2BKHB

Myosin vi nucleotide-free (mdinsert2) crystal structure
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
145
structure length
137
Chain Sequence
b'QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UNCONVENTIONAL MYOSIN
publication title The Structure of the Myosin Vi Motor Reveals the Mechanism of Directionality Reversal
pubmed doi rcsb
source organism Sus scrofa
molecule tags Motor protein/metal-binding protein
total genus 36
structure length 137
sequence length 145
ec nomenclature
pdb deposition date 2005-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2bkhB01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2bkhB02
2L0PA 2LAPA 2M7LA 3O78A 1LXFC 2ZNEA 2LMTA 1PVAA 1QJTA 3DF0B 5I2OA 3JVTC 1MXLC 3LLEA 1CM1A 2LUCA 1BOCA 2JXLA 1GGWA 3RM1A 4DCKA 1KFXS 1Y1XA 3ZNIA 1TNQA 1RWYA 1OSAA 2BECA 1SCVA 2PMYA 4HSZA 3AKBA 2WCBA 1DJYA 1NYAA 2LHIA 1EG3A 1J1DA 2MLEC 2Y1NA 2MA2A 3OHMB 4A4CA 4CFQA 5JJGA 4C0LA 2ZN8A 1MXEA 2K2AA 4P5OE 4DIRA 1QVIY 2I7AA 3AAKA 5K89A 1H8BA 3TDZA 1CFPA 4PDZA 2MBXA 2SCPA 3SG4A 2LMUA 3CZTX 2JTZA 1EXRA 4U8DA 2LLUA 4JPZB 4PHJA 1QX7A 3A8RA 2WC8A 1DVIA 3FWBA 2WCEA 1BG1A 1N0YA 4MSPA 4C0JA 1UP5A 2QACA 1NPQA 1SNLA 1KFXL 1KQMC 2KYCA 3HX4A 1Y1UA 2KFFA 1R6PA 3WHUB 2O5GA 2KNEA 2V53A 1D1OA 2JULA 1DGVA 3FIAA 4XYNA 3NXAA 4M2PA 1K96A 2ZRTA 4NDBA 2ZKMX 1K8UA 2G2BA 1JF0A 4MRXA 4P2YB 3BQ3A 1NCXA 4ICBA 1TTXA 1SCMC 2L98A 3KF9A 3AKAA 1B8CA 4WQ2A 2DOQA 3E3RA 1UHHA 4YI9A 5CSJA 1RJVA 3CR4X 1S6JA 1K9PA 1F54A 3CWGA 2JC2A 3EK4A 2KAYA 2KHNA 4BY5A 4PCWA 1DF0B 3OP0A 4FQOA 3RLZA 1C7WA 3OX6A 2JZIA 1WRLA 2M3WA 2LHLA 3GK2A 1MHOA 1K94A 1E8AA 3LK0A 1A75A 2NCPA 5AEQA 2HETA 2BL0B 3TUYB 1EL4A 4C0KA 1PVBA 1WLMA 1DMOA 1JFJA 2KYFA 1DGUA 4PHKA 4MRYA 3VRRA 5I2LA 1SR6C 1XFWO 2LP3A 4MVFA 1DJZA 1QVIZ 4N1GA 3PM8A 4MN0A 3TDUA 2BBMA 5JOLA 1LINA 4AOMA 4AQJA 4OV2A 2WNDA 3EVRA 3GOFA 5TNCA 1XFZO 3LCPC 5IBWA 1L2OB 1XFXO 1HQVA 2M49B 2B1UA 1AJ5A 4NQGA 1G33A 3IQQA 2BCBA 1KK8B 2KQ6A 3I5GC 4USLA 5D7FA 1CLBA 2OTGC 4MEWA 1OZSA 2NZ0A 4WQ3A 1W7JB 2BE4A 1NX0A 2CNPA 1WDCC 1JUOA 1CTRA 2JNFA 1S3PA 1BLQA 1W7IB 4GPLB 1CMFA 3VRNA 1DJHA 1UURA 2LVVA 3TDIA 1S26D 3WNXB 1IJ6A 3O6BA 1GJYA 5KTYA 1YX7A 3KO0A 4JQ0D 1HT9A 1Y0VH 2K7BA 3F45A 2OPOA 1F55A 2COLB 3D0YA 2MHHA 1PSRA 1QLKA 5AFPA 3OB2B 4PE0A 1XK4A 1UHNA 5CSIA 4GGFC 4A4BA 1BODA 1OQPA 1DJGA 1Y1AA 2L4IA 3OX5A 1F8HA 1YURA 1ZMZA 3GK1A 1CFCA 4BY4A 1F70A 1WY9A 1EJ3A 1IQ3A 2R2IA 1C07A 1ZOTB 3TUYC 2K8MB 3BOWA 3PATA 4CFRA 2JU0A 1YVLA 4MZLA 2LUXA 5AXIA 1VRKA 3QRXA 4N5XA 1AVSA 3SG7A 1FI5A 5F6TA 2KFHA 1NIWA 2I2RE 4GFTA 1PSBA 2KGBC 1TCOB 2L50A 2LANA 3KEVA 1Q80A 2QPTA 3A4UB 4HRGA 5HLOA 1CLLA 4YBHB 1CKKA 1QS7A 2D8NA 1L2OC 4MZJA 1NUBA 4F0ZB 2ZRSA 3NSKA 2JT3A 2BCXA 2MAZA 1QIVA 2M9GA 3LL8B 2SASA 1MQ1A 1TRFA 2Y4QA 1XO5A 3CLNA 3BUOB 1J7RA 1DJXA 2LLSA 3OB1B 3MSEB 1YRUB 2KI4B 5DKRA 1S6IA 2L5XB 3I5HB 5FYXA 5HKYA 4PE4A 2K2FA 2P6BB 3JTDC 3SIAA 2CXJA 1B7TY 2JXCA 4XJKA 2HQWA 2PRUA 4I5KA 4YI8A 2LNKA 3PN7B 4ORCB 1CFDA 1J7QA 2BE6A 1KWOB 2E6WA 2F3YA 1L7ZA 1F71A 1ODBA 2FCDA 1QX5B 1B47A 3DVKA 4AQIA 3PALA 2JT0A 1B1GA 4QJ4B 1K95A 1QV1A 3HCMA 1JWDA 1GQMA 2M8UA 5I8NA 1YX8A 4I5NB 1CDLA 3VRPA 1LKJA 1YTZC 3CR5X 1CMGA 3DVJA 1ALWA 4DUQA 1NCZA 3C1VA 2EGDA 1TNXA 2KGRA 4GNKB 1YUUA 1PK0D 2O60A 1Y6WA 2LVJA 3O4YA 3TZ1A 1SPYA 3EVVA 4OR9B 2PALA 1IJ5A 1SKTA 1AP4A 1A2XA 2MLFC 2KAXA 3FS7A 5CSFA 1F4QA 1PRWA 2H61C 1SL7A 2ISDA 1CDNA 1JSAA 3BUXB 2WOSA 3TS5B 1OMRA 2CTNA 3I5IB 3D10A 1M45A 5HKWA 1FW4A 2JRFA 4IL1A 3CGAA 1UWOA 1M39A 2F8PA 1KK7Y 1QASA 5G08A 5HYDA 1SBJA 1CFFA 1KCYA 1RECA 2G9BA 2KFGA 5HLVA 1NWDA 1NX3A 4D1EA 1QIWA 2EC6B 1FI6A 1TOPA 5BPJA 2KI4C 1TCFA 1B7TZ 1LA3A 3ZWHA 1B4CA 1WRKA 1CNPA 2MRDA 3JVTB 1IQ5A 3SG5A 3AAJA 1AHRA 2JNXA 2E30A 1V1FA 2L51A 4YGCB 2OS8B 5DKQA 2MJWB 1K9KA 3M0WA 1QX2A 1TNWA 1EH2A 1JFKA 2CBLA 4OVNF 1G4YR 3DF0A 5ER5A 1A75B 1GGZA 1G8IA 1H4BA 3BYAA 1KQVA 1SMGA 2ZFDA 1NCYA 1UHIA 1OZOA 5CSNA 1K2HA 1NX1A 1IKUA 1TIZA 1A4PA 2KQYA 1QTXA 2KBIA 2VRGA 2H61A 1BJFA 2BKHB 2FJUB 2EHBA 2KBMA 2K7CA 2K61A 3PLFB 2Y1MA 2KAVA 2LVKA 1SY9A 1XA5A 2TN4A 2JQ6A 3IQOA 2M1KB 2GGZA 1ZACA 2BL0C 3SG3A 1M63B 4DRWA 1KK7Z 1BT6A 1WLZA 4YRUA 3EK7A 3H4SE 1K9UA 1KSMA 2AMIA 1YUTA 1SRAA 1XVJA 3SG2A 2LC5A 2M29A 4NDDA 3CR2A 1IH0A 2WCFA 4CPVA 1J7OA 5AANA 5B8IB 1M31A 1SCMB 1RTP1 2K7OA 1FBVA 5KSZA 2EC6C 4Q04A 3NSLA 4ORBB 4OCIA 1OMDA 3ICBA 2JPTA 2LVIA 1MWNA 4CIDA 1BMOA 1ALVA 1MR8A 2K7DA 1SW8A 2KDHA 5CPVA 5J3XA 1CDMA 3CTNA 3KHEA 1KK8C 2GGMA 3D0YB 2AUCA 1N2DA 2KI6D 4HREE 4DS7A 4QJ5B 2OS8C 2BBNA 1MF8B 1SK6D 2LV7A 1C7VA 5DKNA 3BXKA 1AUIB 2M97A 1XYDA 1F4OA 3BUWB 3NSIA 1U5IA 2L2EA 4GUKA 1XFVO 3EK8A 1RFJA 1SR6B 4GGFA 1K93D 1DF0A 2L4HA 1PALA 1YRTB 1BU3A 2CCMA 4OKHA 2LMVA 2ZN9A 1S6CA 3BOWB 1B8LA 1J55A 2LCPA 1V1GA 2Y5IA 1XFUO 4FTGA 4MZKA 4GGNA 1JF2A 4L9MA 3CS1A 2H2KA 1B9AA 1RROA 2KI6C 5ER4X 3WXAA 1UHKA 1LVCD 1RK9A 2IS9A 4GBAA 1A03A 1YVHA 1YR5A 2LP2A 2GV5A 2K0JA 3BUNB 4WRIA 2CT9A 4YGDB 3I5GB 4ETOA 2OTGB 2ZNDA 2RGIA 1SL9A 4GAOA 4NDCA 1WDCB 2JTTA 1ZFSA 2M7NA 3BUMB 3DD4A 2PASA 1CLMA 1M46A 2F2OA 4I5LB 3DVMA 3O2PA 1KSOA 1S36A 1AK8A 4YGEB 1IWQA 2NLNA 1DJIA 5AERA 1BF5A 1CB1A 3NSOA 2Q4UA 3PFVA 2HPSA 2LM5A 3GK4X 5HKZA 5PALA 4HRHA 2LLTA 4XJKB 3VGOA 4YGAA 1SYMA 3LK1A 1WRZA 4PE1A 1OOJA 1U5IB 1QV0A 2KSPA 1EG4A 1N65A 1MUXA 3DVEA 2F33A 3I5FB 3EKHA 1IGVA 1NSHA 3FWCA 1TNPA 1S5GY 1OE9B 1NX2A 3SG6A 3I5HC 2BCAA 1DTLA 1XK4C 1X02A 4ZCVA 2I94A 1JBAA 1QATA 4UPGA 4I5JA 3WHTB 2JOJA 4JWQA 2AAOA 2FCEA 3PN7C 3PSRA 4ZCUA 4MBEA 1KWOC 1J7PA 1A29A 1NP8A 4M2OA 1KFUS 2HQ8A 1QXPA 4YGBB 4TNCA 1BR1B 1J1EA 1ZUZA 2WORA 5GQQC 3VRQA 4E68A 1TN4A 3VROA 4ORAB 1IRJA 1S1EA 1JC2A 1IG5A 3IF7A 2PSRA 1UHJA 1CDPA 2NXQA 3K21A 2M0RA 2BKIB 2Q91A 4N1FA 1K90D 1LA0A 5KU1A 1OMVA 2KOTA 2M1UA 1XFYO 4PE7A 1YUSA 4PHNA 1AJ4A 4PALA 3JTDB 2FOTA 1FPWA 2F3ZA 5D69A 1KQMB 1KFUL 1QLSA 1DT7B 4QJ3B 3KPXA 4M2QA 3TS5C 2HF5A 1B8RA 3I5IC 1DJWA 1PULA 2LE9B 2F2PA 4PHMA 2NCOA 4CLNA 3SJSA 2PVBA 3EKJA 1FF1A 2JT8A 2JWWA 4MLWA 3EVUA 1R2UA 1S5GZ 3I5FC 5I2QA 1CM4A 1BR4B 2I18A 3SIBA 2A4JA 1SL8A 1UUSA 4R1EA
chains in the Genus database with same CATH superfamily
2L0PA 2LAPA 3FE6A 3O78A 1LXFC 2M7LA 2ZNEA 2LMTA 1PVAA 1QJTA 3DF0B 5I2OA 3JVTC 1MXLC 3LLEA 1CM1A 2LUCA 1BOCA 3FE8A 2JXLA 1GGWA 3RM1A 4DCKA 1KFXS 1Y1XA 3RZSA 3ZNIA 1TNQA 1RWYA 1OSAA 2BECA 1W9ZA 3D74A 1TWOA 1SCVA 2PMYA 4HSZA 3AKBA 2WCBA 1DJYA 1NYAA 2LHIA 1EG3A 1J1DA 2MLEC 2Y1NA 2MA2A 3OHMB 4A4CA 4CFQA 5JJGA 4C0LA 2KLEA 2ZN8A 1MXEA 2K2AA 4P5OE 4DIRA 3S0GA 1QVIY 2I7AA 3AAKA 5FI6A 2P71A 5FI2A 3TDZA 5K89A 2P70A 4PDZA 2MBXA 2SCPA 3SG4A 1CFPA 2LMUA 3CZTX 2JTZA 1EXRA 2QEOA 4U8DA 2LLUA 3PM2A 4JPZB 4PHJA 1QX7A 3A8RA 2WC8A 1DVIA 3FWBA 2WCEA 1BG1A 1N0YA 4MSPA 4C0JA 1UP5A 2QACA 1NPQA 1SNLA 1KFXL 1KQMC 2KYCA 3HX4A 1Y1UA 2KFFA 1R6PA 3WHUB 2O5GA 2QEVA 2KNEA 2V53A 1D1OA 2JULA 1DGVA 2QDIA 3FIAA 3NXAA 4M2PA 4XYNA 1K96A 2ZRTA 4NDBA 2ZKMX 3DXLA 1K8UA 2G2BA 2K60A 1JF0A 4MRXA 4P2YB 3D77A 3S0DA 3BQ3A 1NCXA 4ICBA 1TTXA 1SCMC 2L98A 3KF9A 3AKAA 1B8CA 4WQ2A 2DOQA 3E3RA 1UHHA 4YI9A 5CSJA 1RJVA 3CR4X 1S6JA 1K9PA 1F54A 3CZ1A 1TUJA 3CWGA 2JC2A 3EK4A 3S0EA 2KAYA 2KHNA 2PQLA 3O4XA 4BY5A 4PCWA 1DF0B 3OP0A 4FQOA 3RLZA 1C7WA 3V2LA 3OX6A 2JZIA 1WRLA 3DY9A 2M3WA 2LHLA 3GK2A 2BAPA 1MHOA 1K94A 1E8AA 3LK0A 1A75A 2NCPA 5AEQA 2HETA 2BL0B 3TUYB 1EL4A 4C0KA 1PVBA 1WLMA 1DMOA 1JFJA 2KYFA 1DGUA 4PHKA 4MRYA 3VRRA 5I2LA 1SR6C 1XFWO 2LP3A 4MVFA 3S0FA 1DJZA 1QVIZ 4N1GA 3PM8A 4MN0A 3TDUA 2BBMA 5JOLA 1LINA 4AOMA 4AQJA 4OV2A 2WCLA 2WNDA 3EVRA 3GOFA 5TNCA 1XFZO 3LCPC 5IBWA 1L2OB 2H8VA 1XFXO 1HQVA 2M49B 3Q8IA 2B1UA 1DQEA 1AJ5A 1DELA 4NQGA 3R1PA 1G33A 3IQQA 2BCBA 1KK8B 2KQ6A 3I5GC 4USLA 5D7FA 3B87A 2OTGC 4MEWA 1CLBA 1OZSA 2NZ0A 3QMEA 3BFBA 2PYQA 4WQ3A 1W7JB 2BE4A 1NX0A 1WDCC 2CNPA 1JUOA 1CTRA 2JNFA 1S3PA 3BFHA 1W7IB 4GPLB 1BLQA 3B7AA 1CMFA 3VRNA 1DJHA 1UURA 2LVVA 3TDIA 1S26D 3WNXB 1IJ6A 3O6BA 1GJYA 4F7FA 5KTYA 1YX7A 3KO0A 4JQ0D 1HT9A 1Y0VH 2K7BA 1OOFA 4FQTA 3F45A 2OPOA 1F55A 2COLB 3D0YA 2MHHA 1PSRA 1QLKA 5FI7A 5AFPA 3OB2B 3CDNA 4PE0A 2L5YA 1XK4A 1UHNA 3R72A 4GGFC 5CSIA 1SSEB 4OZDA 4IJ7A 1OQPA 1DJGA 1Y1AA 2L4IA 3OX5A 4A4BA 5HL1A 1F8HA 1YURA 1ZMZA 3GK1A 1CFCA 4BY4A 1F70A 3EG5B 1WY9A 3D73A 1EJ3A 1IQ3A 2R2IA 1C07A 1ZOTB 3TUYC 2K8MB 3VB1A 3BOWA 3PATA 4CFRA 2JU0A 1DC1A 1YVLA 4MZLA 2LUXA 5AXIA 1VRKA 3N7HA 3QRXA 2WCKA 4N5XA 1AVSA 3SG7A 3CABA 1FI5A 5F6TA 3S0AA 2KFHA 1NIWA 2I2RE 4GFTA 1PSBA 2KGBC 1TCOB 2L50A 2LANA 3KEVA 1Q80A 2QPTA 3A4UB 4HRGA 5HLOA 1CLLA 4YBHB 1CKKA 1QS7A 2D8NA 1L2OC 4MZJA 1NUBA 2BNXA 4F0ZB 2ZRSA 3NSKA 2JT3A 2BCXA 2MAZA 1QIVA 1OOGA 2M9GA 3LL8B 2SASA 1MQ1A 1TRFA 3BJHA 3D78A 2Y4QA 1XO5A 3CLNA 3BUOB 1J7RA 1DJXA 2LLSA 3OB1B 1C3ZA 1YRUB 3MSEB 2KI4B 5DKRA 1S6IA 2L5XB 3I5HB 4JKTA 3UNWA 5FYXA 5HKYA 4PE4A 2K2FA 2P6BB 2WCHA 3JTDC 3SIAA 3FE9A 2CXJA 3NHTA 1B7TY 2JXCA 4XJKA 2HQWA 2PRUA 4I5KA 4YI8A 2LNKA 3PN7B 4ORCB 1CFDA 3D76A 2BE6A 1KWOB 3PJIA 2E6WA 2F3YA 1L7ZA 1F71A 1ODBA 2FCDA 1QX5B 1B47A 3DVKA 4AQIA 3PALA 2JT0A 3SS5A 1B1GA 2GTEA 3R1VA 4QJ4B 1K95A 1QV1A 2KLDA 3HCMA 1GQMA 2M8UA 2KPHA 1YX8A 5I8NA 4I5NB 1CDLA 3K1EA 3VRPA 1LKJA 1H8BA 1YTZC 3CR5X 1CMGA 3DVJA 1ALWA 4DUQA 1NCZA 3C1VA 2ERBA 2EGDA 1TNXA 2KGRA 4GNKB 1YUUA 1PK0D 2O60A 1Y6WA 2LVJA 3O4YA 1OOHA 3TZ1A 1SPYA 3EVVA 1QWVA 4OR9B 2PALA 5EL2A 1BODA 1IJ5A 1SKTA 2WCMA 2L2CA 1AP4A 1A2XA 2MLFC 3B86A 2KAXA 3FS7A 3IVTA 1F4QA 5CSFA 1PRWA 2H61C 1SL7A 2ISDA 3S0BA 1CDNA 1JSAA 3BUXB 2WOSA 3TS5B 1P28A 1OMRA 2CTNA 3I5IB 3D10A 1M45A 5HKWA 1FW4A 2JRFA 4IL1A 3CGAA 1UWOA 1M39A 2F8PA 1KK7Y 1QASA 5G08A 5HYDA 1SBJA 1CFFA 1KCYA 1RECA 2G9BA 2KFGA 5HLVA 1NWDA 1NX3A 3B6XA 4D1EA 1QIWA 2EC6B 1FI6A 5DICA 1ORGA 1TOPA 5BPJA 2KI4C 1TCFA 1B7TZ 1LA3A 3ZWHA 1B4CA 1WRKA 1CNPA 1J7QA 2MRDA 1LS8A 3JVTB 3SS3A 1IQ5A 3SG5A 3AAJA 1AHRA 2JNXA 2E30A 3B88A 1V1FA 3NHIA 3DYEA 3L4LA 2L51A 4YGCB 2OS8B 5DKQA 2MJWB 1K9KA 3M0WA 1QX2A 1TNWA 1EH2A 4INXA 1JFKA 2CBLA 4OVNF 1G4YR 3DF0A 5ER5A 1A75B 1GGZA 1G8IA 1H4BA 3BYAA 1KQVA 1SMGA 2ZFDA 1NCYA 1UHIA 1OZOA 5CSNA 1K2HA 1NX1A 1IKUA 1TIZA 1A4PA 3L4AA 2KQYA 3L47A 1QTXA 2KBIA 2VRGA 2H61A 1BJFA 2BKHB 2FJUB 2EHBA 2KBMA 3BFAA 2K7CA 2K61A 3PLFB 2Y1MA 2KAVA 1JWDA 2LVKA 1SY9A 1XA5A 2TN4A 2JQ6A 3CZ0A 3IQOA 2M1KB 2GGZA 1ZACA 2BL0C 3SG3A 1M63B 4DRWA 1KK7Z 1BT6A 1WLZA 4YRUA 3EK7A 5I94A 3SS4A 3H4SE 1K9UA 1KSMA 2AMIA 1YUTA 1SRAA 1XVJA 3SG2A 2LC5A 2M29A 4NDDA 3CR2A 3CYZA 1IH0A 2WCFA 4CPVA 1J7OA 5AANA 5B8IB 1M31A 1SCMB 3UO9A 1RTP1 2K7OA 1FBVA 1OOIX 5KSZA 2EC6C 4Q04A 3NSLA 4ORBB 4OCIA 1OMDA 3ICBA 2JPTA 2LVIA 1MWNA 4CIDA 1BMOA 1ALVA 1MR8A 2K7DA 1SW8A 2KDHA 5CPVA 5J3XA 1CDMA 3CTNA 3KHEA 1KK8C 2GGMA 2WCJA 3D0YB 2AUCA 3DZTA 1N2DA 2FJYA 2KI6D 4HREE 4DS7A 4QJ5B 2OS8C 2BBNA 1MF8B 1SK6D 2LV7A 1C7VA 5DKNA 3BXKA 1AUIB 2M97A 1XYDA 1F4OA 3BUWB 3NSIA 1U5IA 2L2EA 4GUKA 1XFVO 3EK8A 1RFJA 1SR6B 4GGFA 1IIOA 1K93D 1DF0A 2L4HA 1PALA 1YRTB 1BU3A 2CCMA 4OKHA 2LMVA 2QEHA 3R1OA 2ZN9A 1S6CA 3BOWB 1B8LA 1J55A 2LCPA 1V1GA 2Y5IA 4INWA 4PT1A 1XFUO 4FTGA 4MZKA 4GGNA 1JF2A 4L9MA 3CS1A 2H2KA 1B9AA 1RROA 2KI6C 5ER4X 1Z2CB 3WXAA 1UHKA 4KYNA 1LVCD 1RK9A 2IS9A 4GBAA 1A03A 1YVHA 1YR5A 2LP2A 2GV5A 2K0JA 3BUNB 3CZ2A 4WRIA 2CT9A 4YGDB 3I5GB 4ETOA 2OTGB 1T14A 2ZNDA 2RGIA 1SL9A 4GAOA 4NDCA 1WDCB 2JTTA 1ZFSA 2M7NA 3BUMB 3DD4A 2PASA 1C3YA 1CLMA 1M46A 2F2OA 4I5LB 3DVMA 3O2PA 1KSOA 1S36A 1AK8A 4YGEB 1IWQA 2JPOA 1DJIA 2NLNA 5AERA 1BF5A 1CB1A 3NSOA 2Q4UA 3PFVA 2HPSA 3D75A 2LM5A 3GK4X 5HKZA 5PALA 4HRHA 2QEBA 2LLTA 4XJKB 3VGOA 4YGAA 1SYMA 3LK1A 1WRZA 4PE1A 1OOJA 1U5IB 1QV0A 2KSPA 1EG4A 1N65A 1MUXA 3DVEA 2F33A 3I5FB 3EKHA 1IGVA 1NSHA 3FWCA 1OW4A 1TNPA 1S5GY 1OE9B 1NX2A 3SG6A 3I5HC 2BCAA 1DTLA 1XK4C 1X02A 4ZCVA 2I94A 1JBAA 1QATA 4UPGA 3NGVA 4I5JA 3WHTB 2JOJA 4JWQA 2AAOA 2FCEA 3PN7C 3PSRA 4ZCUA 4MBEA 1KWOC 1J7PA 1A29A 1NP8A 4M2OA 3OBVA 2WC6A 2WC5A 2YGUA 1KFUS 1XFRA 2HQ8A 3OGNA 1QXPA 4YGBB 4TNCA 1BR1B 1J1EA 1ZUZA 2WORA 5GQQC 3VRQA 4E68A 1TN4A 3VROA 1DEKA 4ORAB 1IRJA 1S1EA 1JC2A 1IG5A 3IF7A 2PSRA 1UHJA 1CDPA 2NXQA 3K21A 2M0RA 2BKIB 2Q91A 4N1FA 1K90D 1LA0A 5KU1A 1OMVA 2KOTA 2M1UA 1XFYO 4PE7A 1YUSA 4PHNA 1AJ4A 4PALA 3JTDB 2FOTA 1TUZA 1GM0A 1FPWA 2F3ZA 5D69A 1KQMB 1KFUL 1QLSA 1DT7B 4QJ3B 3KPXA 1Z4HA 4M2QA 3TS5C 2HF5A 1B8RA 3I5IC 1DJWA 1PULA 2LE9B 4JD9A 2F2PA 4PHMA 2NCOA 4CLNA 3SJSA 2PVBA 3EKJA 1FF1A 2JT8A 2JWWA 4MLWA 3EVUA 1R2UA 1S5GZ 3I5FC 5D3OA 1CM4A 5I2QA 1BR4B 2I18A 3SIBA 2A4JA 1SL8A 1UUSA 4R1EA
chains in the Genus database with same CATH topology
2L0PA 2LAPA 2M7LA 3O78A 1LXFC 2ZNEA 2LMTA 1PVAA 1QJTA 3DF0B 5I2OA 3JVTC 1MXLC 3LLEA 1CM1A 2LUCA 1BOCA 2JXLA 1GGWA 3RM1A 4DCKA 1KFXS 1Y1XA 3ZNIA 1TNQA 1RWYA 1OSAA 2BECA 1SCVA 2PMYA 4HSZA 3AKBA 2WCBA 1DJYA 1NYAA 2LHIA 1EG3A 1J1DA 2MLEC 2Y1NA 2MA2A 3OHMB 4A4CA 4CFQA 5JJGA 4C0LA 2ZN8A 1MXEA 2K2AA 4P5OE 4DIRA 1QVIY 2I7AA 3AAKA 5K89A 1H8BA 3TDZA 1CFPA 4PDZA 2MBXA 2SCPA 3SG4A 2LMUA 3CZTX 2JTZA 1EXRA 4U8DA 2LLUA 4JPZB 4PHJA 1QX7A 3A8RA 2WC8A 1DVIA 3FWBA 2WCEA 1BG1A 1N0YA 4MSPA 4C0JA 1UP5A 2QACA 1NPQA 1SNLA 1KFXL 1KQMC 2KYCA 3HX4A 1Y1UA 2KFFA 1R6PA 3WHUB 2O5GA 2KNEA 2V53A 1D1OA 2JULA 1DGVA 3FIAA 4XYNA 3NXAA 4M2PA 1K96A 2ZRTA 4NDBA 2ZKMX 1K8UA 2G2BA 1JF0A 4MRXA 4P2YB 3BQ3A 1NCXA 4ICBA 1TTXA 1SCMC 2L98A 3KF9A 3AKAA 1B8CA 4WQ2A 2DOQA 3E3RA 1UHHA 4YI9A 5CSJA 1RJVA 3CR4X 1S6JA 1K9PA 1F54A 3CWGA 2JC2A 3EK4A 2KAYA 2KHNA 4BY5A 4PCWA 1DF0B 3OP0A 4FQOA 3RLZA 1C7WA 3OX6A 2JZIA 1WRLA 2M3WA 2LHLA 3GK2A 1MHOA 1K94A 1E8AA 3LK0A 1A75A 2NCPA 5AEQA 2HETA 2BL0B 3TUYB 1EL4A 4C0KA 1PVBA 1WLMA 1DMOA 1JFJA 2KYFA 1DGUA 4PHKA 4MRYA 3VRRA 5I2LA 1SR6C 1XFWO 2LP3A 4MVFA 1DJZA 1QVIZ 4N1GA 3PM8A 4MN0A 3TDUA 2BBMA 5JOLA 1LINA 4AOMA 4AQJA 4OV2A 2WNDA 3EVRA 3GOFA 5TNCA 1XFZO 3LCPC 5IBWA 1L2OB 1XFXO 1HQVA 2M49B 2B1UA 1AJ5A 4NQGA 1G33A 3IQQA 2BCBA 1KK8B 2KQ6A 3I5GC 4USLA 5D7FA 1CLBA 2OTGC 4MEWA 1OZSA 2NZ0A 4WQ3A 1W7JB 2BE4A 1NX0A 2CNPA 1WDCC 1JUOA 1CTRA 2JNFA 1S3PA 1BLQA 1W7IB 4GPLB 1CMFA 3VRNA 1DJHA 1UURA 2LVVA 3TDIA 1S26D 3WNXB 1IJ6A 3O6BA 1GJYA 5KTYA 1YX7A 3KO0A 4JQ0D 1HT9A 1Y0VH 2K7BA 3F45A 2OPOA 1F55A 2COLB 3D0YA 2MHHA 1PSRA 1QLKA 5AFPA 3OB2B 4PE0A 1XK4A 1UHNA 5CSIA 4GGFC 4A4BA 1BODA 1OQPA 1DJGA 1Y1AA 2L4IA 3OX5A 1F8HA 1YURA 1ZMZA 3GK1A 1CFCA 4BY4A 1F70A 1WY9A 1EJ3A 1IQ3A 2R2IA 1C07A 1ZOTB 3TUYC 2K8MB 3BOWA 3PATA 4CFRA 2JU0A 1YVLA 4MZLA 2LUXA 5AXIA 1VRKA 3QRXA 4N5XA 1AVSA 3SG7A 1FI5A 5F6TA 2KFHA 1NIWA 2I2RE 4GFTA 1PSBA 2KGBC 1TCOB 2L50A 2LANA 3KEVA 1Q80A 2QPTA 3A4UB 4HRGA 5HLOA 1CLLA 4YBHB 1CKKA 1QS7A 2D8NA 1L2OC 4MZJA 1NUBA 4F0ZB 2ZRSA 3NSKA 2JT3A 2BCXA 2MAZA 1QIVA 2M9GA 3LL8B 2SASA 1MQ1A 1TRFA 2Y4QA 1XO5A 3CLNA 3BUOB 1J7RA 1DJXA 2LLSA 3OB1B 3MSEB 1YRUB 2KI4B 5DKRA 1S6IA 2L5XB 3I5HB 5FYXA 5HKYA 4PE4A 2K2FA 2P6BB 3JTDC 3SIAA 2CXJA 1B7TY 2JXCA 4XJKA 2HQWA 2PRUA 4I5KA 4YI8A 2LNKA 3PN7B 4ORCB 1CFDA 1J7QA 2BE6A 1KWOB 2E6WA 2F3YA 1L7ZA 1F71A 1ODBA 2FCDA 1QX5B 1B47A 3DVKA 4AQIA 3PALA 2JT0A 1B1GA 4QJ4B 1K95A 1QV1A 3HCMA 1JWDA 1GQMA 2M8UA 5I8NA 1YX8A 4I5NB 1CDLA 3VRPA 1LKJA 1YTZC 3CR5X 1CMGA 3DVJA 1ALWA 4DUQA 1NCZA 3C1VA 2EGDA 1TNXA 2KGRA 4GNKB 1YUUA 1PK0D 2O60A 1Y6WA 2LVJA 3O4YA 3TZ1A 1SPYA 3EVVA 4OR9B 2PALA 1IJ5A 1SKTA 1AP4A 1A2XA 2MLFC 2KAXA 3FS7A 5CSFA 1F4QA 1PRWA 2H61C 1SL7A 2ISDA 1CDNA 1JSAA 3BUXB 2WOSA 3TS5B 1OMRA 2CTNA 3I5IB 3D10A 1M45A 5HKWA 1FW4A 2JRFA 4IL1A 3CGAA 1UWOA 1M39A 2F8PA 1KK7Y 1QASA 5G08A 5HYDA 1SBJA 1CFFA 1KCYA 1RECA 2G9BA 2KFGA 5HLVA 1NWDA 1NX3A 4D1EA 1QIWA 2EC6B 1FI6A 1TOPA 5BPJA 2KI4C 1TCFA 1B7TZ 1LA3A 3ZWHA 1B4CA 1WRKA 1CNPA 2MRDA 3JVTB 1IQ5A 3SG5A 3AAJA 1AHRA 2JNXA 2E30A 1V1FA 2L51A 4YGCB 2OS8B 5DKQA 2MJWB 1K9KA 3M0WA 1QX2A 1TNWA 1EH2A 1JFKA 2CBLA 4OVNF 1G4YR 3DF0A 5ER5A 1A75B 1GGZA 1G8IA 1H4BA 3BYAA 1KQVA 1SMGA 2ZFDA 1NCYA 1UHIA 1OZOA 5CSNA 1K2HA 1NX1A 1IKUA 1TIZA 1A4PA 2KQYA 1QTXA 2KBIA 2VRGA 2H61A 1BJFA 2BKHB 2FJUB 2EHBA 2KBMA 2K7CA 2K61A 3PLFB 2Y1MA 2KAVA 2LVKA 1SY9A 1XA5A 2TN4A 2JQ6A 3IQOA 2M1KB 2GGZA 1ZACA 2BL0C 3SG3A 1M63B 4DRWA 1KK7Z 1BT6A 1WLZA 4YRUA 3EK7A 3H4SE 1K9UA 1KSMA 2AMIA 1YUTA 1SRAA 1XVJA 3SG2A 2LC5A 2M29A 4NDDA 3CR2A 1IH0A 2WCFA 4CPVA 1J7OA 5AANA 5B8IB 1M31A 1SCMB 1RTP1 2K7OA 1FBVA 5KSZA 2EC6C 4Q04A 3NSLA 4ORBB 4OCIA 1OMDA 3ICBA 2JPTA 2LVIA 1MWNA 4CIDA 1BMOA 1ALVA 1MR8A 2K7DA 1SW8A 2KDHA 5CPVA 5J3XA 1CDMA 3CTNA 3KHEA 1KK8C 2GGMA 3D0YB 2AUCA 1N2DA 2KI6D 4HREE 4DS7A 4QJ5B 2OS8C 2BBNA 1MF8B 1SK6D 2LV7A 1C7VA 5DKNA 3BXKA 1AUIB 2M97A 1XYDA 1F4OA 3BUWB 3NSIA 1U5IA 2L2EA 4GUKA 1XFVO 3EK8A 1RFJA 1SR6B 4GGFA 1K93D 1DF0A 2L4HA 1PALA 1YRTB 1BU3A 2CCMA 4OKHA 2LMVA 2ZN9A 1S6CA 3BOWB 1B8LA 1J55A 2LCPA 1V1GA 2Y5IA 1XFUO 4FTGA 4MZKA 4GGNA 1JF2A 4L9MA 3CS1A 2H2KA 1B9AA 1RROA 2KI6C 5ER4X 3WXAA 1UHKA 1LVCD 1RK9A 2IS9A 4GBAA 1A03A 1YVHA 1YR5A 2LP2A 2GV5A 2K0JA 3BUNB 4WRIA 2CT9A 4YGDB 3I5GB 4ETOA 2OTGB 2ZNDA 2RGIA 1SL9A 4GAOA 4NDCA 1WDCB 2JTTA 1ZFSA 2M7NA 3BUMB 3DD4A 2PASA 1CLMA 1M46A 2F2OA 4I5LB 3DVMA 3O2PA 1KSOA 1S36A 1AK8A 4YGEB 1IWQA 2NLNA 1DJIA 5AERA 1BF5A 1CB1A 3NSOA 2Q4UA 3PFVA 2HPSA 2LM5A 3GK4X 5HKZA 5PALA 4HRHA 2LLTA 4XJKB 3VGOA 4YGAA 1SYMA 3LK1A 1WRZA 4PE1A 1OOJA 1U5IB 1QV0A 2KSPA 1EG4A 1N65A 1MUXA 3DVEA 2F33A 3I5FB 3EKHA 1IGVA 1NSHA 3FWCA 1TNPA 1S5GY 1OE9B 1NX2A 3SG6A 3I5HC 2BCAA 1DTLA 1XK4C 1X02A 4ZCVA 2I94A 1JBAA 1QATA 4UPGA 4I5JA 3WHTB 2JOJA 4JWQA 2AAOA 2FCEA 3PN7C 3PSRA 4ZCUA 4MBEA 1KWOC 1J7PA 1A29A 1NP8A 4M2OA 1KFUS 2HQ8A 1QXPA 4YGBB 4TNCA 1BR1B 1J1EA 1ZUZA 2WORA 5GQQC 3VRQA 4E68A 1TN4A 3VROA 4ORAB 1IRJA 1S1EA 1JC2A 1IG5A 3IF7A 2PSRA 1UHJA 1CDPA 2NXQA 3K21A 2M0RA 2BKIB 2Q91A 4N1FA 1K90D 1LA0A 5KU1A 1OMVA 2KOTA 2M1UA 1XFYO 4PE7A 1YUSA 4PHNA 1AJ4A 4PALA 3JTDB 2FOTA 1FPWA 2F3ZA 5D69A 1KQMB 1KFUL 1QLSA 1DT7B 4QJ3B 3KPXA 4M2QA 3TS5C 2HF5A 1B8RA 3I5IC 1DJWA 1PULA 2LE9B 2F2PA 4PHMA 2NCOA 4CLNA 3SJSA 2PVBA 3EKJA 1FF1A 2JT8A 2JWWA 4MLWA 3EVUA 1R2UA 1S5GZ 3I5FC 5I2QA 1CM4A 1BR4B 2I18A 3SIBA 2A4JA 1SL8A 1UUSA 4R1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L0P A;  2LAP A;  2M7L A;  3O78 A;  1LXF C;  2ZNE A;  2LMT A;  1PVA A;  1QJT A;  3DF0 B;  5I2O A;  3JVT C;  1MXL C;  3LLE A;  1CM1 A;  2LUC A;  1BOC A;  2JXL A;  1GGW A;  3RM1 A;  4DCK A;  1KFX S;  1Y1X A;  3ZNI A;  1TNQ A;  1RWY A;  1OSA A;  2BEC A;  1SCV A;  2PMY A;  4HSZ A;  3AKB A;  2WCB A;  1DJY A;  1NYA A;  2LHI A;  1EG3 A;  1J1D A;  2MLE C;  2Y1N A;  2MA2 A;  3OHM B;  4A4C A;  4CFQ A;  5JJG A;  4C0L A;  2ZN8 A;  1MXE A;  2K2A A;  4P5O E;  4DIR A;  1QVI Y;  2I7A A;  3AAK A;  5K89 A;  1H8B A;  3TDZ A;  1CFP A;  4PDZ A;  2MBX A;  2SCP A;  3SG4 A;  2LMU A;  3CZT X;  2JTZ A;  1EXR A;  4U8D A;  2LLU A;  4JPZ B;  4PHJ A;  1QX7 A;  3A8R A;  2WC8 A;  1DVI A;  3FWB A;  2WCE A;  1BG1 A;  1N0Y A;  4MSP A;  4C0J A;  1UP5 A;  2QAC A;  1NPQ A;  1SNL A;  1KFX L;  1KQM C;  2KYC A;  3HX4 A;  1Y1U A;  2KFF A;  1R6P A;  3WHU B;  2O5G A;  2KNE A;  2V53 A;  1D1O A;  2JUL A;  1DGV A;  3FIA A;  4XYN A;  3NXA A;  4M2P A;  1K96 A;  2ZRT A;  4NDB A;  2ZKM X;  1K8U A;  2G2B A;  1JF0 A;  4MRX A;  4P2Y B;  3BQ3 A;  1NCX A;  4ICB A;  1TTX A;  1SCM C;  2L98 A;  3KF9 A;  3AKA A;  1B8C A;  4WQ2 A;  2DOQ A;  3E3R A;  1UHH A;  4YI9 A;  5CSJ A;  1RJV A;  3CR4 X;  1S6J A;  1K9P A;  1F54 A;  3CWG A;  2JC2 A;  3EK4 A;  2KAY A;  2KHN A;  4BY5 A;  4PCW A;  1DF0 B;  3OP0 A;  4FQO A;  3RLZ A;  1C7W A;  3OX6 A;  2JZI A;  1WRL A;  2M3W A;  2LHL A;  3GK2 A;  1MHO A;  1K94 A;  1E8A A;  3LK0 A;  1A75 A;  2NCP A;  5AEQ A;  2HET A;  2BL0 B;  3TUY B;  1EL4 A;  4C0K A;  1PVB A;  1WLM A;  1DMO A;  1JFJ A;  2KYF A;  1DGU A;  4PHK A;  4MRY A;  3VRR A;  5I2L A;  1SR6 C;  1XFW O;  2LP3 A;  4MVF A;  1DJZ A;  1QVI Z;  4N1G A;  3PM8 A;  4MN0 A;  3TDU A;  2BBM A;  5JOL A;  1LIN A;  4AOM A;  4AQJ A;  4OV2 A;  2WND A;  3EVR A;  3GOF A;  5TNC A;  1XFZ O;  3LCP C;  5IBW A;  1L2O B;  1XFX O;  1HQV A;  2M49 B;  2B1U A;  1AJ5 A;  4NQG A;  1G33 A;  3IQQ A;  2BCB A;  1KK8 B;  2KQ6 A;  3I5G C;  4USL A;  5D7F A;  1CLB A;  2OTG C;  4MEW A;  1OZS A;  2NZ0 A;  4WQ3 A;  1W7J B;  2BE4 A;  1NX0 A;  2CNP A;  1WDC C;  1JUO A;  1CTR A;  2JNF A;  1S3P A;  1BLQ A;  1W7I B;  4GPL B;  1CMF A;  3VRN A;  1DJH A;  1UUR A;  2LVV A;  3TDI A;  1S26 D;  3WNX B;  1IJ6 A;  3O6B A;  1GJY A;  5KTY A;  1YX7 A;  3KO0 A;  4JQ0 D;  1HT9 A;  1Y0V H;  2K7B A;  3F45 A;  2OPO A;  1F55 A;  2COL B;  3D0Y A;  2MHH A;  1PSR A;  1QLK A;  5AFP A;  3OB2 B;  4PE0 A;  1XK4 A;  1UHN A;  5CSI A;  4GGF C;  4A4B A;  1BOD A;  1OQP A;  1DJG A;  1Y1A A;  2L4I A;  3OX5 A;  1F8H A;  1YUR A;  1ZMZ A;  3GK1 A;  1CFC A;  4BY4 A;  1F70 A;  1WY9 A;  1EJ3 A;  1IQ3 A;  2R2I A;  1C07 A;  1ZOT B;  3TUY C;  2K8M B;  3BOW A;  3PAT A;  4CFR A;  2JU0 A;  1YVL A;  4MZL A;  2LUX A;  5AXI A;  1VRK A;  3QRX A;  4N5X A;  1AVS A;  3SG7 A;  1FI5 A;  5F6T A;  2KFH A;  1NIW A;  2I2R E;  4GFT A;  1PSB A;  2KGB C;  1TCO B;  2L50 A;  2LAN A;  3KEV A;  1Q80 A;  2QPT A;  3A4U B;  4HRG A;  5HLO A;  1CLL A;  4YBH B;  1CKK A;  1QS7 A;  2D8N A;  1L2O C;  4MZJ A;  1NUB A;  4F0Z B;  2ZRS A;  3NSK A;  2JT3 A;  2BCX A;  2MAZ A;  1QIV A;  2M9G A;  3LL8 B;  2SAS A;  1MQ1 A;  1TRF A;  2Y4Q A;  1XO5 A;  3CLN A;  3BUO B;  1J7R A;  1DJX A;  2LLS A;  3OB1 B;  3MSE B;  1YRU B;  2KI4 B;  5DKR A;  1S6I A;  2L5X B;  3I5H B;  5FYX A;  5HKY A;  4PE4 A;  2K2F A;  2P6B B;  3JTD C;  3SIA A;  2CXJ A;  1B7T Y;  2JXC A;  4XJK A;  2HQW A;  2PRU A;  4I5K A;  4YI8 A;  2LNK A;  3PN7 B;  4ORC B;  1CFD A;  1J7Q A;  2BE6 A;  1KWO B;  2E6W A;  2F3Y A;  1L7Z A;  1F71 A;  1ODB A;  2FCD A;  1QX5 B;  1B47 A;  3DVK A;  4AQI A;  3PAL A;  2JT0 A;  1B1G A;  4QJ4 B;  1K95 A;  1QV1 A;  3HCM A;  1JWD A;  1GQM A;  2M8U A;  5I8N A;  1YX8 A;  4I5N B;  1CDL A;  3VRP A;  1LKJ A;  1YTZ C;  3CR5 X;  1CMG A;  3DVJ A;  1ALW A;  4DUQ A;  1NCZ A;  3C1V A;  2EGD A;  1TNX A;  2KGR A;  4GNK B;  1YUU A;  1PK0 D;  2O60 A;  1Y6W A;  2LVJ A;  3O4Y A;  3TZ1 A;  1SPY A;  3EVV A;  4OR9 B;  2PAL A;  1IJ5 A;  1SKT A;  1AP4 A;  1A2X A;  2MLF C;  2KAX A;  3FS7 A;  5CSF A;  1F4Q A;  1PRW A;  2H61 C;  1SL7 A;  2ISD A;  1CDN A;  1JSA A;  3BUX B;  2WOS A;  3TS5 B;  1OMR A;  2CTN A;  3I5I B;  3D10 A;  1M45 A;  5HKW A;  1FW4 A;  2JRF A;  4IL1 A;  3CGA A;  1UWO A;  1M39 A;  2F8P A;  1KK7 Y;  1QAS A;  5G08 A;  5HYD A;  1SBJ A;  1CFF A;  1KCY A;  1REC A;  2G9B A;  2KFG A;  5HLV A;  1NWD A;  1NX3 A;  4D1E A;  1QIW A;  2EC6 B;  1FI6 A;  1TOP A;  5BPJ A;  2KI4 C;  1TCF A;  1B7T Z;  1LA3 A;  3ZWH A;  1B4C A;  1WRK A;  1CNP A;  2MRD A;  3JVT B;  1IQ5 A;  3SG5 A;  3AAJ A;  1AHR A;  2JNX A;  2E30 A;  1V1F A;  2L51 A;  4YGC B;  2OS8 B;  5DKQ A;  2MJW B;  1K9K A;  3M0W A;  1QX2 A;  1TNW A;  1EH2 A;  1JFK A;  2CBL A;  4OVN F;  1G4Y R;  3DF0 A;  5ER5 A;  1A75 B;  1GGZ A;  1G8I A;  1H4B A;  3BYA A;  1KQV A;  1SMG A;  2ZFD A;  1NCY A;  1UHI A;  1OZO A;  5CSN A;  1K2H A;  1NX1 A;  1IKU A;  1TIZ A;  1A4P A;  2KQY A;  1QTX A;  2KBI A;  2VRG A;  2H61 A;  1BJF A;  2BKH B;  2FJU B;  2EHB A;  2KBM A;  2K7C A;  2K61 A;  3PLF B;  2Y1M A;  2KAV A;  2LVK A;  1SY9 A;  1XA5 A;  2TN4 A;  2JQ6 A;  3IQO A;  2M1K B;  2GGZ A;  1ZAC A;  2BL0 C;  3SG3 A;  1M63 B;  4DRW A;  1KK7 Z;  1BT6 A;  1WLZ A;  4YRU A;  3EK7 A;  3H4S E;  1K9U A;  1KSM A;  2AMI A;  1YUT A;  1SRA A;  1XVJ A;  3SG2 A;  2LC5 A;  2M29 A;  4NDD A;  3CR2 A;  1IH0 A;  2WCF A;  4CPV A;  1J7O A;  5AAN A;  5B8I B;  1M31 A;  1SCM B;  1RTP 1;  2K7O A;  1FBV A;  5KSZ A;  2EC6 C;  4Q04 A;  3NSL A;  4ORB B;  4OCI A;  1OMD A;  3ICB A;  2JPT A;  2LVI A;  1MWN A;  4CID A;  1BMO A;  1ALV A;  1MR8 A;  2K7D A;  1SW8 A;  2KDH A;  5CPV A;  5J3X A;  1CDM A;  3CTN A;  3KHE A;  1KK8 C;  2GGM A;  3D0Y B;  2AUC A;  1N2D A;  2KI6 D;  4HRE E;  4DS7 A;  4QJ5 B;  2OS8 C;  2BBN A;  1MF8 B;  1SK6 D;  2LV7 A;  1C7V A;  5DKN A;  3BXK A;  1AUI B;  2M97 A;  1XYD A;  1F4O A;  3BUW B;  3NSI A;  1U5I A;  2L2E A;  4GUK A;  1XFV O;  3EK8 A;  1RFJ A;  1SR6 B;  4GGF A;  1K93 D;  1DF0 A;  2L4H A;  1PAL A;  1YRT B;  1BU3 A;  2CCM A;  4OKH A;  2LMV A;  2ZN9 A;  1S6C A;  3BOW B;  1B8L A;  1J55 A;  2LCP A;  1V1G A;  2Y5I A;  1XFU O;  4FTG A;  4MZK A;  4GGN A;  1JF2 A;  4L9M A;  3CS1 A;  2H2K A;  1B9A A;  1RRO A;  2KI6 C;  5ER4 X;  3WXA A;  1UHK A;  1LVC D;  1RK9 A;  2IS9 A;  4GBA A;  1A03 A;  1YVH A;  1YR5 A;  2LP2 A;  2GV5 A;  2K0J A;  3BUN B;  4WRI A;  2CT9 A;  4YGD B;  3I5G B;  4ETO A;  2OTG B;  2ZND A;  2RGI A;  1SL9 A;  4GAO A;  4NDC A;  1WDC B;  2JTT A;  1ZFS A;  2M7N A;  3BUM B;  3DD4 A;  2PAS A;  1CLM A;  1M46 A;  2F2O A;  4I5L B;  3DVM A;  3O2P A;  1KSO A;  1S36 A;  1AK8 A;  4YGE B;  1IWQ A;  2NLN A;  1DJI A;  5AER A;  1BF5 A;  1CB1 A;  3NSO A;  2Q4U A;  3PFV A;  2HPS A;  2LM5 A;  3GK4 X;  5HKZ A;  5PAL A;  4HRH A;  2LLT A;  4XJK B;  3VGO A;  4YGA A;  1SYM A;  3LK1 A;  1WRZ A;  4PE1 A;  1OOJ A;  1U5I B;  1QV0 A;  2KSP A;  1EG4 A;  1N65 A;  1MUX A;  3DVE A;  2F33 A;  3I5F B;  3EKH A;  1IGV A;  1NSH A;  3FWC A;  1TNP A;  1S5G Y;  1OE9 B;  1NX2 A;  3SG6 A;  3I5H C;  2BCA A;  1DTL A;  1XK4 C;  1X02 A;  4ZCV A;  2I94 A;  1JBA A;  1QAT A;  4UPG A;  4I5J A;  3WHT B;  2JOJ A;  4JWQ A;  2AAO A;  2FCE A;  3PN7 C;  3PSR A;  4ZCU A;  4MBE A;  1KWO C;  1J7P A;  1A29 A;  1NP8 A;  4M2O A;  1KFU S;  2HQ8 A;  1QXP A;  4YGB B;  4TNC A;  1BR1 B;  1J1E A;  1ZUZ A;  2WOR A;  5GQQ C;  3VRQ A;  4E68 A;  1TN4 A;  3VRO A;  4ORA B;  1IRJ A;  1S1E A;  1JC2 A;  1IG5 A;  3IF7 A;  2PSR A;  1UHJ A;  1CDP A;  2NXQ A;  3K21 A;  2M0R A;  2BKI B;  2Q91 A;  4N1F A;  1K90 D;  1LA0 A;  5KU1 A;  1OMV A;  2KOT A;  2M1U A;  1XFY O;  4PE7 A;  1YUS A;  4PHN A;  1AJ4 A;  4PAL A;  3JTD B;  2FOT A;  1FPW A;  2F3Z A;  5D69 A;  1KQM B;  1KFU L;  1QLS A;  1DT7 B;  4QJ3 B;  3KPX A;  4M2Q A;  3TS5 C;  2HF5 A;  1B8R A;  3I5I C;  1DJW A;  1PUL A;  2LE9 B;  2F2P A;  4PHM A;  2NCO A;  4CLN A;  3SJS A;  2PVB A;  3EKJ A;  1FF1 A;  2JT8 A;  2JWW A;  4MLW A;  3EVU A;  1R2U A;  1S5G Z;  3I5F C;  5I2Q A;  1CM4 A;  1BR4 B;  2I18 A;  3SIB A;  2A4J A;  1SL8 A;  1UUS A;  4R1E A; 
#chains in the Genus database with same CATH topology
 2L0P A;  2LAP A;  3FE6 A;  3O78 A;  1LXF C;  2M7L A;  2ZNE A;  2LMT A;  1PVA A;  1QJT A;  3DF0 B;  5I2O A;  3JVT C;  1MXL C;  3LLE A;  1CM1 A;  2LUC A;  1BOC A;  3FE8 A;  2JXL A;  1GGW A;  3RM1 A;  4DCK A;  1KFX S;  1Y1X A;  3RZS A;  3ZNI A;  1TNQ A;  1RWY A;  1OSA A;  2BEC A;  1W9Z A;  3D74 A;  1TWO A;  1SCV A;  2PMY A;  4HSZ A;  3AKB A;  2WCB A;  1DJY A;  1NYA A;  2LHI A;  1EG3 A;  1J1D A;  2MLE C;  2Y1N A;  2MA2 A;  3OHM B;  4A4C A;  4CFQ A;  5JJG A;  4C0L A;  2KLE A;  2ZN8 A;  1MXE A;  2K2A A;  4P5O E;  4DIR A;  3S0G A;  1QVI Y;  2I7A A;  3AAK A;  5FI6 A;  2P71 A;  5FI2 A;  3TDZ A;  5K89 A;  2P70 A;  4PDZ A;  2MBX A;  2SCP A;  3SG4 A;  1CFP A;  2LMU A;  3CZT X;  2JTZ A;  1EXR A;  2QEO A;  4U8D A;  2LLU A;  3PM2 A;  4JPZ B;  4PHJ A;  1QX7 A;  3A8R A;  2WC8 A;  1DVI A;  3FWB A;  2WCE A;  1BG1 A;  1N0Y A;  4MSP A;  4C0J A;  1UP5 A;  2QAC A;  1NPQ A;  1SNL A;  1KFX L;  1KQM C;  2KYC A;  3HX4 A;  1Y1U A;  2KFF A;  1R6P A;  3WHU B;  2O5G A;  2QEV A;  2KNE A;  2V53 A;  1D1O A;  2JUL A;  1DGV A;  2QDI A;  3FIA A;  3NXA A;  4M2P A;  4XYN A;  1K96 A;  2ZRT A;  4NDB A;  2ZKM X;  3DXL A;  1K8U A;  2G2B A;  2K60 A;  1JF0 A;  4MRX A;  4P2Y B;  3D77 A;  3S0D A;  3BQ3 A;  1NCX A;  4ICB A;  1TTX A;  1SCM C;  2L98 A;  3KF9 A;  3AKA A;  1B8C A;  4WQ2 A;  2DOQ A;  3E3R A;  1UHH A;  4YI9 A;  5CSJ A;  1RJV A;  3CR4 X;  1S6J A;  1K9P A;  1F54 A;  3CZ1 A;  1TUJ A;  3CWG A;  2JC2 A;  3EK4 A;  3S0E A;  2KAY A;  2KHN A;  2PQL A;  3O4X A;  4BY5 A;  4PCW A;  1DF0 B;  3OP0 A;  4FQO A;  3RLZ A;  1C7W A;  3V2L A;  3OX6 A;  2JZI A;  1WRL A;  3DY9 A;  2M3W A;  2LHL A;  3GK2 A;  2BAP A;  1MHO A;  1K94 A;  1E8A A;  3LK0 A;  1A75 A;  2NCP A;  5AEQ A;  2HET A;  2BL0 B;  3TUY B;  1EL4 A;  4C0K A;  1PVB A;  1WLM A;  1DMO A;  1JFJ A;  2KYF A;  1DGU A;  4PHK A;  4MRY A;  3VRR A;  5I2L A;  1SR6 C;  1XFW O;  2LP3 A;  4MVF A;  3S0F A;  1DJZ A;  1QVI Z;  4N1G A;  3PM8 A;  4MN0 A;  3TDU A;  2BBM A;  5JOL A;  1LIN A;  4AOM A;  4AQJ A;  4OV2 A;  2WCL A;  2WND A;  3EVR A;  3GOF A;  5TNC A;  1XFZ O;  3LCP C;  5IBW A;  1L2O B;  2H8V A;  1XFX O;  1HQV A;  2M49 B;  3Q8I A;  2B1U A;  1DQE A;  1AJ5 A;  1DEL A;  4NQG A;  3R1P A;  1G33 A;  3IQQ A;  2BCB A;  1KK8 B;  2KQ6 A;  3I5G C;  4USL A;  5D7F A;  3B87 A;  2OTG C;  4MEW A;  1CLB A;  1OZS A;  2NZ0 A;  3QME A;  3BFB A;  2PYQ A;  4WQ3 A;  1W7J B;  2BE4 A;  1NX0 A;  1WDC C;  2CNP A;  1JUO A;  1CTR A;  2JNF A;  1S3P A;  3BFH A;  1W7I B;  4GPL B;  1BLQ A;  3B7A A;  1CMF A;  3VRN A;  1DJH A;  1UUR A;  2LVV A;  3TDI A;  1S26 D;  3WNX B;  1IJ6 A;  3O6B A;  1GJY A;  4F7F A;  5KTY A;  1YX7 A;  3KO0 A;  4JQ0 D;  1HT9 A;  1Y0V H;  2K7B A;  1OOF A;  4FQT A;  3F45 A;  2OPO A;  1F55 A;  2COL B;  3D0Y A;  2MHH A;  1PSR A;  1QLK A;  5FI7 A;  5AFP A;  3OB2 B;  3CDN A;  4PE0 A;  2L5Y A;  1XK4 A;  1UHN A;  3R72 A;  4GGF C;  5CSI A;  1SSE B;  4OZD A;  4IJ7 A;  1OQP A;  1DJG A;  1Y1A A;  2L4I A;  3OX5 A;  4A4B A;  5HL1 A;  1F8H A;  1YUR A;  1ZMZ A;  3GK1 A;  1CFC A;  4BY4 A;  1F70 A;  3EG5 B;  1WY9 A;  3D73 A;  1EJ3 A;  1IQ3 A;  2R2I A;  1C07 A;  1ZOT B;  3TUY C;  2K8M B;  3VB1 A;  3BOW A;  3PAT A;  4CFR A;  2JU0 A;  1DC1 A;  1YVL A;  4MZL A;  2LUX A;  5AXI A;  1VRK A;  3N7H A;  3QRX A;  2WCK A;  4N5X A;  1AVS A;  3SG7 A;  3CAB A;  1FI5 A;  5F6T A;  3S0A A;  2KFH A;  1NIW A;  2I2R E;  4GFT A;  1PSB A;  2KGB C;  1TCO B;  2L50 A;  2LAN A;  3KEV A;  1Q80 A;  2QPT A;  3A4U B;  4HRG A;  5HLO A;  1CLL A;  4YBH B;  1CKK A;  1QS7 A;  2D8N A;  1L2O C;  4MZJ A;  1NUB A;  2BNX A;  4F0Z B;  2ZRS A;  3NSK A;  2JT3 A;  2BCX A;  2MAZ A;  1QIV A;  1OOG A;  2M9G A;  3LL8 B;  2SAS A;  1MQ1 A;  1TRF A;  3BJH A;  3D78 A;  2Y4Q A;  1XO5 A;  3CLN A;  3BUO B;  1J7R A;  1DJX A;  2LLS A;  3OB1 B;  1C3Z A;  1YRU B;  3MSE B;  2KI4 B;  5DKR A;  1S6I A;  2L5X B;  3I5H B;  4JKT A;  3UNW A;  5FYX A;  5HKY A;  4PE4 A;  2K2F A;  2P6B B;  2WCH A;  3JTD C;  3SIA A;  3FE9 A;  2CXJ A;  3NHT A;  1B7T Y;  2JXC A;  4XJK A;  2HQW A;  2PRU A;  4I5K A;  4YI8 A;  2LNK A;  3PN7 B;  4ORC B;  1CFD A;  3D76 A;  2BE6 A;  1KWO B;  3PJI A;  2E6W A;  2F3Y A;  1L7Z A;  1F71 A;  1ODB A;  2FCD A;  1QX5 B;  1B47 A;  3DVK A;  4AQI A;  3PAL A;  2JT0 A;  3SS5 A;  1B1G A;  2GTE A;  3R1V A;  4QJ4 B;  1K95 A;  1QV1 A;  2KLD A;  3HCM A;  1GQM A;  2M8U A;  2KPH A;  1YX8 A;  5I8N A;  4I5N B;  1CDL A;  3K1E A;  3VRP A;  1LKJ A;  1H8B A;  1YTZ C;  3CR5 X;  1CMG A;  3DVJ A;  1ALW A;  4DUQ A;  1NCZ A;  3C1V A;  2ERB A;  2EGD A;  1TNX A;  2KGR A;  4GNK B;  1YUU A;  1PK0 D;  2O60 A;  1Y6W A;  2LVJ A;  3O4Y A;  1OOH A;  3TZ1 A;  1SPY A;  3EVV A;  1QWV A;  4OR9 B;  2PAL A;  5EL2 A;  1BOD A;  1IJ5 A;  1SKT A;  2WCM A;  2L2C A;  1AP4 A;  1A2X A;  2MLF C;  3B86 A;  2KAX A;  3FS7 A;  3IVT A;  1F4Q A;  5CSF A;  1PRW A;  2H61 C;  1SL7 A;  2ISD A;  3S0B A;  1CDN A;  1JSA A;  3BUX B;  2WOS A;  3TS5 B;  1P28 A;  1OMR A;  2CTN A;  3I5I B;  3D10 A;  1M45 A;  5HKW A;  1FW4 A;  2JRF A;  4IL1 A;  3CGA A;  1UWO A;  1M39 A;  2F8P A;  1KK7 Y;  1QAS A;  5G08 A;  5HYD A;  1SBJ A;  1CFF A;  1KCY A;  1REC A;  2G9B A;  2KFG A;  5HLV A;  1NWD A;  1NX3 A;  3B6X A;  4D1E A;  1QIW A;  2EC6 B;  1FI6 A;  5DIC A;  1ORG A;  1TOP A;  5BPJ A;  2KI4 C;  1TCF A;  1B7T Z;  1LA3 A;  3ZWH A;  1B4C A;  1WRK A;  1CNP A;  1J7Q A;  2MRD A;  1LS8 A;  3JVT B;  3SS3 A;  1IQ5 A;  3SG5 A;  3AAJ A;  1AHR A;  2JNX A;  2E30 A;  3B88 A;  1V1F A;  3NHI A;  3DYE A;  3L4L A;  2L51 A;  4YGC B;  2OS8 B;  5DKQ A;  2MJW B;  1K9K A;  3M0W A;  1QX2 A;  1TNW A;  1EH2 A;  4INX A;  1JFK A;  2CBL A;  4OVN F;  1G4Y R;  3DF0 A;  5ER5 A;  1A75 B;  1GGZ A;  1G8I A;  1H4B A;  3BYA A;  1KQV A;  1SMG A;  2ZFD A;  1NCY A;  1UHI A;  1OZO A;  5CSN A;  1K2H A;  1NX1 A;  1IKU A;  1TIZ A;  1A4P A;  3L4A A;  2KQY A;  3L47 A;  1QTX A;  2KBI A;  2VRG A;  2H61 A;  1BJF A;  2BKH B;  2FJU B;  2EHB A;  2KBM A;  3BFA A;  2K7C A;  2K61 A;  3PLF B;  2Y1M A;  2KAV A;  1JWD A;  2LVK A;  1SY9 A;  1XA5 A;  2TN4 A;  2JQ6 A;  3CZ0 A;  3IQO A;  2M1K B;  2GGZ A;  1ZAC A;  2BL0 C;  3SG3 A;  1M63 B;  4DRW A;  1KK7 Z;  1BT6 A;  1WLZ A;  4YRU A;  3EK7 A;  5I94 A;  3SS4 A;  3H4S E;  1K9U A;  1KSM A;  2AMI A;  1YUT A;  1SRA A;  1XVJ A;  3SG2 A;  2LC5 A;  2M29 A;  4NDD A;  3CR2 A;  3CYZ A;  1IH0 A;  2WCF A;  4CPV A;  1J7O A;  5AAN A;  5B8I B;  1M31 A;  1SCM B;  3UO9 A;  1RTP 1;  2K7O A;  1FBV A;  1OOI X;  5KSZ A;  2EC6 C;  4Q04 A;  3NSL A;  4ORB B;  4OCI A;  1OMD A;  3ICB A;  2JPT A;  2LVI A;  1MWN A;  4CID A;  1BMO A;  1ALV A;  1MR8 A;  2K7D A;  1SW8 A;  2KDH A;  5CPV A;  5J3X A;  1CDM A;  3CTN A;  3KHE A;  1KK8 C;  2GGM A;  2WCJ A;  3D0Y B;  2AUC A;  3DZT A;  1N2D A;  2FJY A;  2KI6 D;  4HRE E;  4DS7 A;  4QJ5 B;  2OS8 C;  2BBN A;  1MF8 B;  1SK6 D;  2LV7 A;  1C7V A;  5DKN A;  3BXK A;  1AUI B;  2M97 A;  1XYD A;  1F4O A;  3BUW B;  3NSI A;  1U5I A;  2L2E A;  4GUK A;  1XFV O;  3EK8 A;  1RFJ A;  1SR6 B;  4GGF A;  1IIO A;  1K93 D;  1DF0 A;  2L4H A;  1PAL A;  1YRT B;  1BU3 A;  2CCM A;  4OKH A;  2LMV A;  2QEH A;  3R1O A;  2ZN9 A;  1S6C A;  3BOW B;  1B8L A;  1J55 A;  2LCP A;  1V1G A;  2Y5I A;  4INW A;  4PT1 A;  1XFU O;  4FTG A;  4MZK A;  4GGN A;  1JF2 A;  4L9M A;  3CS1 A;  2H2K A;  1B9A A;  1RRO A;  2KI6 C;  5ER4 X;  1Z2C B;  3WXA A;  1UHK A;  4KYN A;  1LVC D;  1RK9 A;  2IS9 A;  4GBA A;  1A03 A;  1YVH A;  1YR5 A;  2LP2 A;  2GV5 A;  2K0J A;  3BUN B;  3CZ2 A;  4WRI A;  2CT9 A;  4YGD B;  3I5G B;  4ETO A;  2OTG B;  1T14 A;  2ZND A;  2RGI A;  1SL9 A;  4GAO A;  4NDC A;  1WDC B;  2JTT A;  1ZFS A;  2M7N A;  3BUM B;  3DD4 A;  2PAS A;  1C3Y A;  1CLM A;  1M46 A;  2F2O A;  4I5L B;  3DVM A;  3O2P A;  1KSO A;  1S36 A;  1AK8 A;  4YGE B;  1IWQ A;  2JPO A;  1DJI A;  2NLN A;  5AER A;  1BF5 A;  1CB1 A;  3NSO A;  2Q4U A;  3PFV A;  2HPS A;  3D75 A;  2LM5 A;  3GK4 X;  5HKZ A;  5PAL A;  4HRH A;  2QEB A;  2LLT A;  4XJK B;  3VGO A;  4YGA A;  1SYM A;  3LK1 A;  1WRZ A;  4PE1 A;  1OOJ A;  1U5I B;  1QV0 A;  2KSP A;  1EG4 A;  1N65 A;  1MUX A;  3DVE A;  2F33 A;  3I5F B;  3EKH A;  1IGV A;  1NSH A;  3FWC A;  1OW4 A;  1TNP A;  1S5G Y;  1OE9 B;  1NX2 A;  3SG6 A;  3I5H C;  2BCA A;  1DTL A;  1XK4 C;  1X02 A;  4ZCV A;  2I94 A;  1JBA A;  1QAT A;  4UPG A;  3NGV A;  4I5J A;  3WHT B;  2JOJ A;  4JWQ A;  2AAO A;  2FCE A;  3PN7 C;  3PSR A;  4ZCU A;  4MBE A;  1KWO C;  1J7P A;  1A29 A;  1NP8 A;  4M2O A;  3OBV A;  2WC6 A;  2WC5 A;  2YGU A;  1KFU S;  1XFR A;  2HQ8 A;  3OGN A;  1QXP A;  4YGB B;  4TNC A;  1BR1 B;  1J1E A;  1ZUZ A;  2WOR A;  5GQQ C;  3VRQ A;  4E68 A;  1TN4 A;  3VRO A;  1DEK A;  4ORA B;  1IRJ A;  1S1E A;  1JC2 A;  1IG5 A;  3IF7 A;  2PSR A;  1UHJ A;  1CDP A;  2NXQ A;  3K21 A;  2M0R A;  2BKI B;  2Q91 A;  4N1F A;  1K90 D;  1LA0 A;  5KU1 A;  1OMV A;  2KOT A;  2M1U A;  1XFY O;  4PE7 A;  1YUS A;  4PHN A;  1AJ4 A;  4PAL A;  3JTD B;  2FOT A;  1TUZ A;  1GM0 A;  1FPW A;  2F3Z A;  5D69 A;  1KQM B;  1KFU L;  1QLS A;  1DT7 B;  4QJ3 B;  3KPX A;  1Z4H A;  4M2Q A;  3TS5 C;  2HF5 A;  1B8R A;  3I5I C;  1DJW A;  1PUL A;  2LE9 B;  4JD9 A;  2F2P A;  4PHM A;  2NCO A;  4CLN A;  3SJS A;  2PVB A;  3EKJ A;  1FF1 A;  2JT8 A;  2JWW A;  4MLW A;  3EVU A;  1R2U A;  1S5G Z;  3I5F C;  5D3O A;  1CM4 A;  5I2Q A;  1BR4 B;  2I18 A;  3SIB A;  2A4J A;  1SL8 A;  1UUS A;  4R1E A; 
#chains in the Genus database with same CATH homology
 2L0P A;  2LAP A;  2M7L A;  3O78 A;  1LXF C;  2ZNE A;  2LMT A;  1PVA A;  1QJT A;  3DF0 B;  5I2O A;  3JVT C;  1MXL C;  3LLE A;  1CM1 A;  2LUC A;  1BOC A;  2JXL A;  1GGW A;  3RM1 A;  4DCK A;  1KFX S;  1Y1X A;  3ZNI A;  1TNQ A;  1RWY A;  1OSA A;  2BEC A;  1SCV A;  2PMY A;  4HSZ A;  3AKB A;  2WCB A;  1DJY A;  1NYA A;  2LHI A;  1EG3 A;  1J1D A;  2MLE C;  2Y1N A;  2MA2 A;  3OHM B;  4A4C A;  4CFQ A;  5JJG A;  4C0L A;  2ZN8 A;  1MXE A;  2K2A A;  4P5O E;  4DIR A;  1QVI Y;  2I7A A;  3AAK A;  5K89 A;  1H8B A;  3TDZ A;  1CFP A;  4PDZ A;  2MBX A;  2SCP A;  3SG4 A;  2LMU A;  3CZT X;  2JTZ A;  1EXR A;  4U8D A;  2LLU A;  4JPZ B;  4PHJ A;  1QX7 A;  3A8R A;  2WC8 A;  1DVI A;  3FWB A;  2WCE A;  1BG1 A;  1N0Y A;  4MSP A;  4C0J A;  1UP5 A;  2QAC A;  1NPQ A;  1SNL A;  1KFX L;  1KQM C;  2KYC A;  3HX4 A;  1Y1U A;  2KFF A;  1R6P A;  3WHU B;  2O5G A;  2KNE A;  2V53 A;  1D1O A;  2JUL A;  1DGV A;  3FIA A;  4XYN A;  3NXA A;  4M2P A;  1K96 A;  2ZRT A;  4NDB A;  2ZKM X;  1K8U A;  2G2B A;  1JF0 A;  4MRX A;  4P2Y B;  3BQ3 A;  1NCX A;  4ICB A;  1TTX A;  1SCM C;  2L98 A;  3KF9 A;  3AKA A;  1B8C A;  4WQ2 A;  2DOQ A;  3E3R A;  1UHH A;  4YI9 A;  5CSJ A;  1RJV A;  3CR4 X;  1S6J A;  1K9P A;  1F54 A;  3CWG A;  2JC2 A;  3EK4 A;  2KAY A;  2KHN A;  4BY5 A;  4PCW A;  1DF0 B;  3OP0 A;  4FQO A;  3RLZ A;  1C7W A;  3OX6 A;  2JZI A;  1WRL A;  2M3W A;  2LHL A;  3GK2 A;  1MHO A;  1K94 A;  1E8A A;  3LK0 A;  1A75 A;  2NCP A;  5AEQ A;  2HET A;  2BL0 B;  3TUY B;  1EL4 A;  4C0K A;  1PVB A;  1WLM A;  1DMO A;  1JFJ A;  2KYF A;  1DGU A;  4PHK A;  4MRY A;  3VRR A;  5I2L A;  1SR6 C;  1XFW O;  2LP3 A;  4MVF A;  1DJZ A;  1QVI Z;  4N1G A;  3PM8 A;  4MN0 A;  3TDU A;  2BBM A;  5JOL A;  1LIN A;  4AOM A;  4AQJ A;  4OV2 A;  2WND A;  3EVR A;  3GOF A;  5TNC A;  1XFZ O;  3LCP C;  5IBW A;  1L2O B;  1XFX O;  1HQV A;  2M49 B;  2B1U A;  1AJ5 A;  4NQG A;  1G33 A;  3IQQ A;  2BCB A;  1KK8 B;  2KQ6 A;  3I5G C;  4USL A;  5D7F A;  1CLB A;  2OTG C;  4MEW A;  1OZS A;  2NZ0 A;  4WQ3 A;  1W7J B;  2BE4 A;  1NX0 A;  2CNP A;  1WDC C;  1JUO A;  1CTR A;  2JNF A;  1S3P A;  1BLQ A;  1W7I B;  4GPL B;  1CMF A;  3VRN A;  1DJH A;  1UUR A;  2LVV A;  3TDI A;  1S26 D;  3WNX B;  1IJ6 A;  3O6B A;  1GJY A;  5KTY A;  1YX7 A;  3KO0 A;  4JQ0 D;  1HT9 A;  1Y0V H;  2K7B A;  3F45 A;  2OPO A;  1F55 A;  2COL B;  3D0Y A;  2MHH A;  1PSR A;  1QLK A;  5AFP A;  3OB2 B;  4PE0 A;  1XK4 A;  1UHN A;  5CSI A;  4GGF C;  4A4B A;  1BOD A;  1OQP A;  1DJG A;  1Y1A A;  2L4I A;  3OX5 A;  1F8H A;  1YUR A;  1ZMZ A;  3GK1 A;  1CFC A;  4BY4 A;  1F70 A;  1WY9 A;  1EJ3 A;  1IQ3 A;  2R2I A;  1C07 A;  1ZOT B;  3TUY C;  2K8M B;  3BOW A;  3PAT A;  4CFR A;  2JU0 A;  1YVL A;  4MZL A;  2LUX A;  5AXI A;  1VRK A;  3QRX A;  4N5X A;  1AVS A;  3SG7 A;  1FI5 A;  5F6T A;  2KFH A;  1NIW A;  2I2R E;  4GFT A;  1PSB A;  2KGB C;  1TCO B;  2L50 A;  2LAN A;  3KEV A;  1Q80 A;  2QPT A;  3A4U B;  4HRG A;  5HLO A;  1CLL A;  4YBH B;  1CKK A;  1QS7 A;  2D8N A;  1L2O C;  4MZJ A;  1NUB A;  4F0Z B;  2ZRS A;  3NSK A;  2JT3 A;  2BCX A;  2MAZ A;  1QIV A;  2M9G A;  3LL8 B;  2SAS A;  1MQ1 A;  1TRF A;  2Y4Q A;  1XO5 A;  3CLN A;  3BUO B;  1J7R A;  1DJX A;  2LLS A;  3OB1 B;  3MSE B;  1YRU B;  2KI4 B;  5DKR A;  1S6I A;  2L5X B;  3I5H B;  5FYX A;  5HKY A;  4PE4 A;  2K2F A;  2P6B B;  3JTD C;  3SIA A;  2CXJ A;  1B7T Y;  2JXC A;  4XJK A;  2HQW A;  2PRU A;  4I5K A;  4YI8 A;  2LNK A;  3PN7 B;  4ORC B;  1CFD A;  1J7Q A;  2BE6 A;  1KWO B;  2E6W A;  2F3Y A;  1L7Z A;  1F71 A;  1ODB A;  2FCD A;  1QX5 B;  1B47 A;  3DVK A;  4AQI A;  3PAL A;  2JT0 A;  1B1G A;  4QJ4 B;  1K95 A;  1QV1 A;  3HCM A;  1JWD A;  1GQM A;  2M8U A;  5I8N A;  1YX8 A;  4I5N B;  1CDL A;  3VRP A;  1LKJ A;  1YTZ C;  3CR5 X;  1CMG A;  3DVJ A;  1ALW A;  4DUQ A;  1NCZ A;  3C1V A;  2EGD A;  1TNX A;  2KGR A;  4GNK B;  1YUU A;  1PK0 D;  2O60 A;  1Y6W A;  2LVJ A;  3O4Y A;  3TZ1 A;  1SPY A;  3EVV A;  4OR9 B;  2PAL A;  1IJ5 A;  1SKT A;  1AP4 A;  1A2X A;  2MLF C;  2KAX A;  3FS7 A;  5CSF A;  1F4Q A;  1PRW A;  2H61 C;  1SL7 A;  2ISD A;  1CDN A;  1JSA A;  3BUX B;  2WOS A;  3TS5 B;  1OMR A;  2CTN A;  3I5I B;  3D10 A;  1M45 A;  5HKW A;  1FW4 A;  2JRF A;  4IL1 A;  3CGA A;  1UWO A;  1M39 A;  2F8P A;  1KK7 Y;  1QAS A;  5G08 A;  5HYD A;  1SBJ A;  1CFF A;  1KCY A;  1REC A;  2G9B A;  2KFG A;  5HLV A;  1NWD A;  1NX3 A;  4D1E A;  1QIW A;  2EC6 B;  1FI6 A;  1TOP A;  5BPJ A;  2KI4 C;  1TCF A;  1B7T Z;  1LA3 A;  3ZWH A;  1B4C A;  1WRK A;  1CNP A;  2MRD A;  3JVT B;  1IQ5 A;  3SG5 A;  3AAJ A;  1AHR A;  2JNX A;  2E30 A;  1V1F A;  2L51 A;  4YGC B;  2OS8 B;  5DKQ A;  2MJW B;  1K9K A;  3M0W A;  1QX2 A;  1TNW A;  1EH2 A;  1JFK A;  2CBL A;  4OVN F;  1G4Y R;  3DF0 A;  5ER5 A;  1A75 B;  1GGZ A;  1G8I A;  1H4B A;  3BYA A;  1KQV A;  1SMG A;  2ZFD A;  1NCY A;  1UHI A;  1OZO A;  5CSN A;  1K2H A;  1NX1 A;  1IKU A;  1TIZ A;  1A4P A;  2KQY A;  1QTX A;  2KBI A;  2VRG A;  2H61 A;  1BJF A;  2BKH B;  2FJU B;  2EHB A;  2KBM A;  2K7C A;  2K61 A;  3PLF B;  2Y1M A;  2KAV A;  2LVK A;  1SY9 A;  1XA5 A;  2TN4 A;  2JQ6 A;  3IQO A;  2M1K B;  2GGZ A;  1ZAC A;  2BL0 C;  3SG3 A;  1M63 B;  4DRW A;  1KK7 Z;  1BT6 A;  1WLZ A;  4YRU A;  3EK7 A;  3H4S E;  1K9U A;  1KSM A;  2AMI A;  1YUT A;  1SRA A;  1XVJ A;  3SG2 A;  2LC5 A;  2M29 A;  4NDD A;  3CR2 A;  1IH0 A;  2WCF A;  4CPV A;  1J7O A;  5AAN A;  5B8I B;  1M31 A;  1SCM B;  1RTP 1;  2K7O A;  1FBV A;  5KSZ A;  2EC6 C;  4Q04 A;  3NSL A;  4ORB B;  4OCI A;  1OMD A;  3ICB A;  2JPT A;  2LVI A;  1MWN A;  4CID A;  1BMO A;  1ALV A;  1MR8 A;  2K7D A;  1SW8 A;  2KDH A;  5CPV A;  5J3X A;  1CDM A;  3CTN A;  3KHE A;  1KK8 C;  2GGM A;  3D0Y B;  2AUC A;  1N2D A;  2KI6 D;  4HRE E;  4DS7 A;  4QJ5 B;  2OS8 C;  2BBN A;  1MF8 B;  1SK6 D;  2LV7 A;  1C7V A;  5DKN A;  3BXK A;  1AUI B;  2M97 A;  1XYD A;  1F4O A;  3BUW B;  3NSI A;  1U5I A;  2L2E A;  4GUK A;  1XFV O;  3EK8 A;  1RFJ A;  1SR6 B;  4GGF A;  1K93 D;  1DF0 A;  2L4H A;  1PAL A;  1YRT B;  1BU3 A;  2CCM A;  4OKH A;  2LMV A;  2ZN9 A;  1S6C A;  3BOW B;  1B8L A;  1J55 A;  2LCP A;  1V1G A;  2Y5I A;  1XFU O;  4FTG A;  4MZK A;  4GGN A;  1JF2 A;  4L9M A;  3CS1 A;  2H2K A;  1B9A A;  1RRO A;  2KI6 C;  5ER4 X;  3WXA A;  1UHK A;  1LVC D;  1RK9 A;  2IS9 A;  4GBA A;  1A03 A;  1YVH A;  1YR5 A;  2LP2 A;  2GV5 A;  2K0J A;  3BUN B;  4WRI A;  2CT9 A;  4YGD B;  3I5G B;  4ETO A;  2OTG B;  2ZND A;  2RGI A;  1SL9 A;  4GAO A;  4NDC A;  1WDC B;  2JTT A;  1ZFS A;  2M7N A;  3BUM B;  3DD4 A;  2PAS A;  1CLM A;  1M46 A;  2F2O A;  4I5L B;  3DVM A;  3O2P A;  1KSO A;  1S36 A;  1AK8 A;  4YGE B;  1IWQ A;  2NLN A;  1DJI A;  5AER A;  1BF5 A;  1CB1 A;  3NSO A;  2Q4U A;  3PFV A;  2HPS A;  2LM5 A;  3GK4 X;  5HKZ A;  5PAL A;  4HRH A;  2LLT A;  4XJK B;  3VGO A;  4YGA A;  1SYM A;  3LK1 A;  1WRZ A;  4PE1 A;  1OOJ A;  1U5I B;  1QV0 A;  2KSP A;  1EG4 A;  1N65 A;  1MUX A;  3DVE A;  2F33 A;  3I5F B;  3EKH A;  1IGV A;  1NSH A;  3FWC A;  1TNP A;  1S5G Y;  1OE9 B;  1NX2 A;  3SG6 A;  3I5H C;  2BCA A;  1DTL A;  1XK4 C;  1X02 A;  4ZCV A;  2I94 A;  1JBA A;  1QAT A;  4UPG A;  4I5J A;  3WHT B;  2JOJ A;  4JWQ A;  2AAO A;  2FCE A;  3PN7 C;  3PSR A;  4ZCU A;  4MBE A;  1KWO C;  1J7P A;  1A29 A;  1NP8 A;  4M2O A;  1KFU S;  2HQ8 A;  1QXP A;  4YGB B;  4TNC A;  1BR1 B;  1J1E A;  1ZUZ A;  2WOR A;  5GQQ C;  3VRQ A;  4E68 A;  1TN4 A;  3VRO A;  4ORA B;  1IRJ A;  1S1E A;  1JC2 A;  1IG5 A;  3IF7 A;  2PSR A;  1UHJ A;  1CDP A;  2NXQ A;  3K21 A;  2M0R A;  2BKI B;  2Q91 A;  4N1F A;  1K90 D;  1LA0 A;  5KU1 A;  1OMV A;  2KOT A;  2M1U A;  1XFY O;  4PE7 A;  1YUS A;  4PHN A;  1AJ4 A;  4PAL A;  3JTD B;  2FOT A;  1FPW A;  2F3Z A;  5D69 A;  1KQM B;  1KFU L;  1QLS A;  1DT7 B;  4QJ3 B;  3KPX A;  4M2Q A;  3TS5 C;  2HF5 A;  1B8R A;  3I5I C;  1DJW A;  1PUL A;  2LE9 B;  2F2P A;  4PHM A;  2NCO A;  4CLN A;  3SJS A;  2PVB A;  3EKJ A;  1FF1 A;  2JT8 A;  2JWW A;  4MLW A;  3EVU A;  1R2U A;  1S5G Z;  3I5F C;  5I2Q A;  1CM4 A;  1BR4 B;  2I18 A;  3SIB A;  2A4J A;  1SL8 A;  1UUS A;  4R1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...