2BKHB

Myosin vi nucleotide-free (mdinsert2) crystal structure
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
145
structure length
137
Chain Sequence
QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Myosin Vi Motor Reveals the Mechanism of Directionality Reversal
pubmed doi rcsb
source organism Sus scrofa
molecule tags Motor protein/metal-binding protein
molecule keywords UNCONVENTIONAL MYOSIN
total genus 36
structure length 137
sequence length 145
ec nomenclature
pdb deposition date 2005-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2bkhB01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2bkhB02
1U5IA 3EK7A 3D0YA 1SR6B 1OZOA 2OS8C 1A75A 3FIAA 3PALA 4MBEA 3IQQA 2WC8A 1ALVA 1QV0A 2LAPA 2WCBA 3AKAA 1BT6A 4CFQA 2D8NA 1H8BA 2F2PA 1UHIA 4DRWA 2PMYA 2GGMA 1YTZC 1S5GZ 4QJ3B 3VRRA 2E6WA 2KOTA 2L4IA 2ZKMX 3EK4A 1F4OA 2LHIA 2NZ0A 1AK8A 1G8IA 2ISDA 3ICBA 3TS5B 3QRXA 1B9AA 3TDZA 1TIZA 1CB1A 3GOFA 2CXJA 4PALA 4OV2A 3BUMB 1BU3A 5DKRA 5D7FA 2F33A 1XO5A 1BODA 1SCMC 3JTDB 3BXKA 2EGDA 2KFFA 2WCEA 5J3XA 1OSAA 3TZ1A 3OB2B 2K7CA 2B1UA 4E68A 4PCWA 1H4BA 1YURA 2WOSA 1SBJA 1MUXA 2BL0B 1B7TZ 1QIWA 1OE9B 4C0LA 3BUOB 1LINA 3H4SE 1AP4A 3KF9A 1DJIA 4NDDA 4CPVA 3I5HB 4ORAB 3WHTB 1CDNA 1CNPA 1B8LA 1F55A 2O60A 3M0WA 1GJYA 1MHOA 3DD4A 3I5IC 1J7PA 2L51A 2WCFA 4NDBA 2O5GA 1DJYA 2M9GA 4PE4A 2BE6A 1DJGA 1S6JA 4MSPA 1AVSA 2JULA 4GFTA 2K61A 1QV1A 1J1EA 2LLUA 4L9MA 4PHMA 4WQ2A 3TDUA 1MF8B 1SY9A 2Y5IA 3A8RA 4AQJA 5AERA 4DS7A 5F6TA 1WRZA 2AMIA 3PM8A 4MRYA 1S6IA 1QS7A 2M7LA 4FTGA 1F71A 4CIDA 1FW4A 5G08A 3LL8B 2MBXA 2MLEC 3CR5X 1UURA 2L5XB 2ZNEA 3EKHA 4GBAA 1JSAA 2QPTA 2BKIB 3SIAA 5JOLA 1K93D 1JUOA 1XFUO 2PALA 1CLMA 5HKWA 2Y1NA 4AQIA 3FWBA 1S26D 3GK4X 1NX3A 1IJ6A 1VRKA 4GGFC 3NXAA 1A4PA 2LM5A 5FYXA 5DKNA 5KTYA 1AJ4A 1CM1A 2I2RE 2FOTA 1C7WA 3GK2A 1K9PA 1AHRA 3O78A 2SASA 1K2HA 1S5GY 1N2DA 1DJZA 3K21A 4I5NB 4R1EA 1TNQA 2P6BB 1JF0A 2JTZA 4I5LB 1SCVA 1K8UA 1N65A 1QX7A 3KO0A 1KSOA 1QATA 2PVBA 2LLSA 5HLOA 4D1EA 4XYNA 1EXRA 1IQ5A 4FQOA 3IF7A 1IQ3A 1NCXA 4ORCB 3I5FB 2OTGC 1KK7Z 4MN0A 2G2BA 1YUTA 5B8IB 1RFJA 3JVTC 1KQMC 2VRGA 2GV5A 4ICBA 5D69A 1B1GA 2K7DA 4MLWA 4YGAA 1IRJA 1QVIY 5HKYA 2WNDA 3MSEB 5HYDA 1L2OB 2M8UA 1E8AA 1RK9A 4YBHB 3ZWHA 3CTNA 1KFUL 1LA3A 2H61A 2HPSA 2PASA 1MWNA 5IBWA 1A75B 2KGRA 4OVNF 2H61C 3D0YB 3EVVA 2KAVA 4GGFA 1G4YR 3SG2A 3VGOA 1ALWA 2BCAA 4MZLA 3FS7A 2K7OA 1XYDA 2K2AA 5DKQA 1OMVA 5HLVA 1KCYA 2BBMA 3F45A 2FCDA 1JWDA 1TNXA 3SIBA 4AOMA 1KWOB 1ZFSA 4NDCA 1TCFA 1BMOA 1TRFA 1UHHA 3NSOA 1CM4A 4N5XA 2LMUA 4QJ4B 4GGNA 1SCMB 2ZN8A 1SW8A 2JQ6A 5KU1A 2MLFC 3BOWA 1FI5A 4M2QA 5I2LA 1XK4A 4MEWA 4ZCVA 2FCEA 1DJHA 2KFHA 3EVRA 3DVKA 3TUYC 2JTTA 2JNFA 1LXFC 2KHNA 2HF5A 2KI4B 4ETOA 1KK7Y 5CSFA 2K8MB 4CLNA 1Y1UA 3NSKA 5TNCA 1M45A 1NX1A 1B47A 3CS1A 1CKKA 1Q80A 1QVIZ 5CSIA 4HSZA 1J7OA 5CPVA 3O2PA 2BE4A 1OMRA 1SRAA 1DVIA 1QX5B 2LC5A 4YGEB 4YRUA 2LVIA 1EJ3A 2KYCA 3BUNB 5JJGA 1KFXS 2M97A 1NCYA 2LUXA 1JFKA 3KPXA 1S6CA 3CLNA 2LV7A 1KWOC 1YUUA 3D10A 1XFVO 1PVBA 1BR1B 1B8RA 1QASA 2I18A 1TNWA 2K7BA 2KYFA 3I5HC 2KAYA 1XVJA 4MRXA 4YI8A 1DMOA 1W7JB 2BCXA 3DF0B 1C07A 3CR4X 4C0JA 3KEVA 2FJUB 1EH2A 2OPOA 1QXPA 2CCMA 1RJVA 3I5GC 3VROA 2I7AA 1A2XA 1OMDA 2EC6C 2GGZA 3SJSA 3BYAA 2OS8B 4OCIA 1PULA 3BUWB 1CMFA 1BG1A 2KI6D 3PSRA 1UUSA 2JT8A 1DJWA 3PN7C 4U8DA 1G33A 4GNKB 1S36A 1NYAA 1YUSA 3CZTX 2DOQA 5CSJA 4PE0A 3AKBA 1HQVA 1K9UA 2RGIA 1SMGA 2M49B 4PE1A 1IG5A 1QIVA 2BBNA 4UPGA 1CDLA 2Y1MA 5AXIA 1BOCA 2I94A 2L50A 2NCPA 3CR2A 1FBVA 1Y1XA 4I5KA 1LKJA 4JQ0D 4BY4A 1A03A 2OTGB 3O6BA 1UHJA 3OP0A 4PDZA 5CSNA 2LNKA 4IL1A 1KQMB 1ZMZA 1YR5A 1UHNA 4PHJA 3WXAA 1DT7B 4DCKA 3SG4A 1ZACA 4PHKA 5I8NA 3VRQA 1B4CA 2JT3A 1ZOTB 1Y0VH 2HETA 3TDIA 3TS5C 3OX5A 5BPJA 1NPQA 1QLSA 3DVJA 3CGAA 2MA2A 2E30A 2M0RA 3PN7B 1SPYA 4M2OA 1L7ZA 2ZRSA 1AJ5A 1GQMA 1IWQA 2KBIA 4PHNA 1RTP1 1CFDA 5AFPA 1MR8A 4JWQA 1JC2A 1F70A 3JVTB 1FI6A 2F8PA 1K96A 3LK0A 1FPWA 2K2FA 4YI9A 2KAXA 1KSMA 2L4HA 2L98A 2BCBA 1DF0A 4USLA 1SL7A 2KQYA 1J7QA 3BUXB 1EG4A 1YRUB 1TNPA 1YVLA 3E3RA 2LP2A 2MJWB 1NP8A 2JNXA 3NSIA 1PK0D 3PFVA 1KK8B 4NQGA 3OHMB 2JT0A 2HQ8A 2TN4A 4WRIA 1M46A 3TUYB 4DIRA 1GGWA 2LUCA 2ZNDA 1KQVA 3OX6A 4TNCA 1OOJA 1X02A 2ZRTA 4MZJA 4P5OE 2SCPA 4JPZB 1K94A 2AAOA 3DVEA 1TTXA 2QACA 1CLLA 2KNEA 2F3ZA 1WRKA 1DF0B 1QJTA 1SL8A 2MRDA 5ER5A 1TCOB 3WNXB 5PALA 2LVKA 2JXLA 1K95A 3SG6A 2AUCA 2PRUA 1XFZO 3A4UB 3NSLA 1U5IB 1RWYA 1BF5A 3OB1B 5AEQA 1CDMA 3DF0A 3GK1A 4C0KA 1SR6C 1CFCA 1F8HA 4DUQA 1PSBA 3I5FC 1UHKA 2JXCA 2COLB 5HKZA 1YVHA 3ZNIA 1LA0A 4N1GA 1KK8C 1J7RA 1NWDA 2MHHA 3AAKA 1TOPA 4OKHA 1NSHA 2KFGA 2EC6B 1S1EA 2LMTA 3AAJA 2EHBA 2CTNA 1IJ5A 2ZFDA 1EL4A 1WLMA 1XFWO 3WHUB 5ER4X 1R6PA 5I2QA 2LE9B 4ZCUA 1DGVA 1PRWA 1CMGA 3CWGA 3HCMA 2NLNA 1IGVA 1SL9A 1WLZA 1D1OA 1M31A 2KBMA 3KHEA 1F54A 2LANA 1V1FA 2M29A 1C7VA 3C1VA 2NXQA 3HX4A 3JTDC 5AANA 1OQPA 1M39A 2CT9A 4GUKA 4HRGA 2IS9A 3BOWB 2BL0C 2LHLA 4Q04A 2LVVA 1S3PA 4BY5A 4WQ3A 1NX2A 1JBAA 3LK1A 4XJKB 1CLBA 1L2OC 2KDHA 4HREE 3SG5A 5K89A 3EKJA 2M1KB 2JWWA 1PALA 2LCPA 3I5IB 1K90D 2G9BA 2ZN9A 4HRHA 4YGCB 2H2KA 1AUIB 1R2UA 2JOJA 1WDCB 2L2EA 1DGUA 1DJXA 1GGZA 2A4JA 1V1GA 2NCOA 1IH0A 2M1UA 4MZKA 1WY9A 1QLKA 4N1FA 1K9KA 4P2YB 2JZIA 2LMVA 4F0ZB 3O4YA 1SNLA 1J55A 1YX8A 1RROA 1UP5A 2V53A 3DVMA 2KI6C 4ORBB 1QTXA 2KGBC 4YGDB 1CDPA 5KSZA 1SKTA 1UWOA 4GAOA 1TN4A 2BECA 2F3YA 4XJKA 2MAZA 3PLFB 2Q4UA 1Y6WA 3RLZA 3VRNA 1JF2A 1SK6D 1CFPA 2CNPA 3SG3A 1XA5A 1HT9A 2K0JA 2LVJA 2F2OA 1EG3A 1SYMA 2L0PA 2M7NA 2KI4C 1YX7A 2JC2A 1NCZA 4M2PA 1A29A 1NUBA 1PSRA 1QX2A 1YRTB 4I5JA 4CFRA 5I2OA 1CFFA 1XFYO 2HQWA 3SG7A 2M3WA 1LVCD 1MXLC 2LLTA 1Y1AA 2JU0A 2PSRA 1KFUS 1DTLA 1WDCC 1W7IB 1F4QA 3BQ3A 3LCPC 4A4CA 3PATA 3EVUA 1NX0A 3VRPA 1MXEA 2JRFA 1XFXO 4QJ5B 1OZSA 1BLQA 1ODBA 3IQOA 2R2IA 3EK8A 4YGBB 2LP3A 1N0YA 1JFJA 1CTRA 3FWCA 4PE7A 2BKHB 2WORA 1WRLA 1B8CA 1XK4C 1BR4B 2Q91A 2CBLA 1IKUA 2KSPA 1KFXL 3RM1A 1FF1A 2Y4QA 4OR9B 2JPTA 1BJFA 1M63B 2KQ6A 1MQ1A 1ZUZA 1PVAA 3LLEA 4MVFA 1NIWA 5GQQC 4A4BA 1B7TY 1J1DA 3I5GB 4GPLB 1RECA
chains in the Genus database with same CATH superfamily
3D73A 1U5IA 3EK7A 3D0YA 1SR6B 5DICA 1OZOA 2OS8C 1A75A 3FIAA 3PALA 4MBEA 3IQQA 3NHIA 2WC8A 1ALVA 1QV0A 2LAPA 2WCBA 3AKAA 3FE6A 1BT6A 4CFQA 2D8NA 3V2LA 1H8BA 2F2PA 1UHIA 2WCMA 3S0DA 4DRWA 2PMYA 2GGMA 1YTZC 1S5GZ 4QJ3B 3VRRA 2E6WA 2KOTA 2L4IA 2ZKMX 3EK4A 1F4OA 2LHIA 2NZ0A 1AK8A 1TUJA 1G8IA 2ISDA 3ICBA 3TS5B 3QRXA 1B9AA 3TDZA 3DZTA 1TIZA 1CB1A 2QEOA 3GOFA 3CZ0A 2CXJA 4PALA 4OV2A 3BUMB 1BU3A 3D74A 5DKRA 5D7FA 2F33A 1XO5A 1BODA 1SCMC 3BJHA 3JTDB 3BXKA 2EGDA 2KFFA 2WCEA 5J3XA 1OSAA 3TZ1A 3OB2B 2K7CA 2B1UA 3B7AA 4PCWA 4E68A 1H4BA 1YURA 2WOSA 1SBJA 1MUXA 2BL0B 1B7TZ 1QIWA 1OE9B 4C0LA 3BUOB 1LINA 3H4SE 3FE9A 1AP4A 3KF9A 1DJIA 4NDDA 4CPVA 2QDIA 3I5HB 4ORAB 3WHTB 1CDNA 1CNPA 1B8LA 1F55A 2O60A 3M0WA 1GJYA 1MHOA 3DD4A 3I5IC 1J7PA 2L51A 2WCFA 4NDBA 2O5GA 1DJYA 2M9GA 4JKTA 4PE4A 2BE6A 1DJGA 1S6JA 4MSPA 1AVSA 2JULA 4GFTA 2H8VA 1QV1A 2K61A 1J1EA 2LLUA 4L9MA 4PHMA 4WQ2A 3TDUA 1MF8B 1SY9A 2Y5IA 3A8RA 4AQJA 5AERA 4DS7A 5F6TA 1WRZA 2AMIA 3PM8A 4MRYA 1Z2CB 3SS3A 1S6IA 2PYQA 4OZDA 1QS7A 2M7LA 5D3OA 4FTGA 1F71A 4CIDA 1FW4A 1DQEA 5G08A 3S0EA 3LL8B 2MBXA 2MLEC 3CR5X 5FI7A 1UURA 2L5XB 2ZNEA 3EKHA 4GBAA 1JSAA 2JPOA 2QPTA 2BKIB 3UO9A 3SIAA 5JOLA 1K93D 2KLEA 1JUOA 1XFUO 2PALA 1CLMA 3B87A 5HKWA 2Y1NA 4AQIA 3FWBA 1S26D 3GK4X 1NX3A 1IJ6A 1VRKA 4GGFC 3NXAA 1A4PA 2LM5A 5FYXA 5DKNA 5KTYA 1AJ4A 1CM1A 2I2RE 2FOTA 1C7WA 3GK2A 1K9PA 1AHRA 3O78A 2FJYA 2SASA 1K2HA 4FQTA 1S5GY 1N2DA 1DJZA 3K21A 4I5NB 4R1EA 1TNQA 3CYZA 2P6BB 1JF0A 2JTZA 4I5LB 1SCVA 1K8UA 1N65A 1QX7A 3KO0A 1KSOA 2L5YA 1QATA 2PVBA 2LLSA 5HLOA 4D1EA 4XYNA 1EXRA 1IQ5A 4FQOA 3IF7A 1B1GA 3IVTA 1IQ3A 1NCXA 4ORCB 3I5FB 2OTGC 1KK7Z 4MN0A 2G2BA 1YUTA 5B8IB 1RFJA 3JVTC 1KQMC 2VRGA 2GV5A 4ICBA 1LS8A 5D69A 2K7DA 4MLWA 3Q8IA 4OKHA 4YGAA 1IRJA 1QVIY 5HKYA 2WNDA 3MSEB 3DY9A 5HYDA 1L2OB 2M8UA 5FI6A 1E8AA 1RK9A 4YBHB 3ZWHA 3CTNA 2QEBA 1KFUL 1LA3A 2H61A 3UNWA 2HPSA 2GTEA 2PASA 1MWNA 5IBWA 1A75B 2KGRA 4OVNF 4JD9A 2H61C 3D0YB 5EL2A 3S0AA 3EVVA 2KAVA 4GGFA 1G4YR 3SG2A 3VGOA 3D76A 1ALWA 2BCAA 3R1PA 3FS7A 2K7OA 4MZLA 1XYDA 2K2AA 3EG5B 5DKQA 1OMVA 5HLVA 1KCYA 2BBMA 3F45A 2FCDA 1JWDA 1TNXA 2P71A 3SIBA 4AOMA 1KWOB 1ZFSA 4NDCA 1TCFA 1BMOA 1TRFA 1UHHA 3NSOA 1CM4A 4N5XA 2LMUA 4QJ4B 4GGNA 1SCMB 2ZN8A 1SW8A 2JQ6A 5KU1A 2MLFC 3BOWA 1FI5A 4M2QA 5I2LA 1XK4A 4MEWA 4ZCVA 2FCEA 1DJHA 2KFHA 3EVRA 3DVKA 3TUYC 2JTTA 2JNFA 1LXFC 2P70A 2KHNA 2HF5A 2KI4B 4ETOA 1KK7Y 3RZSA 5CSFA 2K8MB 4CLNA 1Y1UA 3NSKA 5TNCA 1M45A 1NX1A 1B47A 3CS1A 1CKKA 1Q80A 1QVIZ 5CSIA 4HSZA 3S0BA 1J7OA 5CPVA 3O2PA 2BE4A 1OMRA 2QEHA 1SRAA 1DVIA 1QX5B 2YGUA 2LC5A 4YGEB 4YRUA 2LVIA 1EJ3A 2KYCA 3BUNB 5JJGA 1KFXS 4PT1A 2M97A 2K60A 1NCYA 1DELA 2LUXA 1JFKA 3KPXA 1S6CA 3CLNA 3PM2A 2LV7A 3R1VA 1KWOC 1YUUA 3D10A 1XFVO 1DEKA 5FI2A 1PVBA 1BR1B 1B8RA 1QASA 2I18A 1TNWA 2K7BA 2KYFA 3I5HC 2KAYA 1XVJA 4MRXA 4YI8A 1DMOA 1W7JB 2BCXA 3DF0B 1C07A 3CR4X 4C0JA 3KEVA 1C3ZA 2FJUB 1EH2A 2OPOA 1QXPA 1GM0A 2CCMA 1RJVA 3I5GC 3VROA 2I7AA 1A2XA 1OMDA 2EC6C 2GGZA 1OOFA 3SJSA 3BYAA 2OS8B 4OCIA 1PULA 3BUWB 1CMFA 1BG1A 1SSEB 2KI6D 2QEVA 3PSRA 1UUSA 2JT8A 1DJWA 3PN7C 4U8DA 1G33A 4GNKB 1S36A 1NYAA 1YUSA 3CZTX 2DOQA 5CSJA 4PE0A 3AKBA 1HQVA 1K9UA 2RGIA 1SMGA 2M49B 4PE1A 1IG5A 1QIVA 2BBNA 4UPGA 2L2CA 1CDLA 2Y1MA 5AXIA 1BOCA 2I94A 2L50A 2NCPA 3CR2A 1FBVA 1Y1XA 4I5KA 1LKJA 4JQ0D 4BY4A 3D77A 1A03A 2OTGB 3O6BA 1UHJA 3OP0A 4PDZA 5CSNA 2LNKA 1Z4HA 4IL1A 1KQMB 1ZMZA 1YR5A 1UHNA 4PHJA 3WXAA 1DT7B 4DCKA 3SG4A 1ZACA 4PHKA 5I8NA 3VRQA 1B4CA 2JT3A 1ZOTB 1Y0VH 2HETA 3TDIA 3TS5C 3S0FA 3B6XA 3OX5A 5BPJA 1NPQA 1QLSA 3DVJA 3CGAA 2MA2A 2E30A 2M0RA 2WC6A 3PN7B 1SPYA 4M2OA 1L7ZA 2ZRSA 1AJ5A 1GQMA 3L4LA 1IWQA 2KBIA 4PHNA 1RTP1 5I94A 3L4AA 2BAPA 1CFDA 3OBVA 5AFPA 1MR8A 4JWQA 1JC2A 1F70A 3JVTB 1FI6A 2F8PA 1K96A 3LK0A 1FPWA 2K2FA 4YI9A 2KAXA 1KSMA 2L4HA 2L98A 2BCBA 1DF0A 2PQLA 4USLA 1SL7A 1TWOA 2KQYA 1J7QA 3BUXB 1EG4A 1YRUB 1TNPA 1YVLA 3E3RA 3R1OA 2LP2A 2MJWB 2WC5A 1NP8A 2JNXA 3NSIA 1PK0D 3PFVA 1IIOA 1KK8B 4NQGA 3OHMB 2JT0A 2HQ8A 2TN4A 3N7HA 4WRIA 1M46A 3B86A 3CZ1A 3TUYB 4DIRA 4INWA 1GGWA 2LUCA 2ZNDA 1KQVA 3OX6A 1DC1A 4TNCA 1OOJA 1X02A 2ZRTA 4MZJA 4P5OE 2KPHA 2SCPA 4JPZB 1K94A 2AAOA 3DVEA 1TTXA 2QACA 3SS4A 1CLLA 2KNEA 4IJ7A 2F3ZA 1WRKA 1DF0B 1QJTA 1SL8A 2MRDA 3CABA 3CZ2A 5ER5A 1TCOB 1CFFA 3WNXB 5PALA 2LVKA 2JXLA 1K95A 3OGNA 2AUCA 3SG6A 2PRUA 1XFZO 3A4UB 3FE8A 3NSLA 1U5IB 1RWYA 1OOHA 1BF5A 3OB1B 5AEQA 1CDMA 3QMEA 3DF0A 3GK1A 4C0KA 1SR6C 1CFCA 1F8HA 4DUQA 1PSBA 3I5FC 1UHKA 1TUZA 2JXCA 2COLB 4INXA 1YVHA 5HKZA 3ZNIA 1LA0A 2KLDA 1KK8C 1J7RA 4N1GA 1NWDA 2MHHA 3AAKA 1TOPA 3O4XA 1NSHA 1OOIX 2EC6B 1S1EA 2KFGA 2LMTA 3CDNA 3AAJA 2EHBA 2CTNA 1IJ5A 2ZFDA 1EL4A 3R72A 3SS5A 1WLMA 1XFWO 3WHUB 5HL1A 5ER4X 1R6PA 5I2QA 2LE9B 4ZCUA 2BNXA 1DGVA 1PRWA 1CMGA 3CWGA 3HCMA 3D75A 2NLNA 1IGVA 1XFRA 1SL9A 1WLZA 1D1OA 1OOGA 1M31A 2KBMA 3KHEA 3NGVA 1F54A 2LANA 1P28A 1V1FA 2M29A 1C7VA 3C1VA 2NXQA 3HX4A 3JTDC 4KYNA 1OQPA 5AANA 1M39A 2CT9A 4GUKA 4HRGA 2IS9A 3BOWB 3DXLA 2BL0C 2LHLA 4Q04A 2LVVA 1S3PA 4BY5A 4WQ3A 1NX2A 1JBAA 3LK1A 4XJKB 1CLBA 1L2OC 2KDHA 4HREE 3SG5A 5K89A 3EKJA 2M1KB 2JWWA 3DYEA 1PALA 2LCPA 3B88A 1K90D 3I5IB 2G9BA 2ZN9A 4HRHA 4YGCB 2H2KA 1AUIB 1R2UA 2WCHA 2JOJA 1WDCB 2L2EA 1DGUA 1DJXA 2WCKA 4F7FA 1GGZA 2A4JA 1V1GA 2WCJA 2NCOA 1T14A 3K1EA 2M1UA 4MZKA 1IH0A 1WY9A 1QLKA 4N1FA 1K9KA 4P2YB 2JZIA 2LMVA 4F0ZB 3O4YA 1SNLA 1J55A 1YX8A 1RROA 1UP5A 2V53A 3DVMA 3NHTA 2KI6C 4ORBB 1QTXA 2KGBC 4YGDB 1CDPA 3D78A 5KSZA 1SKTA 1UWOA 4GAOA 1TN4A 2BECA 3L47A 2F3YA 4XJKA 2MAZA 3PLFB 2Q4UA 1Y6WA 3RLZA 3VRNA 1JF2A 1SK6D 1CFPA 2CNPA 3SG3A 1XA5A 1HT9A 2K0JA 2LVJA 2F2OA 1EG3A 1SYMA 2L0PA 3VB1A 2ERBA 2KI4C 1YX7A 2JC2A 1NCZA 2M7NA 4M2PA 1A29A 3S0GA 1NUBA 1PSRA 1QX2A 1YRTB 4I5JA 1W9ZA 4CFRA 5I2OA 1XFYO 2HQWA 3SG7A 2M3WA 3PJIA 1LVCD 1MXLC 2LLTA 1Y1AA 2JU0A 2PSRA 1C3YA 1KFUS 1DTLA 1WDCC 1W7IB 1F4QA 3BQ3A 3LCPC 4A4CA 3PATA 3EVUA 1NX0A 3VRPA 1MXEA 2JRFA 1XFXO 4QJ5B 1OZSA 1BLQA 1ODBA 3IQOA 1OW4A 2R2IA 3EK8A 4YGBB 2LP3A 1N0YA 1JFJA 1CTRA 3BFAA 3FWCA 4PE7A 2BKHB 2WORA 2WCLA 1WRLA 1B8CA 1XK4C 1BR4B 2Q91A 1QWVA 2CBLA 2KSPA 1KFXL 1IKUA 3RM1A 1ORGA 3BFHA 2Y4QA 4OR9B 1FF1A 2JPTA 1BJFA 1M63B 2KQ6A 1MQ1A 1ZUZA 1PVAA 3LLEA 4MVFA 1NIWA 5GQQC 3BFBA 4A4BA 1B7TY 1J1DA 3I5GB 4GPLB 1RECA
chains in the Genus database with same CATH topology
1U5IA 3EK7A 3D0YA 1SR6B 1OZOA 2OS8C 1A75A 3FIAA 3PALA 4MBEA 3IQQA 2WC8A 1ALVA 1QV0A 2LAPA 2WCBA 3AKAA 1BT6A 4CFQA 2D8NA 1H8BA 2F2PA 1UHIA 4DRWA 2PMYA 2GGMA 1YTZC 1S5GZ 4QJ3B 3VRRA 2E6WA 2KOTA 2L4IA 2ZKMX 3EK4A 1F4OA 2LHIA 2NZ0A 1AK8A 1G8IA 2ISDA 3ICBA 3TS5B 3QRXA 1B9AA 3TDZA 1TIZA 1CB1A 3GOFA 2CXJA 4PALA 4OV2A 3BUMB 1BU3A 5DKRA 5D7FA 2F33A 1XO5A 1BODA 1SCMC 3JTDB 3BXKA 2EGDA 2KFFA 2WCEA 5J3XA 1OSAA 3TZ1A 3OB2B 2K7CA 2B1UA 4E68A 4PCWA 1H4BA 1YURA 2WOSA 1SBJA 1MUXA 2BL0B 1B7TZ 1QIWA 1OE9B 4C0LA 3BUOB 1LINA 3H4SE 1AP4A 3KF9A 1DJIA 4NDDA 4CPVA 3I5HB 4ORAB 3WHTB 1CDNA 1CNPA 1B8LA 1F55A 2O60A 3M0WA 1GJYA 1MHOA 3DD4A 3I5IC 1J7PA 2L51A 2WCFA 4NDBA 2O5GA 1DJYA 2M9GA 4PE4A 2BE6A 1DJGA 1S6JA 4MSPA 1AVSA 2JULA 4GFTA 2K61A 1QV1A 1J1EA 2LLUA 4L9MA 4PHMA 4WQ2A 3TDUA 1MF8B 1SY9A 2Y5IA 3A8RA 4AQJA 5AERA 4DS7A 5F6TA 1WRZA 2AMIA 3PM8A 4MRYA 1S6IA 1QS7A 2M7LA 4FTGA 1F71A 4CIDA 1FW4A 5G08A 3LL8B 2MBXA 2MLEC 3CR5X 1UURA 2L5XB 2ZNEA 3EKHA 4GBAA 1JSAA 2QPTA 2BKIB 3SIAA 5JOLA 1K93D 1JUOA 1XFUO 2PALA 1CLMA 5HKWA 2Y1NA 4AQIA 3FWBA 1S26D 3GK4X 1NX3A 1IJ6A 1VRKA 4GGFC 3NXAA 1A4PA 2LM5A 5FYXA 5DKNA 5KTYA 1AJ4A 1CM1A 2I2RE 2FOTA 1C7WA 3GK2A 1K9PA 1AHRA 3O78A 2SASA 1K2HA 1S5GY 1N2DA 1DJZA 3K21A 4I5NB 4R1EA 1TNQA 2P6BB 1JF0A 2JTZA 4I5LB 1SCVA 1K8UA 1N65A 1QX7A 3KO0A 1KSOA 1QATA 2PVBA 2LLSA 5HLOA 4D1EA 4XYNA 1EXRA 1IQ5A 4FQOA 3IF7A 1IQ3A 1NCXA 4ORCB 3I5FB 2OTGC 1KK7Z 4MN0A 2G2BA 1YUTA 5B8IB 1RFJA 3JVTC 1KQMC 2VRGA 2GV5A 4ICBA 5D69A 1B1GA 2K7DA 4MLWA 4YGAA 1IRJA 1QVIY 5HKYA 2WNDA 3MSEB 5HYDA 1L2OB 2M8UA 1E8AA 1RK9A 4YBHB 3ZWHA 3CTNA 1KFUL 1LA3A 2H61A 2HPSA 2PASA 1MWNA 5IBWA 1A75B 2KGRA 4OVNF 2H61C 3D0YB 3EVVA 2KAVA 4GGFA 1G4YR 3SG2A 3VGOA 1ALWA 2BCAA 4MZLA 3FS7A 2K7OA 1XYDA 2K2AA 5DKQA 1OMVA 5HLVA 1KCYA 2BBMA 3F45A 2FCDA 1JWDA 1TNXA 3SIBA 4AOMA 1KWOB 1ZFSA 4NDCA 1TCFA 1BMOA 1TRFA 1UHHA 3NSOA 1CM4A 4N5XA 2LMUA 4QJ4B 4GGNA 1SCMB 2ZN8A 1SW8A 2JQ6A 5KU1A 2MLFC 3BOWA 1FI5A 4M2QA 5I2LA 1XK4A 4MEWA 4ZCVA 2FCEA 1DJHA 2KFHA 3EVRA 3DVKA 3TUYC 2JTTA 2JNFA 1LXFC 2KHNA 2HF5A 2KI4B 4ETOA 1KK7Y 5CSFA 2K8MB 4CLNA 1Y1UA 3NSKA 5TNCA 1M45A 1NX1A 1B47A 3CS1A 1CKKA 1Q80A 1QVIZ 5CSIA 4HSZA 1J7OA 5CPVA 3O2PA 2BE4A 1OMRA 1SRAA 1DVIA 1QX5B 2LC5A 4YGEB 4YRUA 2LVIA 1EJ3A 2KYCA 3BUNB 5JJGA 1KFXS 2M97A 1NCYA 2LUXA 1JFKA 3KPXA 1S6CA 3CLNA 2LV7A 1KWOC 1YUUA 3D10A 1XFVO 1PVBA 1BR1B 1B8RA 1QASA 2I18A 1TNWA 2K7BA 2KYFA 3I5HC 2KAYA 1XVJA 4MRXA 4YI8A 1DMOA 1W7JB 2BCXA 3DF0B 1C07A 3CR4X 4C0JA 3KEVA 2FJUB 1EH2A 2OPOA 1QXPA 2CCMA 1RJVA 3I5GC 3VROA 2I7AA 1A2XA 1OMDA 2EC6C 2GGZA 3SJSA 3BYAA 2OS8B 4OCIA 1PULA 3BUWB 1CMFA 1BG1A 2KI6D 3PSRA 1UUSA 2JT8A 1DJWA 3PN7C 4U8DA 1G33A 4GNKB 1S36A 1NYAA 1YUSA 3CZTX 2DOQA 5CSJA 4PE0A 3AKBA 1HQVA 1K9UA 2RGIA 1SMGA 2M49B 4PE1A 1IG5A 1QIVA 2BBNA 4UPGA 1CDLA 2Y1MA 5AXIA 1BOCA 2I94A 2L50A 2NCPA 3CR2A 1FBVA 1Y1XA 4I5KA 1LKJA 4JQ0D 4BY4A 1A03A 2OTGB 3O6BA 1UHJA 3OP0A 4PDZA 5CSNA 2LNKA 4IL1A 1KQMB 1ZMZA 1YR5A 1UHNA 4PHJA 3WXAA 1DT7B 4DCKA 3SG4A 1ZACA 4PHKA 5I8NA 3VRQA 1B4CA 2JT3A 1ZOTB 1Y0VH 2HETA 3TDIA 3TS5C 3OX5A 5BPJA 1NPQA 1QLSA 3DVJA 3CGAA 2MA2A 2E30A 2M0RA 3PN7B 1SPYA 4M2OA 1L7ZA 2ZRSA 1AJ5A 1GQMA 1IWQA 2KBIA 4PHNA 1RTP1 1CFDA 5AFPA 1MR8A 4JWQA 1JC2A 1F70A 3JVTB 1FI6A 2F8PA 1K96A 3LK0A 1FPWA 2K2FA 4YI9A 2KAXA 1KSMA 2L4HA 2L98A 2BCBA 1DF0A 4USLA 1SL7A 2KQYA 1J7QA 3BUXB 1EG4A 1YRUB 1TNPA 1YVLA 3E3RA 2LP2A 2MJWB 1NP8A 2JNXA 3NSIA 1PK0D 3PFVA 1KK8B 4NQGA 3OHMB 2JT0A 2HQ8A 2TN4A 4WRIA 1M46A 3TUYB 4DIRA 1GGWA 2LUCA 2ZNDA 1KQVA 3OX6A 4TNCA 1OOJA 1X02A 2ZRTA 4MZJA 4P5OE 2SCPA 4JPZB 1K94A 2AAOA 3DVEA 1TTXA 2QACA 1CLLA 2KNEA 2F3ZA 1WRKA 1DF0B 1QJTA 1SL8A 2MRDA 5ER5A 1TCOB 3WNXB 5PALA 2LVKA 2JXLA 1K95A 3SG6A 2AUCA 2PRUA 1XFZO 3A4UB 3NSLA 1U5IB 1RWYA 1BF5A 3OB1B 5AEQA 1CDMA 3DF0A 3GK1A 4C0KA 1SR6C 1CFCA 1F8HA 4DUQA 1PSBA 3I5FC 1UHKA 2JXCA 2COLB 5HKZA 1YVHA 3ZNIA 1LA0A 4N1GA 1KK8C 1J7RA 1NWDA 2MHHA 3AAKA 1TOPA 4OKHA 1NSHA 2KFGA 2EC6B 1S1EA 2LMTA 3AAJA 2EHBA 2CTNA 1IJ5A 2ZFDA 1EL4A 1WLMA 1XFWO 3WHUB 5ER4X 1R6PA 5I2QA 2LE9B 4ZCUA 1DGVA 1PRWA 1CMGA 3CWGA 3HCMA 2NLNA 1IGVA 1SL9A 1WLZA 1D1OA 1M31A 2KBMA 3KHEA 1F54A 2LANA 1V1FA 2M29A 1C7VA 3C1VA 2NXQA 3HX4A 3JTDC 5AANA 1OQPA 1M39A 2CT9A 4GUKA 4HRGA 2IS9A 3BOWB 2BL0C 2LHLA 4Q04A 2LVVA 1S3PA 4BY5A 4WQ3A 1NX2A 1JBAA 3LK1A 4XJKB 1CLBA 1L2OC 2KDHA 4HREE 3SG5A 5K89A 3EKJA 2M1KB 2JWWA 1PALA 2LCPA 3I5IB 1K90D 2G9BA 2ZN9A 4HRHA 4YGCB 2H2KA 1AUIB 1R2UA 2JOJA 1WDCB 2L2EA 1DGUA 1DJXA 1GGZA 2A4JA 1V1GA 2NCOA 1IH0A 2M1UA 4MZKA 1WY9A 1QLKA 4N1FA 1K9KA 4P2YB 2JZIA 2LMVA 4F0ZB 3O4YA 1SNLA 1J55A 1YX8A 1RROA 1UP5A 2V53A 3DVMA 2KI6C 4ORBB 1QTXA 2KGBC 4YGDB 1CDPA 5KSZA 1SKTA 1UWOA 4GAOA 1TN4A 2BECA 2F3YA 4XJKA 2MAZA 3PLFB 2Q4UA 1Y6WA 3RLZA 3VRNA 1JF2A 1SK6D 1CFPA 2CNPA 3SG3A 1XA5A 1HT9A 2K0JA 2LVJA 2F2OA 1EG3A 1SYMA 2L0PA 2M7NA 2KI4C 1YX7A 2JC2A 1NCZA 4M2PA 1A29A 1NUBA 1PSRA 1QX2A 1YRTB 4I5JA 4CFRA 5I2OA 1CFFA 1XFYO 2HQWA 3SG7A 2M3WA 1LVCD 1MXLC 2LLTA 1Y1AA 2JU0A 2PSRA 1KFUS 1DTLA 1WDCC 1W7IB 1F4QA 3BQ3A 3LCPC 4A4CA 3PATA 3EVUA 1NX0A 3VRPA 1MXEA 2JRFA 1XFXO 4QJ5B 1OZSA 1BLQA 1ODBA 3IQOA 2R2IA 3EK8A 4YGBB 2LP3A 1N0YA 1JFJA 1CTRA 3FWCA 4PE7A 2BKHB 2WORA 1WRLA 1B8CA 1XK4C 1BR4B 2Q91A 2CBLA 1IKUA 2KSPA 1KFXL 3RM1A 1FF1A 2Y4QA 4OR9B 2JPTA 1BJFA 1M63B 2KQ6A 1MQ1A 1ZUZA 1PVAA 3LLEA 4MVFA 1NIWA 5GQQC 4A4BA 1B7TY 1J1DA 3I5GB 4GPLB 1RECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U5I A;  3EK7 A;  3D0Y A;  1SR6 B;  1OZO A;  2OS8 C;  1A75 A;  3FIA A;  3PAL A;  4MBE A;  3IQQ A;  2WC8 A;  1ALV A;  1QV0 A;  2LAP A;  2WCB A;  3AKA A;  1BT6 A;  4CFQ A;  2D8N A;  1H8B A;  2F2P A;  1UHI A;  4DRW A;  2PMY A;  2GGM A;  1YTZ C;  1S5G Z;  4QJ3 B;  3VRR A;  2E6W A;  2KOT A;  2L4I A;  2ZKM X;  3EK4 A;  1F4O A;  2LHI A;  2NZ0 A;  1AK8 A;  1G8I A;  2ISD A;  3ICB A;  3TS5 B;  3QRX A;  1B9A A;  3TDZ A;  1TIZ A;  1CB1 A;  3GOF A;  2CXJ A;  4PAL A;  4OV2 A;  3BUM B;  1BU3 A;  5DKR A;  5D7F A;  2F33 A;  1XO5 A;  1BOD A;  1SCM C;  3JTD B;  3BXK A;  2EGD A;  2KFF A;  2WCE A;  5J3X A;  1OSA A;  3TZ1 A;  3OB2 B;  2K7C A;  2B1U A;  4E68 A;  4PCW A;  1H4B A;  1YUR A;  2WOS A;  1SBJ A;  1MUX A;  2BL0 B;  1B7T Z;  1QIW A;  1OE9 B;  4C0L A;  3BUO B;  1LIN A;  3H4S E;  1AP4 A;  3KF9 A;  1DJI A;  4NDD A;  4CPV A;  3I5H B;  4ORA B;  3WHT B;  1CDN A;  1CNP A;  1B8L A;  1F55 A;  2O60 A;  3M0W A;  1GJY A;  1MHO A;  3DD4 A;  3I5I C;  1J7P A;  2L51 A;  2WCF A;  4NDB A;  2O5G A;  1DJY A;  2M9G A;  4PE4 A;  2BE6 A;  1DJG A;  1S6J A;  4MSP A;  1AVS A;  2JUL A;  4GFT A;  2K61 A;  1QV1 A;  1J1E A;  2LLU A;  4L9M A;  4PHM A;  4WQ2 A;  3TDU A;  1MF8 B;  1SY9 A;  2Y5I A;  3A8R A;  4AQJ A;  5AER A;  4DS7 A;  5F6T A;  1WRZ A;  2AMI A;  3PM8 A;  4MRY A;  1S6I A;  1QS7 A;  2M7L A;  4FTG A;  1F71 A;  4CID A;  1FW4 A;  5G08 A;  3LL8 B;  2MBX A;  2MLE C;  3CR5 X;  1UUR A;  2L5X B;  2ZNE A;  3EKH A;  4GBA A;  1JSA A;  2QPT A;  2BKI B;  3SIA A;  5JOL A;  1K93 D;  1JUO A;  1XFU O;  2PAL A;  1CLM A;  5HKW A;  2Y1N A;  4AQI A;  3FWB A;  1S26 D;  3GK4 X;  1NX3 A;  1IJ6 A;  1VRK A;  4GGF C;  3NXA A;  1A4P A;  2LM5 A;  5FYX A;  5DKN A;  5KTY A;  1AJ4 A;  1CM1 A;  2I2R E;  2FOT A;  1C7W A;  3GK2 A;  1K9P A;  1AHR A;  3O78 A;  2SAS A;  1K2H A;  1S5G Y;  1N2D A;  1DJZ A;  3K21 A;  4I5N B;  4R1E A;  1TNQ A;  2P6B B;  1JF0 A;  2JTZ A;  4I5L B;  1SCV A;  1K8U A;  1N65 A;  1QX7 A;  3KO0 A;  1KSO A;  1QAT A;  2PVB A;  2LLS A;  5HLO A;  4D1E A;  4XYN A;  1EXR A;  1IQ5 A;  4FQO A;  3IF7 A;  1IQ3 A;  1NCX A;  4ORC B;  3I5F B;  2OTG C;  1KK7 Z;  4MN0 A;  2G2B A;  1YUT A;  5B8I B;  1RFJ A;  3JVT C;  1KQM C;  2VRG A;  2GV5 A;  4ICB A;  5D69 A;  1B1G A;  2K7D A;  4MLW A;  4YGA A;  1IRJ A;  1QVI Y;  5HKY A;  2WND A;  3MSE B;  5HYD A;  1L2O B;  2M8U A;  1E8A A;  1RK9 A;  4YBH B;  3ZWH A;  3CTN A;  1KFU L;  1LA3 A;  2H61 A;  2HPS A;  2PAS A;  1MWN A;  5IBW A;  1A75 B;  2KGR A;  4OVN F;  2H61 C;  3D0Y B;  3EVV A;  2KAV A;  4GGF A;  1G4Y R;  3SG2 A;  3VGO A;  1ALW A;  2BCA A;  4MZL A;  3FS7 A;  2K7O A;  1XYD A;  2K2A A;  5DKQ A;  1OMV A;  5HLV A;  1KCY A;  2BBM A;  3F45 A;  2FCD A;  1JWD A;  1TNX A;  3SIB A;  4AOM A;  1KWO B;  1ZFS A;  4NDC A;  1TCF A;  1BMO A;  1TRF A;  1UHH A;  3NSO A;  1CM4 A;  4N5X A;  2LMU A;  4QJ4 B;  4GGN A;  1SCM B;  2ZN8 A;  1SW8 A;  2JQ6 A;  5KU1 A;  2MLF C;  3BOW A;  1FI5 A;  4M2Q A;  5I2L A;  1XK4 A;  4MEW A;  4ZCV A;  2FCE A;  1DJH A;  2KFH A;  3EVR A;  3DVK A;  3TUY C;  2JTT A;  2JNF A;  1LXF C;  2KHN A;  2HF5 A;  2KI4 B;  4ETO A;  1KK7 Y;  5CSF A;  2K8M B;  4CLN A;  1Y1U A;  3NSK A;  5TNC A;  1M45 A;  1NX1 A;  1B47 A;  3CS1 A;  1CKK A;  1Q80 A;  1QVI Z;  5CSI A;  4HSZ A;  1J7O A;  5CPV A;  3O2P A;  2BE4 A;  1OMR A;  1SRA A;  1DVI A;  1QX5 B;  2LC5 A;  4YGE B;  4YRU A;  2LVI A;  1EJ3 A;  2KYC A;  3BUN B;  5JJG A;  1KFX S;  2M97 A;  1NCY A;  2LUX A;  1JFK A;  3KPX A;  1S6C A;  3CLN A;  2LV7 A;  1KWO C;  1YUU A;  3D10 A;  1XFV O;  1PVB A;  1BR1 B;  1B8R A;  1QAS A;  2I18 A;  1TNW A;  2K7B A;  2KYF A;  3I5H C;  2KAY A;  1XVJ A;  4MRX A;  4YI8 A;  1DMO A;  1W7J B;  2BCX A;  3DF0 B;  1C07 A;  3CR4 X;  4C0J A;  3KEV A;  2FJU B;  1EH2 A;  2OPO A;  1QXP A;  2CCM A;  1RJV A;  3I5G C;  3VRO A;  2I7A A;  1A2X A;  1OMD A;  2EC6 C;  2GGZ A;  3SJS A;  3BYA A;  2OS8 B;  4OCI A;  1PUL A;  3BUW B;  1CMF A;  1BG1 A;  2KI6 D;  3PSR A;  1UUS A;  2JT8 A;  1DJW A;  3PN7 C;  4U8D A;  1G33 A;  4GNK B;  1S36 A;  1NYA A;  1YUS A;  3CZT X;  2DOQ A;  5CSJ A;  4PE0 A;  3AKB A;  1HQV A;  1K9U A;  2RGI A;  1SMG A;  2M49 B;  4PE1 A;  1IG5 A;  1QIV A;  2BBN A;  4UPG A;  1CDL A;  2Y1M A;  5AXI A;  1BOC A;  2I94 A;  2L50 A;  2NCP A;  3CR2 A;  1FBV A;  1Y1X A;  4I5K A;  1LKJ A;  4JQ0 D;  4BY4 A;  1A03 A;  2OTG B;  3O6B A;  1UHJ A;  3OP0 A;  4PDZ A;  5CSN A;  2LNK A;  4IL1 A;  1KQM B;  1ZMZ A;  1YR5 A;  1UHN A;  4PHJ A;  3WXA A;  1DT7 B;  4DCK A;  3SG4 A;  1ZAC A;  4PHK A;  5I8N A;  3VRQ A;  1B4C A;  2JT3 A;  1ZOT B;  1Y0V H;  2HET A;  3TDI A;  3TS5 C;  3OX5 A;  5BPJ A;  1NPQ A;  1QLS A;  3DVJ A;  3CGA A;  2MA2 A;  2E30 A;  2M0R A;  3PN7 B;  1SPY A;  4M2O A;  1L7Z A;  2ZRS A;  1AJ5 A;  1GQM A;  1IWQ A;  2KBI A;  4PHN A;  1RTP 1;  1CFD A;  5AFP A;  1MR8 A;  4JWQ A;  1JC2 A;  1F70 A;  3JVT B;  1FI6 A;  2F8P A;  1K96 A;  3LK0 A;  1FPW A;  2K2F A;  4YI9 A;  2KAX A;  1KSM A;  2L4H A;  2L98 A;  2BCB A;  1DF0 A;  4USL A;  1SL7 A;  2KQY A;  1J7Q A;  3BUX B;  1EG4 A;  1YRU B;  1TNP A;  1YVL A;  3E3R A;  2LP2 A;  2MJW B;  1NP8 A;  2JNX A;  3NSI A;  1PK0 D;  3PFV A;  1KK8 B;  4NQG A;  3OHM B;  2JT0 A;  2HQ8 A;  2TN4 A;  4WRI A;  1M46 A;  3TUY B;  4DIR A;  1GGW A;  2LUC A;  2ZND A;  1KQV A;  3OX6 A;  4TNC A;  1OOJ A;  1X02 A;  2ZRT A;  4MZJ A;  4P5O E;  2SCP A;  4JPZ B;  1K94 A;  2AAO A;  3DVE A;  1TTX A;  2QAC A;  1CLL A;  2KNE A;  2F3Z A;  1WRK A;  1DF0 B;  1QJT A;  1SL8 A;  2MRD A;  5ER5 A;  1TCO B;  3WNX B;  5PAL A;  2LVK A;  2JXL A;  1K95 A;  3SG6 A;  2AUC A;  2PRU A;  1XFZ O;  3A4U B;  3NSL A;  1U5I B;  1RWY A;  1BF5 A;  3OB1 B;  5AEQ A;  1CDM A;  3DF0 A;  3GK1 A;  4C0K A;  1SR6 C;  1CFC A;  1F8H A;  4DUQ A;  1PSB A;  3I5F C;  1UHK A;  2JXC A;  2COL B;  5HKZ A;  1YVH A;  3ZNI A;  1LA0 A;  4N1G A;  1KK8 C;  1J7R A;  1NWD A;  2MHH A;  3AAK A;  1TOP A;  4OKH A;  1NSH A;  2KFG A;  2EC6 B;  1S1E A;  2LMT A;  3AAJ A;  2EHB A;  2CTN A;  1IJ5 A;  2ZFD A;  1EL4 A;  1WLM A;  1XFW O;  3WHU B;  5ER4 X;  1R6P A;  5I2Q A;  2LE9 B;  4ZCU A;  1DGV A;  1PRW A;  1CMG A;  3CWG A;  3HCM A;  2NLN A;  1IGV A;  1SL9 A;  1WLZ A;  1D1O A;  1M31 A;  2KBM A;  3KHE A;  1F54 A;  2LAN A;  1V1F A;  2M29 A;  1C7V A;  3C1V A;  2NXQ A;  3HX4 A;  3JTD C;  5AAN A;  1OQP A;  1M39 A;  2CT9 A;  4GUK A;  4HRG A;  2IS9 A;  3BOW B;  2BL0 C;  2LHL A;  4Q04 A;  2LVV A;  1S3P A;  4BY5 A;  4WQ3 A;  1NX2 A;  1JBA A;  3LK1 A;  4XJK B;  1CLB A;  1L2O C;  2KDH A;  4HRE E;  3SG5 A;  5K89 A;  3EKJ A;  2M1K B;  2JWW A;  1PAL A;  2LCP A;  3I5I B;  1K90 D;  2G9B A;  2ZN9 A;  4HRH A;  4YGC B;  2H2K A;  1AUI B;  1R2U A;  2JOJ A;  1WDC B;  2L2E A;  1DGU A;  1DJX A;  1GGZ A;  2A4J A;  1V1G A;  2NCO A;  1IH0 A;  2M1U A;  4MZK A;  1WY9 A;  1QLK A;  4N1F A;  1K9K A;  4P2Y B;  2JZI A;  2LMV A;  4F0Z B;  3O4Y A;  1SNL A;  1J55 A;  1YX8 A;  1RRO A;  1UP5 A;  2V53 A;  3DVM A;  2KI6 C;  4ORB B;  1QTX A;  2KGB C;  4YGD B;  1CDP A;  5KSZ A;  1SKT A;  1UWO A;  4GAO A;  1TN4 A;  2BEC A;  2F3Y A;  4XJK A;  2MAZ A;  3PLF B;  2Q4U A;  1Y6W A;  3RLZ A;  3VRN A;  1JF2 A;  1SK6 D;  1CFP A;  2CNP A;  3SG3 A;  1XA5 A;  1HT9 A;  2K0J A;  2LVJ A;  2F2O A;  1EG3 A;  1SYM A;  2L0P A;  2M7N A;  2KI4 C;  1YX7 A;  2JC2 A;  1NCZ A;  4M2P A;  1A29 A;  1NUB A;  1PSR A;  1QX2 A;  1YRT B;  4I5J A;  4CFR A;  5I2O A;  1CFF A;  1XFY O;  2HQW A;  3SG7 A;  2M3W A;  1LVC D;  1MXL C;  2LLT A;  1Y1A A;  2JU0 A;  2PSR A;  1KFU S;  1DTL A;  1WDC C;  1W7I B;  1F4Q A;  3BQ3 A;  3LCP C;  4A4C A;  3PAT A;  3EVU A;  1NX0 A;  3VRP A;  1MXE A;  2JRF A;  1XFX O;  4QJ5 B;  1OZS A;  1BLQ A;  1ODB A;  3IQO A;  2R2I A;  3EK8 A;  4YGB B;  2LP3 A;  1N0Y A;  1JFJ A;  1CTR A;  3FWC A;  4PE7 A;  2BKH B;  2WOR A;  1WRL A;  1B8C A;  1XK4 C;  1BR4 B;  2Q91 A;  2CBL A;  1IKU A;  2KSP A;  1KFX L;  3RM1 A;  1FF1 A;  2Y4Q A;  4OR9 B;  2JPT A;  1BJF A;  1M63 B;  2KQ6 A;  1MQ1 A;  1ZUZ A;  1PVA A;  3LLE A;  4MVF A;  1NIW A;  5GQQ C;  4A4B A;  1B7T Y;  1J1D A;  3I5G B;  4GPL B;  1REC A; 
#chains in the Genus database with same CATH topology
 3D73 A;  1U5I A;  3EK7 A;  3D0Y A;  1SR6 B;  5DIC A;  1OZO A;  2OS8 C;  1A75 A;  3FIA A;  3PAL A;  4MBE A;  3IQQ A;  3NHI A;  2WC8 A;  1ALV A;  1QV0 A;  2LAP A;  2WCB A;  3AKA A;  3FE6 A;  1BT6 A;  4CFQ A;  2D8N A;  3V2L A;  1H8B A;  2F2P A;  1UHI A;  2WCM A;  3S0D A;  4DRW A;  2PMY A;  2GGM A;  1YTZ C;  1S5G Z;  4QJ3 B;  3VRR A;  2E6W A;  2KOT A;  2L4I A;  2ZKM X;  3EK4 A;  1F4O A;  2LHI A;  2NZ0 A;  1AK8 A;  1TUJ A;  1G8I A;  2ISD A;  3ICB A;  3TS5 B;  3QRX A;  1B9A A;  3TDZ A;  3DZT A;  1TIZ A;  1CB1 A;  2QEO A;  3GOF A;  3CZ0 A;  2CXJ A;  4PAL A;  4OV2 A;  3BUM B;  1BU3 A;  3D74 A;  5DKR A;  5D7F A;  2F33 A;  1XO5 A;  1BOD A;  1SCM C;  3BJH A;  3JTD B;  3BXK A;  2EGD A;  2KFF A;  2WCE A;  5J3X A;  1OSA A;  3TZ1 A;  3OB2 B;  2K7C A;  2B1U A;  3B7A A;  4PCW A;  4E68 A;  1H4B A;  1YUR A;  2WOS A;  1SBJ A;  1MUX A;  2BL0 B;  1B7T Z;  1QIW A;  1OE9 B;  4C0L A;  3BUO B;  1LIN A;  3H4S E;  3FE9 A;  1AP4 A;  3KF9 A;  1DJI A;  4NDD A;  4CPV A;  2QDI A;  3I5H B;  4ORA B;  3WHT B;  1CDN A;  1CNP A;  1B8L A;  1F55 A;  2O60 A;  3M0W A;  1GJY A;  1MHO A;  3DD4 A;  3I5I C;  1J7P A;  2L51 A;  2WCF A;  4NDB A;  2O5G A;  1DJY A;  2M9G A;  4JKT A;  4PE4 A;  2BE6 A;  1DJG A;  1S6J A;  4MSP A;  1AVS A;  2JUL A;  4GFT A;  2H8V A;  1QV1 A;  2K61 A;  1J1E A;  2LLU A;  4L9M A;  4PHM A;  4WQ2 A;  3TDU A;  1MF8 B;  1SY9 A;  2Y5I A;  3A8R A;  4AQJ A;  5AER A;  4DS7 A;  5F6T A;  1WRZ A;  2AMI A;  3PM8 A;  4MRY A;  1Z2C B;  3SS3 A;  1S6I A;  2PYQ A;  4OZD A;  1QS7 A;  2M7L A;  5D3O A;  4FTG A;  1F71 A;  4CID A;  1FW4 A;  1DQE A;  5G08 A;  3S0E A;  3LL8 B;  2MBX A;  2MLE C;  3CR5 X;  5FI7 A;  1UUR A;  2L5X B;  2ZNE A;  3EKH A;  4GBA A;  1JSA A;  2JPO A;  2QPT A;  2BKI B;  3UO9 A;  3SIA A;  5JOL A;  1K93 D;  2KLE A;  1JUO A;  1XFU O;  2PAL A;  1CLM A;  3B87 A;  5HKW A;  2Y1N A;  4AQI A;  3FWB A;  1S26 D;  3GK4 X;  1NX3 A;  1IJ6 A;  1VRK A;  4GGF C;  3NXA A;  1A4P A;  2LM5 A;  5FYX A;  5DKN A;  5KTY A;  1AJ4 A;  1CM1 A;  2I2R E;  2FOT A;  1C7W A;  3GK2 A;  1K9P A;  1AHR A;  3O78 A;  2FJY A;  2SAS A;  1K2H A;  4FQT A;  1S5G Y;  1N2D A;  1DJZ A;  3K21 A;  4I5N B;  4R1E A;  1TNQ A;  3CYZ A;  2P6B B;  1JF0 A;  2JTZ A;  4I5L B;  1SCV A;  1K8U A;  1N65 A;  1QX7 A;  3KO0 A;  1KSO A;  2L5Y A;  1QAT A;  2PVB A;  2LLS A;  5HLO A;  4D1E A;  4XYN A;  1EXR A;  1IQ5 A;  4FQO A;  3IF7 A;  1B1G A;  3IVT A;  1IQ3 A;  1NCX A;  4ORC B;  3I5F B;  2OTG C;  1KK7 Z;  4MN0 A;  2G2B A;  1YUT A;  5B8I B;  1RFJ A;  3JVT C;  1KQM C;  2VRG A;  2GV5 A;  4ICB A;  1LS8 A;  5D69 A;  2K7D A;  4MLW A;  3Q8I A;  4OKH A;  4YGA A;  1IRJ A;  1QVI Y;  5HKY A;  2WND A;  3MSE B;  3DY9 A;  5HYD A;  1L2O B;  2M8U A;  5FI6 A;  1E8A A;  1RK9 A;  4YBH B;  3ZWH A;  3CTN A;  2QEB A;  1KFU L;  1LA3 A;  2H61 A;  3UNW A;  2HPS A;  2GTE A;  2PAS A;  1MWN A;  5IBW A;  1A75 B;  2KGR A;  4OVN F;  4JD9 A;  2H61 C;  3D0Y B;  5EL2 A;  3S0A A;  3EVV A;  2KAV A;  4GGF A;  1G4Y R;  3SG2 A;  3VGO A;  3D76 A;  1ALW A;  2BCA A;  3R1P A;  3FS7 A;  2K7O A;  4MZL A;  1XYD A;  2K2A A;  3EG5 B;  5DKQ A;  1OMV A;  5HLV A;  1KCY A;  2BBM A;  3F45 A;  2FCD A;  1JWD A;  1TNX A;  2P71 A;  3SIB A;  4AOM A;  1KWO B;  1ZFS A;  4NDC A;  1TCF A;  1BMO A;  1TRF A;  1UHH A;  3NSO A;  1CM4 A;  4N5X A;  2LMU A;  4QJ4 B;  4GGN A;  1SCM B;  2ZN8 A;  1SW8 A;  2JQ6 A;  5KU1 A;  2MLF C;  3BOW A;  1FI5 A;  4M2Q A;  5I2L A;  1XK4 A;  4MEW A;  4ZCV A;  2FCE A;  1DJH A;  2KFH A;  3EVR A;  3DVK A;  3TUY C;  2JTT A;  2JNF A;  1LXF C;  2P70 A;  2KHN A;  2HF5 A;  2KI4 B;  4ETO A;  1KK7 Y;  3RZS A;  5CSF A;  2K8M B;  4CLN A;  1Y1U A;  3NSK A;  5TNC A;  1M45 A;  1NX1 A;  1B47 A;  3CS1 A;  1CKK A;  1Q80 A;  1QVI Z;  5CSI A;  4HSZ A;  3S0B A;  1J7O A;  5CPV A;  3O2P A;  2BE4 A;  1OMR A;  2QEH A;  1SRA A;  1DVI A;  1QX5 B;  2YGU A;  2LC5 A;  4YGE B;  4YRU A;  2LVI A;  1EJ3 A;  2KYC A;  3BUN B;  5JJG A;  1KFX S;  4PT1 A;  2M97 A;  2K60 A;  1NCY A;  1DEL A;  2LUX A;  1JFK A;  3KPX A;  1S6C A;  3CLN A;  3PM2 A;  2LV7 A;  3R1V A;  1KWO C;  1YUU A;  3D10 A;  1XFV O;  1DEK A;  5FI2 A;  1PVB A;  1BR1 B;  1B8R A;  1QAS A;  2I18 A;  1TNW A;  2K7B A;  2KYF A;  3I5H C;  2KAY A;  1XVJ A;  4MRX A;  4YI8 A;  1DMO A;  1W7J B;  2BCX A;  3DF0 B;  1C07 A;  3CR4 X;  4C0J A;  3KEV A;  1C3Z A;  2FJU B;  1EH2 A;  2OPO A;  1QXP A;  1GM0 A;  2CCM A;  1RJV A;  3I5G C;  3VRO A;  2I7A A;  1A2X A;  1OMD A;  2EC6 C;  2GGZ A;  1OOF A;  3SJS A;  3BYA A;  2OS8 B;  4OCI A;  1PUL A;  3BUW B;  1CMF A;  1BG1 A;  1SSE B;  2KI6 D;  2QEV A;  3PSR A;  1UUS A;  2JT8 A;  1DJW A;  3PN7 C;  4U8D A;  1G33 A;  4GNK B;  1S36 A;  1NYA A;  1YUS A;  3CZT X;  2DOQ A;  5CSJ A;  4PE0 A;  3AKB A;  1HQV A;  1K9U A;  2RGI A;  1SMG A;  2M49 B;  4PE1 A;  1IG5 A;  1QIV A;  2BBN A;  4UPG A;  2L2C A;  1CDL A;  2Y1M A;  5AXI A;  1BOC A;  2I94 A;  2L50 A;  2NCP A;  3CR2 A;  1FBV A;  1Y1X A;  4I5K A;  1LKJ A;  4JQ0 D;  4BY4 A;  3D77 A;  1A03 A;  2OTG B;  3O6B A;  1UHJ A;  3OP0 A;  4PDZ A;  5CSN A;  2LNK A;  1Z4H A;  4IL1 A;  1KQM B;  1ZMZ A;  1YR5 A;  1UHN A;  4PHJ A;  3WXA A;  1DT7 B;  4DCK A;  3SG4 A;  1ZAC A;  4PHK A;  5I8N A;  3VRQ A;  1B4C A;  2JT3 A;  1ZOT B;  1Y0V H;  2HET A;  3TDI A;  3TS5 C;  3S0F A;  3B6X A;  3OX5 A;  5BPJ A;  1NPQ A;  1QLS A;  3DVJ A;  3CGA A;  2MA2 A;  2E30 A;  2M0R A;  2WC6 A;  3PN7 B;  1SPY A;  4M2O A;  1L7Z A;  2ZRS A;  1AJ5 A;  1GQM A;  3L4L A;  1IWQ A;  2KBI A;  4PHN A;  1RTP 1;  5I94 A;  3L4A A;  2BAP A;  1CFD A;  3OBV A;  5AFP A;  1MR8 A;  4JWQ A;  1JC2 A;  1F70 A;  3JVT B;  1FI6 A;  2F8P A;  1K96 A;  3LK0 A;  1FPW A;  2K2F A;  4YI9 A;  2KAX A;  1KSM A;  2L4H A;  2L98 A;  2BCB A;  1DF0 A;  2PQL A;  4USL A;  1SL7 A;  1TWO A;  2KQY A;  1J7Q A;  3BUX B;  1EG4 A;  1YRU B;  1TNP A;  1YVL A;  3E3R A;  3R1O A;  2LP2 A;  2MJW B;  2WC5 A;  1NP8 A;  2JNX A;  3NSI A;  1PK0 D;  3PFV A;  1IIO A;  1KK8 B;  4NQG A;  3OHM B;  2JT0 A;  2HQ8 A;  2TN4 A;  3N7H A;  4WRI A;  1M46 A;  3B86 A;  3CZ1 A;  3TUY B;  4DIR A;  4INW A;  1GGW A;  2LUC A;  2ZND A;  1KQV A;  3OX6 A;  1DC1 A;  4TNC A;  1OOJ A;  1X02 A;  2ZRT A;  4MZJ A;  4P5O E;  2KPH A;  2SCP A;  4JPZ B;  1K94 A;  2AAO A;  3DVE A;  1TTX A;  2QAC A;  3SS4 A;  1CLL A;  2KNE A;  4IJ7 A;  2F3Z A;  1WRK A;  1DF0 B;  1QJT A;  1SL8 A;  2MRD A;  3CAB A;  3CZ2 A;  5ER5 A;  1TCO B;  1CFF A;  3WNX B;  5PAL A;  2LVK A;  2JXL A;  1K95 A;  3OGN A;  2AUC A;  3SG6 A;  2PRU A;  1XFZ O;  3A4U B;  3FE8 A;  3NSL A;  1U5I B;  1RWY A;  1OOH A;  1BF5 A;  3OB1 B;  5AEQ A;  1CDM A;  3QME A;  3DF0 A;  3GK1 A;  4C0K A;  1SR6 C;  1CFC A;  1F8H A;  4DUQ A;  1PSB A;  3I5F C;  1UHK A;  1TUZ A;  2JXC A;  2COL B;  4INX A;  1YVH A;  5HKZ A;  3ZNI A;  1LA0 A;  2KLD A;  1KK8 C;  1J7R A;  4N1G A;  1NWD A;  2MHH A;  3AAK A;  1TOP A;  3O4X A;  1NSH A;  1OOI X;  2EC6 B;  1S1E A;  2KFG A;  2LMT A;  3CDN A;  3AAJ A;  2EHB A;  2CTN A;  1IJ5 A;  2ZFD A;  1EL4 A;  3R72 A;  3SS5 A;  1WLM A;  1XFW O;  3WHU B;  5HL1 A;  5ER4 X;  1R6P A;  5I2Q A;  2LE9 B;  4ZCU A;  2BNX A;  1DGV A;  1PRW A;  1CMG A;  3CWG A;  3HCM A;  3D75 A;  2NLN A;  1IGV A;  1XFR A;  1SL9 A;  1WLZ A;  1D1O A;  1OOG A;  1M31 A;  2KBM A;  3KHE A;  3NGV A;  1F54 A;  2LAN A;  1P28 A;  1V1F A;  2M29 A;  1C7V A;  3C1V A;  2NXQ A;  3HX4 A;  3JTD C;  4KYN A;  1OQP A;  5AAN A;  1M39 A;  2CT9 A;  4GUK A;  4HRG A;  2IS9 A;  3BOW B;  3DXL A;  2BL0 C;  2LHL A;  4Q04 A;  2LVV A;  1S3P A;  4BY5 A;  4WQ3 A;  1NX2 A;  1JBA A;  3LK1 A;  4XJK B;  1CLB A;  1L2O C;  2KDH A;  4HRE E;  3SG5 A;  5K89 A;  3EKJ A;  2M1K B;  2JWW A;  3DYE A;  1PAL A;  2LCP A;  3B88 A;  1K90 D;  3I5I B;  2G9B A;  2ZN9 A;  4HRH A;  4YGC B;  2H2K A;  1AUI B;  1R2U A;  2WCH A;  2JOJ A;  1WDC B;  2L2E A;  1DGU A;  1DJX A;  2WCK A;  4F7F A;  1GGZ A;  2A4J A;  1V1G A;  2WCJ A;  2NCO A;  1T14 A;  3K1E A;  2M1U A;  4MZK A;  1IH0 A;  1WY9 A;  1QLK A;  4N1F A;  1K9K A;  4P2Y B;  2JZI A;  2LMV A;  4F0Z B;  3O4Y A;  1SNL A;  1J55 A;  1YX8 A;  1RRO A;  1UP5 A;  2V53 A;  3DVM A;  3NHT A;  2KI6 C;  4ORB B;  1QTX A;  2KGB C;  4YGD B;  1CDP A;  3D78 A;  5KSZ A;  1SKT A;  1UWO A;  4GAO A;  1TN4 A;  2BEC A;  3L47 A;  2F3Y A;  4XJK A;  2MAZ A;  3PLF B;  2Q4U A;  1Y6W A;  3RLZ A;  3VRN A;  1JF2 A;  1SK6 D;  1CFP A;  2CNP A;  3SG3 A;  1XA5 A;  1HT9 A;  2K0J A;  2LVJ A;  2F2O A;  1EG3 A;  1SYM A;  2L0P A;  3VB1 A;  2ERB A;  2KI4 C;  1YX7 A;  2JC2 A;  1NCZ A;  2M7N A;  4M2P A;  1A29 A;  3S0G A;  1NUB A;  1PSR A;  1QX2 A;  1YRT B;  4I5J A;  1W9Z A;  4CFR A;  5I2O A;  1XFY O;  2HQW A;  3SG7 A;  2M3W A;  3PJI A;  1LVC D;  1MXL C;  2LLT A;  1Y1A A;  2JU0 A;  2PSR A;  1C3Y A;  1KFU S;  1DTL A;  1WDC C;  1W7I B;  1F4Q A;  3BQ3 A;  3LCP C;  4A4C A;  3PAT A;  3EVU A;  1NX0 A;  3VRP A;  1MXE A;  2JRF A;  1XFX O;  4QJ5 B;  1OZS A;  1BLQ A;  1ODB A;  3IQO A;  1OW4 A;  2R2I A;  3EK8 A;  4YGB B;  2LP3 A;  1N0Y A;  1JFJ A;  1CTR A;  3BFA A;  3FWC A;  4PE7 A;  2BKH B;  2WOR A;  2WCL A;  1WRL A;  1B8C A;  1XK4 C;  1BR4 B;  2Q91 A;  1QWV A;  2CBL A;  2KSP A;  1KFX L;  1IKU A;  3RM1 A;  1ORG A;  3BFH A;  2Y4Q A;  4OR9 B;  1FF1 A;  2JPT A;  1BJF A;  1M63 B;  2KQ6 A;  1MQ1 A;  1ZUZ A;  1PVA A;  3LLE A;  4MVF A;  1NIW A;  5GQQ C;  3BFB A;  4A4B A;  1B7T Y;  1J1D A;  3I5G B;  4GPL B;  1REC A; 
#chains in the Genus database with same CATH homology
 1U5I A;  3EK7 A;  3D0Y A;  1SR6 B;  1OZO A;  2OS8 C;  1A75 A;  3FIA A;  3PAL A;  4MBE A;  3IQQ A;  2WC8 A;  1ALV A;  1QV0 A;  2LAP A;  2WCB A;  3AKA A;  1BT6 A;  4CFQ A;  2D8N A;  1H8B A;  2F2P A;  1UHI A;  4DRW A;  2PMY A;  2GGM A;  1YTZ C;  1S5G Z;  4QJ3 B;  3VRR A;  2E6W A;  2KOT A;  2L4I A;  2ZKM X;  3EK4 A;  1F4O A;  2LHI A;  2NZ0 A;  1AK8 A;  1G8I A;  2ISD A;  3ICB A;  3TS5 B;  3QRX A;  1B9A A;  3TDZ A;  1TIZ A;  1CB1 A;  3GOF A;  2CXJ A;  4PAL A;  4OV2 A;  3BUM B;  1BU3 A;  5DKR A;  5D7F A;  2F33 A;  1XO5 A;  1BOD A;  1SCM C;  3JTD B;  3BXK A;  2EGD A;  2KFF A;  2WCE A;  5J3X A;  1OSA A;  3TZ1 A;  3OB2 B;  2K7C A;  2B1U A;  4E68 A;  4PCW A;  1H4B A;  1YUR A;  2WOS A;  1SBJ A;  1MUX A;  2BL0 B;  1B7T Z;  1QIW A;  1OE9 B;  4C0L A;  3BUO B;  1LIN A;  3H4S E;  1AP4 A;  3KF9 A;  1DJI A;  4NDD A;  4CPV A;  3I5H B;  4ORA B;  3WHT B;  1CDN A;  1CNP A;  1B8L A;  1F55 A;  2O60 A;  3M0W A;  1GJY A;  1MHO A;  3DD4 A;  3I5I C;  1J7P A;  2L51 A;  2WCF A;  4NDB A;  2O5G A;  1DJY A;  2M9G A;  4PE4 A;  2BE6 A;  1DJG A;  1S6J A;  4MSP A;  1AVS A;  2JUL A;  4GFT A;  2K61 A;  1QV1 A;  1J1E A;  2LLU A;  4L9M A;  4PHM A;  4WQ2 A;  3TDU A;  1MF8 B;  1SY9 A;  2Y5I A;  3A8R A;  4AQJ A;  5AER A;  4DS7 A;  5F6T A;  1WRZ A;  2AMI A;  3PM8 A;  4MRY A;  1S6I A;  1QS7 A;  2M7L A;  4FTG A;  1F71 A;  4CID A;  1FW4 A;  5G08 A;  3LL8 B;  2MBX A;  2MLE C;  3CR5 X;  1UUR A;  2L5X B;  2ZNE A;  3EKH A;  4GBA A;  1JSA A;  2QPT A;  2BKI B;  3SIA A;  5JOL A;  1K93 D;  1JUO A;  1XFU O;  2PAL A;  1CLM A;  5HKW A;  2Y1N A;  4AQI A;  3FWB A;  1S26 D;  3GK4 X;  1NX3 A;  1IJ6 A;  1VRK A;  4GGF C;  3NXA A;  1A4P A;  2LM5 A;  5FYX A;  5DKN A;  5KTY A;  1AJ4 A;  1CM1 A;  2I2R E;  2FOT A;  1C7W A;  3GK2 A;  1K9P A;  1AHR A;  3O78 A;  2SAS A;  1K2H A;  1S5G Y;  1N2D A;  1DJZ A;  3K21 A;  4I5N B;  4R1E A;  1TNQ A;  2P6B B;  1JF0 A;  2JTZ A;  4I5L B;  1SCV A;  1K8U A;  1N65 A;  1QX7 A;  3KO0 A;  1KSO A;  1QAT A;  2PVB A;  2LLS A;  5HLO A;  4D1E A;  4XYN A;  1EXR A;  1IQ5 A;  4FQO A;  3IF7 A;  1IQ3 A;  1NCX A;  4ORC B;  3I5F B;  2OTG C;  1KK7 Z;  4MN0 A;  2G2B A;  1YUT A;  5B8I B;  1RFJ A;  3JVT C;  1KQM C;  2VRG A;  2GV5 A;  4ICB A;  5D69 A;  1B1G A;  2K7D A;  4MLW A;  4YGA A;  1IRJ A;  1QVI Y;  5HKY A;  2WND A;  3MSE B;  5HYD A;  1L2O B;  2M8U A;  1E8A A;  1RK9 A;  4YBH B;  3ZWH A;  3CTN A;  1KFU L;  1LA3 A;  2H61 A;  2HPS A;  2PAS A;  1MWN A;  5IBW A;  1A75 B;  2KGR A;  4OVN F;  2H61 C;  3D0Y B;  3EVV A;  2KAV A;  4GGF A;  1G4Y R;  3SG2 A;  3VGO A;  1ALW A;  2BCA A;  4MZL A;  3FS7 A;  2K7O A;  1XYD A;  2K2A A;  5DKQ A;  1OMV A;  5HLV A;  1KCY A;  2BBM A;  3F45 A;  2FCD A;  1JWD A;  1TNX A;  3SIB A;  4AOM A;  1KWO B;  1ZFS A;  4NDC A;  1TCF A;  1BMO A;  1TRF A;  1UHH A;  3NSO A;  1CM4 A;  4N5X A;  2LMU A;  4QJ4 B;  4GGN A;  1SCM B;  2ZN8 A;  1SW8 A;  2JQ6 A;  5KU1 A;  2MLF C;  3BOW A;  1FI5 A;  4M2Q A;  5I2L A;  1XK4 A;  4MEW A;  4ZCV A;  2FCE A;  1DJH A;  2KFH A;  3EVR A;  3DVK A;  3TUY C;  2JTT A;  2JNF A;  1LXF C;  2KHN A;  2HF5 A;  2KI4 B;  4ETO A;  1KK7 Y;  5CSF A;  2K8M B;  4CLN A;  1Y1U A;  3NSK A;  5TNC A;  1M45 A;  1NX1 A;  1B47 A;  3CS1 A;  1CKK A;  1Q80 A;  1QVI Z;  5CSI A;  4HSZ A;  1J7O A;  5CPV A;  3O2P A;  2BE4 A;  1OMR A;  1SRA A;  1DVI A;  1QX5 B;  2LC5 A;  4YGE B;  4YRU A;  2LVI A;  1EJ3 A;  2KYC A;  3BUN B;  5JJG A;  1KFX S;  2M97 A;  1NCY A;  2LUX A;  1JFK A;  3KPX A;  1S6C A;  3CLN A;  2LV7 A;  1KWO C;  1YUU A;  3D10 A;  1XFV O;  1PVB A;  1BR1 B;  1B8R A;  1QAS A;  2I18 A;  1TNW A;  2K7B A;  2KYF A;  3I5H C;  2KAY A;  1XVJ A;  4MRX A;  4YI8 A;  1DMO A;  1W7J B;  2BCX A;  3DF0 B;  1C07 A;  3CR4 X;  4C0J A;  3KEV A;  2FJU B;  1EH2 A;  2OPO A;  1QXP A;  2CCM A;  1RJV A;  3I5G C;  3VRO A;  2I7A A;  1A2X A;  1OMD A;  2EC6 C;  2GGZ A;  3SJS A;  3BYA A;  2OS8 B;  4OCI A;  1PUL A;  3BUW B;  1CMF A;  1BG1 A;  2KI6 D;  3PSR A;  1UUS A;  2JT8 A;  1DJW A;  3PN7 C;  4U8D A;  1G33 A;  4GNK B;  1S36 A;  1NYA A;  1YUS A;  3CZT X;  2DOQ A;  5CSJ A;  4PE0 A;  3AKB A;  1HQV A;  1K9U A;  2RGI A;  1SMG A;  2M49 B;  4PE1 A;  1IG5 A;  1QIV A;  2BBN A;  4UPG A;  1CDL A;  2Y1M A;  5AXI A;  1BOC A;  2I94 A;  2L50 A;  2NCP A;  3CR2 A;  1FBV A;  1Y1X A;  4I5K A;  1LKJ A;  4JQ0 D;  4BY4 A;  1A03 A;  2OTG B;  3O6B A;  1UHJ A;  3OP0 A;  4PDZ A;  5CSN A;  2LNK A;  4IL1 A;  1KQM B;  1ZMZ A;  1YR5 A;  1UHN A;  4PHJ A;  3WXA A;  1DT7 B;  4DCK A;  3SG4 A;  1ZAC A;  4PHK A;  5I8N A;  3VRQ A;  1B4C A;  2JT3 A;  1ZOT B;  1Y0V H;  2HET A;  3TDI A;  3TS5 C;  3OX5 A;  5BPJ A;  1NPQ A;  1QLS A;  3DVJ A;  3CGA A;  2MA2 A;  2E30 A;  2M0R A;  3PN7 B;  1SPY A;  4M2O A;  1L7Z A;  2ZRS A;  1AJ5 A;  1GQM A;  1IWQ A;  2KBI A;  4PHN A;  1RTP 1;  1CFD A;  5AFP A;  1MR8 A;  4JWQ A;  1JC2 A;  1F70 A;  3JVT B;  1FI6 A;  2F8P A;  1K96 A;  3LK0 A;  1FPW A;  2K2F A;  4YI9 A;  2KAX A;  1KSM A;  2L4H A;  2L98 A;  2BCB A;  1DF0 A;  4USL A;  1SL7 A;  2KQY A;  1J7Q A;  3BUX B;  1EG4 A;  1YRU B;  1TNP A;  1YVL A;  3E3R A;  2LP2 A;  2MJW B;  1NP8 A;  2JNX A;  3NSI A;  1PK0 D;  3PFV A;  1KK8 B;  4NQG A;  3OHM B;  2JT0 A;  2HQ8 A;  2TN4 A;  4WRI A;  1M46 A;  3TUY B;  4DIR A;  1GGW A;  2LUC A;  2ZND A;  1KQV A;  3OX6 A;  4TNC A;  1OOJ A;  1X02 A;  2ZRT A;  4MZJ A;  4P5O E;  2SCP A;  4JPZ B;  1K94 A;  2AAO A;  3DVE A;  1TTX A;  2QAC A;  1CLL A;  2KNE A;  2F3Z A;  1WRK A;  1DF0 B;  1QJT A;  1SL8 A;  2MRD A;  5ER5 A;  1TCO B;  3WNX B;  5PAL A;  2LVK A;  2JXL A;  1K95 A;  3SG6 A;  2AUC A;  2PRU A;  1XFZ O;  3A4U B;  3NSL A;  1U5I B;  1RWY A;  1BF5 A;  3OB1 B;  5AEQ A;  1CDM A;  3DF0 A;  3GK1 A;  4C0K A;  1SR6 C;  1CFC A;  1F8H A;  4DUQ A;  1PSB A;  3I5F C;  1UHK A;  2JXC A;  2COL B;  5HKZ A;  1YVH A;  3ZNI A;  1LA0 A;  4N1G A;  1KK8 C;  1J7R A;  1NWD A;  2MHH A;  3AAK A;  1TOP A;  4OKH A;  1NSH A;  2KFG A;  2EC6 B;  1S1E A;  2LMT A;  3AAJ A;  2EHB A;  2CTN A;  1IJ5 A;  2ZFD A;  1EL4 A;  1WLM A;  1XFW O;  3WHU B;  5ER4 X;  1R6P A;  5I2Q A;  2LE9 B;  4ZCU A;  1DGV A;  1PRW A;  1CMG A;  3CWG A;  3HCM A;  2NLN A;  1IGV A;  1SL9 A;  1WLZ A;  1D1O A;  1M31 A;  2KBM A;  3KHE A;  1F54 A;  2LAN A;  1V1F A;  2M29 A;  1C7V A;  3C1V A;  2NXQ A;  3HX4 A;  3JTD C;  5AAN A;  1OQP A;  1M39 A;  2CT9 A;  4GUK A;  4HRG A;  2IS9 A;  3BOW B;  2BL0 C;  2LHL A;  4Q04 A;  2LVV A;  1S3P A;  4BY5 A;  4WQ3 A;  1NX2 A;  1JBA A;  3LK1 A;  4XJK B;  1CLB A;  1L2O C;  2KDH A;  4HRE E;  3SG5 A;  5K89 A;  3EKJ A;  2M1K B;  2JWW A;  1PAL A;  2LCP A;  3I5I B;  1K90 D;  2G9B A;  2ZN9 A;  4HRH A;  4YGC B;  2H2K A;  1AUI B;  1R2U A;  2JOJ A;  1WDC B;  2L2E A;  1DGU A;  1DJX A;  1GGZ A;  2A4J A;  1V1G A;  2NCO A;  1IH0 A;  2M1U A;  4MZK A;  1WY9 A;  1QLK A;  4N1F A;  1K9K A;  4P2Y B;  2JZI A;  2LMV A;  4F0Z B;  3O4Y A;  1SNL A;  1J55 A;  1YX8 A;  1RRO A;  1UP5 A;  2V53 A;  3DVM A;  2KI6 C;  4ORB B;  1QTX A;  2KGB C;  4YGD B;  1CDP A;  5KSZ A;  1SKT A;  1UWO A;  4GAO A;  1TN4 A;  2BEC A;  2F3Y A;  4XJK A;  2MAZ A;  3PLF B;  2Q4U A;  1Y6W A;  3RLZ A;  3VRN A;  1JF2 A;  1SK6 D;  1CFP A;  2CNP A;  3SG3 A;  1XA5 A;  1HT9 A;  2K0J A;  2LVJ A;  2F2O A;  1EG3 A;  1SYM A;  2L0P A;  2M7N A;  2KI4 C;  1YX7 A;  2JC2 A;  1NCZ A;  4M2P A;  1A29 A;  1NUB A;  1PSR A;  1QX2 A;  1YRT B;  4I5J A;  4CFR A;  5I2O A;  1CFF A;  1XFY O;  2HQW A;  3SG7 A;  2M3W A;  1LVC D;  1MXL C;  2LLT A;  1Y1A A;  2JU0 A;  2PSR A;  1KFU S;  1DTL A;  1WDC C;  1W7I B;  1F4Q A;  3BQ3 A;  3LCP C;  4A4C A;  3PAT A;  3EVU A;  1NX0 A;  3VRP A;  1MXE A;  2JRF A;  1XFX O;  4QJ5 B;  1OZS A;  1BLQ A;  1ODB A;  3IQO A;  2R2I A;  3EK8 A;  4YGB B;  2LP3 A;  1N0Y A;  1JFJ A;  1CTR A;  3FWC A;  4PE7 A;  2BKH B;  2WOR A;  1WRL A;  1B8C A;  1XK4 C;  1BR4 B;  2Q91 A;  2CBL A;  1IKU A;  2KSP A;  1KFX L;  3RM1 A;  1FF1 A;  2Y4Q A;  4OR9 B;  2JPT A;  1BJF A;  1M63 B;  2KQ6 A;  1MQ1 A;  1ZUZ A;  1PVA A;  3LLE A;  4MVF A;  1NIW A;  5GQQ C;  4A4B A;  1B7T Y;  1J1D A;  3I5G B;  4GPL B;  1REC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...