4C0JA

Crystal structure of drosophila miro ef hand and cgtpase domains in the apo state (apo-miros)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
404
structure length
404
Chain Sequence
b'ELTSACKKSLVRIFKICDIDGDNLLNDYELNLFQRRCFNTPLQPQILDEVKAVIQKNVPDGIYNDAVTLKGFLFLHCLFIQRGRNETTWAVLRRFGYNDQLEMCQEYLRPPLKIPPGSSTELSHRGQQFLIAVFERYDRDGDGALSPEEHKMLFSTCPAAPWSYSTDIRKSCPINETTGWVTLHGWLCRWTLMTLIDVVKTMEYLAYLGFNVHENDSQLAAIHVTRERRIDLAKRQSSRSVYKCHVIGPKGSGKTGMCRGFLVEDMHKLIGKEFKTNVVNCINSVQVYGQEKHLILRDIDVRHALDPLQPQEVNCDVACLVYDSSNPRSFEYVARIYIKYYAESKIPVMIVGTKCDMDERRQDYLMQPSEFCDKYKLLPPHLFSLKTNKKELYTKLATMAAFPH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL RHO GTPASE
publication title Structural Coupling of the EF Hand and C-Terminal Gtpase Domains in the Mitochondrial Protein Miro.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase
total genus 116
structure length 404
sequence length 404
ec nomenclature ec 3.6.5.-:
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
A PF08355 EF_assoc_1 EF hand associated
A PF08356 EF_assoc_2 EF hand associated
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0jA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0jA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4c0jA03
6Q21A 4LCBA 1VECA 4A2PA 2M3WA 3RSOA 3O8DA 4LHWA 1CKEA 3IO5A 3KKMA 1XXHE 2M1UA 1Z8FA 5TB5A 3KXKA 1N6RA 1KSFX 1NBME 1XEWX 1ZNXA 2YYZA 4LOAA 2MLFC 2IEZA 2LLUA 1Z0KA 2B21A 4ZCUA 4A2QA 3ASYA 4A4BA 3ADCA 1ZD8A 4WXPA 3H4MA 1JFKA 2KBIA 1WDTA 1FW6A 3NSOA 1D1OA 4TTQA 1QG4A 2BJVA 4HLCA 3SG3A 1XRJA 3A8RA 2C98A 3W3AA 4HSEA 3I5YA 1XF9A 4UNSA 5G3YA 2BCBA 3QOFA 1YRTB 2ZNEA 2LE9B 1P75A 4Z1MA 3RSLA 3SU8A 1D2NA 3OB1B 4D0LB 1QLKA 2PH1A 1CNPA 2ZI7A 1KO8A 3CX7A 5CDFE 3P1JA 5TMPA 2HYIC 3AVYA 2B8TA 3BB4A 5C2JB 1DAEA 4PQRA 1TQ6A 3DF0A 1JEDA 3Q8XB 3IHWA 4MRNA 1Z22A 3EZFA 3V00A 5B30A 5KNCA 4BPBA 1NLZA 3PN7C 1U90A 3D3QA 2WMNB 5IRCD 4NYMQ 4BWYA 5EUMA 3KX2A 3QNUA 1SL7A 2AXNA 1PLJA 4AYTA 1GQMA 2KI4C 2JLWA 3C5CA 1KQMC 1KO4A 2KWIA 3K1JA 5DGXA 1CXZA 3TE6A 1SKYE 3QJYA 1CIPA 1Z08A 2ZRFA 4MGKR 1S5GZ 2JIZD 4AG6A 3EPLA 5F3WB 3U7FB 2BMJA 2A5YB 5JECA 3CR4X 4V0NA 1YUTA 4QHYA 5FPHA 3RRZA 4G3XA 5IK2D 3ND8A 3LBNA 1SXJC 1VPLA 2C77A 1X6VA 2AD1A 1Z0IA 1ZMXA 3X1DA 1RJVA 2KQYA 1AA9A 1WRKA 1QZXA 4FXPA 5FOWA 3I32A 5FR1A 1G6HA 2JC2A 1PRWA 2K2FA 4XVRA 2GDJA 4AYWA 2C9CA 4FTGA 2IYXA 4QHSA 1N6OA 5H68A 3CPHA 4M9XA 2L0XA 2CTNA 5EP1A 1CR1A 4QGFA 1C07A 2FSGA 3QY0A 1IJ5A 3TKLA 5C1BA 3RS4A 4DRWA 4IOMA 2F6RA 4LYFA 3SC3A 3IIJA 1ZJ6A 3QXHA 4TL8A 1XFXO 1AGPA 2BEKA 1BH2A 2J0QA 1SCMC 1M63B 2GZAA 2J9RA 2ZUDA 2G9NA 3U6KA 5F2EA 2MA2A 3LK0A 3KKNA 2CJWA 2EU8A 1SVMA 3FWYA 1CJTC 2GGZA 1GGWA 4QKQA 3GLIA 2XXAB 3M0EA 1FX0B 2CDNA 1DJYA 3AUYA 1NX0A 2AHOA 2JJ2D 1VIYA 3VU9B 4G01B 3NXAA 4CEJB 4CEIB 2Z43A 3EC2A 4MYHA 1BT6A 4XJKA 1C9KA 3R7WA 2IYTA 4QHTA 2PL3A 3UATA 5EJEA 2FDCA 4DSNA 2KSQA 1E2JA 1J8YF 2RHMA 4LX0A 4GZLA 4F91B 1N5IA 3H84A 3W3ZB 1P60A 3CX8A 1Y1AA 4PHTA 2GXSA 5EXXA 2BC9A 2REBA 3KFVA 5A0FA 2C99A 2W6JD 3MUFA 3U3MA 2ZANA 1G41A 1A29A 4P31A 3ZYCA 1Q44A 4YGDB 1G5TA 2V53A 2IYSA 1H8EA 2QTHA 3E2IA 5KSPA 5HR5A 1T8TA 1CR0A 3MJHA 1E0AA 2ORIA 3DVEA 3SIAA 1BYUA 1GRQA 2OBNA 4GFTA 3DVMA 4PE7A 2EYQA 3DHWC 1ZVQA 1Q0UA 4GSYA 1D9ZA 2QT1A 3CR8A 3SHFA 1KI1A 2CHVA 5JHHB 2BE4A 1QVRA 2DWOA 1WDCB 1J7PA 3QE0A 4QBHA 1YVHA 3GJ3A 2M97A 4I4LA 2J1LA 5J4HA 5L3QA 3D31A 4ETOA 4EUNA 2ODEA 2XNDD 3U7EB 1WDCC 5JCPA 1XFUO 5FPKA 2VIIA 2AK2A 1G3IA 1JPNA 4DIRA 1H8HA 3UXMA 3AGPA 4DUQA 4M2OA 1VIAA 4X8LA 2JLUA 3KB2A 3BD9A 2GCPA 2LCFA 2QP9X 5IDVA 4NYIR 2AFHE 2GZHA 1VG8A 4US0R 4PANA 1GRRA 4QJ3A 3U60B 1CEEA 1JAHA 1GG2A 2WKPA 1NMYA 3GLFE 3QG5A 4N5XA 2PASA 1Q1QA 1BJFA 2ZR9A 2J7KA 1S5GY 3NG1A 1PLKA 1CLBA 4EPVA 3WMGA 1EFRD 2ANBA 4XD7A 4FCTA 1W7JB 1II0A 4H1UA 4V0KA 2ZYUX 2KYFA 2W2XA 1GNPA 1QHHA 4N3NA 2EGDA 4RKEA 3DZDA 2IW3A 3FOZA 1CBUA 1TNXA 2P6NA 2VYFA 3KKPA 1QX2A 3QXXA 2CMKA 2ZJZA 5DH9A 5JBQA 2BKEA 3MD0A 1W0KA 4QJ4B 4I1UA 3VQTA 1U8YA 3K9NA 3KJIA 1E2IA 1TEVA 2CLSA 2MMCA 3OZXA 2R2AA 4TMXA 2G1KA 2KHNA 3RS3A 2NO6A 2YHSA 1Z28A 1L7VC 2H92A 2GF0A 3CW2A 1A1VA 3B8HA 1TQ4A 4M2LA 4JBWA 3BFKA 2ZI6A 3BUWB 4D2IA 3SJBA 2J7PA 5EXTA 3KQHA 5I8NA 2PJRA 1UEJA 2ZYTX 2L51A 1COWD 8OHMA 4MRYA 4LYAA 2C78A 3NH9A 4TLCA 3PUVA 1ZMZA 2IX3A 1NSFA 4PHJA 4TZ6A 5TNCA 3SG4A 2QPAA 2VP9A 2VP4A 3W6PA 3AKBA 3C8UA 1NNEA 4HRHA 1OH6A 2BEJA 1RPZA 1K5DA 2ZAOA 3ECCA 1OLOA 1Z47A 5C46F 2ZREA 4BZQA 2FV8A 2HV8A 5IF9A 2CCKA 1JXMA 2MJWB 4B71A 2QBYA 2W00A 4LZZA 3DOEA 3AM1A 3B2EA 2OXRA 1KYIA 1Z06A 4FMDB 4ZPXA 3RDPA 2H7VA 2OV2A 1OKKD 4V0ME 1UBCA 2Q9AA 4N1GA 2PSRA 1KZGB 2WOOA 3TW4A 3QF4A 1E6CA 4OR9B 3ZZTA 4LJ8A 5DNYB 2E87A 2ZTSA 4CEHB 1YQTA 1YR9A 5E7MA 3O8RA 3DMDA 2DYKA 1MXEA 1YR6A 1YVDA 2ODNA 1Q1ZA 1KFXS 1VYTA 1B4CA 2ZRNA 1CLMA 5GJCA 3TDUA 3DL0A 2JXLA 2JNXA 4YXWD 4OQLA 5FL7A 1HURA 1OV4A 2VHJA 3A58B 4KYUA 2CE2X 5FPTA 3TSZA 1DGVA 4AURA 4ESHA 4QXAA 3RS7A 2WCBA 1S36A 4W9MC 3KL4A 4QJ5B 3W5JA 5IBWA 1KCYA 1L2OC 3B7GA 3KQNA 2Y1MA 1OQPA 2D2EA 2ZPTX 4Z51A 1RVDA 4Q18A 1XMVA 4HAWA 1NCZA 1KK7Y 3FB4A 4KFSA 5E3HA 1IY1A 1KO7A 2WWYA 4HB2A 2WHXA 3CH4B 3E1SA 1X8KA 4CDGA 4DDTA 4NBSA 1T9HA 3O47A 4Q7JB 2C9YA 5L3SA 1OH5A 5JHGB 1AN0A 2CXXA 3L0SA 2QMEA 1OXSC 2A7QA 1DG1G 4FMDF 2BKIB 3VNUA 5SZKB 3RLZA 1FTSA 4Q1FA 2NIPA 2WJJA 4TL6A 3U5ZB 3CM0A 2MBXA 3SYKA 1ZOTB 1FZQA 1GNRA 1D6JA 2IXGA 4F7WA 1FQKA 4QGHA 3RRMA 1N6NA 4JLKA 1SR6B 4WA7A 2WWIA 4A36A 1EX6A 1LF5A 3GK2A 2ZJAA 4GI7A 3BS4A 3VR5A 4OI1A 3WYFA 2HLDA 1KFXL 3M6AA 3R20A 4JVNA 2LM5A 2R9VA 2PMYA 2O8CA 1E96A 1OSNA 2GEUA 2GETA 2Z6VA 4GBAA 1DJGA 1Z0DA 2F9LA 1K94A 2L50A 5EZ5A 4A0HA 5CM9C 4Z54A 1AS2A 3VGOA 4IKEA 4NDBA 1YVLA 3GLGB 1QDEA 4PHHA 1E98A 4F38A 2CL0X 4JKYA 4YQFA 5FOXA 4PE1A 5K89A 2PMDA 1VCMA 2Y5IA 1Z29A 3BC1A 2GEDA 2FG5A 2F8PA 4YGAA 1VYUA 1WCV1 1T8UA 3L2OB 4Q4HB 2Y4QA 3UKDA 4HSZA 4FQOA 4ORBB 2WIBA 4EJSB 4PAQA 1JFJA 1UKZA 2KSPA 3BAFA 4PHFA 2H1LA 2QE7D 1NPQA 2HYDA 2ECKA 4KXFB 4NPHA 4H9GA 4JZKA 3VHXA 1TF5A 4FWIB 3WHKA 2FFBA 2FX3A 4P2YB 5LDDC 4DCSA 1EL4A 1W4AA 5EP2A 2NPFA 1KSMA 1VRKA 3DO6A 3PVSA 3QKUA 5D3QA 1EK0A 2ZYVX 3A4UB 4UXIA 5K8LA 5FUYA 1SVSA 2QP3A 3SS8A 2H61C 2ZVQX 3O78A 3D6TB 5GJWC 3TMKA 1K6MA 2O5VA 1CJKC 2H5EA 2VO1A 3AVWA 2XJ9A 3BFVA 4Q1CA 2MAZA 2NOAA 4BLOA 2IYZA 3NIBA 1NVUQ 4HUTA 5FYXA 3EIEA 4N1FA 2D62A 4YGBB 4LY6A 4QBFA 5G41A 1K8RA 3RC3A 1G16A 2DFNA 5BXQC 5KPJA 3LLUA 3EZ9A 4NDZA 5EP4A 1YRAA 1FUKA 4M1SA 3CRQA 5SZJA 4WAUA 1NX3A 1LF0A 4DDUA 1BMOA 4DS7A 1ALWA 3CRMA 1TCFA 1CR2A 3TW8B 4B33A 1CLLA 3B85A 3P26A 4MKFA 2ODBA 2X8AA 1QG2A 4PO9A 3BIFA 3UG7A 4DWJA 1E2EA 1JR3D 2QZ4A 5AJVB 3I5GB 3ZVLA 3CNOA 1XXHB 2VHTA 3AAJA 2ZJBA 4IJMA 4Q9IA 1LVCD 3CNNA 2CEAA 1FMLA 3SE0A 2EFEB 3ZDQA 3U4QB 4G1UC 3WBKA 2J0VA 1C4OA 4R2HA 2V55B 3KTAA 4PPNA 2B8WA 4C0SA 3DPUA 2FNAA 1OE9B 3WY9A 4CFQA 4KI0A 4W7SA 3BGWA 3T5GA 2DFKB 3TVDA 3AKYA 3W6NA 2CT9A 1KAGA 3FGNA 4OI2A 4CFRA 4MYTA 2G3YA 3PFVA 2YC2C 4AKIA 4TSFD 3TUYB 1KI8A 2GXUA 4L9WA 5AEQA 3AF1A 2IF0A 3J81k 1ZUHA 1DOAA 2X2FA 4B75A 4DEXA 1R8SA 2FJUA 4USLA 3NWJA 4DVGA 2LP3A 3WP1B 2NG1A 5EE1A 1W36C 4PHMA 1NBMD 1P2TA 3B9PA 1TNDA 3JZMA 4PC1A 4EDHA 2GBLA 3I92A 4F4IA 3ZIAD 1Q21A 1HQYE 2KBEA 2B92A 1ZM9A 4U02A 2J45A 4A0FA 3N2EA 1GKUB 2NO1A 4B44A 4J0QA 1CM4A 2LVJA 3T1TA 2LWIA 3DZ8A 4TT3D 4B6FA 1IY2A 1DJZA 2EW1A 2ZI5A 3GLHE 2COLB 5JWOA 2OHFA 4PFSA 2L4IA 3TSOA 3EARA 4KFUA 1SY9A 1DGUA 1B8LA 4TTRA 5EP3A 2VQSA 2DB3A 3LO5A 1CFDA 4DCTA 2AKYA 3OIVA 4A9AA 2K8MB 4PO1A 2OE2A 2OCYC 1ZM3A 1DG3A 4OHWA 2GAOA 5J3XA 1KI6B 2PALA 2PT5A 3B78A 3THOA 1GILA 3EWAA 1UHNA 3I5HB 1KK3A 4Q4JA 3U6BA 4PPGA 2GXAA 1SGWA 2WJYA 1RYHA 5EE5B 4PHGA 1BIFA 5D3MA 5CSIA 3CRW1 2R6DA 2KAVA 4CYMA 3AP2A 1I2MA 3PXGA 2QU8A 1K90D 2Q9BA 2G1JA 4Q19A 4RFSA 2EHBA 1JQJC 1K8UA 3NH6A 4NZYA 2CCJA 4YLGA 2G2BA 1VHLA 2QAGA 3EKHA 3KEVA 2HCJB 1F2UB 2ZEJA 4OK6A 4M9QA 4EFLA 2ZUBA 3K21A 2PLRA 1PLLA 4IEEA 2DFTA 3JTDC 2QMOA 5EXPA 2JLYA 1TNWA 4TZ0A 1CRQA 2KGRA 1G8FA 4WRIA 3SG5A 2JJ8A 1KKLA 3ETLA 3W8NA 3WMEA 5DLQC 3LWNA 1E1RD 1NN3A 1Z63A 5KYKA 1ZU5A 3ND9A 5HZHA 5KSOA 2BMDA 3LDAA 3EVUA 3PALA 1R10A 1R4AA 4K46A 4GAOA 2WWXA 3PENA 1XU4A 1S1CA 2W58A 4MYUA 3WHTB 2CE7A 1NYAA 3A4MA 1NN0A 1E2FA 2GRJA 1D2MA 1HV8A 2BBMA 3EC1A 3QBTA 4LDJA 3VR1A 1U8AA 2WTUA 1IWQA 2CCMA 2NCPA 3BOWB 2DOQA 1QIVA 1XK4C 1CMGA 1BS1A 1E1QD 1S3GA 2VSXA 4MQBA 3T34A 4Q03A 4AC9A 2BV3A 1MUXA 1A2BA 4G5QA 2P67A 1Z0FA 4Q4AB 3DM5A 5JZVA 1XFYO 2DWPA 2ZRAA 1S3PA 4C7OA 3C15C 3EZ7A 5IK2A 2OILA 5AUOB 1E3MA 1J7OA 1KMQA 1UF9A 1VG0B 2BCJQ 3KUCA 3SYLA 3T15A 3Q7QA 4MDFA 1N2CE 3N70A 4QRHA 2L5XB 5AERA 3TQCA 2FSIA 4Z8YA 3V4FA 4NP6A 3BUOB 1AGRA 1WRZA 1XTQA 5CK4A 3B82A 1XMSA 2ZU6A 2CNWA 4F93B 4TLBA 2ORVA 4PDZA 3K9HA 5JI2E 1E9EA 2DWQA 1Q22A 1KNQA 1P73A 5D69A 4BECA 3X1WA 1G4YR 1IKUA 3BJIC 5E7JA 3RLFA 1RFLA 5JS8A 1DAKA 5EQTA 1SXJA 1UURA 3LD9A 2NXQA 1X1SA 3GJXC 2JCSA 4WQ3A 5SZIA 1OIXA 2JT3A 4YGEB 1HEIA 1P4SA 1G7CA 2Q0HA 3LXRA 4PPFA 4QOSA 4A92A 1KWOB 3K9LA 2JJ1D 4Q1EA 2RAPA 3L8YA 1Z83A 4XWOA 3WXAA 4AOMA 1JF0A 5CYOA 1W46A 3K0CC 4D4JA 1A03A 3BK7A 3IPYA 4AYXA 4DLRA 4JSTA 3CUEF 3OEHD 3PR1A 1E4YA 5JS7A 5BQ5A 1QX7A 1SVWA 3B1WA 1OH7A 4DB2A 1YUSA 3A1UA 4KU4A 1TF7A 2CHGA 5FBWB 1F55A 3B1ZA 3DEFA 4DLSA 2Q91A 3NTUA 2ZQ5A 2O0HA 4D0NA 3QI2A 1E9BA 1ZW6A 2XTNA 2PX0A 3GPLA 2W6JA 1LXFC 1EFCA 2QTFA 3W8RA 1ZCAA 4EQ6A 4Y0AA 1OIVA 2ZRHA 4L5BA 3QQ5A 4LJ6A 2HEIA 3NXSA 3GLIE 2LANA 2V6JA 4HDCA 3S1AA 4YMSA 1L7ZA 4IXMA 1FOEB 3H0KA 5G08A 1FX0A 2WJVA 1W48A 4D4MA 4GRAA 3VU9A 1XMIA 2OTGB 3EVVA 1TNQA 2E1RA 1FQJA 1PV4A 4CEJA 1CTRA 5D7FA 4BFVA 1T5IA 2CBZA 1VKJA 3PUZA 4BY5A 1S1MA 3L82B 1W0JD 3VAAA 1ZRHA 4AKHA 4BRUA 4DC9A 5LPNA 1MRNA 3GCGA 1SULA 2XNDA 2GBLC 2OZEA 4QGGA 1MH1A 2M7LA 2FE4A 5FPYA 3K0SA 1KJZA 3QKRB 1RE0A 1MO6A 4E03A 1GKYA 2GF9A 2QRZA 1OFUX 2BKUA 2VHCA 4GPTA 2NCOA 1M8PA 2VHQA 5CIWA 3L0OA 1W49A 3FFAA 4CRWB 4P4UA 1DJHA 2QROA 2KAXA 1OPXA 5HCIA 4DT1B 1F6BA 2GILA 2KQ6A 4LJYA 3WBJA 2ZRCA 1N6PA 3OIUA 4HZUB 1QHIA 3RC8A 4YRUA 4HRGA 1E79D 3U3RA 1XD2B 2DFLA 2V3CC 3CRRA 4JVLA 1OB5A 1RIFA 2J87A 3ZWHA 4BLPA 4HYYA 3IKJA 2ZJ2A 5E95A 3TAHA 4C0JA 2J59A 1CR4A 3QEOA 3RABA 1W5SA 4CLNA 2Q3MA 1QASA 1OJLA 4DHEA 3QF7A 2JWWA 3KFXA 2P6BB 1AZSC 2GVZC 2ZM5A 2ZRGA 2AXPA 2QGZA 4B32A 4RZ2A 2ZI9A 3T12A 2FU5C 1EG7A 5DI9A 4Q00A 1AJEA 2G9BA 2YINC 2MMGA 4KJZA 4PZZA 1J2JA 3QSYA 2G0TA 3Q72A 2AFIE 4A6XA 2QAGC 1UAAA 3IPXA 2ZE8A 2SHKA 2D7DA 2MRDA 1MWNA 3QKTA 1M39A 5HKZA 1G3MA 1GIAA 2PEZA 4DCKA 1WB9A 2OAP1 1R7RA 3N5CA 1U0JA 3ZQ6A 1TUIA 1VMAA 4LSGA 4MZJA 2IYRA 3DKVA 3BB3A 1NKTA 2QI9C 2M29A 3D7MA 4BLTA 1UJ2A 1OMVA 1N6IA 1UP5A 4HUQB 4LC0A 3W90A 3SI7A 1EWQA 4A15A 2RB4A 2FA9A 1XNJA 1S9DA 3MCAA 1E9DA 3R8CA 3T35A 1MOZA 4DIDA 1Y6WA 1L8QA 2ZJYA 5FH9A 2RGBA 2V7QA 5SZHB 1GL7A 4TL9A 2WC8A 2H17A 2ZKMX 1D2EA 2ZU0C 1K2HA 1JB1A 3OHMA 4EFNA 3VR2A 2RGIA 3PEYA 3NHAA 1E9CA 4QJ4A 3V9PA 3IF7A 3ZNIA 3LQQA 1RK9A 2ZROA 3NSLA 4URZR 4BFTA 1U98A 1EG3A 1XBTA 1WLZA 4DKXA 2P0EA 4JLMA 1AS3A 3EX7C 1KSHA 1KIMA 3CIOA 2Z83A 1VCOA 1CDMA 1IY0A 1OMRA 1F60A 5FI1B 5AFPA 2IS6A 1KKMA 3ZD6A 1RJ9A 1ZUNB 5JJGA 2XSZA 1XO5A 2FSHA 1DTSA 2TMKA 3PEUA 1G3RA 2KYCA 5DN6D 3IQOA 5HKKD 4I81A 1G3QA 1X8JA 5J40A 2ONKA 3I62A 1XDBA 5ANRB 2JLZA 2F1RA 1J7KA 3FFBA 1DAGA 1ZM4A 3VTKA 1GJYA 1M34E 2WWGA 3K0AA 1RROA 1XEWY 3B9QA 1KK8B 2QTVB 2VTKA 3OFND 2X2EA 1PSRA 1S6JA 2HF5A 1WA5A 5EUQB 3BE4A 1TU3A 4LWZA 1KK8C 5CIQA 1U94A 3THWA 5KNBA 3NSKA 3LQRA 3IIKA 2NQ2C 1ZC3A 5B2ZA 4Q7MB 1XFZO 3SBEA 2KFGA 1S2MA 4WOPA 3SN6A 4YMUA 1G3UA 2GVDC 2Y1NA 1N0YA 4G5RA 4TYPA 5AK0A 3E3RA 2OFOA 5F9HA 4PCWA 1EXMA 4A0RA 2HT1A 3QPWA 4AQJA 1L4UA 4ICBA 1HTWA 4L4UA 3ICEA 3KDSE 2ZR0A 1GSIA 4IDOA 2ZJOA 1J70A 3D0YB 1Z2AA 4GPLB 1NVVQ 1NIWA 1IHUA 3UPUA 3RS0A 1FUUA 3LCPC 4V02A 2QPOA 3LA6A 4O2LA 3LXXA 2KFHA 2BE6A 1JQLB 1MO5A 2VSOA 1TX4B 1NI3A 2GJSA 2UZ3A 3B13B 3RANA 3VRQA 5H1YA 3TUJC 1QLSA 2HCBA 1AUIB 1F54A 4RD4A 3NEJA 4XJXA 1G5RA 2F43B 2F2PA 2F3ZA 4NMMA 1UWOA 2EC6B 1UPTA 3C5HA 1F3OA 1NX1A 1RYFA 1WQ1R 2OCBA 4AWXA 1UKYA 1BMFD 5TVKA 1CFFA 1LV7A 1KSOA 4UKDA 3WNBA 2XOKA 2D2FA 1E0KA 1CLUA 3CS1A 1IQ3A 4FMCB 3F45A 3FS7A 4D81A 1XEXA 4OJQA 5GADl 2BMEA 1MR3F 2KBFA 2YC4C 3EKJA 2G0NA 3FYHA 3N2IA 3Q3JB 2LUCA 3A1VA 1YURA 4L9MA 1Z2CA 3SZRA 1IAQA 1BOFA 4XSHA 3BUMB 4BFXA 1YE8A 2J5XA 3REFA 4I1VA 2IC5A 2FPLA 3IHLA 2IEYA 2WJHA 3LW7A 5FBRB 1Y0VH 3UMRA 5KSZA 5CITA 2ZSFA 1SL8A 4TMTA 3SHWA 4ITRC 2PX3A 4M22A 2A9KA 4R1EA 3PUYA 2HPSA 5GQQC 1AQUA 4IDQA 2PZFA 1DT7B 3ZQJA 4HAUA 2ZS9A 1S4QA 4W5HA 4C0AC 3THYA 4CT5A 2IWHA 5ELXA 1E2HA 3PQCA 5GJVC 5TDHA 2QAJA 4M1WA 4N1AA 1RRCA 1OXUA 4NONA 4AKEA 4Q4HA 3GLHB 2LKCA 1FNNA 4V0OA 4EJSA 3QBVA 2ZYWX 2K7OA 1XCPA 3FMPB 2DPXA 1XPOA 4M2PA 1YZNA 4GGFA 2KI6D 4RD0A 821PA 3EIQA 3AVQA 2WBLC 4TYNA 1II8A 3MWYW 2KB0A 2F1IA 2ZJ5A 3GOFA 1JR3A 2WORA 1E4VA 1G6OA 2H16A 2JASA 4RD2A 2H61A 4FMCF 2O5GA 1J8MF 3SEAA 4B3BA 3M1IA 2CK3D 4M9ZA 4MLWA 3U3JA 3TRFA 3SG6A 2IYLD 2NMVA 1XA5A 4OKHA 4YI9A 4P33A 1OIWA 1KI2A 3PUWA 1CFPA 4YDSA 3RNLA 4DJTA 1OHHD 2I4IA 4URVR 4AD8A 2G6BA 4BEJA 2FGJA 1G18A 5FOVA 4JVSB 4P4SA 3L8ZA 1I2DA 2IL1A 2J0UB 4KSBA 2CXJA 2D4HA 1KFUS 1TN4A 4QBIA 2ZRKA 4M4SA 5AJYA 3O6BA 1SVKA 3U3OA 4ASUA 3I8SA 1IBRA 5KPDA 4US2R 4QC2A 2K0JA 1Q3TA 2KDHA 1K9KA 2C03A 4P32A 2HQ8A 4JS0A 1YTZC 3P4XA 4MBEA 1WP9A 1KDTA 2EQBA 4X8HA 2KAYA 2PEYA 3QXCA 3KJEA 2V9PA 1FP6A 4B3FX 4YMWA 4UNQA 2OT3B 5F6TA 1KI9A 1XMJA 4P5OE 2RGXA 2YOGA 4HLQB 4OK5A 3U4QA 3ZIAA 5G3ZA 2IUSA 3JVVA 1SMGA 2FCEA 3V4RA 3FHTA 3KXIA 4M1YA 4BEBA 4Q9KA 4A4DA 1D9XA 4I1SA 4PHKA 1Z07A 2BM1A 3BH7A 4B47A 1OXTA 4U5XA 2OSBA 1SVIA 1FFHA 1NCXA 1T3HA 3KO0A 3QIAA 4C30A 1VCIA 2JXCA 1CKKA 1M31A 4D4KA 4KYIB 4FI3C 4Q1AA 2F3TA 2EFDB 1GFIA 1R2UA 2RGNC 3VX4A 1U81A 1RRPA 3SJSA 3CZPA 3DF0B 2N42A 1US8B 1JJVA 3K70B 121PA 5KSYA 3FWCA 2A30A 3RYTC 3ZJYA 2VRWA 5FUWA 4FD2A 2O8FA 4Q47A 2A78A 4JJZA 1NUBA 1GITA 3OIYA 4RZXA 1XPUA 2RGGA 3VX3A 1YHNA 2JLSA 2QQ0A 3HWSA 5CK5A 4KAXA 4ACAA 5EZ6B 2QNRA 2YWEA 5JOLA 3I1FA 3KZ1E 5LB2A 4Q1BA 1G8PA 5CSFA 1DAMA 1VTKA 1XPRA 4OJKA 3AVTA 4Z1MD 3OF5A 1E94E 4ERNA 1LA0A 2MHHA 3B5JA 4V0LA 3R9XA 1ZBDA 4MRVA 4PAOA 3HDTA 1O3YA 1W1WA 1S1EA 4RSGA 4B2LA 1FMJA 1UADA 2A5JA 1QXPA 2C2HA 3B6EA 3P27A 4IRUB 4MN0A 5HTKA 3ZVRA 3WXMA 3K70D 1E9SA 2HQWA 3BUXB 4JYCA 5FFMA 1KI6A 1E1RA 3LK1A 1NKSA 3CF0A 3EASA 4MRRA 5G40A 5JJLA 2D3WA 5HLVA 4XIGS 2JLVA 3C14C 5DI3B 5HE9A 1QRAA 1IN4A 1WRLA 4JL5A 3H2YA 4IVPA 1YR7A 1ETUA 3AKEA 4OI4A 1OXVA 4MSPA 1E2PA 1FTNA 2W0SA 4BFYA 4JPZB 2ZRJA 1KK2A 1V1FA 3THXA 1AKYA 1IONA 4ILEA 4XSGA 2WSMA 1DF0B 2QACA 3IGFA 5CLLA 1UKVY 4HATA 2NO7A 4LV5B 3EPKA 2OLKA 1R6PA 5I2LA 2UKDA 3OAAA 1PSBA 4DBLC 2GCNA 2OLJA 2V54A 1R8QA 2ANCA 1EXRA 4HEJA 4GP6A 4MDEA 1G33A 3GLIB 2WNDA 1IRJA 1MXLC 1I4LD 2O8EB 621PA 1VG9B 1CTQA 2P5TB 5B58C 1A7JA 1MQ1A 2VP0A 2O8DA 2BCAA 1W5TA 4BQSA 4JBXA 4NU0A 1WF3A 1SR6C 3R7WB 1TF2A 4FCVA 5HLOA 4YMVA 1QHGA 4O2RA 1Y1XA 1P6XA 3VR4A 1L4YA 1EFUA 1TU4A 2W2VA 2XNSA 1W2HA 1I4DD 3CB4A 2E9SA 1KZ7B 2Z4RA 3GJ7A 2ZSDA 2VH5R 4KCGA 3U44B 2CL6X 3GEIA 4CZ2A 1SVOA 1XK4A 1Q12A 2F1HA 2Q3HA 2ZNDA 4JWQA 2LLTA 3PG5A 4QG7A 2AWNA 1VHTA 2KE5A 4GMXA 3HPQA 4ZDIA 4MRXA 3PATA 4JLOA 1W4BA 1SPYA 4KVGA 4DLWA 1W7AA 3WMFA 1E2NA 3QUSA 5AR1A 5B8IB 2ZRLA 3ZD7A 3BERA 3QEJA 4NYJQ 1U5IB 4NYMR 5KDOA 4WIAA 2WCFA 5FL3A 2QMHA 4EJSC 2PZGA 2ZRMA 1R0XA 4PXAA 2XGJA 3CO5A 1G1MA 4M53A 4MITA 1XTKA 4UJ5A 4R71A 1AVSA 1IGVA 2E30A 2KBMA 4GGFC 1LVGA 3FHCB 4CGZA 3WNXB 5J5CA 3VKHA 1XCGB 2ZE5A 3AVOA 4JL8A 2H57A 3KJGA 3WNCA 5L3QB 2WSSD 3NEYA 3BBPA 4FW9A 1GKIA 4TYYA 3LV8A 5C18A 5BW8A 4Z8XA 4W5WA 2VP2A 2JULA 1G21E 1F2TA 1QF9A 3OEED 1SXJE 2IA5A 2K61A 1C7WA 5FI0B 2ZE7A 1S0UA 2ZETA 1SL9A 3FKSD 4QM6A 3RHFA 2IHYA 1RRGA 2YKGA 1NLFA 3K0CA 4O25A 1YZUA 4QL3A 3C7KA 1MV5A 4GDFA 1NJGA 2FH5B 1SRAA 2IS9A 4TLAA 2HUPA 2ZFDA 1QHHB 3GK1A 1NVVR 1YRBA 4NCJA 1LNZA 2A2ZA 2ZRDA 2GJ9A 3I5GC 1UHIA 5CB6A 1W0JA 3FHOA 3HYRA 5IT5A 1NP8A 1B8CA 3KKOA 1SHKA 4LRWA 1CMFA 1UHJA 2VP5A 4MEWA 1CM1A 4YBHB 1OT3A 3CWGA 2I2RE 2P6UA 1OE0A 1FI6A 4Q4LA 4OYHA 4ZDWA 1KOFA 2GESA 1W4RA 1F70A 3CPJB 2FZ4A 1TRFA 3SJZA 4DXAA 5JRJA 1MABA 3FMFA 1DJXA 3CZTX 5ER5A 3FE2A 4GNKB 4PZLA 2A4JA 1TEXA 1S26D 2V4ZA 2WJGA 2WKRA 2XJ4A 3TUYC 2Y8EA 1JALA 4POAA 3CTNA 4ORAB 2EYUA 4IOLA 4RFVA 1T0JB 1NVWQ 4M1KA 5TY0A 3RS5A 2V8OA 3IQWA 4JKIA 1Q1EA 4PE0A 1SVLA 1X02A 3GFPA 2BECA 1AHRA 1G19A 3CLNA 1L2TA 4PE4A 2LHIA 1EX7A 2C04A 4PSAA 3PJRA 5GJBA 4MKGA 4C0HA 1E69A 1ZP6A 4B3CA 1ONBA 2ODWA 2GTPA 2QBYB 1SKYB 5TARA 4RD3A 4MKIA 3X1XA 4BGDA 3LLMA 1Y63A 4E5UA 1XTSA 2AN9A 3AGQA 3DVKA 2FOLA 2QORA 3AKDA 4HB3A 2OS8B 5K8TA 3BORA 3TQFA 1IXZA 4HB0A 5CJ2A 1OF1A 2B7BA 3Q5EA 2HT6A 2WPDD 2GJAA 2J7PD 3HP1A 1RECA 1KMHB 2QP4A 1XZQA 4HZUA 2IYWA 2JRFA 1N0WA 4B2IA 1TTTA 4DDWA 1XD2A 2BBWA 1QIWA 3OP0A 1ZAKA 2I7AA 1ZNZA 2B6HA 1F8HA 2QM8A 2I1VB 1PVOA 2O8BB 3EXAA 4DB4A 3P4YA 4ZCIA 1R2QA 2BWJA 1CRPA 1BOCA 2R62A 4A82A 1LB1B 4E07A 3I5HC 2C5LA 4FMBB 5P21A 4XTCS 3GMTA 1HT9A 2Q6TA 4DSOA 1NY5A 1ZC4A 4ARZA 1NN5A 1CDNA 5JMTA 1XJ0A 1NRJB 2AWOA 4X8MA 4I5LB 4OHYA 1B8RA 4C0QC 4DLVA 4HAZA 1WRBA 4JLPA 2K7DA 1OZSA 2O60A 3TH5A 1NVXQ 1AZTA 3PITA 2RGAA 4PPQA 1F71A 4GT1A 1M46A 4HUQA 4MRSA 3G0HA 2QSYA 1R5NA 3AVVA 1UHKA 1XFAA 1BKDR 3HX4A 3PEVA 1K95A 3UANA 5FL7D 3SYNA 4DEYA 3FMIA 2HETA 1VG1A 4OV2A 4G5SA 2QMUA 1JR6A 2ZN9A 3E5HA 5KO2A 1IN5A 1WLMA 2E6WA 2GHIA 2ZIAA 4DLTA 1J7RA 4D82A 5FTMA 5AUQA 5JWRA 2W6ID 4GOXA 1KGDA 2BMFA 4B35A 3OESA 2XTZA 5DYGA 1KO1A 2BOVA 4NKRA 2LV7A 1V5WA 3OFNA 2EVWX 2JIZA 5J47A 1V1GA 1Z5ZA 5DO9A 3T5DA 5H8WA 2CNPA 4ZKEA 4BFUA 4UNRA 1OW3B 1NY6A 4MGZR 2FF7A 2JAQA 1MT0A 4DLYA 1Z6TA 2XB2A 3KUDA 4UQOA 5FTJA 2HJVA 2RGCA 4LJ9A 4NE2A 5KUTA 1K93D 2H18A 1CDPA 4RZ3A 1XYDA 4GGNA 1SKQA 2AUCA 4ZCVA 2OAQ1 2R8RA 4L8GA 4BASA 5JRZA 2GGMA 1Q1BA 4BY4A 1TIZA 2HXYA 2HJGA 2ZE6A 2A5GA 5DE3A 4MVFA 1DS6A 4LBWA 1QATA 1PZNA 2WICA 3SBDA 5BWMA 3GD7A 3CKLA 1IH0A 1K9UA 1ZUZA 4PO8A 3PCRB 1G7TA 4F4JA 3A4LA 3T1QA 2OG2A 5F9FA 3JVTB 5KTYA 1G4AE 1E99A 4DSTA 2AK3A 4W5JA 1NLYA 3MLEA 3UWKA 3GLFB 4TYQA 3GJ6A 1JBKA 3SQWA 4NYIQ 4NCIA 1IN8A 4RVCA 1E8AA 4DRZA 2JJ2A 3THXB 5K8UA 5BYKA 3IEVA 1KWOC 2DY1A 4UXJA 4DCNA 3W5IA 4K8OA 3QPUA 4M21A 3ADKA 1P7CA 1G64A 2LKDA 1R0ZA 3SG2A 3CLVA 4EPTA 3OE7D 1BMFA 4BLQA 1AM4D 1M6NA 4B73A 5KDDA 1UDXA 2WOSA 5J4VA 2Z4SA 3MSXA 4DUGD 2Q4UA 1ZUIA 4HI0E 3KQUA 3LH5A 4A8JB 2IYUA 1ZIOA 3AF0A 4II7A 1F5NA 1UUSA 3FPAA 5FUXA 2C9OA 4PSKA 1XTIA 4LBYA 2XXAA 3TUIC 3TS5B 4A8JC 1RC8A 1QVAA 1RRFA 2WAXA 3RS2A 1HE1C 4Q9HA 3EK4A 1KI3A 2J3EA 4CEIA 3NSIA 3WYGA 2R65A 3O2PA 2AMIA 1LY1A 3NBXX 4WW0A 2OTGC 1FL9A 3BB1A 3GJ8A 1XVJA 4QFMA 3DKPA 4C0KA 1M1YE 3D8BA 5FOUA 1A4RA 1R0WA 3IUYA 1NL3A 1UBEA 2W83A 4TQ9A 2NZJA 2IUUA 3AVXA 1YZLA 1XWIA 2CBLA 3X2SA 1W2GA 2O52A 4P3YA 5EE0A 1WMSA 3KJHA 3MG9A 5AANA 4M1MA 1N2DA 2YV5A 4BFWA 5C4MA 3SDZA 3LW8A 1KAOA 4HDQB 1C1YA 1ZYUA 4RY2A 2BL0B 1BODA 1E2GA 3U7GA 3TIFA 1DAIA 1G8GA 2BBNA 1HE8B 1XD9A 2UVQA 3CNLA 5DSZA 2R6AA 1EFRA 3I4LA 5HE8A 1M2OB 3CR2A 3WNDA 1NG9A 2CK3A 4KLZA 3Q5DA 3SFZA 3EZ2A 2LMUA 3B1XA 1HH4A 2OFWA 1DAHA 4RKFA 2JGNA 2WWFA 3NBZC 4URXR 2D7CA 2ZRIA 1AJ5A 4YGCB 3L0IB 1QTXA 4ZCLA 3GP8A 1OHHA 1RW4A 3TK1A 2QL6A 5JWHA 3EK7A 1TUEA 3CF2A 4K81B 1M74A 2BHRA 1BYIA 1XP8A 2PCLA 4WXRA 2OFXA 1E2LA 1W44A 1CULC 1MRSA 4TQUS 3A37A 2B7CA 3SQXA 4IL1A 3MWJA 4C3ZA 4CVNA 3TDIA 2IHBA 3HJNA 2ERXA 5DKNA 4F4CA 4JBYA 5E4FA 3Q9LA 3CRVA 3B60A 3MRSA 2V1XA 4M1TA 2I94A 1IN7A 1LS1A 4ABYA 2ZS8A 2KNEA 4Q4JB 1ZINA 3CWZA 2R6GA 1ZACA 1ZD1A 3MMPA 5D3MB 1T6NA 1IN6A 3EW9A 2WKQA 3VRPA 1XB2A 4DCVA 3MAAC 5DKRA 1JAIA 1COWA 1QHNA 4G5GA 1IXSB 1M45A 3CBQA 3NVAA 4LJAA 4B43A 4PZYA 2IBMA 4LJ5A 4Q1DA 1JXOA 4I99A 3EIHA 4IVRA 4RCYA 2WV9A 2F55A 3ICBA 5LB4A 2IXFA 3G5UA 3NBFA 4URWR 5PALA 2ERYA 2O0JA 5EXSA 1B23P 2J0UA 3IEUA 4URYR 4C2TA 4I5JA 1DJIA 1P9WA 4Q04A 2M9GA 2XB4A 3MWLA 3LLEA 5CYPA 3GJ5A 2VHUA 4WZAE 1BF5A 3K0FB 1V43A 4IHQA 1PK0D 3CZQA 4G0NA 2GK7A 2OUKA 5BN4A 2WMOB 2ZVPX 3QVVA 2EWWA 5BYJA 4EPYA 1OKKA 3RWMB 4BFSA 3I5FB 2JNFA 2LLSA 5DHAA 2HXSA 4LHXA 1FBVA 3QXJA 4NHOA 2F9MA 2ISDA 4NCNA 1GL6A 3I5FC 3H1TA 1YUUA 1KHTA 1XJQA 2JDID 1LS6A 4MZLA 1D8TA 3FDIA 2DHRA 4GL2A 1KJWA 2P3SA 1FI5A 1Z0JA 2PBRA 4LV6A 1PVAA 4GZMA 2LP2A 3CWQA 4YXWA 3TAUA 4B6EA 1WBBA 3IQQA 4OK3A 3U2QA 3SG7A 2QGNA 4C0LA 2RGNA 1ELOA 1HYQA 1H4BA 1VYVA 4TTPA 3T06B 4C7OB 1E2DA 2G83A 4KODA 3T61A 5L8VA 1OB2A 1G8HA 3LVQE 1OZOA 2K7BA 2WZQA 3PN7B 1QHSA 2HF8A 4U8DA 1SK6D 4JLBA 1US8A 1LFDB 2PRUA 1WY9A 4A0GA 5FOTA 4ZI3A 3GJ0A 1OSAA 5L3VA 3FKQA 2KI4B 2RMKA 3TSWA 4CEHA 2JU0A 2GCOB 1A75B 1KQMB 1Q20A 3A1SA 4UXHA 2J0SA 2D8NA 5JSZB 1KK0A 2FGKA 4A4CA 1N6KA 4M0LA 4US1R 4B34A 4D80A 2W2TA 3OIWA 5CM8B 1UBGA 2L98A 1X8LA 1IQPA 3EWSA 3BXZA 4ZI2A 3CPEA 3I8XA 4EPXA 1P72A 4C0BA 3DVJA 1NWDA 1ZD9A 4OQFA 2ZRSA 2KOTA 2CLDX 3MJRA 1SXJB 3VROA 2IF2A 2WM9B 4TMKA 2C96A 3IO3A 4EKDA 1BR1B 4QJ5A 2NLNA 2LMTA 2BJWA 4N0DA 3IIMA 1IG5A 4KFRA 1FPWA 1UBFA 2F3RA 2X1VA 1JEEA 4HDOB 2KI5A 4DDVA 1A4PA 1YZGA 3WYAA 4O0MA 5GVRA 4MUBA 3W34A 4KHZA 4BFZA 5M04A 2CNWD 1ALVA 2WCEA 2REXB 5DI3A 3QKSB 2PT7A 2FFAA 2GJ8A 1OFIA 2X77A 5TV2A 1J90A 1XZPA 4OQNA 4X8OA 1UFQA 1SCMB 2M0RA 2CVHA 3NDBB 1NIJA 4XYNA 3OX5A 1PULA 4JVMA 1OH8A 2WOJA 2JT0A 4ACBA 1DF0A 1BO6A 2XITA 4EQ6B 4PHNA 2EC6C 3DM9B 1SXJD 2CCGA 3BWDD 4BLSA 1EFTA 1KJYA 2JTZA 2KFFA 3G82C 1RWYA 4NCHA 2XTMA 3S1AB 2BCGY 3LX8A 2O8EA 3KB1A 2ZSEA 4QM7A 4BE7B 2BVNA 2QE7A 1KTVA 1U0HC 4S35A 5DIFA 5FTLA 4AKGA 1GTVA 2AAOA 3CGAA 3EPJA 2LC5A 2KGBC 1YZQA 2I3BA 1JNYA 4HLUC 3VNVA 1ZNYA 1P2UA 2KI6C 1XTJA 3F5FA 3W9YA 3ZZUA 4KLNA 1JECA 2N1BA 2X19A 1YR5A 3C41J 4B3DA 1ANKA 1E9FA 4CPVA 1Z6YA 3BRWD 1K5GA 2O0KA 2WSSA 5AJZA 5KDLA 1FP7A 3U44A 4C4PA 5HZKA 3GLGA 4MGYR 4OBEA 2QPTA 4XVUA 1U0LA 1G291 4A1FA 1U99A 4R9UC 2VPPA 3OEEA 2XZOA 5LD2B 2FEOA 4IDHA 2GEVA 2C95A 4DSUA 2G88A 1CJVC 2RKOA 4OI0A 4TMWA 3FKSA 4JLNA 3RRNA 1ZM7A 1U5IA 3VFDA 2P65A 421PA 2K2AA 2WVJA 4XWKA 2ATXA 1P9RA 1J1DA 2H8KA 5DKQA 1XX6A 3HU1A 4OKSA 4CW7A 1ZFSA 3BYAA 5I2QA 1DE0A 5KU1A 4PQFA 3B1YA 4GFDA 3AV0B 1TOPA 2KJQA 4JT4A 2OO7A 3H4SE 1R5BA 4NL4H 4CT4B 4NDCA 1CU1A 1U2RA 4JMPA 4LK2A 3TJZA 2GJKA 3VRRA 3C1VA 2ZSBA 2P6RA 3UIEA 3AF4A 3UWOA 1KK7Z 1ZCBA 2RH5A 1ESMA 2C8VA 3PV0A 5FTNA 3ZVMA 4IDPA 5FR2A 3WHUB 1QS7A 2QENA 3RRYA 3SJCA 4ZIRA 4PAMA 4KV9A 4OQMA 1TPZA 3K53A 2OBLA 1W47A 1E2KA 1QX5B 2JLXA 3I73A 3PIRA 2JT8A 1NG1A 3HPRA 4TSFA 1BR4B 4XOIA 4JL6A 3HU2A 3ZGXA 4D25A 4OVNF 3MGCA 1NX2A 4ZIRB 1YRUB 4LUCA 1M7HA 1RFJA 3TZ1A 1LW7A 2BBTA 4P0TA 3TUZC 3GFOA 1JJ7A 4D0GA 1K9PA 5FTKA 5A4JA 1XXHA 2GAAA 3WRYC 1CJMA 1Q57A 1TNPA 1NBMA 2R6FA 2ONJA 1KI4A 3RM1A 1MO3A 1TQDA 2EFGA 3UK6A 3SIBA 3X1ZA 4F92B 4F0ZB 3O8CA 3AP3A 1OOJA 4S2EA 1KQVA 1CF4A 5HCNA 1TADA 3OHMB 1E2QA 5B64A 2FPMA 3EZ6A 2QY9A 1R0YA 4QBGB 4TT3A 2W0MA 3LNCA 3R9IA 1HT2E 3BXKA 1U8ZA 1YZTA 1KDPA 2I1QA 2ZRPA 1QBKC 2XX3A 4Q21A 3A6PC 2F33A 2OESA 2P5SA 5CB8A 2AX4A 4PR0A 1DARA 3CONA 3DMNA 5CDFA 4DLXA 2F2OA 4GNKA 3VHLB 4LPKA 2WPDA 1XFWO 2FOTA 1DADA 1XEFA 2BM0A 3QPVA 4HLDA 4JT2A 4WQ2A 4YI8A 1RJ9B 4LC1A 3CR5X 1N6HA 1VDZA 3F3YA 4IOKA 3B1VA 3VR3A 2CVFA 2LMVA 3K70C 1RTP1 2VSFA 4KITB 4LPSA 3A36A 1PVBA 1A2KC 1KY2A 2MSCB 3DOFA 3ONWA 4JQ0D 1Q3HA 4DLUA 3A4NA 2V7QD 3LRPA 2GKSA 221PA 2IWRA 1E9RA 1N5JA 1KFUL 4HREE 2M1KB 1D5CA 1JUOA 1HY3A 3K0AB 2LNKA 4JJKA 5CLQA 2BDTA 3GJ4A 3ASZA 4D1EA 4GOKA 1NP6A 3PUXA 2OXCA 1S3SA 2JATA 1DEKA 2PVBA 2PZEA 4ZV4A 3Q85A 4RCZA 3THWB 4KBGA 1NCYA 3LL8B 1NJFA 1OFTA 4HB4A 4PC3A 1QHXA 3QENA 5J4LA 3P20A 4UJ3A 1E9AA 3RWOA 1KMHA 4NCKA 3PEWA 1T3SA 1ESNA 3GQBA 4PSVA 1LINA 2XSZD 4WZBE 2L0PA 4TYWA 5CJPA 1JSAA 1WE2A 5G53C 1G8IA 4UNPA 1UEIA 1FNMA 5LD2C 4EFMA 2O8BA 1JBAA 2ATVA 3KHEA 1JC2A 1SYMA 3NC1C 5C4GB 3EPHA 1EWRA 2NZ0A 1S6IA 2SASA 2DCUA 4LHZA 5A5GA 3U7HB 1L2OB 1E0SA 4WBSA 4ESVA 1NSTA 3GK4X 1W4CA 2CLCX 4HAYA 1C7VA 1N0VC 1A2XA 2W6IA 4DIEA 1PUJA 1TMKA 1P3JA 1PALA 2ZN8A 1E1QA 1M7GA 1N3BA 2RCNA 1EJ3A 3JZAA 5UKDA 4B2PA 1F2UA 4LHVA 1N5KA 2CJWB 4E09A 1OFHA 5AUNB 4ORCB 3LBIA 2DBYA 3AF3A 3RAPR 2IS4A 3KQLA 4HAXA 3L0PA 4KVAA 4NTZA 4BLRA 2ZRBA 2BCXA 1F48A 2YWFA 4XJKB 1XJCA 1BU3A 2IUTA 1S96A 2N46A 2B1UA 1YX8A 1AKEA 4M9SA 1FW4A 3EVRA 2A3RA 1T91A 1KI7A 3EAQA 5DHFA 5CSNA 3MSEB 4BZPA 4ZKDA 5KNDA 1QVIZ 4BRWA 2AL7A 2R44A 4IFEA 4UNNA 2RGDA 1UKEA 4B3GA 4M8NE 2V1UA 1XEXB 1DMOA 1G8YA 4TNCA 4A6PA 5ER4X 3WRXC 4AK9A 3BOWA 2G77B 3CF6R 4PC7A 4C2UA 2YOFA 3OB2B 3BH6A 1T5LA 4TMZA 1CS4C 2JEOA 1ZU4A 4U7DA 1G17A 2LVVA 3LBHA 2NTYC 4Q4AA 1ZM2A 2YJTD 2MSEB 2I18A 2VP6A 1GRNA 1N25A 2UZIR 3AH8A 3LX5A 1GZSA 1DAFA 4IXNA 5GVSA 2F7SA 2JJ1A 2HF9A 3D10A 1QJTA 3AKAA 2YWHA 4EAQA 1J1EA 2ZUCA 4WZ6A 2VRGA 4QNRA 1CFCA 1NIPA 4Q9LA 3U3KA 3THYB 5HKWA 3IBYA 3QRXA 3JVUA 3ZZ0A 3AUXA 2M49B 4FCWA 1EESA 3OEHA 3IQXA 4RJLA 1U9IA 2XOKD 1YR8A 1P62B 2FWRA 1A5TA 4LBVA 2YOHA 2LAPA 3OE7A 4PC6A 4B3XA 2ZXUA 3HYTA 1UM8A 1GWNA 1FF1A 2GZDA 3LVRE 2F3YA 2IT1A 3REGA 2ZITA 4DUGA 1H8ED 3HR7A 4QJ3B 2PMKA 3BOSA 2K5UA 4GUKA 1DVIA 1DVRA 4IOJA 1II8B 1J99A 3GLFA 2IYYA 1KK1A 3M0WA 2QUZA 2XAUA 2GV5A 1NMXA 1YU9A 2ZI4A 3CX6A 4OHXA 4AIIA 1H8BA 4IDNA 2OCPA 3SNHA 3X1YA 1QHYA 4U00A 4FIDA 2AR7A 4Q9JA 3AVUA 3F0TA 1IOZA 1P9NA 4LJ7A 3NBYC 5FBLB 4HAVA 1FPMA 3EG5A 2J41A 4P4SB 1H8HD 3OX6A 1KO5A 3KPXA 1N0UA 2NPIA 3PLFB 2ASEA 2Z5FA 5JEEA 2M8UA 4EIWA 1WBDA 3VKGA 2DR3A 1DO0A 1Z3IX 3AQ4A 1GVNB 2IS1A 2JOJA 1NMZA 1HQCA 4LV8B 3IDQA 5JLJA 4A8JA 3R9WA 4ZDJA 5IHPA 1HQVA 5B57C 3SR0A 3QG1A 4DZZA 2XZLA 2L4HA 3NHBA 1VCNA 4GBMA 4TWZA 4XD7D 3PFIA 4JLDA 3UMSA 2AD5A 2ZRTA 3AVPA 3BQ3A 1TTXA 3L43A 1E79A 2REOA 4ZDKA 4IFBA 1GM5A 4E22A 4YDHB 1H65A 1CDLA 4G5OA 5CSJA 1G20E 2Q9CA 1LKJA 1NN1A 4RD1A 1MHOA 1OXXK 2D74A 2Q21A 1KDOA 2QEQA 1AJ4A 1Y1UA 4GMDA 4XVQA 3I61A 1F4QA 3R8FA 1GNQA 5F98A 1W0KD 4Q7LA 3QKRA 3TBKA 3ZS9A 1IJFA 4L16A 4PQYA 1HUQA 4QGAA 5EE9A 4ASUD 3E70C 3NKVA 521PA 3ZH9B 1QVIY 4KSCA 1EFHA 1WXQA 4TLEA 3ZS8A 3FMOB 1MR8A 1W36B 3QVUA 1AQYA 4DT1A 1E32A 1AK2A 3VR6A 3LFUA 2O8FB 5JJKA 4V0MA 1B7TZ 4A2WA 3QF4B 1OYYA 3GEHA 2OS8C 5FOSA 3AEZA 3IBGA 4FINA 4R2IA 4FN5A 2CL7X 1Z0AA 4PC2A 2Z0MA 3MWKA 1T4GA 1P2VA 2P2LA 5FUVA 3FIAA 3SOPA 4JLJA 1YX7A 5FBVB 3PM8A 5I2OA 5JCZA 3KF9A 4TN1A 2JTTA 1EGAA 1R6BX 4D4LA 3KQKA 4PALA 1AIPA 2NZ8A 4JLAA 1W36D 2EFCB 1YZKA 2ZS7A 3HCMA 4P4TA 4LJ4A 3QXSA 2JPTA 1XCMA 2FFQA 1YKSA 3W6OA 4AY2A 5L3SB 5E7IA 3GEEA 1AS0A 2TN4A 1Z6GA 1DO2A 1G4UR 3BH0A 4IEIA 5JI3E 4PTLA 2VBCA 2R6CA 2BIFA 1SBJA 3UG6A 2YVUA 1HA3A 1IQ5A 4MH0R 2IXEA 2JDIA 4M2QA 2YNMA 4MA4A 1GGZA 2PLFA 1YJ5A 4OL0A 1W7IB 4I5NB 3AAKA 2BBSA 2QM7A 5DN6A 5HKKA 1M7BA 2H2KA 1IJEA 2AKAB 1PUIA 2OBMA 4ZO4A 1GP2A 1Z6XA 1MF8B 3K09A 3JTDB 4Q01A 4V03A 2LVKA 1P5ZB 4MUAA 4Y0VA 3ADDA 1P2SA 1OYWA 4LHYA 4Q02A 1BG1A 2OEPA 3K0FA 2O8DB 5AWFC 1RKBA 2XEXA 3I5IB 1GL9B 2XZPA 3DDCA 2WJIA 3HU3A 4Q48A 1P61B 2LVIA 4D6PA 1JPJA 1DTLA 1TL7C 1MO4A 1KSJA 2K7CA 3LY5A 3I5IC 1X3SA 2O8CB 2L2EA 4YC7A 1NF3A 1R5OA 2ZI3A 1B1GA 4MGIR 3CR7A 1GAJA 3C4JA 4RZUA 1LA3A 5JEDA 2VLIA 4NDDA 2IS2A 2FSFA 2QQEA 5H70A 3LAWA 5AJWA 2RHDA 3Q7PA 4Q7KA 1S8FA 1QV0A 2LUXA 4R7ZA 3TDZA 2Q3FA 1CP2A 3OAAD 4NH0A 3SJAA 4AQIA 1RZ3A 4LGMA 1U9IC 5FPSA 1TAGA 3H86A 5AXIA 1DELA 4ON9A 3HR8A 1G7SA 5EE3A 1SKTA 2GK6A 4E68A 4ZCMA 2HLDD 1K96A 4HZIA 5DISB 1EG4A 3DVLA 4H1VA 2VF8A 5KHOC 4QNMA 1G7RA 2FPKA 4TMVA 4KO8A 3JVTC 3UMFA 1ODFA 1IXRC 3K9GA 2PJZA 2WAYA 1JF2A 1GOTA 4AG5A 3I5XA 1XFVO 2GCOA 1A75A 2FFHA 4IVQA 5BN3A 3U61B 5JJIA 3O4YA 4OQXA 3DD4A 3AF2A 2OCAA 2RGEA 3RVBA 5BN5A 5JSZA 4MRPA 1SHZA 4FWTA 4Q66C 2JZIA 1B7TY 1JWDA 3M4YA 2ZJ8A 3TR0A 2GA8A 2QA5A 1F2TB 4LBZA 4M1OA 2NO0A 4TL7A 2ZAMA 2IK8A 3D0YA 2WWWA 1XTRA 2PCJA 1N5LA 3EA5A 1HT1E 3TR5A 4OCIA 2ZR7A 3FTQA 2YWGA 3I3SR 4I1OA 3I72A 3MFYA 4JYBA 4EPWA 4CF7A 2MSDB 5JFGA 4WVFA 5FBQB 2JLQA 2NGRA 1X86B 4URUR 1ODBA 4OHZA 3BUNB 2JLRA 2ORWA 3TLXA 4UPGA 5CPVA 2GNOA 3AKCA 4BUJA 1BLQA 2IYQA 4Q5IA 1X1RA 4C9BA 3T1OA 4R98A 2FEMA 2F1JA 2D06A 4XWAA 3ADBA 3QKSA 3F8TA 3TS5C 1S6CA 2F43A 2M7NA 2VL7A 2CHQA 2J46A 3KTAB 4DCUA 1QV1A 1CJUC 1E2MA 4DLZA 3PSRA 2V6IA 2EWVA 3ZLJA 1I4TD 1EH2A 1ZNWA 4LYJA 4LYHA 3NC0C 3O8BA 3ZVNA 2BKHB 1F4OA 4IW3B 3AP1A 1J7QA 5HKYA 2QT0A 3NDPA 5BPJA 2WWHA 1TCOB 1DBSA 1MABB 1XD8A 3EA0A 4HLUA 3C16C 1GDDA 1UHHA 1IM2A 3VMFA 2SCPA 2HDNB 4YMTA 5J4YA 2FJUB 2JQ6A 2OPOA 2FMXA 2LHLA 2QRNA 2JA1A 4NQGA 3CH5A 2NO9A 3KKQA 4YONB 4OHVA 1N65A 1PJRA 4KFTA 4TQAA 1LTQA 2QSZA 2R2IA 2BL0C 4MZKA 2A5FA 3A1WA 3A8TA 1ZIPA 4JIMA 2MLEC 3GLGE 2WIAA 3IILA 2GXQA 4MKHA 4PX9A 3TVTA 5J4KA 1KY3A 5L3RA 1S9HA 2IYVA 3AB3A 1SZPA 1B9AA 3GFTA 1UDWA 2VEDA 4NYJR 4JSYA 1AK8A 1IJ6A 3GLHA 3FVQA 3K0EA 3P32A 3TNFA 1Q80A 2VA8A 4GP7A 5KOYA 2EFHB 1N6LA 2VF7A 4JLVA 5LBIA 1A82A 2FCDA 5TXGA 1T0HB 4B76A 1AP4A 4BZXA 5HPYB 4CIDA 1J55A 1E0JA 2LCPA 1Y3AA 4XH9B 1T3LA 5AUPB 4B74A 4EPRA 1JR3E 1O87A 3SFVA 1DPFA 4GOJA 2BBOA 2GWHA 1KDRA 1NSHA 3BFXA 1KSGA 1SCVA 3EK8A 3WHLA 1MKYA 1Z6AA 1B47A 1CB1A 2ZSAA 3T1VA 4B48A 4TLDA 3FWBA 3ICQB 4N0EA 5HYDA 4O3MA 4I5KA 1TQ2A 4L15A 5DYIA 2YZ2A 4ARZB 4LI0A 3VKWA 4RFSB 1B0UA 2A5DA 5AJXA 4D26A 1DJWA 2QAGB 3K8YA 3TGPA 1SNLA 1G9XA 2OM2A 4XTRA 4L9SA 4AI6A 1GUAA 4KBFA 1G5PA 1SQ5A 1SW8A 3VRNA 1II9A 3A1TA 4RD6A 1OMDA 5K8IA 3WP0A 3K09C 1JI0A 3KXLA 2QN6A 4MYCA 721PA 2FZLA 2QG6A 1KNXA 2FN4A
chains in the Genus database with same CATH superfamily
1QH8A 1PQUA 1PR2A 4KDFA 2PANA 5I8ZA 1P4AA 2BFPA 1AE1A 2XCUA 3NSOA 1RXIA 3W3AA 2VJDA 4FR5A 4QX6A 4H77A 1U8TA 3SC2A 3PFFA 5CX4A 3FUXA 5F7JA 3CX7A 3OZSA 4MR9A 2PH7A 5C2JB 1C3OA 3RBVA 2IKSA 3MB8A 2Q62A 1QLJA 2BP7A 3PN7C 2VNIA 4EY7A 5B58T 3LL7A 4MGKR 1EBUA 2BMJA 5FPHA 4LKOA 3FTDA 5JCOA 5CEJA 1V7QA 3D3NA 1NUTA 4NV1A 2C9CA 2IYXA 1KAQA 2WUEA 3Q6IA 4E3WA 3ZX4A 1SCMC 1DGQA 4FQTA 4WOCA 1ZJJA 1SVMA 1TYZA 5J2TA 1T5DX 2JGEA 4I66A 3VU9B 1SBZA 5EJEA 3DE2X 3E6AA 1OD6A 1JX6A 3W3ZB 2YY5A 4HOYA 5E9WA 2BFFA 4MGHA 1H8EA 1S5PA 2E55A 4GSYA 3KLMX 2Z5LA 1QFZA 3L84A 3PA6A 2WTMA 1LX6A 5FPKA 2VIIA 1H8HA 4CTMA 3KB2A 1VG8A 3H9GA 3DBLA 4WKPA 4TTSA 5JOQA 2FLKA 4UVEA 1J25A 1A9SA 1TZCA 4AZ0B 4CG0A 3CPSA 1D2RA 1GJRA 4GG1A 4IYRA 4EHKA 2ARKA 1DV1A 3L7MA 5DH9A 2O4CA 4QJ4B 4I1UA 4M0KA 5BV0A 4YBRA 3RS3A 3M1AA 4XB6B 2PRYA 2ZI6A 3MTDA 2HHCA 2IX3A 1UAYA 1LV8A 4MPRA 3WGGA 1FJGB 4HEA6 3WGMA 4Q93A 2OXRA 2OQRA 1Z06A 4ZPXA 1YDEA 4A03A 4B0PA 1NQTA 4DREA 3ZZTA 1E6CA 4CEHB 1YZHA 4JJ6A 3VPXA 1A77A 5CVCA 2DYKA 2B25A 2NO4A 3BEOA 1MH9A 2FMUA 1NCZA 4IKOA 3KCNA 1E1NA 5K0ZA 3NETA 4BBZA 3OC6A 3F8SA 3IPLA 1UJ5A 4O1MA 4YYZA 3LLSA 2AYYA 4FMDF 4KPEC 1ZD2P 2EW2A 3NIWA 2CZQA 4J2OA 4P0PB 2D00A 3N07A 4MVJP 5DTIA 5CM9C 5DXFA 2FPUA 1BFDA 2YYSA 4F5DA 1UKZA 1RLMA 4Y2XA 1NUHA 3N87A 4FWIB 1FZTA 2A1UA 2I3GA 4R8KA 5TNXA 1B0PA 1QIGA 4UXIA 5K8LA 3D6TB 5ERGB 3NIBA 3EIEA 1K8RA 2VWQA 2W2LD 2Q8PA 1JE0A 3G89A 5HOEA 5CDYA 4ZN6A 1PK7A 1JR3D 3ZVLA 5CH5A 1Y6FA 5A05A 3E9YA 3C1AA 4R2HA 4GYYA 2B8WA 4CFQA 3G68A 3BGWA 2ZGVA 4LGVA 1JEAA 4UHJA 4ARBA 4ADSG 4OMDA 2A1IA 1R8SA 1E6WA 2LP3A 2WCJA 3QU5A 2C5EA 5C8XA 2ASVA 2W98A 1RAAA 4FYVA 1DJZA 5LMCA 5JWOA 4MS1A 4YJ3B 1USWA 2CFSA 1YC2A 1DPGA 4OHWA 2R8XA 3IAS1 4Q4JA 2BT4A 1BIFA 1E3JA 3W5UA 1ZR4A 2NYAA 2BELA 3HU5A 2Q9BA 2VAXA 1JQJC 3CXUA 3LYUA 4EFLA 2B35A 3EDCA 3DCNA 2HCRA 1JH9A 1ZU5A 3NONA 1A1SA 3MWFA 2W58A 3A4MA 4QQ8A 3U40A 1Y6GA 3DM5A 3ZY6A 5JZVA 1URPA 2VNJA 1YO6A 2OILA 3N70A 3LT2A 3BMNB 1CUDA 4LCEA 1E9EA 1M73E 1RFLA 2H59A 3SIWA 1G21A 2C5HA 1MJGM 3CZ4A 3WXAA 2QR3A 3H97A 3IVXA 1SKUA 3S2IA 4LFBB 3EG5B 4KU4A 3EQ7A 5CX1B 1ISMA 4RORA 1HDEA 4A8HA 5CVJA 2JCBA 3L9XA 1Y1PA 1FX0A 2WJVA 5CNIA 1EJ6A 1UZMA 4NXMB 2Q6VA 4YASA 3P2OA 4BY5A 1IXYA 5IMSA 5I3CA 4LOKA 2FE4A 1GGJA 1OFUX 2HREA 4RA9A 1CCWA 1M8PA 2EJUA 4G0OA 1FSZA 1N6PA 1Z8DA 1NC3A 4JITA 3IDFA 1GYQA 1P0FA 3ZV4A 2PRZA 3TINA 3NVDA 4R40A 1QASA 1B43A 4B32A 3HDJA 4PRKA 4KJZA 3HJHA 1UAAA 2ZE8A 2KHZA 2R6ZA 3OZEA 2VJPA 2M29A 1UJ2A 4HUQB 1TLTA 4LC0A 5IEBA 3D76A 9LDBA 4B3IA 1GL7A 2FJYA 4G0YA 2ZU0C 4GLOA 3OTIA 3ZNIA 4QYIB 4XR9A 3TNLA 2D54A 5C8YF 1P91A 2IS6A 3UK2A 3PDUA 2XYVA 2ONKA 1L5GB 2ZAYA 2JGRA 1I01A 3U17A 2CNNA 2VJAA 3NSKA 3NTOA 1XNGA 5AK0A 3E3RA 1DC6A 4AQJA 3MJEA 2I22A 1J70A 5ICEA 1AQJA 3E5NA 4YRMA 3BTOA 3GX1A 1F51E 3LA6A 3QWBA 3SR4A 3VRQA 4XYEA 5BY2A 2HCBA 1ZWKA 1G5RA 3UAGA 2FKAA 2XCQA 4R05A 3DQPA 1L7DA 2VDMB 4B7AA 1SIOA 2CFCA 4GOND 1FTQA 3TI9A 5CFLA 1OXKB 3UT6A 3PUYA 2PZFA 2ZS9A 3FJ1A 4MVJD 2E6UX 3BXGA 4P22A 2ZTHA 5AW8A 3E4DA 4IIJB 4WE3A 2OENG 4AUEA 4IJWA 2X7JA 1UQTA 1L5FA 1UINA 1MB3A 2H16A 4ZREA 5DCUA 3RVKA 4MLWA 3C48A 2Z1MA 5AHXA 5FOVA 2R48A 2CXJA 3ME5A 1UDRA 4D9EA 2ZBVA 4M4SA 3O6BA 4MCIA 3B36A 4Q15A 3RROA 3ONVA 4WZAA 1JEQB 4NSNA 1Q3TA 2HA5A 2Z1DA 3P4XA 4X8HA 3F7MA 3H8JA 2W11A 4G4IA 1QAMA 1YDMA 2B6NA 2V6FA 2FCEA 1Z07A 4G65A 3ISVA 4OFXA 1K7CA 2F3TA 3BSFA 3LKVA 1AQNA 1U02A 3ZJYA 3S0JA 3ENQA 4F6LA 3QUBA 4O2AF 3E9QA 3VX3A 3UHFA 3SM9A 4PW0A 1XPRA 4CLRA 1D6NA 4RY0A 4PAOA 3U39A 3PQDA 3GOHA 3IT1A 1QXPA 3CGGA 5JRDS 5AYVA 5K51A 2PXCA 3B7WA 3L0BA 1E1RA 4CM8B 1GKLA 3HCBA 2R60A 2HU5A 4O59O 1WRLA 1RI3A 5BQ3A 5AXDA 4BFYA 4CM4A 1IONA 1SRQA 3LBAA 2M32A 4GP6A 4UREA 5B58C 3ASVA 3LIPA 2VH5R 3U44B 5A0TA 3PG5A 2AWNA 5EMKA 1W7AA 2ZYAA 1HE4A 2PBFA 2B0CA 1U5IB 4JI4B 1PX0A 3FGZA 4G5XA 5LZ8A 4JL8A 1MPTA 4G2NA 2F8SA 3NFRA 3HXOA 5A03A 1GKIA 2OB1A 2ZUUA 5DCWA 1SB9A 2ET6A 3KFLA 5IBQA 2HEGA 5FI0B 1HX7A 3I9V6 2C29D 2QV7A 2PLAA 1TDJA 3RHFA 1O7JA 1QCDA 4KVFA 5BWBA 1NJGA 2FH5B 2IYNA 3WSWA 1TUBA 1YKFA 3AK4A 4KG7A 4N0QA 5CCXA 5IT5A 3IVRA 3DQQA 1J2TA 4Q34A 1KOFA 4RK4A 3AR9A 3CZTX 2FI1A 3TUYC 1NVWQ 4JKIA 2J09A 2JVKA 3G2QA 1ZP6A 4B3CA 1ONBA 1SKYB 3GT3A 1T9DA 3T3PB 2PR7A 3SSOA 2P9EA 3AKDA 3BFAA 4MEJA 3ZWBA 1QVWA 2JRFA 1XD2A 2ZYGA 4HH0A 1LB1B 5GGYA 4EGQA 3SF8A 3IAHA 3JYPA 4R3NA 2B34A 1B8RA 2O3SA 3WKBA 3TH5A 2R8PA 4LRYA 4PPQA 2XWJI 5C35A 3FMIA 4OV2A 1YL7A 5A3QA 2W6ID 3ND5A 1VGVA 1DP4A 5T4FA 2RIPA 3I4FA 4MGZR 2EQAA 4MQFA 5C5EA 3IEPA 4CIAA 3DLIA 3W1VA 3GD7A 2WYUA 3IERA 1V5FA 3PCRB 4GICA 3A4LA 1SIWA 4YUZA 4PZPA 3D7SA 3E15A 2W37A 1SELA 3QH4A 4BV8A 5KOHA 1YFZA 4BJ5A 3HP7A 2ZT6A 1BMFA 3MZ0A 2FMKA 4DJDC 3PJFA 5GMOA 1WKVA 4DUGD 1CUHA 5DN9A 4EYSA 1GZ4A 1M66A 2QVXX 1MAHA 3MIIA 5I4BA 4CEIA 4HFMA 2R65A 3R0JA 3VO9A 1UOOA 3QHAA 5ISMA 4ZYUA 1M8GA 1MLDA 3MG9A 2QN3A 3WYNA 3AR2A 5A9SB 1C1YA 4LDQA 2PUWA 1E2GA 1HE8B 2PJDA 3P9KA 4FFNA 4AMYA 1RQGA 4UDXX 4URXR 1P1KA 2PCLA 3DC7A 2V9ZA 5ICGA 2C2XA 1WS6A 3VR6D 1W2WB 5ALJA 4CMBA 4BAZA 2ZS8A 1FLVA 4JP8A 3MMPA 4PGAA 2ZSUA 1VKZA 1COWA 1QHNA 2IBMA 1QNFA 3ICPA 4IVRA 1K8QA 3BHMA 3H4TA 1SB8A 4URYR 1BW9B 1JJFA 2JH9A 1JHPA 5CVDA 5DMXA 2J07A 3AY6A 4WLOA 2WD8A 3SBOA 2MDTA 2X5OA 5DM60 4MZLA 4YXWA 2O57A 1CUWA 2QGNA 3O2QB 5L8VA 2I6UA 4OFBA 5KYUB 4U8DA 3O21A 2JK1A 1EWVA 4Y8VA 2KI4B 3UXEA 1KK0A 1N2HA 1K08A 4M0LA 4TXNA 4DMUB 1P72A 2R84A 1DZ3A 3FYDA 2IH2A 1XVAA 2C96A 4EKDA 1FPWA 1QS0A 2IYPA 2FFAA 3O8QB 5BW6B 2HMWA 3DNFA 3M9WA 2WP8J 2O2DA 2CKDA 4NFYA 4I4TA 1K4KA 4J16C 4XQEA 1YR5A 1E9FA 3TG2A 1N0IA 4WLUA 4CMAA 3PJEA 1YQXA 4OA5A 4A1FA 2C4HA 2XZOA 4IDHA 1YAJA 3CTPA 4JLNA 2P65A 1N3YA 3ELYA 3ZV5A 4GFDA 3TJZA 3UIEA 3RBZA 2QVGA 4C5BA 3IH5A 4YV2A 3G17A 2OBLA 2JLXA 8ABPA 3PIRA 2I67A 1ECLA 3FCYA 1RFJA 3GG9A 4D0GA 1MIOB 1V47A 1T9KA 4DV7B 4F92B 1YS2X 3A6DA 2W0MA 1U8ZA 1Z8NA 1KDPA 1LKZA 4L3VA 4LA4A 2IPNA 2YCBA 3DMNA 2QN2A 3IV9A 4WQ2A 3F3YA 2E21A 4KITB 1H1TA 5E4JA 2HQOA 2A7XA 2IWRA 2H9YA 4JJKA 5MFPA 1JUOA 2QRQA 5CLQA 2BDTA 2R751 4GQIA 4M6WB 1MVOA 2QZSA 3FHJA 4J0KA 4UHKA 1RP7A 4YCSA 3ZEIA 5AXBA 5JC1A 3G79A 5CGQB 1V0JA 1NI4A 3GUUA 5K8VA 3AIIA 3IKLA 4EFMA 5EQFA 1YI1A 3GPDG 4DG8A 4WJLA 1N0VC 3TQHA 1P3JA 1PALA 4RZIA 4J7UA 4GEGA 5GZ1A 3T0GA 5AUNB 1IVYA 1HYBA 3AF3A 3EEYA 2AQ8A 2V3WA 2N46A 1MIHA 3EVRA 2R44A 4M8NE 1ZPDA 4A6PA 4C2UA 3X3HA 2YOFA 1JS1X 3QE9Y 2LVVA 2XR1A 1EWKA 1FYWA 2FOXA 3PR3A 2ZDHA 4U39A 3ND6A 2ZPAA 3ZZ0A 4H4CA 4R1UA 2G25A 4IX9A 5LDGA 3IDOA 3NNDA 1X70A 1U2SA 1VLHA 2AIRA 1DVIA 4OUDB 3M0WA 3FA2A 1X0XA 3U80A 2JHGA 4MYRA 3I6ZA 1SM4A 4JWKA 4N7JA 2IZ1A 3WWDA 1PHPA 3B6XA 5DK4A 1K63A 2Z5FA 3HWX1 3NAGA 5B6IA 4K05A 2QR2A 3L6EA 4Y6OA 5DGCA 2XZLA 4BBPA 4M89A 2V7UA 1H65A 1UT5A 4RD1A 5K20A 1F4QA 4L16A 1GV0A 1LEHA 2JH3A 5FNZA 5JV5A 1RJGA 3QTTA 1XZCA 2JHFA 5JNWA 3M3DA 2O8FB 2FRVA 5JDCC 3CO0S 1ORIA 4ZQFA 3BGOS 3FGPA 5ERXA 3NPAA 3IFSA 1DBRA 3FIAA 3H5RA 3OG9A 1MC5A 3KF9A 3L7CA 3UK0A 3AUTA 2ZS7A 1TCCA 3G1TA 1ZGGA 3W6OA 1DO2A 3CVJA 5JI3E 3CLTC 1ZOLA 1RXSA 2Y67A 1XHEA 4V03A 4DPKA 1DT3A 3MCVA 4Q02A 2O8DB 2Y05A 2RCYA 2WYHA 3ZNQA 5J1SB 1S2OA 4X7BA 1RI4A 2Q3FA 3OAAD 2Y1XA 1DELA 4EEKA 3O4GA 3FSGD 2GK6A 1VHQA 5KHOC 4FD3A 4WTOA 3TL6A 5JSUA 3AFMA 5MFZA 5CFRA 2ZIXA 2H08A 4H60A 4CCYA 3KQPA 3V1UA 4HNAB 3QA3E 3O3NB 5BSVA 1PQPA 2QX8A 3ZWOA 1UM9B 4RMIA 3BMQA 3WWOA 1S6CA 5K0EA 4LG1A 1FJHA 1QGED 2WD7A 2BKHB 3TAXA 1T1EA 3M83A 1DBSA 5DBIA 3HXQA 2DU8A 2LHLA 2JA1A 4YONB 1SQ0A 1B6GA 1IEVA 2VEDA 5THQA 1UBKS 5A3SA 3WR5A 3P2IA 4QTXA 2EFHB 5A5EA 5KWJA 3F5DA 3CMMA 1L9KA 3R7DA 5REQB 3AR6A 3FCCA 2DTXA 4EMSA 1W35A 3PNBA 3PUJA 1V1MB 2XDQA 1YUNA 1KFKB 1SCVA 2EP7A 1B47A 1NDUA 5FEMA 2DUMA 4K9OA 3BREA 4F3YA 1II9A 2IDKA 1RWXA 2SICE 3V34A 5DNAA 4QEZA 2E49A 2H48A 5D1HA 3UUFA 3O8DA 1G5FA 3WAKA 1NBME 1ZNXA 4MIEA 2Y1OA 1U0OC 1G59A 1N5MA 3VJMA 4MOWA 1TQ6A 3PCXA 1UPBA 1I6MA 1OI2A 4BWYA 1LWOA 4H3KB 1NHWA 4NWIA 4AYTA 1JHYA 4DQKA 3E9EA 2GO1A 1JEOA 2XH8A 1AUXA 1SD5A 3H6KA 1OT5A 5FOWA 1L8LA 2KPHA 5G4KA 3DFIA 1P4GA 3RR2A 3G49A 3L6BA 1ONSA 1I9CA 1XFXO 2G9NA 4O4HA 1RXCA 2CJWA 3M0EA 2HWKA 3PNOA 4G01B 5DIZA 3GWZA 3OCUA 4MYHA 1RRVA 1XTTA 1B3RA 1G20B 2GLTA 3P2KA 1QF7A 4C05A 1FDWA 1I80A 3EGDA 4GKJB 2GS9A 3ZK7A 3G9XA 4Y9RA 3CR8A 5J4HA 3UGTA 3IEKA 3ZDCA 2AFHE 2GZHA 2PUEA 3UYLA 4IZIA 4H1UA 4V0KA 1Z7WA 1LJUA 2KYFA 2D6FA 3DZDA 1TNXA 4PWZA 1PBNA 3IB3A 2I2BA 3WGKA 3MD0A 1U8YA 4BFCA 2VJMB 2R8ZA 4U7TB 5AI0A 1Q1GA 4P83A 3FOBA 3J81A 4RL6A 5EZQA 4HVLA 3KQHA 3MCUA 1UBLS 1RU3A 4ZEMA 3PUVA 4CHTA 4IIHA 3ECCA 3LY8A 2ODPA 1T13A 4F2WA 5IWAB 4MW6A 4HF7A 5KKAA 4D9GA 2ZT7A 5D1NA 5E7MA 3TECE 4HJRA 2XODA 5C8DA 3EVAA 1VRWA 1L2OC 2JLAA 1HK7A 5BV1A 5C32A 4NBSA 4Q7JB 3TWOA 4L28A 2Q2NA 2QMEA 5ARBA 2FETA 7MHTA 2OZVA 3HCEA 1HE2A 5ELLA 3GFGA 3VNUA 3KOWA 3MQ4A 4BNGA 2H1VA 1ZOTB 3BN3A 5IJAA 4EA6A 2FPIB 3OZDA 3WRWA 1YOVA 4CR8A 1IZ9A 3CKYA 4WUTA 5JYDA 1ZKDA 2H4HA 4H6VA 3IEMA 3TCNA 1YVLA 3UXHA 2G6TA 3VVMA 1Q0PA 4DR4B 1Z4OA 2DOKA 4O4JB 1YBMA 2QE7D 3E3LA 3GNSA 1EL4A 1KSMA 2TMGA 2CVZA 3F3KA 4YROA 2H7XA 1TJ3A 2GZMA 3HK2A 1SUCA 5SZJA 1BMOA 2E82A 4L85A 4DS7A 2ATCA 2GEKA 1O1YA 2VHTA 4Q9IA 4S24A 4MDHA 4E12A 4PPNA 4GBED 5U4QA 3RV3A 1L5WA 1MHPA 4RH0A 1GADO 3BA1A 4W7SA 3WJAA 3SQOA 1E3TA 1PE0A 1DC5A 2X2FA 4YJDA 4Y6SA 2R1VA 3ZGLA 1P2TA 2B92A 4NOMA 4R7GA 4DWOA 2D13A 4L7QA 3R9XB 2PRIA 3DAPA 3IODA 3WB2A 4BHTA 3CABA 4W8HA 3QIVA 1D04A 1BROA 4K3UA 2HDHA 1UBJS 3CRW1 3S68A 4D9JA 4LJRA 3VR4H 3FWNA 1KOJA 2PLRA 2E5FA 4TUYF 1KMMA 2HIHA 1CRQA 3ND9A 3PDIA 1GEGA 1TEZA 4R9VA 4ZWNA 1CY6A 3L1IA 4MYUA 5I7AA 2AS0A 1NN0A 4R6WA 2WNSA 2CCMA 1PIWA 3KVYA 3WO1A 2QS9A 2FJPA 4C7OA 1D0SA 1NTOA 1E3MA 1FRVA 2DTEA 2H7CA 5AERA 3V4FA 2FSIA 1NRWA 3ZBTA 3F6BX 1KNQA 4EW3A 1P73A 2YJNA 1EB9A 2I2AA 1KEWA 5JD3A 2IPXA 2VA9A 1X1SA 3R41A 3FSEA 1CDEA 3K9LA 3HRKA 2PS1A 4I1RA 4MV5A 1W46A 1E1KA 3QTBA 2NTEA 4Q0MA 1POXA 1F55A 4EL0A 2PX0A 3W8RA 4EQ6A 2GEBA 2W7TA 4EUSA 3HNOA 4BX0A 4DE5A 4LW8A 2P35A 3FE9A 4YR9A 4AKHA 2JLBA 4FKMA 1C50A 4UOQA 3SVLA 2C20A 4I8XA 2PPVA 3WBJA 3P4UA 1J2YA 3K1ZA 4RIGA 2V3CC 4LOLA 1UR5A 3RYHA 1CR4A 2WYOA 3DYIA 5F9MA 3IXMA 4XM1A 2WCKA 3GUCA 1XC7A 2QVLA 4P5PA 1UODA 3IPXA 2XE4A 5I4IA 1ILWA 3I01A 2H1WA 1OMVA 2EJCA 1QQ5A 2K7ZA 1SMKA 4RMHA 3OHMA 3A06A 1B93A 3Q7SA 2MINB 4WNCA 2E37A 4YFYA 3M82A 5EI5A 1QP8A 5BQPA 2V7XA 5JJGA 3HZHA 1FDTA 3BA6A 4RTRA 2X8LA 1H6BA 1BMQA 1ADBA 3FFBA 5AXCA 4JEUA 3T0IA 4E2ZA 1PR0A 4G41A 5BT8A 5JZ9A 5I5EA 1WDLA 2PKYX 5JQGF 2J5KA 5JJCA 2GQ0A 1U0TA 3K6SB 4G0QA 1N0YA 2UYQA 3DZFA 1ZG3A 2WU0A 2EATA 4ICBA 1H66A 3H4IA 5K8JB 4LVCA 3D0YB 1VKOA 2PWYA 3G59A 1AF7A 1KYXA 2BE6A 4H17A 2GJSA 4FU0A 2IBSA 4F1WA 4N65A 2UXBB 1J06A 4YCMA 5CD1A 4NMMA 3UNWA 1F3OA 1OVMA 2FVXA 2SKDA 3UN1A 3WNBA 4FMCB 1IQ3A 1MR3F 4HL6A 5AI6A 4F6RA 1GCOA 1JLKA 2PX3A 3E22A 4W5HA 5J3JA 4K6MA 5TDHA 1NE7A 4NONA 4ROSA 5E3IA 3GLHB 1TK9A 3FZQA 1YZNA 2O0MA 2MYPA 2BUBA 2PRKA 4TYNA 3M7IA 3EF3A 4ZV7A 2W4QA 4R5MA 1FLNA 4FZ3A 1GEEA 4P33A 3VYSB 4KQ9A 1CK4A 5KYVA 4U5QA 1IEWA 2E5WA 3OJWA 1NW5A 1KDTA 4B3FX 2YV2A 1Z2NX 5F6TA 4WGFA 4P5OE 4A6DA 3JVVA 1K5PA 1OREA 4UHFA 1T9ZA 1WZUA 3ISTA 5KS2A 1ORVA 2VRWA 5FUWA 4FD2A 1T6YA 2QG9A 4Z4CA 4RZXA 1P28A 4KE9A 3EC7A 2QTBA 4MP3A 5LB2A 4TKUB 3PGVA 1RRMA 3OFKA 1HM5A 3HVJA 3VMMA 1J7JA 3IX7A 4MN0A 4KX5A 4RDHA 2A9OA 2GB4A 1NKSA 3EASA 2JLVA 3FHLA 2GN6A 4BYGA 3H2YA 3OM1A 4KQWA 1LCIA 3TLAA 1AKYA 4KACA 5CLLA 4HATA 3ZK8A 2EP8A 1R8QA 4HEJA 1XQYA 5JAHA 5HK8A 621PA 1UOEA 1VG9B 2KX7A 4BQSA 2H1HA 3OY7A 3OO1A 1TF2A 4FCVA 1O2DA 2PSHA 1DKMA 1UKCA 1L4YA 3FJOA 1SJ9A 2NUTA 2FK8A 4ESOA 4PFQA 2NTJA 4RA6B 2ZNDA 4ZDIA 3IJ5A 3MJDA 5EJ9A 4FONA 4NYJQ 4YQZA 4QEKA 2XGJA 3A25A 2PZ8A 4F86A 2E30A 4G1MB 3KQTA 2H57A 4X63A 3HNPA 5I7OA 4NV0A 5MHTA 5IANA 4NFHA 3KSUA 4PNPA 5ED4A 5KTOA 3GRFA 2C7OA 1U3UA 1NLFA 3K0CA 4O25A 5CG2A 3ESAA 1JIIA 3IMGA 2V5UA 1I4WA 1V6CA 2ZKLA 3GK1A 3WAJA 4MLZA 3BD8A 1LW6E 2H7YA 4BGEA 3RSGA 1B8CA 1UHJA 1QYIA 4YBHB 3PI6A 2ECFA 4PZLA 2Y8EA 2COEA 3JQ7B 3OFVA 2VQFB 5AH0A 2PFKA 5DYYA 2G72A 1G19A 4YJFA 2J08A 3U7QA 4EUKA 3NCHA 1NTRA 1HE5A 1N0WA 5BQXA 1QIWA 3OP0A 1R2QA 5LR6A 2QW0X 1DG9A 3LCCA 1NRJB 4AF7A 5FYQA 1X0VA 2V98A 4C0QC 1IUOA 3UMVA 2V6BA 4TTVA 1R4NA 3T7IA 2A0YA 3V1YA 5LIRA 1G5IA 1XFAA 1PRYA 1QU3A 1GU0A 1VG1A 2ZQYA 3DBRA 5EWJA 3VDXA 3GQVA 2BOVA 4ZYTA 4RTPA 1Z5ZA 2PFGA 2CNPA 1OW3B 1DC7A 1X7YA 1V5GA 4DLYA 5H3LA 1RM3A 2PJUA 5KAPA 1V9CA 1P31A 2VDJA 4YPVA 10MHA 4TWJA 1HF3A 1Y3BE 4QDKA 3AEXA 1PZNA 3NJRA 4ARIA 4UDNA 4YMHA 2R8EA 5AVQA 3GLFB<