2BKHB

Myosin vi nucleotide-free (mdinsert2) crystal structure
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
145
structure length
137
Chain Sequence
QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UNCONVENTIONAL MYOSIN
publication title The Structure of the Myosin Vi Motor Reveals the Mechanism of Directionality Reversal
pubmed doi rcsb
source organism Sus scrofa
molecule tags Motor protein/metal-binding protein
total genus 36
structure length 137
sequence length 145
ec nomenclature
pdb deposition date 2005-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2bkhB01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2bkhB02
4PE4A 5HLOA 2E6WA 1AVSA 3SJSA 3MSEB 1DT7B 1F71A 3BUNB 2ZKMX 3SG7A 2BL0B 1UHHA 3JTDC 2LNKA 1BODA 2L98A 1LVCD 1XFVO 2MJWB 1SRAA 4PDZA 4MRXA 2LVIA 1RK9A 3EVRA 3C1VA 2LVKA 2JOJA 2PASA 1CMGA 1CFPA 1IKUA 2ZFDA 1DVIA 1OQPA 4ORAB 2K7OA 1MUXA 1Q80A 2BKIB 3WXAA 1KWOB 1F55A 4DUQA 4I5NB 2K7CA 3D0YA 1NIWA 2DOQA 1NX2A 1AHRA 2LVVA 2A4JA 2JT0A 1BT6A 1A29A 1A4PA 2L0PA 1CKKA 1TNWA 3PSRA 5ER5A 4PCWA 1AJ4A 1RJVA 2FCDA 4DCKA 3CR2A 4M2PA 1KCYA 1SL8A 3BUXB 2M1KB 1CM4A 1C7VA 2MLEC 1F8HA 4WRIA 4JWQA 4D1EA 2JXCA 1B9AA 1KFUS 1TN4A 1CFCA 2Q91A 3KO0A 2L5XB 2F3ZA 1QATA 1J1EA 3TDUA 1FPWA 3LCPC 2KYFA 2D8NA 2Y1NA 3DVEA 3NSOA 5KTYA 4DS7A 1CFFA 5I2QA 4DRWA 1QVIZ 1Y0VH 3DVJA 3OB2B 1DTLA 1CLBA 2B1UA 2JZIA 1S6IA 2WCBA 3ZWHA 1C07A 2KFHA 3GK2A 4MZKA 4I5JA 3OX6A 4WQ2A 2JNXA 1LA0A 3E3RA 1CDNA 1DJXA 5G08A 1NYAA 1XYDA 1Y6WA 2LMTA 1EL4A 1S26D 2ZN9A 1DGVA 3VRPA 2BKHB 1GGWA 1SW8A 3BOWA 3HCMA 4I5LB 5DKNA 2KAVA 1B8LA 4CFRA 1K90D 2AMIA 2BBMA 1CNPA 4A4CA 3IQQA 3TS5C 1QXPA 2WOSA 4XJKA 5AEQA 1KFUL 1XFXO 2LHIA 1S6CA 3EK7A 1IRJA 3LLEA 4C0JA 4P5OE 1DJYA 1NCZA 2NLNA 3TUYC 3CZTX 1JWDA 4E68A 2KAXA 2LP3A 2LC5A 1DJWA 1GGZA 1SCMB 3FWCA 4TNCA 4YGDB 1ZUZA 2BL0C 1TNPA 1CDMA 2BECA 1ZOTB 1EXRA 1BLQA 1WLMA 1RTP1 1SKTA 1Y1XA 4M2QA 1QASA 1DF0A 1SBJA 1H4BA 2I18A 4MLWA 4QJ4B 1KK7Y 2AAOA 1G4YR 3VRNA 4AQJA 1M46A 4ETOA 3I5GC 5I2LA 3IQOA 1F4QA 1YVLA 4A4BA 4XYNA 1RECA 1A75A 1YX7A 1JFKA 1FBVA 1NSHA 1CDPA 1KSMA 3D0YB 2PRUA 1J7RA 1KWOC 1QX5B 2O60A 1XFYO 4U8DA 4PHMA 2L50A 2AUCA 4YI8A 4WQ3A 2CBLA 1QV1A 1SL7A 2M3WA 1QIVA 2L51A 4PHKA 4AOMA 1AJ5A 1QX2A 2JT3A 2MHHA 2Y1MA 1OMRA 3SG2A 2K2AA 5AERA 4F0ZB 3PLFB 4MEWA 2LV7A 2JTTA 1NWDA 2CNPA 2F8PA 4C0KA 1KQVA 2BBNA 3I5HC 2FJUB 5JOLA 2L4IA 2Q4UA 1V1GA 1K9PA 3I5IC 1OMVA 1YURA 1UHJA 2M0RA 3DD4A 1W7IB 1EJ3A 1NUBA 4MVFA 4BY5A 1XA5A 1YRUB 1K8UA 2NZ0A 3EK8A 2NXQA 2H61C 4HSZA 2CT9A 3AKAA 4GNKB 3BUWB 3BQ3A 1X02A 2KSPA 1KFXS 1QTXA 2HQWA 1FI5A 2LCPA 1DMOA 1NX0A 1AP4A 2ISDA 1WRZA 2GGZA 4PE1A 2JULA 3NSKA 2JC2A 1CLLA 2K7DA 1JC2A 1JF0A 2K8MB 1SR6B 4AQIA 1NCXA 5CPVA 3FWBA 4ZCVA 3SIAA 1RFJA 1NPQA 1J7QA 2Y4QA 5IBWA 2MAZA 2KI6D 2KQ6A 1L2OB 3HX4A 1TCFA 4YGEB 5CSNA 1NX1A 1PVBA 1OE9B 1QX7A 1MHOA 1UURA 1KSOA 1DJGA 3BUMB 5JJGA 1G33A 2F33A 3DF0A 2LUXA 1IQ5A 1LKJA 3I5FB 1J1DA 4XJKB 1F4OA 3PATA 2TN4A 1MXLC 1KK8B 2Y5IA 2WNDA 1Y1AA 2K2FA 3WNXB 3CLNA 2JWWA 2I2RE 2HETA 2OTGB 1U5IA 3IF7A 1IJ6A 1WRLA 1B1GA 2NCOA 1BOCA 1JF2A 1TTXA 1TOPA 2IS9A 5BPJA 1WLZA 1CFDA 1VRKA 1JSAA 1YR5A 1OZSA 3JTDB 3GOFA 1QLKA 1J7PA 1SCMC 1RWYA 1SMGA 1YTZC 2F2PA 5B8IB 3NSLA 4MRYA 1K2HA 5CSJA 4OVNF 1XFZO 2KOTA 4HREE 4DIRA 1S6JA 1BR1B 3O78A 3VRRA 1XO5A 1TNXA 1A2XA 2GV5A 2QACA 3PM8A 4YRUA 1ZACA 1CDLA 1NCYA 1UHNA 2L2EA 4GPLB 5D7FA 4GUKA 4ORBB 3OX5A 2SCPA 3OB1B 2M97A 3TDIA 3PN7B 2EC6B 1QIWA 1W7JB 3LK0A 4M2OA 1XK4C 3PALA 1DGUA 2ZRTA 4GGNA 2LM5A 3RLZA 4MZLA 5HLVA 1K9UA 2LMUA 1S36A 1S5GY 1J55A 1TNQA 2HPSA 2KI4B 1XFWO 4NDCA 1BJFA 1YVHA 2EGDA 3CR5X 2COLB 1S1EA 3CTNA 1QS7A 1XVJA 3SG4A 1CB1A 4QJ5B 1D1OA 1SYMA 5AFPA 3EK4A 1SY9A 3PFVA 2SASA 2H2KA 2PMYA 1K95A 1M39A 4USLA 1OOJA 1A03A 3WHTB 1TCOB 1QLSA 2JXLA 2K61A 2KGRA 1B4CA 1KK7Z 1LINA 1M45A 1CTRA 2LAPA 2QPTA 4OCIA 1UP5A 4PE0A 2H61A 4ZCUA 1EG4A 1YUSA 1F70A 1SNLA 1TIZA 4Q04A 5AANA 4MBEA 2VRGA 1ODBA 5HKZA 1IGVA 1AK8A 1PALA 1B7TY 2GGMA 1XFUO 4YI9A 2EHBA 2PALA 2M7NA 3KEVA 1KQMB 4CIDA 3AKBA 4I5KA 4P2YB 4PHNA 2I94A 3SIBA 2LANA 2M29A 1UHIA 1SR6C 4ORCB 4GFTA 1LXFC 1GJYA 2JQ6A 4FQOA 5DKQA 4PE7A 1L2OC 5F6TA 5GQQC 4GGFC 1WDCB 1EG3A 2OS8B 1JBAA 5TNCA 1HT9A 1WY9A 2CCMA 2JTZA 2LUCA 2LLUA 2M1UA 2BCXA 1OSAA 2MRDA 1QV0A 4QJ3B 2O5GA 3D10A 1SCVA 2WORA 4MN0A 2ZRSA 1MF8B 5AXIA 3WHUB 4CFQA 1K9KA 1M63B 1NP8A 1U5IB 3CWGA 1SPYA 2LLTA 3O6BA 1SK6D 1TRFA 2OTGC 1IG5A 3F45A 1BG1A 1BU3A 2G9BA 2LMVA 3BUOB 4L9MA 4C0LA 5CSFA 1M31A 3O2PA 3TDZA 2I7AA 3SG6A 2L4HA 3OP0A 3NXAA 1ZFSA 2BE4A 1R2UA 2M8UA 1CM1A 2M7LA 4CPVA 4UPGA 2RGIA 4GAOA 1UHKA 2KI6C 3EKJA 3NSIA 4GBAA 3I5GB 3H4SE 2JT8A 2JU0A 2KFFA 2M9GA 3CS1A 3K21A 1L7ZA 2CXJA 2F2OA 5I8NA 3OHMB 2FCEA 3BOWB 5HKYA 4OV2A 5K89A 3AAJA 1MXEA 3LL8B 2ZNEA 1IJ5A 3JVTB 1CLMA 3TZ1A 5PALA 4PHJA 3ICBA 2JPTA 4ICBA 3PN7C 2KBIA 2EC6C 2KAYA 2MBXA 1IH0A 3CR4X 1YUTA 1K96A 3BXKA 4YGCB 1XK4A 1MWNA 2ZN8A 4JPZB 2LE9B 4N1GA 1GQMA 3LK1A 1MQ1A 5CSIA 1ALVA 3KF9A 1MR8A 3GK1A 1PRWA 2KI4C 1WRKA 3EVUA 1KFXL 3I5HB 1FI6A 1G8IA 2P6BB 3EVVA 4YBHB 3I5IB 2K0JA 2BE6A 2KNEA 5I2OA 1DJHA 4OKHA 2PSRA 1IQ3A 1DF0B 5J3XA 1PSBA 4MZJA 1ZMZA 4MSPA 2CTNA 1SL9A 2F3YA 2HQ8A 4FTGA 1A75B 1BMOA 2KFGA 5HKWA 1QVIY 1YX8A 1RROA 1E8AA 1Y1UA 2G2BA 1UWOA 2ZNDA 1FF1A 1BF5A 3ZNIA 3CGAA 1YRTB 1LA3A 2R2IA 3A4UB 4N5XA 4NDBA 2LLSA 3DVKA 4IL1A 1KQMC 1UUSA 2OPOA 4NQGA 2KGBC 2BCBA 3RM1A 1S5GZ 2KDHA 3KPXA 1FW4A 1PSRA 1R6PA 2KYCA 4GGFA 4HRGA 3O4YA 2PVBA 2M49B 1V1FA 1WDCC 2OS8C 2V53A 3SG3A 3A8RA 3SG5A 1QJTA 2KQYA 3VROA 1N0YA 1IWQA 1JFJA 1K94A 4CLNA 2MA2A 2LP2A 2MLFC 3GK4X 2E30A 2NCPA 5KSZA 1BR4B 1PULA 4NDDA 2HF5A 4N1FA 1B8RA 3VRQA 3DVMA 4OR9B 1YUUA 5FYXA 3FS7A 1OMDA 3BYAA 1PK0D 1CMFA 1B7TZ 5HYDA 2WCEA 4R1EA 1K93D 1AUIB 1JUOA 1S3PA 1ALWA 1PVAA 4YGBB 5KU1A 1DJZA 1F54A 3QRXA 2KBMA 4YGAA 4PALA 5DKRA 3KHEA 2KHNA 1B47A 2WCFA 2BCAA 3DF0B 3FIAA 2WC8A 1EH2A 1N65A 4JQ0D 2LVJA 2JRFA 3TS5B 1OZOA 3VGOA 1B8CA 1N2DA 1NX3A 3EKHA 3I5FC 2FOTA 3JVTC 2JNFA 2LHLA 5ER4X 1DJIA 5D69A 1KK8C 3TUYB 4HRHA 1H8BA 2K7BA 4BY4A 1J7OA 1HQVA 1C7WA 3M0WA 3AAKA
chains in the Genus database with same CATH superfamily
4PE4A 5HLOA 1OW4A 2E6WA 1Z4HA 1AVSA 3SJSA 3MSEB 1DT7B 3DZTA 1F71A 3BUNB 2ZKMX 3SG7A 2BL0B 1UHHA 3JTDC 2LNKA 1BODA 2L98A 1LVCD 1XFVO 2MJWB 1SRAA 2WCKA 4PDZA 4MRXA 1DC1A 2LVIA 1RK9A 2QEOA 3EVRA 3C1VA 2LVKA 2JOJA 2PASA 1CMGA 1CFPA 1IKUA 2ZFDA 1DVIA 1OQPA 4ORAB 3SS5A 2K7OA 3OGNA 1MUXA 1Q80A 2BKIB 3WXAA 1KWOB 1F55A 4DUQA 1DELA 4I5NB 2K7CA 3VB1A 3D0YA 1NIWA 2DOQA 1NX2A 4OZDA 1AHRA 3V2LA 2LVVA 2A4JA 2JT0A 1BT6A 1A29A 1A4PA 2L0PA 1CKKA 1TNWA 3PSRA 3N7HA 2QEVA 3D77A 5ER5A 4PCWA 1AJ4A 1RJVA 2FCDA 4DCKA 3CR2A 4M2PA 1KCYA 1SL8A 3BUXB 2M1KB 1CM4A 1C7VA 2MLEC 3B6XA 1F8HA 4WRIA 4JWQA 4D1EA 2JXCA 3RZSA 1B9AA 5FI6A 1KFUS 1TN4A 1DQEA 1CFCA 2Q91A 3KO0A 2L5XB 2F3ZA 3CZ0A 1QATA 1J1EA 3TDUA 1FPWA 3DXLA 1TUJA 3LCPC 2KYFA 2D8NA 2Y1NA 3DVEA 3S0AA 4JKTA 3NSOA 5KTYA 4DS7A 1CFFA 5I2QA 1LS8A 4DRWA 1QVIZ 1Y0VH 3DVJA 3OB2B 1DTLA 1CLBA 3EG5B 2KLDA 2B1UA 2JZIA 1S6IA 2WCBA 3ZWHA 1C07A 2KFHA 3D74A 3GK2A 4MZKA 4I5JA 3D76A 3OX6A 4WQ2A 2JNXA 1LA0A 2KLEA 3E3RA 1CDNA 1DJXA 5G08A 2P70A 1NYAA 1XYDA 1Y6WA 2LMTA 1EL4A 1S26D 2ZN9A 1DGVA 1OOFA 3R1VA 3VRPA 2BKHB 1GGWA 1SW8A 3BOWA 3HCMA 4I5LB 5DKNA 2KAVA 1B8LA 4CFRA 1K90D 2AMIA 2BBMA 1CNPA 4A4CA 3IQQA 3TS5C 1QXPA 2WOSA 4XJKA 5AEQA 1KFUL 1XFXO 2LHIA 1S6CA 3EK7A 1IRJA 3LLEA 4C0JA 4P5OE 1DJYA 1TWOA 1NCZA 2NLNA 3TUYC 3CZTX 4PT1A 1JWDA 4E68A 2KAXA 2LP3A 2LC5A 1DJWA 1GGZA 5DICA 1SCMB 3FWCA 4TNCA 4YGDB 1ZUZA 2BL0C 2QEHA 1TNPA 1CDMA 2BECA 1ZOTB 1EXRA 1BLQA 1WLMA 1RTP1 1SKTA 1Y1XA 4M2QA 1QASA 1DF0A 1SBJA 1H4BA 2I18A 4MLWA 4QJ4B 1KK7Y 2AAOA 1G4YR 5EL2A 3VRNA 4AQJA 1M46A 4ETOA 3CZ2A 3I5GC 5FI7A 3IQOA 5I2LA 1OOIX 1F4QA 1YVLA 4A4BA 5HL1A 4XYNA 1RECA 3DYEA 1A75A 1YX7A 1JFKA 1FBVA 1NSHA 1CDPA 1KSMA 3D0YB 2PRUA 1J7RA 1KWOC 1QX5B 2O60A 1XFYO 4U8DA 2WCMA 1T14A 4PHMA 2L50A 2AUCA 4YI8A 3S0BA 4FQTA 1QWVA 4WQ3A 3B88A 2CBLA 1QV1A 1SL7A 2M3WA 1QIVA 2L51A 4PHKA 4AOMA 1AJ5A 1QX2A 2JT3A 2MHHA 1DEKA 1OMRA 2Y1MA 2K2AA 3SG2A 5AERA 4F0ZB 2JPOA 3PLFB 4MEWA 2LV7A 2JTTA 1NWDA 2CNPA 2F8PA 4C0KA 1KQVA 2BBNA 3I5HC 2FJUB 5JOLA 2L4IA 2Q4UA 2WCLA 1V1GA 1K9PA 3I5IC 1OMVA 1YURA 1UHJA 2M0RA 1IIOA 3DD4A 1W7IB 1EJ3A 1NUBA 4MVFA 4INXA 4BY5A 1XA5A 1YRUB 1K8UA 2NZ0A 3EK8A 2NXQA 2YGUA 2H61C 4HSZA 3CZ1A 2CT9A 3AKAA 4GNKB 3BUWB 3BQ3A 1X02A 2KSPA 1KFXS 1QTXA 2HQWA 2ERBA 1FI5A 2LCPA 1DMOA 1NX0A 4INWA 1AP4A 2ISDA 1WRZA 2GGZA 4PE1A 2JULA 3NSKA 2JC2A 1CLLA 2K7DA 1JC2A 1JF0A 2K8MB 1SR6B 4AQIA 1NCXA 5CPVA 3FWBA 4ZCVA 3SIAA 1RFJA 1NPQA 1J7QA 2Y4QA 5IBWA 2MAZA 2KI6D 2KQ6A 1L2OB 3B86A 3HX4A 1TCFA 4YGEB 5CSNA 1NX1A 1PVBA 1OE9B 1QX7A 1MHOA 1UURA 1KSOA 1DJGA 2WC6A 3B87A 3R1OA 3BUMB 5JJGA 1G33A 2F33A 3DF0A 2LUXA 1IQ5A 1LKJA 3I5FB 1J1DA 4XJKB 1F4OA 3PATA 2TN4A 1MXLC 2FJYA 1KK8B 2Y5IA 2WNDA 1Y1AA 2K2FA 3WNXB 3CLNA 2JWWA 2I2RE 2HETA 2OTGB 1U5IA 3IF7A 1IJ6A 1WRLA 1B1GA 2NCOA 1BOCA 1JF2A 1TTXA 1TOPA 2IS9A 2WCHA 3QMEA 3K1EA 5BPJA 1WLZA 1CFDA 1VRKA 1JSAA 1YR5A 1OZSA 2PYQA 3JTDB 3GOFA 1QLKA 1J7PA 2P71A 1SCMC 1RWYA 1SMGA 1TUZA 1YTZC 2F2PA 5B8IB 3NSLA 3S0DA 4MRYA 1K2HA 5CSJA 4OVNF 1XFZO 2K60A 2KOTA 3D78A 4HREE 4DIRA 2L2CA 2QDIA 1S6JA 1BR1B 3O78A 3VRRA 1XO5A 3UNWA 1TNXA 2KPHA 1A2XA 2GV5A 2QACA 3PM8A 4YRUA 1ZACA 1CDLA 1NCYA 1UHNA 2L2EA 4GPLB 5D7FA 4GUKA 4ORBB 3OX5A 2SCPA 3OB1B 2M97A 3TDIA 3PN7B 2EC6B 1QIWA 1W7JB 3LK0A 4M2OA 1XK4C 3PALA 1DGUA 2ZRTA 4GGNA 2LM5A 3RLZA 4MZLA 5HLVA 1K9UA 2LMUA 1S36A 1S5GY 1J55A 1TNQA 2HPSA 2KI4B 1XFWO 4NDCA 1BJFA 3IVTA 1YVHA 3SS3A 2EGDA 3UO9A 3CR5X 2COLB 1S1EA 3CTNA 1QS7A 1XVJA 3SG4A 1CB1A 4QJ5B 1D1OA 1SYMA 5AFPA 3FE9A 3EK4A 1SY9A 3PFVA 2SASA 4IJ7A 2H2KA 2PMYA 3PJIA 1C3YA 1K95A 1M39A 4USLA 1OOJA 1A03A 3SS4A 1C3ZA 3WHTB 1TCOB 1QLSA 2JXLA 2K61A 2KGRA 3D75A 1B4CA 1KK7Z 1LINA 1M45A 1CTRA 2LAPA 2QPTA 4OCIA 1UP5A 4PE0A 2H61A 4ZCUA 3BFHA 1EG4A 1YUSA 1F70A 1SNLA 1TIZA 4Q04A 5AANA 4MBEA 2BAPA 2VRGA 1ODBA 1XFRA 5HKZA 1IGVA 1AK8A 1PALA 1B7TY 2GGMA 1XFUO 4YI9A 2EHBA 2PALA 2BNXA 2M7NA 1OOHA 1KQMB 3KEVA 3AKBA 4I5KA 4P2YB 4PHNA 4CIDA 1OOGA 2I94A 3SIBA 2LANA 2M29A 1UHIA 1SR6C 4ORCB 4GFTA 1LXFC 1Z2CB 3NHTA 1GJYA 2JQ6A 4FQOA 5DKQA 4PE7A 1L2OC 5F6TA 5GQQC 4GGFC 1WDCB 1EG3A 2OS8B 1JBAA 5TNCA 1HT9A 1WY9A 2CCMA 2JTZA 2LUCA 2LLUA 2M1UA 2BCXA 1OSAA 2MRDA 1QV0A 3R72A 4QJ3B 2O5GA 2GTEA 3D10A 1SCVA 2WORA 4MN0A 2ZRSA 1MF8B 3FE6A 5AXIA 3WHUB 4CFQA 1K9KA 1M63B 1NP8A 1U5IB 3CWGA 1SPYA 2LLTA 3O6BA 1SK6D 1TRFA 2OTGC 1IG5A 3B7AA 3F45A 1BG1A 1BU3A 2G9BA 2LMVA 3D73A 3BUOB 4L9MA 4C0LA 5CSFA 1M31A 3O2PA 3TDZA 2I7AA 3SG6A 2L4HA 3OP0A 2L5YA 3NXAA 1ZFSA 2BE4A 1R2UA 2M8UA 1CM1A 2M7LA 4CPVA 4UPGA 2RGIA 4GAOA 1UHKA 2KI6C 3BFBA 3EKJA 3BFAA 3NSIA 4GBAA 3I5GB 3H4SE 2JT8A 2JU0A 2KFFA 2M9GA 3BJHA 3CS1A 3CDNA 1L7ZA 2CXJA 3K21A 2F2OA 5I8NA 3OHMB 2FCEA 3BOWB 5HKYA 4OV2A 5K89A 3AAJA 3R1PA 1MXEA 3LL8B 2ZNEA 1IJ5A 5D3OA 3JVTB 1CLMA 4JD9A 3TZ1A 5PALA 3L47A 4PHJA 3S0FA 3ICBA 2JPTA 4ICBA 3PN7C 2KBIA 2EC6C 2KAYA 2MBXA 1IH0A 3CR4X 1YUTA 1K96A 3BXKA 4YGCB 1XK4A 1MWNA 2ZN8A 4JPZB 2LE9B 4N1GA 1GQMA 3LK1A 1MQ1A 5CSIA 1ALVA 1W9ZA 3KF9A 1GM0A 1MR8A 3GK1A 5FI2A 2PQLA 1PRWA 2KI4C 3DY9A 1WRKA 3EVUA 3S0GA 1KFXL 3I5HB 1FI6A 1G8IA 2P6BB 3EVVA 3OBVA 4YBHB 3I5IB 2K0JA 2BE6A 2KNEA 5I2OA 1DJHA 4OKHA 2PSRA 1IQ3A 1DF0B 5J3XA 1PSBA 4MZJA 1ZMZA 3L4AA 4MSPA 2CTNA 1ORGA 1SL9A 2F3YA 2HQ8A 4FTGA 1A75B 1BMOA 2KFGA 5HKWA 5I94A 1QVIY 1YX8A 1RROA 1E8AA 1Y1UA 2G2BA 1UWOA 2ZNDA 1FF1A 1BF5A 3ZNIA 3CGAA 1YRTB 1LA3A 2R2IA 3A4UB 4N5XA 4NDBA 2QEBA 2LLSA 3DVKA 4IL1A 3Q8IA 1KQMC 1UUSA 2OPOA 4NQGA 3CYZA 2KGBC 2BCBA 3NGVA 3RM1A 1S5GZ 1P28A 2KDHA 3KPXA 3CABA 1FW4A 1PSRA 1R6PA 2KYCA 4GGFA 4HRGA 3O4YA 2PVBA 2M49B 1V1FA 1WDCC 2OS8C 2V53A 2WCJA 3SG3A 3A8RA 3SG5A 1QJTA 2KQYA 3VROA 1N0YA 1IWQA 3FE8A 1JFJA 3O4XA 1K94A 4CLNA 2MA2A 2LP2A 2MLFC 3GK4X 2E30A 2NCPA 5KSZA 1BR4B 1PULA 4NDDA 2HF5A 3PM2A 4N1FA 1B8RA 1SSEB 3VRQA 3DVMA 4OR9B 1YUUA 5FYXA 3FS7A 1OMDA 3BYAA 3NHIA 1PK0D 1CMFA 1B7TZ 5HYDA 2WCEA 4R1EA 1K93D 4F7FA 1AUIB 1JUOA 1S3PA 1ALWA 1PVAA 4YGBB 5KU1A 2WC5A 1DJZA 1F54A 3QRXA 2KBMA 4YGAA 4PALA 5DKRA 3KHEA 2KHNA 1B47A 2WCFA 2BCAA 3DF0B 3FIAA 3S0EA 2WC8A 1EH2A 1N65A 4JQ0D 2LVJA 2JRFA 3TS5B 1OZOA 3VGOA 1B8CA 1N2DA 1NX3A 3EKHA 3I5FC 2FOTA 3JVTC 2JNFA 2LHLA 5ER4X 4KYNA 1DJIA 5D69A 1KK8C 3TUYB 4HRHA 1H8BA 3L4LA 2K7BA 4BY4A 1J7OA 1HQVA 2H8VA 1C7WA 3M0WA 3AAKA
chains in the Genus database with same CATH topology
4PE4A 5HLOA 2E6WA 1AVSA 3SJSA 3MSEB 1DT7B 1F71A 3BUNB 2ZKMX 3SG7A 2BL0B 1UHHA 3JTDC 2LNKA 1BODA 2L98A 1LVCD 1XFVO 2MJWB 1SRAA 4PDZA 4MRXA 2LVIA 1RK9A 3EVRA 3C1VA 2LVKA 2JOJA 2PASA 1CMGA 1CFPA 1IKUA 2ZFDA 1DVIA 1OQPA 4ORAB 2K7OA 1MUXA 1Q80A 2BKIB 3WXAA 1KWOB 1F55A 4DUQA 4I5NB 2K7CA 3D0YA 1NIWA 2DOQA 1NX2A 1AHRA 2LVVA 2A4JA 2JT0A 1BT6A 1A29A 1A4PA 2L0PA 1CKKA 1TNWA 3PSRA 5ER5A 4PCWA 1AJ4A 1RJVA 2FCDA 4DCKA 3CR2A 4M2PA 1KCYA 1SL8A 3BUXB 2M1KB 1CM4A 1C7VA 2MLEC 1F8HA 4WRIA 4JWQA 4D1EA 2JXCA 1B9AA 1KFUS 1TN4A 1CFCA 2Q91A 3KO0A 2L5XB 2F3ZA 1QATA 1J1EA 3TDUA 1FPWA 3LCPC 2KYFA 2D8NA 2Y1NA 3DVEA 3NSOA 5KTYA 4DS7A 1CFFA 5I2QA 4DRWA 1QVIZ 1Y0VH 3DVJA 3OB2B 1DTLA 1CLBA 2B1UA 2JZIA 1S6IA 2WCBA 3ZWHA 1C07A 2KFHA 3GK2A 4MZKA 4I5JA 3OX6A 4WQ2A 2JNXA 1LA0A 3E3RA 1CDNA 1DJXA 5G08A 1NYAA 1XYDA 1Y6WA 2LMTA 1EL4A 1S26D 2ZN9A 1DGVA 3VRPA 2BKHB 1GGWA 1SW8A 3BOWA 3HCMA 4I5LB 5DKNA 2KAVA 1B8LA 4CFRA 1K90D 2AMIA 2BBMA 1CNPA 4A4CA 3IQQA 3TS5C 1QXPA 2WOSA 4XJKA 5AEQA 1KFUL 1XFXO 2LHIA 1S6CA 3EK7A 1IRJA 3LLEA 4C0JA 4P5OE 1DJYA 1NCZA 2NLNA 3TUYC 3CZTX 1JWDA 4E68A 2KAXA 2LP3A 2LC5A 1DJWA 1GGZA 1SCMB 3FWCA 4TNCA 4YGDB 1ZUZA 2BL0C 1TNPA 1CDMA 2BECA 1ZOTB 1EXRA 1BLQA 1WLMA 1RTP1 1SKTA 1Y1XA 4M2QA 1QASA 1DF0A 1SBJA 1H4BA 2I18A 4MLWA 4QJ4B 1KK7Y 2AAOA 1G4YR 3VRNA 4AQJA 1M46A 4ETOA 3I5GC 5I2LA 3IQOA 1F4QA 1YVLA 4A4BA 4XYNA 1RECA 1A75A 1YX7A 1JFKA 1FBVA 1NSHA 1CDPA 1KSMA 3D0YB 2PRUA 1J7RA 1KWOC 1QX5B 2O60A 1XFYO 4U8DA 4PHMA 2L50A 2AUCA 4YI8A 4WQ3A 2CBLA 1QV1A 1SL7A 2M3WA 1QIVA 2L51A 4PHKA 4AOMA 1AJ5A 1QX2A 2JT3A 2MHHA 2Y1MA 1OMRA 3SG2A 2K2AA 5AERA 4F0ZB 3PLFB 4MEWA 2LV7A 2JTTA 1NWDA 2CNPA 2F8PA 4C0KA 1KQVA 2BBNA 3I5HC 2FJUB 5JOLA 2L4IA 2Q4UA 1V1GA 1K9PA 3I5IC 1OMVA 1YURA 1UHJA 2M0RA 3DD4A 1W7IB 1EJ3A 1NUBA 4MVFA 4BY5A 1XA5A 1YRUB 1K8UA 2NZ0A 3EK8A 2NXQA 2H61C 4HSZA 2CT9A 3AKAA 4GNKB 3BUWB 3BQ3A 1X02A 2KSPA 1KFXS 1QTXA 2HQWA 1FI5A 2LCPA 1DMOA 1NX0A 1AP4A 2ISDA 1WRZA 2GGZA 4PE1A 2JULA 3NSKA 2JC2A 1CLLA 2K7DA 1JC2A 1JF0A 2K8MB 1SR6B 4AQIA 1NCXA 5CPVA 3FWBA 4ZCVA 3SIAA 1RFJA 1NPQA 1J7QA 2Y4QA 5IBWA 2MAZA 2KI6D 2KQ6A 1L2OB 3HX4A 1TCFA 4YGEB 5CSNA 1NX1A 1PVBA 1OE9B 1QX7A 1MHOA 1UURA 1KSOA 1DJGA 3BUMB 5JJGA 1G33A 2F33A 3DF0A 2LUXA 1IQ5A 1LKJA 3I5FB 1J1DA 4XJKB 1F4OA 3PATA 2TN4A 1MXLC 1KK8B 2Y5IA 2WNDA 1Y1AA 2K2FA 3WNXB 3CLNA 2JWWA 2I2RE 2HETA 2OTGB 1U5IA 3IF7A 1IJ6A 1WRLA 1B1GA 2NCOA 1BOCA 1JF2A 1TTXA 1TOPA 2IS9A 5BPJA 1WLZA 1CFDA 1VRKA 1JSAA 1YR5A 1OZSA 3JTDB 3GOFA 1QLKA 1J7PA 1SCMC 1RWYA 1SMGA 1YTZC 2F2PA 5B8IB 3NSLA 4MRYA 1K2HA 5CSJA 4OVNF 1XFZO 2KOTA 4HREE 4DIRA 1S6JA 1BR1B 3O78A 3VRRA 1XO5A 1TNXA 1A2XA 2GV5A 2QACA 3PM8A 4YRUA 1ZACA 1CDLA 1NCYA 1UHNA 2L2EA 4GPLB 5D7FA 4GUKA 4ORBB 3OX5A 2SCPA 3OB1B 2M97A 3TDIA 3PN7B 2EC6B 1QIWA 1W7JB 3LK0A 4M2OA 1XK4C 3PALA 1DGUA 2ZRTA 4GGNA 2LM5A 3RLZA 4MZLA 5HLVA 1K9UA 2LMUA 1S36A 1S5GY 1J55A 1TNQA 2HPSA 2KI4B 1XFWO 4NDCA 1BJFA 1YVHA 2EGDA 3CR5X 2COLB 1S1EA 3CTNA 1QS7A 1XVJA 3SG4A 1CB1A 4QJ5B 1D1OA 1SYMA 5AFPA 3EK4A 1SY9A 3PFVA 2SASA 2H2KA 2PMYA 1K95A 1M39A 4USLA 1OOJA 1A03A 3WHTB 1TCOB 1QLSA 2JXLA 2K61A 2KGRA 1B4CA 1KK7Z 1LINA 1M45A 1CTRA 2LAPA 2QPTA 4OCIA 1UP5A 4PE0A 2H61A 4ZCUA 1EG4A 1YUSA 1F70A 1SNLA 1TIZA 4Q04A 5AANA 4MBEA 2VRGA 1ODBA 5HKZA 1IGVA 1AK8A 1PALA 1B7TY 2GGMA 1XFUO 4YI9A 2EHBA 2PALA 2M7NA 3KEVA 1KQMB 4CIDA 3AKBA 4I5KA 4P2YB 4PHNA 2I94A 3SIBA 2LANA 2M29A 1UHIA 1SR6C 4ORCB 4GFTA 1LXFC 1GJYA 2JQ6A 4FQOA 5DKQA 4PE7A 1L2OC 5F6TA 5GQQC 4GGFC 1WDCB 1EG3A 2OS8B 1JBAA 5TNCA 1HT9A 1WY9A 2CCMA 2JTZA 2LUCA 2LLUA 2M1UA 2BCXA 1OSAA 2MRDA 1QV0A 4QJ3B 2O5GA 3D10A 1SCVA 2WORA 4MN0A 2ZRSA 1MF8B 5AXIA 3WHUB 4CFQA 1K9KA 1M63B 1NP8A 1U5IB 3CWGA 1SPYA 2LLTA 3O6BA 1SK6D 1TRFA 2OTGC 1IG5A 3F45A 1BG1A 1BU3A 2G9BA 2LMVA 3BUOB 4L9MA 4C0LA 5CSFA 1M31A 3O2PA 3TDZA 2I7AA 3SG6A 2L4HA 3OP0A 3NXAA 1ZFSA 2BE4A 1R2UA 2M8UA 1CM1A 2M7LA 4CPVA 4UPGA 2RGIA 4GAOA 1UHKA 2KI6C 3EKJA 3NSIA 4GBAA 3I5GB 3H4SE 2JT8A 2JU0A 2KFFA 2M9GA 3CS1A 3K21A 1L7ZA 2CXJA 2F2OA 5I8NA 3OHMB 2FCEA 3BOWB 5HKYA 4OV2A 5K89A 3AAJA 1MXEA 3LL8B 2ZNEA 1IJ5A 3JVTB 1CLMA 3TZ1A 5PALA 4PHJA 3ICBA 2JPTA 4ICBA 3PN7C 2KBIA 2EC6C 2KAYA 2MBXA 1IH0A 3CR4X 1YUTA 1K96A 3BXKA 4YGCB 1XK4A 1MWNA 2ZN8A 4JPZB 2LE9B 4N1GA 1GQMA 3LK1A 1MQ1A 5CSIA 1ALVA 3KF9A 1MR8A 3GK1A 1PRWA 2KI4C 1WRKA 3EVUA 1KFXL 3I5HB 1FI6A 1G8IA 2P6BB 3EVVA 4YBHB 3I5IB 2K0JA 2BE6A 2KNEA 5I2OA 1DJHA 4OKHA 2PSRA 1IQ3A 1DF0B 5J3XA 1PSBA 4MZJA 1ZMZA 4MSPA 2CTNA 1SL9A 2F3YA 2HQ8A 4FTGA 1A75B 1BMOA 2KFGA 5HKWA 1QVIY 1YX8A 1RROA 1E8AA 1Y1UA 2G2BA 1UWOA 2ZNDA 1FF1A 1BF5A 3ZNIA 3CGAA 1YRTB 1LA3A 2R2IA 3A4UB 4N5XA 4NDBA 2LLSA 3DVKA 4IL1A 1KQMC 1UUSA 2OPOA 4NQGA 2KGBC 2BCBA 3RM1A 1S5GZ 2KDHA 3KPXA 1FW4A 1PSRA 1R6PA 2KYCA 4GGFA 4HRGA 3O4YA 2PVBA 2M49B 1V1FA 1WDCC 2OS8C 2V53A 3SG3A 3A8RA 3SG5A 1QJTA 2KQYA 3VROA 1N0YA 1IWQA 1JFJA 1K94A 4CLNA 2MA2A 2LP2A 2MLFC 3GK4X 2E30A 2NCPA 5KSZA 1BR4B 1PULA 4NDDA 2HF5A 4N1FA 1B8RA 3VRQA 3DVMA 4OR9B 1YUUA 5FYXA 3FS7A 1OMDA 3BYAA 1PK0D 1CMFA 1B7TZ 5HYDA 2WCEA 4R1EA 1K93D 1AUIB 1JUOA 1S3PA 1ALWA 1PVAA 4YGBB 5KU1A 1DJZA 1F54A 3QRXA 2KBMA 4YGAA 4PALA 5DKRA 3KHEA 2KHNA 1B47A 2WCFA 2BCAA 3DF0B 3FIAA 2WC8A 1EH2A 1N65A 4JQ0D 2LVJA 2JRFA 3TS5B 1OZOA 3VGOA 1B8CA 1N2DA 1NX3A 3EKHA 3I5FC 2FOTA 3JVTC 2JNFA 2LHLA 5ER4X 1DJIA 5D69A 1KK8C 3TUYB 4HRHA 1H8BA 2K7BA 4BY4A 1J7OA 1HQVA 1C7WA 3M0WA 3AAKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PE4 A;  5HLO A;  2E6W A;  1AVS A;  3SJS A;  3MSE B;  1DT7 B;  1F71 A;  3BUN B;  2ZKM X;  3SG7 A;  2BL0 B;  1UHH A;  3JTD C;  2LNK A;  1BOD A;  2L98 A;  1LVC D;  1XFV O;  2MJW B;  1SRA A;  4PDZ A;  4MRX A;  2LVI A;  1RK9 A;  3EVR A;  3C1V A;  2LVK A;  2JOJ A;  2PAS A;  1CMG A;  1CFP A;  1IKU A;  2ZFD A;  1DVI A;  1OQP A;  4ORA B;  2K7O A;  1MUX A;  1Q80 A;  2BKI B;  3WXA A;  1KWO B;  1F55 A;  4DUQ A;  4I5N B;  2K7C A;  3D0Y A;  1NIW A;  2DOQ A;  1NX2 A;  1AHR A;  2LVV A;  2A4J A;  2JT0 A;  1BT6 A;  1A29 A;  1A4P A;  2L0P A;  1CKK A;  1TNW A;  3PSR A;  5ER5 A;  4PCW A;  1AJ4 A;  1RJV A;  2FCD A;  4DCK A;  3CR2 A;  4M2P A;  1KCY A;  1SL8 A;  3BUX B;  2M1K B;  1CM4 A;  1C7V A;  2MLE C;  1F8H A;  4WRI A;  4JWQ A;  4D1E A;  2JXC A;  1B9A A;  1KFU S;  1TN4 A;  1CFC A;  2Q91 A;  3KO0 A;  2L5X B;  2F3Z A;  1QAT A;  1J1E A;  3TDU A;  1FPW A;  3LCP C;  2KYF A;  2D8N A;  2Y1N A;  3DVE A;  3NSO A;  5KTY A;  4DS7 A;  1CFF A;  5I2Q A;  4DRW A;  1QVI Z;  1Y0V H;  3DVJ A;  3OB2 B;  1DTL A;  1CLB A;  2B1U A;  2JZI A;  1S6I A;  2WCB A;  3ZWH A;  1C07 A;  2KFH A;  3GK2 A;  4MZK A;  4I5J A;  3OX6 A;  4WQ2 A;  2JNX A;  1LA0 A;  3E3R A;  1CDN A;  1DJX A;  5G08 A;  1NYA A;  1XYD A;  1Y6W A;  2LMT A;  1EL4 A;  1S26 D;  2ZN9 A;  1DGV A;  3VRP A;  2BKH B;  1GGW A;  1SW8 A;  3BOW A;  3HCM A;  4I5L B;  5DKN A;  2KAV A;  1B8L A;  4CFR A;  1K90 D;  2AMI A;  2BBM A;  1CNP A;  4A4C A;  3IQQ A;  3TS5 C;  1QXP A;  2WOS A;  4XJK A;  5AEQ A;  1KFU L;  1XFX O;  2LHI A;  1S6C A;  3EK7 A;  1IRJ A;  3LLE A;  4C0J A;  4P5O E;  1DJY A;  1NCZ A;  2NLN A;  3TUY C;  3CZT X;  1JWD A;  4E68 A;  2KAX A;  2LP3 A;  2LC5 A;  1DJW A;  1GGZ A;  1SCM B;  3FWC A;  4TNC A;  4YGD B;  1ZUZ A;  2BL0 C;  1TNP A;  1CDM A;  2BEC A;  1ZOT B;  1EXR A;  1BLQ A;  1WLM A;  1RTP 1;  1SKT A;  1Y1X A;  4M2Q A;  1QAS A;  1DF0 A;  1SBJ A;  1H4B A;  2I18 A;  4MLW A;  4QJ4 B;  1KK7 Y;  2AAO A;  1G4Y R;  3VRN A;  4AQJ A;  1M46 A;  4ETO A;  3I5G C;  5I2L A;  3IQO A;  1F4Q A;  1YVL A;  4A4B A;  4XYN A;  1REC A;  1A75 A;  1YX7 A;  1JFK A;  1FBV A;  1NSH A;  1CDP A;  1KSM A;  3D0Y B;  2PRU A;  1J7R A;  1KWO C;  1QX5 B;  2O60 A;  1XFY O;  4U8D A;  4PHM A;  2L50 A;  2AUC A;  4YI8 A;  4WQ3 A;  2CBL A;  1QV1 A;  1SL7 A;  2M3W A;  1QIV A;  2L51 A;  4PHK A;  4AOM A;  1AJ5 A;  1QX2 A;  2JT3 A;  2MHH A;  2Y1M A;  1OMR A;  3SG2 A;  2K2A A;  5AER A;  4F0Z B;  3PLF B;  4MEW A;  2LV7 A;  2JTT A;  1NWD A;  2CNP A;  2F8P A;  4C0K A;  1KQV A;  2BBN A;  3I5H C;  2FJU B;  5JOL A;  2L4I A;  2Q4U A;  1V1G A;  1K9P A;  3I5I C;  1OMV A;  1YUR A;  1UHJ A;  2M0R A;  3DD4 A;  1W7I B;  1EJ3 A;  1NUB A;  4MVF A;  4BY5 A;  1XA5 A;  1YRU B;  1K8U A;  2NZ0 A;  3EK8 A;  2NXQ A;  2H61 C;  4HSZ A;  2CT9 A;  3AKA A;  4GNK B;  3BUW B;  3BQ3 A;  1X02 A;  2KSP A;  1KFX S;  1QTX A;  2HQW A;  1FI5 A;  2LCP A;  1DMO A;  1NX0 A;  1AP4 A;  2ISD A;  1WRZ A;  2GGZ A;  4PE1 A;  2JUL A;  3NSK A;  2JC2 A;  1CLL A;  2K7D A;  1JC2 A;  1JF0 A;  2K8M B;  1SR6 B;  4AQI A;  1NCX A;  5CPV A;  3FWB A;  4ZCV A;  3SIA A;  1RFJ A;  1NPQ A;  1J7Q A;  2Y4Q A;  5IBW A;  2MAZ A;  2KI6 D;  2KQ6 A;  1L2O B;  3HX4 A;  1TCF A;  4YGE B;  5CSN A;  1NX1 A;  1PVB A;  1OE9 B;  1QX7 A;  1MHO A;  1UUR A;  1KSO A;  1DJG A;  3BUM B;  5JJG A;  1G33 A;  2F33 A;  3DF0 A;  2LUX A;  1IQ5 A;  1LKJ A;  3I5F B;  1J1D A;  4XJK B;  1F4O A;  3PAT A;  2TN4 A;  1MXL C;  1KK8 B;  2Y5I A;  2WND A;  1Y1A A;  2K2F A;  3WNX B;  3CLN A;  2JWW A;  2I2R E;  2HET A;  2OTG B;  1U5I A;  3IF7 A;  1IJ6 A;  1WRL A;  1B1G A;  2NCO A;  1BOC A;  1JF2 A;  1TTX A;  1TOP A;  2IS9 A;  5BPJ A;  1WLZ A;  1CFD A;  1VRK A;  1JSA A;  1YR5 A;  1OZS A;  3JTD B;  3GOF A;  1QLK A;  1J7P A;  1SCM C;  1RWY A;  1SMG A;  1YTZ C;  2F2P A;  5B8I B;  3NSL A;  4MRY A;  1K2H A;  5CSJ A;  4OVN F;  1XFZ O;  2KOT A;  4HRE E;  4DIR A;  1S6J A;  1BR1 B;  3O78 A;  3VRR A;  1XO5 A;  1TNX A;  1A2X A;  2GV5 A;  2QAC A;  3PM8 A;  4YRU A;  1ZAC A;  1CDL A;  1NCY A;  1UHN A;  2L2E A;  4GPL B;  5D7F A;  4GUK A;  4ORB B;  3OX5 A;  2SCP A;  3OB1 B;  2M97 A;  3TDI A;  3PN7 B;  2EC6 B;  1QIW A;  1W7J B;  3LK0 A;  4M2O A;  1XK4 C;  3PAL A;  1DGU A;  2ZRT A;  4GGN A;  2LM5 A;  3RLZ A;  4MZL A;  5HLV A;  1K9U A;  2LMU A;  1S36 A;  1S5G Y;  1J55 A;  1TNQ A;  2HPS A;  2KI4 B;  1XFW O;  4NDC A;  1BJF A;  1YVH A;  2EGD A;  3CR5 X;  2COL B;  1S1E A;  3CTN A;  1QS7 A;  1XVJ A;  3SG4 A;  1CB1 A;  4QJ5 B;  1D1O A;  1SYM A;  5AFP A;  3EK4 A;  1SY9 A;  3PFV A;  2SAS A;  2H2K A;  2PMY A;  1K95 A;  1M39 A;  4USL A;  1OOJ A;  1A03 A;  3WHT B;  1TCO B;  1QLS A;  2JXL A;  2K61 A;  2KGR A;  1B4C A;  1KK7 Z;  1LIN A;  1M45 A;  1CTR A;  2LAP A;  2QPT A;  4OCI A;  1UP5 A;  4PE0 A;  2H61 A;  4ZCU A;  1EG4 A;  1YUS A;  1F70 A;  1SNL A;  1TIZ A;  4Q04 A;  5AAN A;  4MBE A;  2VRG A;  1ODB A;  5HKZ A;  1IGV A;  1AK8 A;  1PAL A;  1B7T Y;  2GGM A;  1XFU O;  4YI9 A;  2EHB A;  2PAL A;  2M7N A;  3KEV A;  1KQM B;  4CID A;  3AKB A;  4I5K A;  4P2Y B;  4PHN A;  2I94 A;  3SIB A;  2LAN A;  2M29 A;  1UHI A;  1SR6 C;  4ORC B;  4GFT A;  1LXF C;  1GJY A;  2JQ6 A;  4FQO A;  5DKQ A;  4PE7 A;  1L2O C;  5F6T A;  5GQQ C;  4GGF C;  1WDC B;  1EG3 A;  2OS8 B;  1JBA A;  5TNC A;  1HT9 A;  1WY9 A;  2CCM A;  2JTZ A;  2LUC A;  2LLU A;  2M1U A;  2BCX A;  1OSA A;  2MRD A;  1QV0 A;  4QJ3 B;  2O5G A;  3D10 A;  1SCV A;  2WOR A;  4MN0 A;  2ZRS A;  1MF8 B;  5AXI A;  3WHU B;  4CFQ A;  1K9K A;  1M63 B;  1NP8 A;  1U5I B;  3CWG A;  1SPY A;  2LLT A;  3O6B A;  1SK6 D;  1TRF A;  2OTG C;  1IG5 A;  3F45 A;  1BG1 A;  1BU3 A;  2G9B A;  2LMV A;  3BUO B;  4L9M A;  4C0L A;  5CSF A;  1M31 A;  3O2P A;  3TDZ A;  2I7A A;  3SG6 A;  2L4H A;  3OP0 A;  3NXA A;  1ZFS A;  2BE4 A;  1R2U A;  2M8U A;  1CM1 A;  2M7L A;  4CPV A;  4UPG A;  2RGI A;  4GAO A;  1UHK A;  2KI6 C;  3EKJ A;  3NSI A;  4GBA A;  3I5G B;  3H4S E;  2JT8 A;  2JU0 A;  2KFF A;  2M9G A;  3CS1 A;  3K21 A;  1L7Z A;  2CXJ A;  2F2O A;  5I8N A;  3OHM B;  2FCE A;  3BOW B;  5HKY A;  4OV2 A;  5K89 A;  3AAJ A;  1MXE A;  3LL8 B;  2ZNE A;  1IJ5 A;  3JVT B;  1CLM A;  3TZ1 A;  5PAL A;  4PHJ A;  3ICB A;  2JPT A;  4ICB A;  3PN7 C;  2KBI A;  2EC6 C;  2KAY A;  2MBX A;  1IH0 A;  3CR4 X;  1YUT A;  1K96 A;  3BXK A;  4YGC B;  1XK4 A;  1MWN A;  2ZN8 A;  4JPZ B;  2LE9 B;  4N1G A;  1GQM A;  3LK1 A;  1MQ1 A;  5CSI A;  1ALV A;  3KF9 A;  1MR8 A;  3GK1 A;  1PRW A;  2KI4 C;  1WRK A;  3EVU A;  1KFX L;  3I5H B;  1FI6 A;  1G8I A;  2P6B B;  3EVV A;  4YBH B;  3I5I B;  2K0J A;  2BE6 A;  2KNE A;  5I2O A;  1DJH A;  4OKH A;  2PSR A;  1IQ3 A;  1DF0 B;  5J3X A;  1PSB A;  4MZJ A;  1ZMZ A;  4MSP A;  2CTN A;  1SL9 A;  2F3Y A;  2HQ8 A;  4FTG A;  1A75 B;  1BMO A;  2KFG A;  5HKW A;  1QVI Y;  1YX8 A;  1RRO A;  1E8A A;  1Y1U A;  2G2B A;  1UWO A;  2ZND A;  1FF1 A;  1BF5 A;  3ZNI A;  3CGA A;  1YRT B;  1LA3 A;  2R2I A;  3A4U B;  4N5X A;  4NDB A;  2LLS A;  3DVK A;  4IL1 A;  1KQM C;  1UUS A;  2OPO A;  4NQG A;  2KGB C;  2BCB A;  3RM1 A;  1S5G Z;  2KDH A;  3KPX A;  1FW4 A;  1PSR A;  1R6P A;  2KYC A;  4GGF A;  4HRG A;  3O4Y A;  2PVB A;  2M49 B;  1V1F A;  1WDC C;  2OS8 C;  2V53 A;  3SG3 A;  3A8R A;  3SG5 A;  1QJT A;  2KQY A;  3VRO A;  1N0Y A;  1IWQ A;  1JFJ A;  1K94 A;  4CLN A;  2MA2 A;  2LP2 A;  2MLF C;  3GK4 X;  2E30 A;  2NCP A;  5KSZ A;  1BR4 B;  1PUL A;  4NDD A;  2HF5 A;  4N1F A;  1B8R A;  3VRQ A;  3DVM A;  4OR9 B;  1YUU A;  5FYX A;  3FS7 A;  1OMD A;  3BYA A;  1PK0 D;  1CMF A;  1B7T Z;  5HYD A;  2WCE A;  4R1E A;  1K93 D;  1AUI B;  1JUO A;  1S3P A;  1ALW A;  1PVA A;  4YGB B;  5KU1 A;  1DJZ A;  1F54 A;  3QRX A;  2KBM A;  4YGA A;  4PAL A;  5DKR A;  3KHE A;  2KHN A;  1B47 A;  2WCF A;  2BCA A;  3DF0 B;  3FIA A;  2WC8 A;  1EH2 A;  1N65 A;  4JQ0 D;  2LVJ A;  2JRF A;  3TS5 B;  1OZO A;  3VGO A;  1B8C A;  1N2D A;  1NX3 A;  3EKH A;  3I5F C;  2FOT A;  3JVT C;  2JNF A;  2LHL A;  5ER4 X;  1DJI A;  5D69 A;  1KK8 C;  3TUY B;  4HRH A;  1H8B A;  2K7B A;  4BY4 A;  1J7O A;  1HQV A;  1C7W A;  3M0W A;  3AAK A; 
#chains in the Genus database with same CATH topology
 4PE4 A;  5HLO A;  1OW4 A;  2E6W A;  1Z4H A;  1AVS A;  3SJS A;  3MSE B;  1DT7 B;  3DZT A;  1F71 A;  3BUN B;  2ZKM X;  3SG7 A;  2BL0 B;  1UHH A;  3JTD C;  2LNK A;  1BOD A;  2L98 A;  1LVC D;  1XFV O;  2MJW B;  1SRA A;  2WCK A;  4PDZ A;  4MRX A;  1DC1 A;  2LVI A;  1RK9 A;  2QEO A;  3EVR A;  3C1V A;  2LVK A;  2JOJ A;  2PAS A;  1CMG A;  1CFP A;  1IKU A;  2ZFD A;  1DVI A;  1OQP A;  4ORA B;  3SS5 A;  2K7O A;  3OGN A;  1MUX A;  1Q80 A;  2BKI B;  3WXA A;  1KWO B;  1F55 A;  4DUQ A;  1DEL A;  4I5N B;  2K7C A;  3VB1 A;  3D0Y A;  1NIW A;  2DOQ A;  1NX2 A;  4OZD A;  1AHR A;  3V2L A;  2LVV A;  2A4J A;  2JT0 A;  1BT6 A;  1A29 A;  1A4P A;  2L0P A;  1CKK A;  1TNW A;  3PSR A;  3N7H A;  2QEV A;  3D77 A;  5ER5 A;  4PCW A;  1AJ4 A;  1RJV A;  2FCD A;  4DCK A;  3CR2 A;  4M2P A;  1KCY A;  1SL8 A;  3BUX B;  2M1K B;  1CM4 A;  1C7V A;  2MLE C;  3B6X A;  1F8H A;  4WRI A;  4JWQ A;  4D1E A;  2JXC A;  3RZS A;  1B9A A;  5FI6 A;  1KFU S;  1TN4 A;  1DQE A;  1CFC A;  2Q91 A;  3KO0 A;  2L5X B;  2F3Z A;  3CZ0 A;  1QAT A;  1J1E A;  3TDU A;  1FPW A;  3DXL A;  1TUJ A;  3LCP C;  2KYF A;  2D8N A;  2Y1N A;  3DVE A;  3S0A A;  4JKT A;  3NSO A;  5KTY A;  4DS7 A;  1CFF A;  5I2Q A;  1LS8 A;  4DRW A;  1QVI Z;  1Y0V H;  3DVJ A;  3OB2 B;  1DTL A;  1CLB A;  3EG5 B;  2KLD A;  2B1U A;  2JZI A;  1S6I A;  2WCB A;  3ZWH A;  1C07 A;  2KFH A;  3D74 A;  3GK2 A;  4MZK A;  4I5J A;  3D76 A;  3OX6 A;  4WQ2 A;  2JNX A;  1LA0 A;  2KLE A;  3E3R A;  1CDN A;  1DJX A;  5G08 A;  2P70 A;  1NYA A;  1XYD A;  1Y6W A;  2LMT A;  1EL4 A;  1S26 D;  2ZN9 A;  1DGV A;  1OOF A;  3R1V A;  3VRP A;  2BKH B;  1GGW A;  1SW8 A;  3BOW A;  3HCM A;  4I5L B;  5DKN A;  2KAV A;  1B8L A;  4CFR A;  1K90 D;  2AMI A;  2BBM A;  1CNP A;  4A4C A;  3IQQ A;  3TS5 C;  1QXP A;  2WOS A;  4XJK A;  5AEQ A;  1KFU L;  1XFX O;  2LHI A;  1S6C A;  3EK7 A;  1IRJ A;  3LLE A;  4C0J A;  4P5O E;  1DJY A;  1TWO A;  1NCZ A;  2NLN A;  3TUY C;  3CZT X;  4PT1 A;  1JWD A;  4E68 A;  2KAX A;  2LP3 A;  2LC5 A;  1DJW A;  1GGZ A;  5DIC A;  1SCM B;  3FWC A;  4TNC A;  4YGD B;  1ZUZ A;  2BL0 C;  2QEH A;  1TNP A;  1CDM A;  2BEC A;  1ZOT B;  1EXR A;  1BLQ A;  1WLM A;  1RTP 1;  1SKT A;  1Y1X A;  4M2Q A;  1QAS A;  1DF0 A;  1SBJ A;  1H4B A;  2I18 A;  4MLW A;  4QJ4 B;  1KK7 Y;  2AAO A;  1G4Y R;  5EL2 A;  3VRN A;  4AQJ A;  1M46 A;  4ETO A;  3CZ2 A;  3I5G C;  5FI7 A;  3IQO A;  5I2L A;  1OOI X;  1F4Q A;  1YVL A;  4A4B A;  5HL1 A;  4XYN A;  1REC A;  3DYE A;  1A75 A;  1YX7 A;  1JFK A;  1FBV A;  1NSH A;  1CDP A;  1KSM A;  3D0Y B;  2PRU A;  1J7R A;  1KWO C;  1QX5 B;  2O60 A;  1XFY O;  4U8D A;  2WCM A;  1T14 A;  4PHM A;  2L50 A;  2AUC A;  4YI8 A;  3S0B A;  4FQT A;  1QWV A;  4WQ3 A;  3B88 A;  2CBL A;  1QV1 A;  1SL7 A;  2M3W A;  1QIV A;  2L51 A;  4PHK A;  4AOM A;  1AJ5 A;  1QX2 A;  2JT3 A;  2MHH A;  1DEK A;  1OMR A;  2Y1M A;  2K2A A;  3SG2 A;  5AER A;  4F0Z B;  2JPO A;  3PLF B;  4MEW A;  2LV7 A;  2JTT A;  1NWD A;  2CNP A;  2F8P A;  4C0K A;  1KQV A;  2BBN A;  3I5H C;  2FJU B;  5JOL A;  2L4I A;  2Q4U A;  2WCL A;  1V1G A;  1K9P A;  3I5I C;  1OMV A;  1YUR A;  1UHJ A;  2M0R A;  1IIO A;  3DD4 A;  1W7I B;  1EJ3 A;  1NUB A;  4MVF A;  4INX A;  4BY5 A;  1XA5 A;  1YRU B;  1K8U A;  2NZ0 A;  3EK8 A;  2NXQ A;  2YGU A;  2H61 C;  4HSZ A;  3CZ1 A;  2CT9 A;  3AKA A;  4GNK B;  3BUW B;  3BQ3 A;  1X02 A;  2KSP A;  1KFX S;  1QTX A;  2HQW A;  2ERB A;  1FI5 A;  2LCP A;  1DMO A;  1NX0 A;  4INW A;  1AP4 A;  2ISD A;  1WRZ A;  2GGZ A;  4PE1 A;  2JUL A;  3NSK A;  2JC2 A;  1CLL A;  2K7D A;  1JC2 A;  1JF0 A;  2K8M B;  1SR6 B;  4AQI A;  1NCX A;  5CPV A;  3FWB A;  4ZCV A;  3SIA A;  1RFJ A;  1NPQ A;  1J7Q A;  2Y4Q A;  5IBW A;  2MAZ A;  2KI6 D;  2KQ6 A;  1L2O B;  3B86 A;  3HX4 A;  1TCF A;  4YGE B;  5CSN A;  1NX1 A;  1PVB A;  1OE9 B;  1QX7 A;  1MHO A;  1UUR A;  1KSO A;  1DJG A;  2WC6 A;  3B87 A;  3R1O A;  3BUM B;  5JJG A;  1G33 A;  2F33 A;  3DF0 A;  2LUX A;  1IQ5 A;  1LKJ A;  3I5F B;  1J1D A;  4XJK B;  1F4O A;  3PAT A;  2TN4 A;  1MXL C;  2FJY A;  1KK8 B;  2Y5I A;  2WND A;  1Y1A A;  2K2F A;  3WNX B;  3CLN A;  2JWW A;  2I2R E;  2HET A;  2OTG B;  1U5I A;  3IF7 A;  1IJ6 A;  1WRL A;  1B1G A;  2NCO A;  1BOC A;  1JF2 A;  1TTX A;  1TOP A;  2IS9 A;  2WCH A;  3QME A;  3K1E A;  5BPJ A;  1WLZ A;  1CFD A;  1VRK A;  1JSA A;  1YR5 A;  1OZS A;  2PYQ A;  3JTD B;  3GOF A;  1QLK A;  1J7P A;  2P71 A;  1SCM C;  1RWY A;  1SMG A;  1TUZ A;  1YTZ C;  2F2P A;  5B8I B;  3NSL A;  3S0D A;  4MRY A;  1K2H A;  5CSJ A;  4OVN F;  1XFZ O;  2K60 A;  2KOT A;  3D78 A;  4HRE E;  4DIR A;  2L2C A;  2QDI A;  1S6J A;  1BR1 B;  3O78 A;  3VRR A;  1XO5 A;  3UNW A;  1TNX A;  2KPH A;  1A2X A;  2GV5 A;  2QAC A;  3PM8 A;  4YRU A;  1ZAC A;  1CDL A;  1NCY A;  1UHN A;  2L2E A;  4GPL B;  5D7F A;  4GUK A;  4ORB B;  3OX5 A;  2SCP A;  3OB1 B;  2M97 A;  3TDI A;  3PN7 B;  2EC6 B;  1QIW A;  1W7J B;  3LK0 A;  4M2O A;  1XK4 C;  3PAL A;  1DGU A;  2ZRT A;  4GGN A;  2LM5 A;  3RLZ A;  4MZL A;  5HLV A;  1K9U A;  2LMU A;  1S36 A;  1S5G Y;  1J55 A;  1TNQ A;  2HPS A;  2KI4 B;  1XFW O;  4NDC A;  1BJF A;  3IVT A;  1YVH A;  3SS3 A;  2EGD A;  3UO9 A;  3CR5 X;  2COL B;  1S1E A;  3CTN A;  1QS7 A;  1XVJ A;  3SG4 A;  1CB1 A;  4QJ5 B;  1D1O A;  1SYM A;  5AFP A;  3FE9 A;  3EK4 A;  1SY9 A;  3PFV A;  2SAS A;  4IJ7 A;  2H2K A;  2PMY A;  3PJI A;  1C3Y A;  1K95 A;  1M39 A;  4USL A;  1OOJ A;  1A03 A;  3SS4 A;  1C3Z A;  3WHT B;  1TCO B;  1QLS A;  2JXL A;  2K61 A;  2KGR A;  3D75 A;  1B4C A;  1KK7 Z;  1LIN A;  1M45 A;  1CTR A;  2LAP A;  2QPT A;  4OCI A;  1UP5 A;  4PE0 A;  2H61 A;  4ZCU A;  3BFH A;  1EG4 A;  1YUS A;  1F70 A;  1SNL A;  1TIZ A;  4Q04 A;  5AAN A;  4MBE A;  2BAP A;  2VRG A;  1ODB A;  1XFR A;  5HKZ A;  1IGV A;  1AK8 A;  1PAL A;  1B7T Y;  2GGM A;  1XFU O;  4YI9 A;  2EHB A;  2PAL A;  2BNX A;  2M7N A;  1OOH A;  1KQM B;  3KEV A;  3AKB A;  4I5K A;  4P2Y B;  4PHN A;  4CID A;  1OOG A;  2I94 A;  3SIB A;  2LAN A;  2M29 A;  1UHI A;  1SR6 C;  4ORC B;  4GFT A;  1LXF C;  1Z2C B;  3NHT A;  1GJY A;  2JQ6 A;  4FQO A;  5DKQ A;  4PE7 A;  1L2O C;  5F6T A;  5GQQ C;  4GGF C;  1WDC B;  1EG3 A;  2OS8 B;  1JBA A;  5TNC A;  1HT9 A;  1WY9 A;  2CCM A;  2JTZ A;  2LUC A;  2LLU A;  2M1U A;  2BCX A;  1OSA A;  2MRD A;  1QV0 A;  3R72 A;  4QJ3 B;  2O5G A;  2GTE A;  3D10 A;  1SCV A;  2WOR A;  4MN0 A;  2ZRS A;  1MF8 B;  3FE6 A;  5AXI A;  3WHU B;  4CFQ A;  1K9K A;  1M63 B;  1NP8 A;  1U5I B;  3CWG A;  1SPY A;  2LLT A;  3O6B A;  1SK6 D;  1TRF A;  2OTG C;  1IG5 A;  3B7A A;  3F45 A;  1BG1 A;  1BU3 A;  2G9B A;  2LMV A;  3D73 A;  3BUO B;  4L9M A;  4C0L A;  5CSF A;  1M31 A;  3O2P A;  3TDZ A;  2I7A A;  3SG6 A;  2L4H A;  3OP0 A;  2L5Y A;  3NXA A;  1ZFS A;  2BE4 A;  1R2U A;  2M8U A;  1CM1 A;  2M7L A;  4CPV A;  4UPG A;  2RGI A;  4GAO A;  1UHK A;  2KI6 C;  3BFB A;  3EKJ A;  3BFA A;  3NSI A;  4GBA A;  3I5G B;  3H4S E;  2JT8 A;  2JU0 A;  2KFF A;  2M9G A;  3BJH A;  3CS1 A;  3CDN A;  1L7Z A;  2CXJ A;  3K21 A;  2F2O A;  5I8N A;  3OHM B;  2FCE A;  3BOW B;  5HKY A;  4OV2 A;  5K89 A;  3AAJ A;  3R1P A;  1MXE A;  3LL8 B;  2ZNE A;  1IJ5 A;  5D3O A;  3JVT B;  1CLM A;  4JD9 A;  3TZ1 A;  5PAL A;  3L47 A;  4PHJ A;  3S0F A;  3ICB A;  2JPT A;  4ICB A;  3PN7 C;  2KBI A;  2EC6 C;  2KAY A;  2MBX A;  1IH0 A;  3CR4 X;  1YUT A;  1K96 A;  3BXK A;  4YGC B;  1XK4 A;  1MWN A;  2ZN8 A;  4JPZ B;  2LE9 B;  4N1G A;  1GQM A;  3LK1 A;  1MQ1 A;  5CSI A;  1ALV A;  1W9Z A;  3KF9 A;  1GM0 A;  1MR8 A;  3GK1 A;  5FI2 A;  2PQL A;  1PRW A;  2KI4 C;  3DY9 A;  1WRK A;  3EVU A;  3S0G A;  1KFX L;  3I5H B;  1FI6 A;  1G8I A;  2P6B B;  3EVV A;  3OBV A;  4YBH B;  3I5I B;  2K0J A;  2BE6 A;  2KNE A;  5I2O A;  1DJH A;  4OKH A;  2PSR A;  1IQ3 A;  1DF0 B;  5J3X A;  1PSB A;  4MZJ A;  1ZMZ A;  3L4A A;  4MSP A;  2CTN A;  1ORG A;  1SL9 A;  2F3Y A;  2HQ8 A;  4FTG A;  1A75 B;  1BMO A;  2KFG A;  5HKW A;  5I94 A;  1QVI Y;  1YX8 A;  1RRO A;  1E8A A;  1Y1U A;  2G2B A;  1UWO A;  2ZND A;  1FF1 A;  1BF5 A;  3ZNI A;  3CGA A;  1YRT B;  1LA3 A;  2R2I A;  3A4U B;  4N5X A;  4NDB A;  2QEB A;  2LLS A;  3DVK A;  4IL1 A;  3Q8I A;  1KQM C;  1UUS A;  2OPO A;  4NQG A;  3CYZ A;  2KGB C;  2BCB A;  3NGV A;  3RM1 A;  1S5G Z;  1P28 A;  2KDH A;  3KPX A;  3CAB A;  1FW4 A;  1PSR A;  1R6P A;  2KYC A;  4GGF A;  4HRG A;  3O4Y A;  2PVB A;  2M49 B;  1V1F A;  1WDC C;  2OS8 C;  2V53 A;  2WCJ A;  3SG3 A;  3A8R A;  3SG5 A;  1QJT A;  2KQY A;  3VRO A;  1N0Y A;  1IWQ A;  3FE8 A;  1JFJ A;  3O4X A;  1K94 A;  4CLN A;  2MA2 A;  2LP2 A;  2MLF C;  3GK4 X;  2E30 A;  2NCP A;  5KSZ A;  1BR4 B;  1PUL A;  4NDD A;  2HF5 A;  3PM2 A;  4N1F A;  1B8R A;  1SSE B;  3VRQ A;  3DVM A;  4OR9 B;  1YUU A;  5FYX A;  3FS7 A;  1OMD A;  3BYA A;  3NHI A;  1PK0 D;  1CMF A;  1B7T Z;  5HYD A;  2WCE A;  4R1E A;  1K93 D;  4F7F A;  1AUI B;  1JUO A;  1S3P A;  1ALW A;  1PVA A;  4YGB B;  5KU1 A;  2WC5 A;  1DJZ A;  1F54 A;  3QRX A;  2KBM A;  4YGA A;  4PAL A;  5DKR A;  3KHE A;  2KHN A;  1B47 A;  2WCF A;  2BCA A;  3DF0 B;  3FIA A;  3S0E A;  2WC8 A;  1EH2 A;  1N65 A;  4JQ0 D;  2LVJ A;  2JRF A;  3TS5 B;  1OZO A;  3VGO A;  1B8C A;  1N2D A;  1NX3 A;  3EKH A;  3I5F C;  2FOT A;  3JVT C;  2JNF A;  2LHL A;  5ER4 X;  4KYN A;  1DJI A;  5D69 A;  1KK8 C;  3TUY B;  4HRH A;  1H8B A;  3L4L A;  2K7B A;  4BY4 A;  1J7O A;  1HQV A;  2H8V A;  1C7W A;  3M0W A;  3AAK A; 
#chains in the Genus database with same CATH homology
 4PE4 A;  5HLO A;  2E6W A;  1AVS A;  3SJS A;  3MSE B;  1DT7 B;  1F71 A;  3BUN B;  2ZKM X;  3SG7 A;  2BL0 B;  1UHH A;  3JTD C;  2LNK A;  1BOD A;  2L98 A;  1LVC D;  1XFV O;  2MJW B;  1SRA A;  4PDZ A;  4MRX A;  2LVI A;  1RK9 A;  3EVR A;  3C1V A;  2LVK A;  2JOJ A;  2PAS A;  1CMG A;  1CFP A;  1IKU A;  2ZFD A;  1DVI A;  1OQP A;  4ORA B;  2K7O A;  1MUX A;  1Q80 A;  2BKI B;  3WXA A;  1KWO B;  1F55 A;  4DUQ A;  4I5N B;  2K7C A;  3D0Y A;  1NIW A;  2DOQ A;  1NX2 A;  1AHR A;  2LVV A;  2A4J A;  2JT0 A;  1BT6 A;  1A29 A;  1A4P A;  2L0P A;  1CKK A;  1TNW A;  3PSR A;  5ER5 A;  4PCW A;  1AJ4 A;  1RJV A;  2FCD A;  4DCK A;  3CR2 A;  4M2P A;  1KCY A;  1SL8 A;  3BUX B;  2M1K B;  1CM4 A;  1C7V A;  2MLE C;  1F8H A;  4WRI A;  4JWQ A;  4D1E A;  2JXC A;  1B9A A;  1KFU S;  1TN4 A;  1CFC A;  2Q91 A;  3KO0 A;  2L5X B;  2F3Z A;  1QAT A;  1J1E A;  3TDU A;  1FPW A;  3LCP C;  2KYF A;  2D8N A;  2Y1N A;  3DVE A;  3NSO A;  5KTY A;  4DS7 A;  1CFF A;  5I2Q A;  4DRW A;  1QVI Z;  1Y0V H;  3DVJ A;  3OB2 B;  1DTL A;  1CLB A;  2B1U A;  2JZI A;  1S6I A;  2WCB A;  3ZWH A;  1C07 A;  2KFH A;  3GK2 A;  4MZK A;  4I5J A;  3OX6 A;  4WQ2 A;  2JNX A;  1LA0 A;  3E3R A;  1CDN A;  1DJX A;  5G08 A;  1NYA A;  1XYD A;  1Y6W A;  2LMT A;  1EL4 A;  1S26 D;  2ZN9 A;  1DGV A;  3VRP A;  2BKH B;  1GGW A;  1SW8 A;  3BOW A;  3HCM A;  4I5L B;  5DKN A;  2KAV A;  1B8L A;  4CFR A;  1K90 D;  2AMI A;  2BBM A;  1CNP A;  4A4C A;  3IQQ A;  3TS5 C;  1QXP A;  2WOS A;  4XJK A;  5AEQ A;  1KFU L;  1XFX O;  2LHI A;  1S6C A;  3EK7 A;  1IRJ A;  3LLE A;  4C0J A;  4P5O E;  1DJY A;  1NCZ A;  2NLN A;  3TUY C;  3CZT X;  1JWD A;  4E68 A;  2KAX A;  2LP3 A;  2LC5 A;  1DJW A;  1GGZ A;  1SCM B;  3FWC A;  4TNC A;  4YGD B;  1ZUZ A;  2BL0 C;  1TNP A;  1CDM A;  2BEC A;  1ZOT B;  1EXR A;  1BLQ A;  1WLM A;  1RTP 1;  1SKT A;  1Y1X A;  4M2Q A;  1QAS A;  1DF0 A;  1SBJ A;  1H4B A;  2I18 A;  4MLW A;  4QJ4 B;  1KK7 Y;  2AAO A;  1G4Y R;  3VRN A;  4AQJ A;  1M46 A;  4ETO A;  3I5G C;  5I2L A;  3IQO A;  1F4Q A;  1YVL A;  4A4B A;  4XYN A;  1REC A;  1A75 A;  1YX7 A;  1JFK A;  1FBV A;  1NSH A;  1CDP A;  1KSM A;  3D0Y B;  2PRU A;  1J7R A;  1KWO C;  1QX5 B;  2O60 A;  1XFY O;  4U8D A;  4PHM A;  2L50 A;  2AUC A;  4YI8 A;  4WQ3 A;  2CBL A;  1QV1 A;  1SL7 A;  2M3W A;  1QIV A;  2L51 A;  4PHK A;  4AOM A;  1AJ5 A;  1QX2 A;  2JT3 A;  2MHH A;  2Y1M A;  1OMR A;  3SG2 A;  2K2A A;  5AER A;  4F0Z B;  3PLF B;  4MEW A;  2LV7 A;  2JTT A;  1NWD A;  2CNP A;  2F8P A;  4C0K A;  1KQV A;  2BBN A;  3I5H C;  2FJU B;  5JOL A;  2L4I A;  2Q4U A;  1V1G A;  1K9P A;  3I5I C;  1OMV A;  1YUR A;  1UHJ A;  2M0R A;  3DD4 A;  1W7I B;  1EJ3 A;  1NUB A;  4MVF A;  4BY5 A;  1XA5 A;  1YRU B;  1K8U A;  2NZ0 A;  3EK8 A;  2NXQ A;  2H61 C;  4HSZ A;  2CT9 A;  3AKA A;  4GNK B;  3BUW B;  3BQ3 A;  1X02 A;  2KSP A;  1KFX S;  1QTX A;  2HQW A;  1FI5 A;  2LCP A;  1DMO A;  1NX0 A;  1AP4 A;  2ISD A;  1WRZ A;  2GGZ A;  4PE1 A;  2JUL A;  3NSK A;  2JC2 A;  1CLL A;  2K7D A;  1JC2 A;  1JF0 A;  2K8M B;  1SR6 B;  4AQI A;  1NCX A;  5CPV A;  3FWB A;  4ZCV A;  3SIA A;  1RFJ A;  1NPQ A;  1J7Q A;  2Y4Q A;  5IBW A;  2MAZ A;  2KI6 D;  2KQ6 A;  1L2O B;  3HX4 A;  1TCF A;  4YGE B;  5CSN A;  1NX1 A;  1PVB A;  1OE9 B;  1QX7 A;  1MHO A;  1UUR A;  1KSO A;  1DJG A;  3BUM B;  5JJG A;  1G33 A;  2F33 A;  3DF0 A;  2LUX A;  1IQ5 A;  1LKJ A;  3I5F B;  1J1D A;  4XJK B;  1F4O A;  3PAT A;  2TN4 A;  1MXL C;  1KK8 B;  2Y5I A;  2WND A;  1Y1A A;  2K2F A;  3WNX B;  3CLN A;  2JWW A;  2I2R E;  2HET A;  2OTG B;  1U5I A;  3IF7 A;  1IJ6 A;  1WRL A;  1B1G A;  2NCO A;  1BOC A;  1JF2 A;  1TTX A;  1TOP A;  2IS9 A;  5BPJ A;  1WLZ A;  1CFD A;  1VRK A;  1JSA A;  1YR5 A;  1OZS A;  3JTD B;  3GOF A;  1QLK A;  1J7P A;  1SCM C;  1RWY A;  1SMG A;  1YTZ C;  2F2P A;  5B8I B;  3NSL A;  4MRY A;  1K2H A;  5CSJ A;  4OVN F;  1XFZ O;  2KOT A;  4HRE E;  4DIR A;  1S6J A;  1BR1 B;  3O78 A;  3VRR A;  1XO5 A;  1TNX A;  1A2X A;  2GV5 A;  2QAC A;  3PM8 A;  4YRU A;  1ZAC A;  1CDL A;  1NCY A;  1UHN A;  2L2E A;  4GPL B;  5D7F A;  4GUK A;  4ORB B;  3OX5 A;  2SCP A;  3OB1 B;  2M97 A;  3TDI A;  3PN7 B;  2EC6 B;  1QIW A;  1W7J B;  3LK0 A;  4M2O A;  1XK4 C;  3PAL A;  1DGU A;  2ZRT A;  4GGN A;  2LM5 A;  3RLZ A;  4MZL A;  5HLV A;  1K9U A;  2LMU A;  1S36 A;  1S5G Y;  1J55 A;  1TNQ A;  2HPS A;  2KI4 B;  1XFW O;  4NDC A;  1BJF A;  1YVH A;  2EGD A;  3CR5 X;  2COL B;  1S1E A;  3CTN A;  1QS7 A;  1XVJ A;  3SG4 A;  1CB1 A;  4QJ5 B;  1D1O A;  1SYM A;  5AFP A;  3EK4 A;  1SY9 A;  3PFV A;  2SAS A;  2H2K A;  2PMY A;  1K95 A;  1M39 A;  4USL A;  1OOJ A;  1A03 A;  3WHT B;  1TCO B;  1QLS A;  2JXL A;  2K61 A;  2KGR A;  1B4C A;  1KK7 Z;  1LIN A;  1M45 A;  1CTR A;  2LAP A;  2QPT A;  4OCI A;  1UP5 A;  4PE0 A;  2H61 A;  4ZCU A;  1EG4 A;  1YUS A;  1F70 A;  1SNL A;  1TIZ A;  4Q04 A;  5AAN A;  4MBE A;  2VRG A;  1ODB A;  5HKZ A;  1IGV A;  1AK8 A;  1PAL A;  1B7T Y;  2GGM A;  1XFU O;  4YI9 A;  2EHB A;  2PAL A;  2M7N A;  3KEV A;  1KQM B;  4CID A;  3AKB A;  4I5K A;  4P2Y B;  4PHN A;  2I94 A;  3SIB A;  2LAN A;  2M29 A;  1UHI A;  1SR6 C;  4ORC B;  4GFT A;  1LXF C;  1GJY A;  2JQ6 A;  4FQO A;  5DKQ A;  4PE7 A;  1L2O C;  5F6T A;  5GQQ C;  4GGF C;  1WDC B;  1EG3 A;  2OS8 B;  1JBA A;  5TNC A;  1HT9 A;  1WY9 A;  2CCM A;  2JTZ A;  2LUC A;  2LLU A;  2M1U A;  2BCX A;  1OSA A;  2MRD A;  1QV0 A;  4QJ3 B;  2O5G A;  3D10 A;  1SCV A;  2WOR A;  4MN0 A;  2ZRS A;  1MF8 B;  5AXI A;  3WHU B;  4CFQ A;  1K9K A;  1M63 B;  1NP8 A;  1U5I B;  3CWG A;  1SPY A;  2LLT A;  3O6B A;  1SK6 D;  1TRF A;  2OTG C;  1IG5 A;  3F45 A;  1BG1 A;  1BU3 A;  2G9B A;  2LMV A;  3BUO B;  4L9M A;  4C0L A;  5CSF A;  1M31 A;  3O2P A;  3TDZ A;  2I7A A;  3SG6 A;  2L4H A;  3OP0 A;  3NXA A;  1ZFS A;  2BE4 A;  1R2U A;  2M8U A;  1CM1 A;  2M7L A;  4CPV A;  4UPG A;  2RGI A;  4GAO A;  1UHK A;  2KI6 C;  3EKJ A;  3NSI A;  4GBA A;  3I5G B;  3H4S E;  2JT8 A;  2JU0 A;  2KFF A;  2M9G A;  3CS1 A;  3K21 A;  1L7Z A;  2CXJ A;  2F2O A;  5I8N A;  3OHM B;  2FCE A;  3BOW B;  5HKY A;  4OV2 A;  5K89 A;  3AAJ A;  1MXE A;  3LL8 B;  2ZNE A;  1IJ5 A;  3JVT B;  1CLM A;  3TZ1 A;  5PAL A;  4PHJ A;  3ICB A;  2JPT A;  4ICB A;  3PN7 C;  2KBI A;  2EC6 C;  2KAY A;  2MBX A;  1IH0 A;  3CR4 X;  1YUT A;  1K96 A;  3BXK A;  4YGC B;  1XK4 A;  1MWN A;  2ZN8 A;  4JPZ B;  2LE9 B;  4N1G A;  1GQM A;  3LK1 A;  1MQ1 A;  5CSI A;  1ALV A;  3KF9 A;  1MR8 A;  3GK1 A;  1PRW A;  2KI4 C;  1WRK A;  3EVU A;  1KFX L;  3I5H B;  1FI6 A;  1G8I A;  2P6B B;  3EVV A;  4YBH B;  3I5I B;  2K0J A;  2BE6 A;  2KNE A;  5I2O A;  1DJH A;  4OKH A;  2PSR A;  1IQ3 A;  1DF0 B;  5J3X A;  1PSB A;  4MZJ A;  1ZMZ A;  4MSP A;  2CTN A;  1SL9 A;  2F3Y A;  2HQ8 A;  4FTG A;  1A75 B;  1BMO A;  2KFG A;  5HKW A;  1QVI Y;  1YX8 A;  1RRO A;  1E8A A;  1Y1U A;  2G2B A;  1UWO A;  2ZND A;  1FF1 A;  1BF5 A;  3ZNI A;  3CGA A;  1YRT B;  1LA3 A;  2R2I A;  3A4U B;  4N5X A;  4NDB A;  2LLS A;  3DVK A;  4IL1 A;  1KQM C;  1UUS A;  2OPO A;  4NQG A;  2KGB C;  2BCB A;  3RM1 A;  1S5G Z;  2KDH A;  3KPX A;  1FW4 A;  1PSR A;  1R6P A;  2KYC A;  4GGF A;  4HRG A;  3O4Y A;  2PVB A;  2M49 B;  1V1F A;  1WDC C;  2OS8 C;  2V53 A;  3SG3 A;  3A8R A;  3SG5 A;  1QJT A;  2KQY A;  3VRO A;  1N0Y A;  1IWQ A;  1JFJ A;  1K94 A;  4CLN A;  2MA2 A;  2LP2 A;  2MLF C;  3GK4 X;  2E30 A;  2NCP A;  5KSZ A;  1BR4 B;  1PUL A;  4NDD A;  2HF5 A;  4N1F A;  1B8R A;  3VRQ A;  3DVM A;  4OR9 B;  1YUU A;  5FYX A;  3FS7 A;  1OMD A;  3BYA A;  1PK0 D;  1CMF A;  1B7T Z;  5HYD A;  2WCE A;  4R1E A;  1K93 D;  1AUI B;  1JUO A;  1S3P A;  1ALW A;  1PVA A;  4YGB B;  5KU1 A;  1DJZ A;  1F54 A;  3QRX A;  2KBM A;  4YGA A;  4PAL A;  5DKR A;  3KHE A;  2KHN A;  1B47 A;  2WCF A;  2BCA A;  3DF0 B;  3FIA A;  2WC8 A;  1EH2 A;  1N65 A;  4JQ0 D;  2LVJ A;  2JRF A;  3TS5 B;  1OZO A;  3VGO A;  1B8C A;  1N2D A;  1NX3 A;  3EKH A;  3I5F C;  2FOT A;  3JVT C;  2JNF A;  2LHL A;  5ER4 X;  1DJI A;  5D69 A;  1KK8 C;  3TUY B;  4HRH A;  1H8B A;  2K7B A;  4BY4 A;  1J7O A;  1HQV A;  1C7W A;  3M0W A;  3AAK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...