  4PHK A;  2LUX A;  3JVT B;  1EJ3 A;  1Y1U A;  1IG5 A;  3IQQ A;  1J1D A;  1VRK A;  2KAV A;  2JNF A;  1FBV A;  1YVL A;  3OHM B;  1V1G A;  1B8C A;  1SR6 C;  1M31 A;  3I5G B;  3O6B A;  2WCE A;  3VRR A;  4PCW A;  3WHU B;  2KYC A;  2M0R A;  2F8P A;  4NDD A;  1CM1 A;  2Y5I A;  2JTT A;  1N2D A;  1LKJ A;  1YRU B;  1IKU A;  3VRQ A;  1S5G Y;  1NX3 A;  2KAX A;  3KEV A;  3PAL A;  1S6C A;  2LLU A;  1S6I A;  2KFF A;  3KHE A;  1SMG A;  3FWC A;  4XYN A;  3WNX B;  1KWO C;  3FIA A;  1AP4 A;  5AEQ A;  1GGZ A;  3C1V A;  3AKA A;  5CSJ A;  2LAN A;  2M7L A;  2LP2 A;  4HSZ A;  1B8R A;  1NIW A;  4JPZ B;  3LLE A;  2JZI A;  1XYD A;  1YRT B;  2CCM A;  2KFH A;  2GV5 A;  2JTZ A; 
#chains in the Genus database with same CATH topology
 1TUJ A;  2WC8 A;  1OOF A;  1QV1 A;  1LA3 A;  1XO5 A;  2JU0 A;  1MR8 A;  5KTY A;  1QV0 A;  3CR2 A;  5ER4 X;  5F6T A;  1DVI A;  1XA5 A;  1SCV A;  3L47 A;  4OKH A;  5PAL A;  2ZRS A;  1DGV A;  2L0P A;  3B7A A;  5CSI A;  3OB2 B;  5HLV A;  3R1P A;  1A29 A;  2KNE A;  5IBW A;  1QJT A;  1K95 A;  3S0G A;  2K7B A;  2LMV A;  1FW4 A;  3SS3 A;  1QX7 A;  4P5O E;  5J3X A;  1OMR A;  2ZND A;  1RJV A;  2WND A;  5CSN A;  1UHJ A;  2LMU A;  3KF9 A;  3MSE B;  4BY4 A;  1CB1 A;  4MRX A;  5D69 A;  1WRZ A;  3KPX A;  1OQP A;  4OV2 A;  1ALV A;  1TUZ A;  4I5K A;  2L98 A;  1L2O B;  1TIZ A;  2QEV A;  1NYA A;  1XFR A;  2KBI A;  1UUS A;  2LM5 A;  3EK7 A;  3K1E A;  4WRI A;  5FYX A;  5KU1 A;  2KGR A;  1NWD A;  1WRK A;  1UHK A;  1YR5 A;  3R72 A;  4AOM A;  1J7O A;  1SL8 A;  2M1U A;  3CZT X;  1J55 A;  1KK7 Z;  4MN0 A;  1F4O A;  1QX5 B;  3DVE A;  2QEO A;  5B8I B;  3CDN A;  1RK9 A;  2KI4 B;  3OGN A;  1K96 A;  3SS5 A;  3UO9 A;  1K8U A;  4OZD A;  3PM2 A;  5JOL A;  3JTD B;  2MAZ A;  4GGF C;  1QXP A;  4MEW A;  2Y1M A;  1SCM B;  1RWY A;  1GQM A;  1XK4 C;  2MJW B;  2MLF C;  3PLF B;  4ETO A;  3BFA A;  4I5N B;  1F71 A;  4INX A;  2CT9 A;  1QVI Y;  3IQO A;  3N7H A;  4FQT A;  2WOR A;  1HT9 A;  1TNW A;  5DKR A;  1SNL A;  2BE4 A;  3I5F B;  3NGV A;  3F45 A;  4PHM A;  1BOD A;  4F7F A;  3BUW B;  1NSH A;  1RRO A;  1HQV A;  2BCA A;  3D0Y A;  3CTN A;  3LL8 B;  1M63 B;  4OR9 B;  3S0B A;  1WDC C;  3BYA A;  3DVK A;  1S5G Z;  2CTN A;  5HLO A;  1CLM A;  2K7D A;  1JUO A;  1WLZ A;  2I18 A;  3OX5 A;  3CWG A;  2KLD A;  1QX2 A;  2L4I A;  4Q04 A;  1CDP A;  3I5H C;  2BL0 C;  2FCE A;  3CZ0 A;  3OP0 A;  1YUR A;  2JT3 A;  4PHN A;  1QLK A;  4E68 A;  1AJ5 A;  4M2O A;  2HQW A;  3GK2 A;  3EK4 A;  1H4B A;  2JT8 A;  1TTX A;  2COL B;  2BAP A;  1NP8 A;  2F3Z A;  1UHH A;  2L2E A;  2L50 A;  1QAT A;  1X02 A;  3FE9 A;  4MVF A;  2PSR A;  3SG7 A;  1CFP A;  1CDL A;  1OOI X;  3ZNI A;  3A8R A;  1IJ5 A;  1CM4 A;  2F2O A;  2VRG A;  3BUO B;  1N0Y A;  1TN4 A;  2LNK A;  4C0K A;  1SR6 B;  1KFX L;  2NZ0 A;  2ZNE A;  1CTR A;  1J7Q A;  4PAL A;  5JJG A;  2R2I A;  1SPY A;  3TDU A;  3EVR A;  2BEC A;  3SG6 A;  2B1U A;  4C0J A;  1YVH A;  2BBN A;  2I94 A;  2QEB A;  1C3Z A;  2GGZ A;  2HET A;  1KWO B;  3CGA A;  1J7R A;  1H8B A;  2LLT A;  3CS1 A;  3SIA A;  2LHI A;  1JFJ A;  1LS8 A;  1CMF A;  4CPV A;  2JQ6 A;  2FCD A;  1KFX S;  2JPO A;  4N5X A;  2M97 A;  1G4Y R;  4IJ7 A;  2CNP A;  1NX0 A;  1OMD A;  2SAS A;  1KQM C;  2L5X B;  3CLN A;  2WC5 A;  3WXA A;  2K8M B;  1NX1 A;  3ICB A;  2WCL A;  5TNC A;  3CZ1 A;  3B88 A;  4FQO A;  4MRY A;  2F2P A;  4QJ5 B;  1KQV A;  3SG5 A;  1CDM A;  1OZO A;  1JSA A;  5BPJ A;  4ICB A;  4YGE B;  3RM1 A;  1ALW A;  2LCP A;  4PE0 A;  4AQJ A;  2ZN8 A;  2BKI B;  4MZK A;  1YUU A;  1N65 A;  4USL A;  3BJH A;  4M2P A;  4BY5 A;  4QJ4 B;  1A2X A;  3OBV A;  5K89 A;  4YGA A;  2G9B A;  3DVM A;  3LK0 A;  1QVI Z;  3GK4 X;  3OX6 A;  5D3O A;  5HKW A;  1IJ6 A;  4A4B A;  3O4Y A;  5D7F A;  1OOJ A;  1EG4 A;  1DMO A;  2RGI A;  5I8N A;  3OB1 B;  3HX4 A;  1DJI A;  4JWQ A;  1AVS A;  3D74 A;  1CLB A;  3EVU A;  2GTE A;  3KO0 A;  2M9G A;  4DUQ A;  1A03 A;  4WQ3 A;  1BT6 A;  1NCY A;  3BUM B;  1B1G A;  2M3W A;  2Y4Q A;  2K2F A;  2NLN A;  1IGV A;  3PN7 C;  2MLE C;  2WCB A;  1BG1 A;  2QDI A;  1M39 A;  1A75 B;  1JFK A;  4N1G A;  1B7T Y;  4CLN A;  5AFP A;  2O5G A;  3FWB A;  1K2H A;  2FJU B;  1DJG A;  1QTX A;  1TCF A;  3BOW B;  1OE9 B;  1G8I A;  3DZT A;  1CDN A;  5FI6 A;  1GJY A;  4CFR A;  1NPQ A;  3I5I C;  1KFU L;  3TZ1 A;  3ZWH A;  2LC5 A;  2KAY A;  2WC6 A;  1J1E A;  1MXL C;  1REC A;  2DOQ A;  2LLS A;  2LV7 A;  3DVJ A;  1YTZ C;  3H4S E;  2F33 A;  2ZFD A;  3VRP A;  2KI6 C;  1CFC A;  1CFF A;  2Q91 A;  1B9A A;  3GK1 A;  1V1F A;  4YRU A;  1FI6 A;  5GQQ C;  1XVJ A;  1YX7 A;  4AQI A;  1UP5 A;  3D75 A;  3VRO A;  3SG4 A;  4MSP A;  3R1O A;  1Q80 A;  1DJW A;  1PVA A;  1MF8 B;  5DIC A;  2KSP A;  4ORC B;  1ZFS A;  3I5H B;  2BL0 B;  2LVK A;  5HKY A;  2OTG C;  2OS8 C;  2KBM A;  1M46 A;  1OOH A;  1DF0 B;  2K7O A;  2L2C A;  4GGN A;  1C7V A;  1TNQ A;  1SL9 A;  1IH0 A;  4OVN F;  2H61 C;  4UPG A;  4GBA A;  2Y1N A;  2ZN9 A;  1EL4 A;  1G33 A;  4HRE E;  4MLW A;  2NXQ A;  5FI2 A;  1GM0 A;  4YBH B;  2JWW A;  1K9P A;  2ISD A;  1A75 A;  1OSA A;  2BCB A;  3B86 A;  1UHN A;  3D10 A;  2EGD A;  3EK8 A;  5CPV A;  2LE9 B;  3D76 A;  1A4P A;  2HQ8 A;  4PT1 A;  2JT0 A;  1ODB A;  3BOW A;  2ERB A;  2KLE A;  1ZOT B;  1CLL A;  1SW8 A;  1W7I B;  2WOS A;  4FTG A;  1PRW A;  1S6J A;  4D1E A;  2L4H A;  1KK8 B;  2WCH A;  4PE7 A;  3S0A A;  1BR1 B;  2Q4U A;  2EC6 C;  2O60 A;  1LA0 A;  2WCJ A;  1T14 A;  2NCO A;  2MBX A;  1DJX A;  1XK4 A;  2MHH A;  3IVT A;  4I5J A;  3Q8I A;  4CFQ A;  1OZS A;  3RZS A;  2K60 A;  4YGC B;  1R6P A;  4PDZ A;  3VB1 A;  5I2Q A;  1DEK A;  3TDI A;  1QWV A;  2LVJ A;  3WHT B;  3S0F A;  1R2U A;  1QIV A;  4JQ0 D;  2LUC A;  2NCP A;  1UHI A;  4CID A;  2KI6 D;  3TUY C;  1BR4 B;  1FF1 A;  1XFZ O;  4DS7 A;  1IWQ A;  3SS4 A;  1CFD A;  1B7T Z;  1KQM B;  1S3P A;  1SKT A;  2LAP A;  2K2A A;  5FI7 A;  3TDZ A;  1Y1A A;  2K61 A;  5DKQ A;  4DCK A;  3IF7 A;  1YUS A;  2BBM A;  1PVB A;  5I94 A;  1NCZ A;  2PQL A;  4YGB B;  1W9Z A;  3PAT A;  3PJI A;  2BCX A;  4M2Q A;  2P71 A;  3DY9 A;  2OPO A;  4C0L A;  1QAS A;  2PMY A;  3BUX B;  1IQ3 A;  1C07 A;  2A4J A;  1RFJ A;  2KDH A;  4KYN A;  3DD4 A;  2JRF A;  2GGM A;  4GUK A;  4DRW A;  1XFU O;  1TRF A;  2V53 A;  4INW A;  3E3R A;  5CSF A;  2TN4 A;  3L4L A;  3HCM A;  1MQ1 A;  1Z2C B;  2AUC A;  1ZMZ A;  2KHN A;  3BFH A;  3QME A;  3TS5 C;  3BQ3 A;  3K21 A;  3QRX A;  3M0W A;  2AAO A;  1U5I B;  3AKB A;  1BMO A;  1F4Q A;  2D8N A;  3PSR A;  1F55 A;  1GGW A;  4GFT A;  3AAK A;  4GNK B;  1PUL A;  4ZCV A;  1DC1 A;  2IS9 A;  1PAL A;  1ZAC A;  2H2K A;  3PN7 B;  4I5L B;  2G2B A;  4OCI A;  3NSK A;  1AK8 A;  3SG2 A;  3DXL A;  1FPW A;  2QAC A;  1TCO B;  2LVI A;  2L51 A;  1D1O A;  1TNX A;  2KYF A;  2M49 B;  1K9U A;  3D73 A;  3L4A A;  1CKK A;  1SRA A;  4PE4 A;  5AXI A;  4R1E A;  1QLS A;  4PHJ A;  1OW4 A;  1WY9 A;  3I5I B;  1J7P A;  3O4X A;  1S1E A;  4MBE A;  4HRH A;  1UWO A;  2JC2 A;  1OMV A;  3JVT C;  2H8V A;  1IQ5 A;  5HL1 A;  4GAO A;  2LMT A;  1JBA A;  4PE1 A;  1YUT A;  4P2Y B;  5I2O A;  3EKJ A;  3EVV A;  2HPS A;  3NXA A;  5G08 A;  1W7J B;  3SJS A;  4U8D A;  3I5G C;  3DF0 B;  1DQE A;  2BNX A;  3BUN B;  4QJ3 B;  3D77 A;  1DT7 B;  4GPL B;  2P6B B;  1PK0 D;  1JF0 A;  1S26 D;  1K93 D;  1FI5 A;  1DJZ A;  2JNX A;  2KQ6 A;  3CAB A;  3LCP C;  4XJK B;  4A4C A;  5HKZ A;  1BF5 A;  3EG5 B;  3SIB A;  3UNW A;  2M7N A;  2LP3 A;  1QIW A;  3R1V A;  2LHL A;  1ZUZ A;  2OTG B;  3D0Y B;  1U5I A;  2FOT A;  1XFV O;  2OS8 B;  3CZ2 A;  3LK1 A;  1MWN A;  4F0Z B;  1MUX A;  2EHB A;  2FJY A;  3A4U B;  1DTL A;  1WRL A;  2PYQ A;  1JC2 A;  2AMI A;  1WDC B;  1EXR A;  2CXJ A;  1KFU S;  2MA2 A;  1C3Y A;  1SK6 D;  1NUB A;  3RLZ A;  3FE6 A;  1JF2 A;  1S36 A;  4IL1 A;  1SY9 A;  1SL7 A;  2PVB A;  1PSR A;  1F70 A;  4JKT A;  5I2L A;  1LVC D;  3NSI A;  1SBJ A;  2L5Y A;  1B4C A;  4MZJ A;  1DJY A;  5DKN A;  3VGO A;  1QS7 A;  1IRJ A;  1YX8 A;  2LVV A;  2SCP A;  3EKH A;  4YI9 A;  1LIN A;  1BJF A;  2BKH B;  2EC6 B;  5AAN A;  1XFX O;  3FS7 A;  1KCY A;  1SYM A;  2JOJ A;  3PM8 A;  2QEH A;  1TWO A;  1MXE A;  3BFB A;  3GOF A;  2PAL A;  2E30 A;  1F8H A;  1RTP 1;  1C7W A;  4NQG A;  3BXK A;  4ORA B;  2PAS A;  4ZCU A;  1P28 A;  1WLM A;  3DF0 A;  4L9M A;  1L2O C;  3DYE A;  3TUY B;  4ORB B;  4YI8 A;  3SG3 A;  1L7Z A;  1LXF C;  3NSO A;  3VRN A;  1B8L A;  1Y6W A;  1XFW O;  3NSL A;  2JXC A;  2K7C A;  2K0J A;  1K94 A;  2I2R E;  1AJ4 A;  3CYZ A;  4GGF A;  4XJK A;  1DEL A;  1BLQ A;  4JD9 A;  3PFV A;  5AER A;  2M29 A;  3NHT A;  1AUI B;  2KI4 C;  1XFY O;  1KSO A;  3V2L A;  1CMG A;  1EH2 A;  4NDB A;  1PSB A;  3JTD C;  2QPT A;  4NDC A;  1BOC A;  2H61 A;  2M8U A;  1E8A A;  3S0D A;  1SCM C;  1UUR A;  2JXL A;  3CR4 X;  4HRG A;  4TNC A;  1DGU A;  2CBL A;  2ZRT A;  1DJH A;  3TS5 B;  1IIO A;  1K9K A;  2HF5 A;  1AHR A;  3I5F C;  1NX2 A;  5HYD A;  1Y0V H;  2KPH A;  3O78 A;  4WQ2 A;  1F54 A;  5ER5 A;  4MZL A;  1Y1X A;  3O2P A;  1NCX A;  4DIR A;  1DF0 A;  2MRD A;  2P70 A;  2ZKM X;  3FE8 A;  2BE6 A;  2F3Y A;  2M1K B;  2PRU A;  2JUL A;  1JWD A;  1CNP A;  2E6W A;  4YGD B;  2I7A A;  5EL2 A;  3B6X A;  1KSM A;  1EG3 A;  2YGU A;  4N1F A;  5KSZ A;  1TOP A;  1TNP A;  1KK8 C;  1KK7 Y;  2WCF A;  2KQY A;  1M45 A;  1K90 D;  2KGB C;  3B87 A;  3CR5 X;  1BU3 A;  1ORG A;  3AAJ A;  1MHO A;  2JPT A;  2KFG A;  1B47 A;  2KOT A;  3D78 A;  2LUX A;  4PHK A;  3JVT B;  1EJ3 A;  1Y1U A;  1IG5 A;  3IQQ A;  1J1D A;  1VRK A;  2KAV A;  2WCM A;  2JNF A;  1FBV A;  1YVL A;  3S0E A;  3OHM B;  1V1G A;  1B8C A;  1SR6 C;  1M31 A;  3I5G B;  3O6B A;  2WCE A;  3NHI A;  3VRR A;  4PCW A;  1SSE B;  3WHU B;  2KYC A;  2WCK A;  2M0R A;  2F8P A;  4NDD A;  1CM1 A;  2Y5I A;  2JTT A;  1N2D A;  1LKJ A;  1YRU B;  1IKU A;  3VRQ A;  1S5G Y;  1NX3 A;  2KAX A;  3KEV A;  3PAL A;  1S6C A;  2LLU A;  1S6I A;  2KFF A;  3KHE A;  1SMG A;  3FWC A;  4XYN A;  3WNX B;  1KWO C;  3FIA A;  1AP4 A;  5AEQ A;  1GGZ A;  3C1V A;  3AKA A;  5CSJ A;  2LAN A;  2M7L A;  2LP2 A;  1OOG A;  4HSZ A;  1Z4H A;  1B8R A;  1NIW A;  4JPZ B;  3LLE A;  2JZI A;  1XYD A;  1YRT B;  2CCM A;  2KFH A;  2GV5 A;  2JTZ A; 
#chains in the Genus database with same CATH homology
 2WC8 A;  1QV1 A;  1LA3 A;  1XO5 A;  2JU0 A;  1MR8 A;  5KTY A;  1QV0 A;  3CR2 A;  5ER4 X;  5F6T A;  1DVI A;  1XA5 A;  1SCV A;  4OKH A;  5PAL A;  2ZRS A;  1DGV A;  2L0P A;  5CSI A;  3OB2 B;  5HLV A;  1A29 A;  2KNE A;  5IBW A;  1QJT A;  1K95 A;  2K7B A;  2LMV A;  1FW4 A;  1QX7 A;  4P5O E;  5J3X A;  1OMR A;  2ZND A;  1RJV A;  2WND A;  5CSN A;  1UHJ A;  2LMU A;  3KF9 A;  3MSE B;  4BY4 A;  1CB1 A;  4MRX A;  5D69 A;  1WRZ A;  3KPX A;  1OQP A;  4OV2 A;  1ALV A;  4I5K A;  2L98 A;  1L2O B;  1TIZ A;  1NYA A;  2KBI A;  2LM5 A;  1UUS A;  3EK7 A;  5FYX A;  5KU1 A;  4WRI A;  2KGR A;  1NWD A;  1WRK A;  1UHK A;  1YR5 A;  4AOM A;  1J7O A;  1SL8 A;  2M1U A;  3CZT X;  1J55 A;  1KK7 Z;  4MN0 A;  1F4O A;  1QX5 B;  3DVE A;  5B8I B;  1RK9 A;  2KI4 B;  1K96 A;  1K8U A;  5JOL A;  3JTD B;  2MAZ A;  4GGF C;  1QXP A;  4MEW A;  2Y1M A;  1SCM B;  1RWY A;  1GQM A;  1XK4 C;  2MJW B;  2MLF C;  3PLF B;  4ETO A;  1F71 A;  4I5N B;  2CT9 A;  1QVI Y;  3IQO A;  2WOR A;  1HT9 A;  1TNW A;  5DKR A;  1SNL A;  2BE4 A;  3I5F B;  3F45 A;  4PHM A;  1BOD A;  3BUW B;  1NSH A;  1RRO A;  1HQV A;  2BCA A;  3D0Y A;  3CTN A;  3LL8 B;  1M63 B;  4OR9 B;  1WDC C;  3BYA A;  3DVK A;  1S5G Z;  2CTN A;  5HLO A;  1CLM A;  2K7D A;  1JUO A;  1WLZ A;  2I18 A;  3OX5 A;  3CWG A;  1QX2 A;  2L4I A;  4Q04 A;  1CDP A;  3I5H C;  2BL0 C;  2FCE A;  3OP0 A;  4E68 A;  1YUR A;  2JT3 A;  4PHN A;  1QLK A;  1AJ5 A;  4M2O A;  2HQW A;  3GK2 A;  3EK4 A;  1H4B A;  2JT8 A;  1TTX A;  2COL B;  1NP8 A;  2F3Z A;  1UHH A;  2L2E A;  2L50 A;  1QAT A;  1X02 A;  4MVF A;  2PSR A;  3SG7 A;  1CFP A;  1CDL A;  3ZNI A;  3A8R A;  1IJ5 A;  1CM4 A;  2F2O A;  2VRG A;  3BUO B;  1N0Y A;  1TN4 A;  2LNK A;  4C0K A;  1SR6 B;  1KFX L;  2NZ0 A;  2ZNE A;  1CTR A;  1J7Q A;  4PAL A;  5JJG A;  2R2I A;  1SPY A;  3TDU A;  3EVR A;  2BEC A;  3SG6 A;  2B1U A;  4C0J A;  1YVH A;  2BBN A;  2I94 A;  2GGZ A;  2HET A;  1KWO B;  3CGA A;  1J7R A;  1H8B A;  2LLT A;  3CS1 A;  3SIA A;  2LHI A;  1JFJ A;  1CMF A;  4CPV A;  2JQ6 A;  2FCD A;  1KFX S;  4N5X A;  2M97 A;  1G4Y R;  2CNP A;  1NX0 A;  1OMD A;  2SAS A;  1KQM C;  2L5X B;  3CLN A;  3WXA A;  2K8M B;  1NX1 A;  3ICB A;  5TNC A;  4MRY A;  4FQO A;  4QJ5 B;  2F2P A;  1KQV A;  3SG5 A;  1CDM A;  1OZO A;  1JSA A;  5BPJ A;  4ICB A;  4YGE B;  3RM1 A;  1ALW A;  2LCP A;  4PE0 A;  4AQJ A;  2ZN8 A;  2BKI B;  4MZK A;  1YUU A;  1N65 A;  4USL A;  4BY5 A;  4M2P A;  4QJ4 B;  1A2X A;  5K89 A;  4YGA A;  2G9B A;  3DVM A;  3LK0 A;  1QVI Z;  3GK4 X;  3OX6 A;  5HKW A;  1IJ6 A;  4A4B A;  3O4Y A;  5D7F A;  1OOJ A;  1EG4 A;  1DMO A;  2RGI A;  5I8N A;  3OB1 B;  3HX4 A;  1DJI A;  4JWQ A;  1AVS A;  1CLB A;  3EVU A;  3KO0 A;  2M9G A;  4DUQ A;  1A03 A;  4WQ3 A;  1BT6 A;  1NCY A;  3BUM B;  1B1G A;  2M3W A;  2Y4Q A;  2K2F A;  2NLN A;  1IGV A;  3PN7 C;  2MLE C;  2WCB A;  1BG1 A;  1M39 A;  1A75 B;  1JFK A;  4N1G A;  1B7T Y;  4CLN A;  5AFP A;  2O5G A;  3FWB A;  1K2H A;  2FJU B;  1DJG A;  1QTX A;  1TCF A;  3BOW B;  1OE9 B;  1G8I A;  1CDN A;  1GJY A;  4CFR A;  1NPQ A;  3I5I C;  1KFU L;  3TZ1 A;  3ZWH A;  2LC5 A;  2KAY A;  1J1E A;  1MXL C;  1REC A;  2DOQ A;  2LLS A;  2LV7 A;  3DVJ A;  1YTZ C;  3H4S E;  2F33 A;  2ZFD A;  3VRP A;  2KI6 C;  1CFC A;  1CFF A;  2Q91 A;  1B9A A;  3GK1 A;  1V1F A;  4YRU A;  1FI6 A;  5GQQ C;  1XVJ A;  1YX7 A;  4AQI A;  1UP5 A;  3VRO A;  3SG4 A;  4MSP A;  1Q80 A;  1DJW A;  1PVA A;  1MF8 B;  2KSP A;  4ORC B;  1ZFS A;  3I5H B;  2BL0 B;  2LVK A;  5HKY A;  2OTG C;  2OS8 C;  2KBM A;  1M46 A;  1C7V A;  1DF0 B;  2K7O A;  4GGN A;  1TNQ A;  1SL9 A;  1IH0 A;  4OVN F;  2H61 C;  4UPG A;  4GBA A;  2Y1N A;  2ZN9 A;  1EL4 A;  1G33 A;  4HRE E;  4MLW A;  2NXQ A;  4YBH B;  2JWW A;  1K9P A;  2ISD A;  1A75 A;  1OSA A;  2BCB A;  1UHN A;  3D10 A;  2EGD A;  3EK8 A;  5CPV A;  2LE9 B;  1A4P A;  2HQ8 A;  2JT0 A;  1ODB A;  3BOW A;  1ZOT B;  1CLL A;  1SW8 A;  1W7I B;  2WOS A;  4FTG A;  1PRW A;  1S6J A;  4D1E A;  2L4H A;  1KK8 B;  4PE7 A;  1BR1 B;  2Q4U A;  2EC6 C;  2O60 A;  1LA0 A;  2NCO A;  2MBX A;  1DJX A;  1XK4 A;  2MHH A;  4I5J A;  4CFQ A;  1OZS A;  4YGC B;  1R6P A;  4PDZ A;  5I2Q A;  3TDI A;  3WHT B;  2LVJ A;  1R2U A;  1QIV A;  4JQ0 D;  2LUC A;  2NCP A;  1UHI A;  4CID A;  2KI6 D;  3TUY C;  1BR4 B;  1FF1 A;  1XFZ O;  4DS7 A;  1IWQ A;  1CFD A;  1B7T Z;  1KQM B;  1S3P A;  1SKT A;  2LAP A;  2K2A A;  3TDZ A;  1Y1A A;  2K61 A;  5DKQ A;  4DCK A;  3IF7 A;  1YUS A;  2BBM A;  1PVB A;  1NCZ A;  4YGB B;  3PAT A;  2BCX A;  4M2Q A;  1C07 A;  2OPO A;  4C0L A;  1QAS A;  2PMY A;  3BUX B;  1IQ3 A;  2A4J A;  1RFJ A;  2KDH A;  3DD4 A;  2JRF A;  2GGM A;  4GUK A;  4DRW A;  1XFU O;  1TRF A;  2V53 A;  3E3R A;  5CSF A;  2TN4 A;  3HCM A;  1MQ1 A;  2AUC A;  1ZMZ A;  2KHN A;  3TS5 C;  3BQ3 A;  3K21 A;  3QRX A;  3M0W A;  2AAO A;  1U5I B;  3AKB A;  1BMO A;  1F4Q A;  2D8N A;  3PSR A;  1F55 A;  1GGW A;  4GFT A;  3AAK A;  4GNK B;  1PUL A;  4ZCV A;  2IS9 A;  1PAL A;  1ZAC A;  2H2K A;  3PN7 B;  4I5L B;  2G2B A;  4OCI A;  3NSK A;  1AK8 A;  3SG2 A;  1FPW A;  2QAC A;  1TCO B;  2LVI A;  2L51 A;  1D1O A;  1TNX A;  2KYF A;  2M49 B;  1K9U A;  1CKK A;  1SRA A;  4PE4 A;  5AXI A;  4R1E A;  1QLS A;  4PHJ A;  1WY9 A;  3I5I B;  1J7P A;  1S1E A;  4MBE A;  4HRH A;  1UWO A;  2JC2 A;  1OMV A;  3JVT C;  1IQ5 A;  4GAO A;  2LMT A;  1JBA A;  4PE1 A;  1YUT A;  4P2Y B;  5I2O A;  3EKJ A;  3EVV A;  2HPS A;  3NXA A;  5G08 A;  1W7J B;  3SJS A;  4U8D A;  3I5G C;  3DF0 B;  3BUN B;  1DT7 B;  4QJ3 B;  4GPL B;  2P6B B;  1PK0 D;  1JF0 A;  1S26 D;  1K93 D;  1FI5 A;  1DJZ A;  2JNX A;  2KQ6 A;  3LCP C;  4XJK B;  4A4C A;  5HKZ A;  1BF5 A;  3SIB A;  2M7N A;  2LP3 A;  1QIW A;  2LHL A;  1ZUZ A;  2OTG B;  3D0Y B;  1U5I A;  2FOT A;  1XFV O;  2OS8 B;  3LK1 A;  1MWN A;  4F0Z B;  1MUX A;  2EHB A;  3A4U B;  1DTL A;  1WRL A;  1JC2 A;  2AMI A;  1WDC B;  1EXR A;  2CXJ A;  1KFU S;  2MA2 A;  1SK6 D;  1NUB A;  3RLZ A;  1JF2 A;  1S36 A;  4IL1 A;  1SY9 A;  1SL7 A;  2PVB A;  1PSR A;  1F70 A;  5I2L A;  1LVC D;  3NSI A;  1SBJ A;  1B4C A;  4MZJ A;  1DJY A;  5DKN A;  3VGO A;  1QS7 A;  1IRJ A;  1YX8 A;  2LVV A;  2SCP A;  3EKH A;  4YI9 A;  1LIN A;  1BJF A;  2BKH B;  2EC6 B;  5AAN A;  1XFX O;  3FS7 A;  1KCY A;  1SYM A;  2JOJ A;  3PM8 A;  1MXE A;  3GOF A;  2PAL A;  2E30 A;  1F8H A;  1RTP 1;  1C7W A;  4NQG A;  3BXK A;  4ORA B;  2PAS A;  4ZCU A;  1WLM A;  3DF0 A;  4L9M A;  1L2O C;  3TUY B;  4ORB B;  4YI8 A;  3SG3 A;  1L7Z A;  1LXF C;  3NSO A;  3VRN A;  1B8L A;  1Y6W A;  1XFW O;  3NSL A;  2JXC A;  2K7C A;  2K0J A;  1K94 A;  2I2R E;  1AJ4 A;  4XJK A;  4GGF A;  1BLQ A;  3PFV A;  5AER A;  2M29 A;  1AUI B;  2KI4 C;  1XFY O;  1KSO A;  1CMG A;  1EH2 A;  4NDB A;  1PSB A;  3JTD C;  2QPT A;  4NDC A;  1BOC A;  2H61 A;  2M8U A;  1E8A A;  1SCM C;  1UUR A;  2JXL A;  3CR4 X;  4HRG A;  4TNC A;  1DGU A;  2CBL A;  2ZRT A;  1DJH A;  3TS5 B;  1K9K A;  2HF5 A;  1AHR A;  3I5F C;  1NX2 A;  5HYD A;  1Y0V H;  3O78 A;  4WQ2 A;  1F54 A;  5ER5 A;  4MZL A;  1Y1X A;  3O2P A;  1NCX A;  4DIR A;  1DF0 A;  2MRD A;  2ZKM X;  2BE6 A;  2F3Y A;  2M1K B;  2PRU A;  2JUL A;  1JWD A;  1CNP A;  2E6W A;  4YGD B;  2I7A A;  1KSM A;  1EG3 A;  4N1F A;  5KSZ A;  1TOP A;  1TNP A;  1KK8 C;  1KK7 Y;  2WCF A;  2KQY A;  1M45 A;  1K90 D;  2KGB C;  3CR5 X;  1BU3 A;  3AAJ A;  1MHO A;  2JPT A;  2KFG A;  1B47 A;  2KOT A;  4PHK A;  2LUX A;  3JVT B;  1EJ3 A;  1Y1U A;  1IG5 A;  3IQQ A;  1J1D A;  1VRK A;  2KAV A;  2JNF A;  1FBV A;  1YVL A;  3OHM B;  1V1G A;  1B8C A;  1SR6 C;  1M31 A;  3I5G B;  3O6B A;  2WCE A;  3VRR A;  4PCW A;  3WHU B;  2KYC A;  2M0R A;  2F8P A;  4NDD A;  1CM1 A;  2Y5I A;  2JTT A;  1N2D A;  1LKJ A;  1YRU B;  1IKU A;  3VRQ A;  1S5G Y;  1NX3 A;  2KAX A;  3KEV A;  3PAL A;  1S6C A;  2LLU A;  1S6I A;  2KFF A;  3KHE A;  1SMG A;  3FWC A;  4XYN A;  3WNX B;  1KWO C;  3FIA A;  1AP4 A;  5AEQ A;  1GGZ A;  3C1V A;  3AKA A;  5CSJ A;  2LAN A;  2M7L A;  2LP2 A;  4HSZ A;  1B8R A;  1NIW A;  4JPZ B;  3LLE A;  2JZI A;  1XYD A;  1YRT B;  2CCM A;  2KFH A;  2GV5 A;  2JTZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...