4C0JA

Crystal structure of drosophila miro ef hand and cgtpase domains in the apo state (apo-miros)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
404
structure length
404
Chain Sequence
ELTSACKKSLVRIFKICDIDGDNLLNDYELNLFQRRCFNTPLQPQILDEVKAVIQKNVPDGIYNDAVTLKGFLFLHCLFIQRGRNETTWAVLRRFGYNDQLEMCQEYLRPPLKIPPGSSTELSHRGQQFLIAVFERYDRDGDGALSPEEHKMLFSTCPAAPWSYSTDIRKSCPINETTGWVTLHGWLCRWTLMTLIDVVKTMEYLAYLGFNVHENDSQLAAIHVTRERRIDLAKRQSSRSVYKCHVIGPKGSGKTGMCRGFLVEDMHKLIGKEFKTNVVNCINSVQVYGQEKHLILRDIDVRHALDPLQPQEVNCDVACLVYDSSNPRSFEYVARIYIKYYAESKIPVMIVGTKCDMDERRQDYLMQPSEFCDKYKLLPPHLFSLKTNKKELYTKLATMAAFPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Coupling of the EF Hand and C-Terminal Gtpase Domains in the Mitochondrial Protein Miro.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase
molecule keywords MITOCHONDRIAL RHO GTPASE
total genus 116
structure length 404
sequence length 404
ec nomenclature ec 3.6.5.-:
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
A PF08355 EF_assoc_1 EF hand associated
A PF08356 EF_assoc_2 EF hand associated
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0jA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0jA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4c0jA03
5B57C 2AKAB 4CEJA 2ZRJA 2TN4A 5J3XA 3GOFA 1HT9A 1DJHA 1N2CE 1G6OA 1P2SA 4HB0A 1HA3A 1UBEA 4X8MA 1XU4A 2A30A 2YJTD 4PANA 1S9DA 2G9NA 3RRMA 3H86A 1KWOB 3CS1A 3BAFA 3L8ZA 3LBIA 4V03A 5FPKA 3VX4A 1KAGA 5CM9C 5G40A 3IHWA 2ZREA 3E5HA 4KFSA 2ONJA 4F91B 2CE2X 2PLRA 5EE0A 2RGDA 4B75A 1COWA 4YMTA 4LPKA 4KI0A 2BBSA 3VRPA 3IO5A 4MRRA 2WIBA 4EPVA 4QGAA 4TN1A 1H8EA 1YR9A 1ZINA 4DUGD 5LD2C 3AVUA 2NPFA 3I5FB 1P5ZB 4OYHA 1EJ3A 2OFWA 1IXSB 4Q01A 3UKDA 5EP2A 2LANA 2IYVA 2FSIA 4JBWA 4B73A 1ALWA 1IN6A 1IONA 2ZRNA 2A2ZA 3HU3A 4DIRA 5D7FA 3VMFA 3BYAA 3DHWC 4MKIA 4NMMA 4AOMA 2M7NA 1VG9B 3WNBA 1Y1XA 4GMXA 4TQAA 1GP2A 1SCMC 1FL9A 1NX2A 1BR4B 3SIAA 3T1VA 1Q12A 4G5OA 3TUJC 8OHMA 2Y5IA 3VRNA 4E03A 5JJLA 4W5HA 1MXEA 3CLNA 1QIVA 2QU8A 4ITRC 4B33A 3BERA 1UKVY 1MH1A 1A1VA 2OM2A 3BRWD 5AWFC 3UXMA 4BUJA 2ZM5A 1BF5A 1V1FA 2QG6A 2A5YB 2JASA 2WCFA 1GRNA 1KSMA 1GNRA 2NCOA 3M1IA 1KO4A 1PUJA 4QBFA 5F9FA 4B6EA 5IRCD 1ZIPA 1XJ0A 5J4VA 1ZNXA 3MFYA 4LYFA 1MOZA 4OL0A 3KPXA 3PATA 2Z4SA 1OHHA 3F8TA 4QGGA 2CMKA 1OYWA 2V4ZA 3HYTA 1GQMA 4WQ3A 1YVDA 2DHRA 4GOXA 5EP3A 2A4JA 2VQSA 2IS1A 4H1UA 1SKQA 3EK7A 1ANKA 4OKHA 3BB3A 2XNDD 5TB5A 1NCXA 2WJJA 3CWQA 1IOZA 4MZLA 1S3GA 3SS8A 2BMEA 1TPZA 3DDCA 2AFHE 3MSEB 3PJRA 1QX5B 2RAPA 3SFZA 1IJEA 2ZJ2A 4DSNA 4LHXA 3HWSA 1QHIA 2O8EA 2Z5FA 1UEIA 3OHMB 1IY0A 3H1TA 2XGJA 4HB3A 3MJRA 1CKKA 1KMHA 1NMZA 1ODFA 4DEXA 1S4QA 1G21E 3OEEA 3MGCA 1NP8A 3PUXA 1W0JA 5J5CA 3VU9A 2NZJA 4N1FA 1JNYA 3WP1B 5L3VA 4LV6A 1AA9A 1CLUA 2B7BA 2K7BA 3BB1A 4FW9A 4HI0E 1GVNB 1KAOA 1WDCC 4M2QA 1DJXA 1ZU4A 1Z6YA 4XD7D 4YGEB 3QE0A 1OOJA 4HLUC 2AK3A 2GF9A 1XTIA 3QXHA 4DLRA 3B1ZA 2IYXA 1KCYA 3PIRA 4M0LA 2KFFA 1MT0A 3OF5A 1II0A 3X1XA 5FUXA 1ZCAA 3QJYA 1M31A 1US8B 1E69A 1JAHA 1G4YR 1EXMA 1QVAA 1P7CA 4Q1EA 4Q4HB 1KO1A 1E9CA 3ZQJA 4LY6A 1K9UA 5GJVC 4XYNA 3U7FB 1ZMZA 2JIZA 3FVQA 1NVVR 3DVJA 3W3ZB 1SPYA 5CDFE 1GL9B 1ZBDA 2ZPTX 3B2EA 3KXIA 3FYHA 2JGNA 2WORA 4NYJQ 3R8CA 1IN7A 2OE2A 4C9BA 1R10A 2WWIA 3QI2A 4A1FA 1H8HA 4HRGA 2L0PA 4MBEA 2UZ3A 4NKRA 1Q44A 2P0EA 1XTSA 1Z29A 1E9FA 1WP9A 3AVWA 3LO5A 5F98A 3W34A 4LJ9A 2GGZA 3KXLA 4ZIRB 1G7CA 3VNVA 4D81A 2LHIA 1J7PA 1Q20A 1QZXA 2FZ4A 2JLRA 2LLTA 3IQWA 1YR8A 4FD2A 2R6AA 3CH5A 4QJ5A 5JI3E 2L50A 3PFVA 1FW6A 4B2PA 1O3YA 1S6CA 1XX6A 1XZQA 2IYQA 5J4KA 2VP0A 1Y1AA 1T5IA 2NPIA 4GBMA 3AKCA 4QL3A 1U2RA 2FH5B 2F3RA 1WF3A 4A9AA 4AC9A 1CFDA 3FIAA 2XTZA 1K5DA 5DKQA 1KFXS 4MUAA 2CNWD 5J4LA 2V7QA 1J8MF 2GCPA 1UHHA 3I8XA 1L7VC 4IVRA 1OV4A 5HCIA 1U9IC 3ND8A 4NHOA 4HDOB 4WOPA 1KQMC 5AXIA 4KU4A 5A4JA 4DBLC 4M53A 4TQUS 2JQ6A 2PL3A 5CSNA 3BH6A 1U9IA 5J40A 1JECA 2IXEA 3CLVA 1G3IA 3GJ6A 4LYAA 2R6GA 2AK2A 2WOOA 5GVSA 1X1RA 1T0JB 5KPJA 5JJGA 4DLSA 4CEHA 3WXMA 2BWJA 3DKVA 2F1JA 1GG2A 3I8SA 3PVSA 1RZ3A 3CIOA 1G7RA 4URYR 2ZRSA 2M3WA 1Z28A 2J45A 2BEJA 4UNQA 2IWRA 3THWA 4QJ3A 1JQJC 5KDDA 3BOSA 3NWJA 3PG5A 2IYYA 4M22A 2NO1A 1MKYA 1NG1A 2GKSA 4HUQA 4NE2A 4O2LA 2CL7X 3ZZ0A 3T34A 4IFEA 1GM5A 5D3MB 2QBYB 4EJSA 5CPVA 1G18A 1AKEA 1SHKA 3K0CA 1Z3IX 4DCVA 1PVAA 1U8YA 4A2WA 1C7WA 4JLVA 2ERXA 3GLGE 4QG7A 1CRPA 3DZDA 3QRXA 1UKYA 2QE7A 1VPLA 1Q1EA 3DVKA 3NSKA 5D69A 2V8OA 5EUMA 1C9KA 2J0VA 2AL7A 2VSXA 3PM8A 3ZLJA 4Q4AA 4TYYA 3THXA 5EE1A 2F3YA 5BYJA 1XXHA 3ZVLA 5J4YA 4WW0A 2QMOA 2XEXA 3NBFA 1JR6A 5EZ5A 2FCDA 4IKEA 4WIAA 3B1VA 1AK8A 4B3DA 3LX8A 1XK4C 1TEXA 1CLMA 2JIZD 4BZPA 1VCIA 3AM1A 2M7LA 1E0AA 3FMOB 3WHUB 221PA 1DVIA 2ZYVX 5DYGA 4M1SA 5FOWA 1TNDA 3AVOA 1N5LA 5FPSA 2IUTA 2ASEA 3I72A 5KUTA 6Q21A 2O8BA 2GDJA 5IBWA 1XTJA 1GL6A 1X6VA 2QTVB 3O47A 3NG1A 4NH0A 5TVKA 3CZQA 4PPFA 4MSPA 5KSYA 1S26D 4UNSA 3U6BA 4BRUA 1E94E 3O6BA 4AG5A 1OE9B 3AV0B 1KK1A 4FMCB 1PK0D 1UDWA 4TMXA 3FHTA 3GFTA 3CO5A 1CLLA 3DM5A 3LXXA 3W3AA 3ECCA 1W4RA 2ZUCA 4IL1A 1XMSA 2H16A 3BXZA 2I2RE 1R6PA 3CR8A 4MKHA 3RC3A 3N5CA 4EDHA 1W48A 1XEXB 1Z0AA 2XTNA 1SL7A 3QPVA 3R7WB 2GTPA 2M97A 4B47A 4RFVA 1W36D 4OI2A 1ZJ6A 3DZ8A 2GAOA 5JRJA 5EXPA 4KHZA 2OS8B 3W9YA 4WRIA 1JFKA 1G1MA 4Z8XA 5G41A 3D0YB 2PBRA 1Y3AA 3QKRA 5G53C 3W6OA 4HREE 2D74A 2BE6A 5F6TA 1N6NA 4G3XA 4C2UA 1CM4A 1G7TA 2YINC 1SXJE 2ZR9A 4WAUA 1OHHD 5JWOA 2CL6X 4FMCF 2ONKA 5AUOB 4RD6A 2ZE8A 1I4TD 4QRHA 3T1TA 2ATXA 2VTKA 4GI7A 2ZJOA 4CT5A 1G3RA 2H61C 2P6NA 4LX0A 2ZRKA 4C7OA 3H4SE 2NO0A 2Q3FA 3OX6A 3NDBB 2F3ZA 2R8RA 3TDZA 1ZW6A 2BCJQ 1TU4A 2CEAA 2KE5A 1DF0A 2OBMA 2ORWA 3K0AA 1OH7A 3RC8A 1IBRA 4GP6A 1H8ED 1A75B 2M0RA 1OFUX 3M6AA 3NBZC 5CSJA 3K1JA 2ANCA 3V4FA 1IN8A 4KVGA 1E2FA 4IVQA 1KSGA 3QSYA 1WA5A 2L98A 2HUPA 2QPTA 2G9BA 3BFKA 1K93D 3GK2A 1E2IA 2ZJAA 1JJ7A 1ZNYA 1N5KA 4PE1A 3UMRA 2VSOA 3RWMB 5SZKB 1H4BA 4KLZA 2YC4C 4QXAA 1P60A 1NNEA 2DPXA 3U60B 4OQMA 3K70B 2PASA 1XD8A 1ZC3A 1P2UA 4OI1A 5KYKA 2QTHA 1GNQA 1VYTA 1SL8A 2G0NA 2JULA 4TL8A 4Z54A 1UBFA 1LF5A 3CX7A 2QZ4A 2VSFA 4OI0A 2JXLA 4DDUA 2O8CA 1L4YA 5DI9A 2FOLA 2IWHA 3I5IC 2P2LA 3PUVA 4JLBA 2P3SA 5TV2A 4KYUA 2O60A 1QV1A 2HDNB 1ZP6A 2H92A 3B5JA 2HPSA 1JF0A 2F7SA 4AKEA 1BIFA 2RHMA 1DVRA 1XPOA 4DCNA 1SXJB 1NJFA 3LY5A 3TUYB 1YZGA 3OAAA 2BKHB 4I5LB 3ICBA 1QG4A 1K2HA 1Z22A 3PR1A 3W6PA 1SY9A 4I5KA 1QF9A 2W2XA 3RRNA 2ZAMA 4PZLA 4HAXA 3UWKA 3OEHA 1TUIA 1QTXA 2IS9A 1RFJA 1PJRA 4EPWA 2IS4A 2FV8A 4UKDA 1AN0A 3ASYA 2DFTA 1NIJA 1IH0A 3TW8B 1SK6D 2EGDA 1QHGA 4KV9A 2QTFA 4ETOA 4P33A 4MZJA 2XAUA 2F1RA 2XTMA 3CPEA 1XTKA 2LHLA 4JYBA 1PRWA 1OFIA 2W6JD 2Z0MA 1E0JA 4AURA 3MWYW 5L3QA 1GKIA 3EWSA 1CBUA 2ZSEA 2QT0A 4XVQA 1FOEB 2DWPA 1KMQA 3GK1A 1CNPA 3PCRB 1OE0A 3NEYA 5FTJA 4BECA 3WMFA 5CB6A 1VG1A 4PZYA 3WYAA 4RD4A 3U3RA 4BRWA 1R5OA 1G4AE 1VECA 1NVUQ 4PE4A 3BS4A 1YRBA 3AGPA 4AYWA 2JJ2A 2JJ2D 1EESA 4GOKA 2MSDB 4TYNA 3QBVA 4Q4JB 1DARA 2K7DA 3I5YA 4CRWB 1I2DA 2EFGA 2KAYA 5KDOA 3I5GB 2WV9A 1XJQA 5FI0B 4B74A 3A8RA 1KJWA 3IQQA 5ER5A 3EC2A 2ORIA 4GT1A 1C07A 5FTNA 4LYHA 3CF0A 3RVBA 4V0LA 5AJZA 4EIWA 2MAZA 3TLXA 1TTXA 3CRRA 5CB8A 1Z0JA 4XTCS 3WYFA 4LC0A 4CVNA 1RROA 2OEPA 1FX0B 4PZZA 1CMGA 2ZRLA 3D8BA 2GA8A 2GESA 4B2LA 3BUOB 2V1UA 4B3BA 2PMYA 5C18A 1KI8A 3T1QA 1XCMA 1OIXA 3LNCA 2G1KA 4IDHA 4PSAA 4QGHA 2PRUA 2LM5A 4GDFA 1S36A 1Y6WA 1JFJA 2P6UA 5DI3A 3GEEA 1YZUA 4TTRA 2DWOA 4NDBA 1K94A 1OQPA 4PSVA 3K9HA 3DMNA 2XZOA 3RS5A 2GJAA 1R8SA 2BM0A 1FMLA 4D4JA 2RGBA 3PUYA 2VP2A 1BT6A 3LD9A 4NCKA 4FIDA 1S3SA 1KJYA 1N6IA 2F8PA 4FMBB 2M49B 1AK2A 1DAHA 1U8AA 3D3QA 1RRGA 4RKFA 5JLJA 1AJ5A 3HPQA 5BN5A 3I32A 1XA5A 4P0TA 4PO9A 2HQWA 3FKSA 4A4CA 3RDPA 1G8YA 2C5LA 3UK6A 5BW8A 1AJEA 1CFPA 5AUPB 3LQQA 2OPOA 2JPTA 5J47A 3T61A 2RGGA 1NYAA 1R6BX 1U99A 3JVTB 4P2YB 3P27A 1TQ6A 4X8OA 2EC6C 1JF2A 1KO5A 2J46A 3ZZUA 1F55A 3TJZA 2NIPA 2VL7A 521PA 1KSHA 3MWLA 2QAGC 3DPUA 4P31A 4BLSA 5JEEA 1GNPA 4IDPA 1YRAA 4DB2A 2F2OA 2JU0A 5CIQA 3I5IB 3IHLA 1MF8B 1HQVA 2W0SA 1SGWA 3Q7QA 5IK2D 1DO0A 4AKIA 2VBCA 1OIVA 2Q9BA 4US2R 3V00A 3EX7C 2PMDA 3VRQA 2ZI3A 4OK6A 3QBTA 1E98A 1KJZA 2WJVA 4JKIA 5JECA 1Z6XA 2DR3A 2VA8A 3V4RA 1A2BA 2QGNA 2X1VA 4CGZA 1MUXA 2E30A 1LY1A 1AS0A 2I4IA 4OKSA 3QF4B 1FMJA 4PHFA 2DFNA 1B47A 1FF1A 4R71A 5KNDA 3U4QB 4KXFB 1J2JA 4XH9B 1G5RA 4PQYA 3G0HA 2QE7D 1EG4A 2LVIA 1JR3A 1QHNA 4KVAA 1XMVA 2C78A 2GK7A 3BUWB 1GTVA 2R6DA 3HPRA 4G5RA 4M2LA 4LYJA 3O2PA 2HCBA 3KQKA 2B21A 1T9HA 3OFNA 4RFSA 4E22A 1XPRA 4A8JA 2ATVA 4PC1A 3P4XA 1VG0B 2G0TA 2OBNA 3QG5A 3JVVA 4ZKEA 1T4GA 4HAVA 2W83A 3BFVA 3NC1C 1J7OA 1J7QA 1D9XA 5KDLA 2CK3A 2EFHB 1BMOA 2EYUA 1L8QA 2YVUA 1S6IA 4PC6A 2BMJA 3TAUA 2OXRA 3SYNA 1RIFA 1EWRA 2W2TA 2W6IA 4KITB 4DB4A 3FWBA 3BQ3A 1J7KA 4TMVA 3TIFA 4C0KA 2CT9A 2PALA 3EKJA 4LV8B 2Q91A 1W44A 1E96A 2ZRTA 3K9GA 1SR6C 3CUEF 1AVSA 1KI7A 2ZYWX 5TY0A 4URXR 1K96A 1WQ1R 2JXCA 3OE7A 4QHSA 2FCEA 4TMKA 4TMWA 1W5TA 4GNKA 2OBLA 621PA 4WBSA 3GLIE 4YMWA 5LBIA 4ASUD 2JLXA 3LL8B 1KHTA 2BBTA 2NGRA 2V7QD 4PO8A 3SR0A 4A8JC 2HEIA 4C0SA 3EPLA 3ADBA 3GLIB 2KFGA 5GQQC 1E1RD 3NEJA 1QHYA 5KPDA 2VHUA 1SYMA 4Q9KA 1E79D 2B7CA 4JZKA 4RSGA 1DAIA 1E99A 1SL9A 1CULC 4TZ0A 3QUSA 1G20E 2GETA 4LOAA 3BK7A 4LSGA 2ZRHA 4Y0AA 5FOUA 1NG9A 2QAGA 1DAGA 5KO2A 2FOTA 3W5JA 5HZHA 5BYKA 2WZQA 4XIGS 1M63B 1TNXA 4NU0A 4B3FX 3I5FC 4WZ6A 2UVQA 1EFHA 2LNKA 1XRJA 1WRLA 5HKWA 3L0OA 3FPAA 4LBYA 3BGWA 1CJKC 3SJAA 5GADl 3CR2A 1T3SA 3LAWA 4JLNA 2LUXA 4O3MA 2QP4A 4U02A 2CL0X 4GFDA 1KK0A 3IQOA 4RD0A 4KODA 4JBXA 4RCZA 4LHZA 2JJ8A 1TCOB 2BDTA 2XZPA 1NPQA 1PLJA 3WHLA 1M74A 1DJZA 1QVIY 4ORCB 4XVRA 3QPWA 3A37A 3NH6A 4L9WA 3SJCA 1UHJA 3K0FB 4M2OA 4HRHA 1ZMXA 2BKEA 5B2ZA 4MRXA 4NCJA 5KU1A 3ZIAA 5TNCA 4FWTA 1CR2A 4U8DA 1Z07A 3O8DA 4Q02A 2K5UA 2AX4A 1Y0VH 1DO2A 2OAQ1 4CFQA 4LDJA 1Z0DA 5CSIA 4TLAA 1FQJA 5AJYA 2KI6C 3E3RA 2WWYA 1J55A 1KI6A 4ICBA 3B1XA 3HU1A 3QXCA 4Q1BA 2KQYA 2ZS8A 5TDHA 3DOFA 4JL5A 3VFDA 2QN6A 3A4MA 5LB2A 3DM9B 4G1UC 5ANRB 1RC8A 3RAPR 2JT8A 3DOEA 1ZVQA 1SNLA 2VO1A 1MWNA 4GGFC 2JA1A 4MRYA 3OB2B 1KSFX 1SKYE 1JR3E 2WJYA 2Z6VA 1WY9A 4TLCA 2CK3D 3VR2A 3M0WA 4AKGA 2C04A 1ZIOA 1TU3A 3EASA 2MLEC 4GPLB 4N0DA 4AD8A 3BOWB 2F3TA 4TQ9A 4NL4H 5DE3A 5DYIA 4ESVA 4NBSA 4YMUA 2H8KA 1UHNA 4NQGA 2WKRA 1JUOA 4O2RA 4B48A 2WSSD 1BOCA 2XITA 4A2PA 1WDTA 3AKYA 2ZN8A 3K21A 1P6XA 1YZNA 5KTYA 1GILA 4PPGA 3TVDA 5JSZA 3KEVA 2GEUA 1S3PA 5I2OA 2KWIA 3QOFA 1EWQA 2DWQA 5LPNA 4WXPA 3H4MA 3QIAA 4TT3D 3TUYC 4LHYA 2CHVA 4P5OE 5DH9A 4EPXA 4QC2A 3K70C 4C0JA 5FR2A 1GGZA 4D4MA 1SVIA 1VKJA 2WAYA 1TQ4A 4L8GA 2NG1A 1XEWX 3C41J 4DCSA 2PEYA 1X8JA 2VRGA 1E2GA 2BBNA 3A1WA 3FMFA 3NXSA 1N6PA 4U5XA 4Z8YA 5IK2A 2ZI5A 1KTVA 2RGNA 1N5JA 1EX7A 4PHGA 4Q4AB 2AN9A 1S5GY 1IAQA 2D2FA 2GXUA 3HU2A 3K53A 1HT1E 2VHJA 1Z83A 3T15A 4LUCA 2CTNA 4J0QA 1E4YA 2ZUDA 3VGOA 1E2MA 1NLFA 4OJQA 5JJIA 3CZPA 3SQXA 4JLAA 4MQBA 2L4HA 2X77A 1A2XA 2M8UA 1NL3A 2YV5A 1JAIA 2QI9C 1RKBA 3QEJA 3KJGA 4QKQA 1E2NA 2N46A 2P5SA 4DLZA 2OG2A 4Z51A 3AP2A 2ZNEA 2TMKA 1BYIA 4MGYR 1BG1A 2XXAA 3KJHA 5FTMA 3JTDC 3OEED 2KDHA 1D2NA 3TUIC 2HF5A 5M04A 3R9WA 3KKQA 5FUYA 2IS6A 4MZKA 4N0EA 2FNAA 2F43B 2HLDA 2JWWA 2RB4A 2WJHA 2FX3A 1QBKC 2AMIA 4YGCB 1DPFA 3HJNA 2C77A 2C9OA 4Q7LA 5FBQB 1F2TB 2O0HA 2GJKA 1II8A 2AR7A 3VX3A 2LP3A 1F48A 2MBXA 2K8MB 3WNXB 2VLIA 4EFMA 4QM6A 4MITA 4B76A 1G8IA 1VIYA 4JJKA 1NJGA 2LMTA 4GRAA 3NSLA 1JXMA 2QQEA 2PZGA 4GGNA 4LRWA 3LXRA 2PJRA 3KQUA 4MN0A 1KZ7B 1MO4A 4JBYA 3GCGA 4Q7JB 3BORA 1P3JA 3SIBA 1E1QA 3MCAA 3Q85A 4LJ4A 4DDWA 2O8DB 4D26A 3R20A 1B1GA 4ZI3A 1LINA 3AH8A 3JZMA 1XD2A 4UQOA 3C5CA 5FBLB 2IA5A 3CH4B 3D0YA 2LUCA 2VF8A 4F92B 1P9NA 2HF8A 5FTKA 2JLZA 1QHHA 4C0LA 1GDDA 1KI1A 2HXYA 5C2JB 1SHZA 4LHVA 3TQCA 2CLCX 1F71A 3AUYA 2IYUA 3IF7A 4V0ME 1G33A 3DD4A 1QVRA 1F54A 1W36C 1FUKA 3IUYA 5AJXA 1SQ5A 3PUWA 1PLKA 1Z0IA 4OQLA 3U44A 2ZXUA 3H2YA 2G88A 2EFEB 4HZUA 5ELXA 1ZNZA 3RS3A 3EZ7A 1YR7A 1KK3A 2YOFA 1F2UB 3K0AB 1NIPA 3SG3A 2ZI4A 1NMYA 2LCPA 1NP6A 2R6CA 2C95A 3G5UA 5SZJA 3CNOA 1MQ1A 1G8HA 1RJVA 1X02A 1KNQA 2G83A 3Q8XB 4AI6A 1W46A 4E07A 5JS8A 4M9QA 2XSZA 5HLOA 1EX6A 4GMDA 1W7JB 4JLDA 4G01B 4WVFA 1UWOA 1DBSA 3FWYA 3QKSB 3OB1B 1Z06A 2HLDD 1KK8C 1LS1A 3BH7A 3IBYA 3R9IA 1CFCA 1II9A 1MABA 5SZIA 4BY4A 5FPTA 4D4KA 2JOJA 4YBHB 1QHSA 4AY2A 3BB4A 3I3SR 1HTWA 1SVMA 1W47A 4DRWA 4I5JA 5SZHB 2H61A 2Y1MA 3K9NA 1NMXA 3UMSA 1X8LA 5B64A 2ZRIA 3W5IA 1NY5A 1SW8A 4M21A 3ND9A 5K8TA 2C98A 3PN7B 5DKNA 2YYZA 4V02A 3OIUA 4O25A 3P32A 4USLA 3I4LA 5KOYA 2ISDA 3OESA 1YR6A 4MH0R 4UXJA 1G3QA 3OEHD 4XJXA 4C0AC 4D80A 1EFCA 2VHCA 1U5IB 3CPJB 1HQYE 4IDQA 4DVGA 1R0XA 1SXJA 2OESA 2GCOB 2EWVA 1XFAA 4IXMA 5FOXA 3QPUA 1C4OA 4QOSA 2QMHA 1A29A 2WWWA 3KKOA 3A58B 3QXJA 4BGDA 5CYOA 2CCGA 4HATA 4ACAA 5JI2E 4YRUA 1QRAA 4IDOA 4DSOA 1KDTA 1CIPA 1EK0A 3EW9A 2J9RA 4KSBA 4US0R 4DLXA 4QFMA 2LAPA 4XJKA 4P4SB 4CEHB 1F4OA 2J7KA 4V0NA 3LBNA 1CDMA 5C4GB 4N5XA 1NRJB 3IEUA 2JLSA 1K9PA 3A4LA 5CSFA 1XWIA 5JS7A 2VYFA 2PCLA 4LK2A 4QJ3B 1JEEA 4TYQA 5TARA 2IX3A 4D82A 4PDZA 1R2QA 3E70C 3UG6A 3GLGA 2QM7A 2FJUB 1M34E 3BUMB 1SBJA 4Q1CA 1SVSA 1EH2A 1LB1B 3A36A 4S35A 5AJWA 2H57A 4XOIA 1A7JA 3GQBA 2LCFA 1KQMB 1E0SA 2QSZA 4OHXA 2VEDA 4U00A 2QRZA 1A4PA 4JLPA 2GF0A 1KZGB 2ZN9A 3A1TA 3TBKA 1VYVA 1SCMB 4TWZA 1OZOA 1VIAA 3MJHA 4I5NB 1P4SA 2GCNA 3LLUA 5P21A 1KWOC 2FPLA 2GVZC 2PLFA 3B6EA 4HAYA 1QX2A 1XXHB 1Z2CA 3ZS9A 2ZRBA 1RECA 1IG5A 1ZM4A 1X1SA 1NSHA 2ZJYA 3HP1A 2ZQ5A 2I3BA 2QUZA 1L2TA 1ZAKA 3KTAB 3NHAA 3T5DA 1TADA 1W5SA 4DDTA 2GJSA 2VP5A 3KF9A 5KSOA 1AP4A 2SASA 2ZRFA 1A4RA 5HZKA 1NCZA 3REGA 2GNOA 2ZI9A 3KB2A 2EYQA 1K90D 4M9ZA 3MMPA 2UZIR 3WY9A 4OQNA 1DJWA 3WHTB 3B1WA 1DJYA 3NC0C 3T5GA 2O8BB 4PHMA 1KFUL 1CFFA 1U8ZA 3B78A 5CK4A 3ZIAD 4HAZA 2KOTA 4EJSC 3ZD6A 1Q80A 1LFDB 1TOPA 1S96A 1BMFD 4UPGA 1G19A 2O5VA 3SJBA 2GRJA 2MSCB 1ZM2A 3PEUA 5DISB 3TKLA 2PJZA 4RZXA 1L7ZA 3U7HB 2VP9A 3C15C 3Q9LA 2GXSA 1ZCBA 4MDFA 1IXRC 1KDOA 3NSOA 2BOVA 4TTPA 2E87A 4XTRA 2J0QA 4JLMA 5I8NA 1YZLA 2QGZA 4NCNA 2J0UA 3RRZA 3L0IB 2FGJA 4R2IA 4C4PA 3KQNA 4MGIR 2BMFA 3DL0A 2RGAA 4NPHA 5F2EA 5TXGA 4KYIB 1JEDA 4PQRA 1G3UA 1FI6A 4Q4LA 2R6FA 1DT7B 1TQ2A 1KIMA 4BFWA 4M2PA 2QL6A 4B3CA 3GLHA 3HDTA 1IWQA 5IT5A 4CPVA 1TRFA 1K8RA 2O8EB 3UMFA 2W00A 3SG2A 1IGVA 2RHDA 3L0SA 2FE4A 1OFHA 2Z4RA 3JZAA 2G6BA 4GGFA 2O0KA 4LJ8A 1R2UA 4JS0A 2V9PA 2XOKA 4DIDA 1E1RA 4KSCA 4JJZA 3TZ1A 1LF0A 1YUSA 4PPNA 3T1OA 2WVJA 1OB2A 1K95A 1M7GA 4M1MA 1CJUC 4JVNA 3L2OB 1TNQA 2G77B 4HB2A 4DRZA 5A0FA 1CDLA 2CCJA 1K6MA 3U3JA 3ZVNA 3U3MA 1OH5A 1Y63A 2OFXA 3GEIA 1IQ5A 4V0MA 5LB4A 2AKYA 4FMDF 2ZJ5A 3CF2A 5FPHA 1AM4D 1ZYUA 2X8AA 2A5GA 4DJTA 1HE1C 5FH9A 2WOJA 1SKTA 4GUKA 1R0ZA 4AK9A 4QBIA 3PXGA 4F4IA 2H2KA 1F3OA 1MRNA 2ZSFA 3GP8A 5G3YA 4Z1MD 3U6KA 4IXNA 4QBHA 1OMRA 4Q1FA 1YVLA 2GHIA 3A1SA 3NXAA 5E95A 4AYTA 1XD9A 5EJEA 3IIJA 4BLOA 1NN0A 4OV2A 1E2LA 2VF7A 1RWYA 2LC5A 4CT4B 4ZV4A 3EPJA 3WYGA 2GZHA 4JLOA 4GL2A 1DADA 2QPOA 1AUIB 2GBLC 2RGIA 5CDFA 4HDCA 2JDIA 2YC2C 4NCIA 1GRRA 1XEWY 2GVDC 2HF9A 1GKUB 1H8BA 1KI2A 1FTNA 1NLYA 1UBGA 2FEMA 4Q5IA 2VP4A 2JDID 3GPLA 1E2QA 5KSPA 4OJKA 3B7GA 3TAHA 2EVWX 1FQKA 2IS2A 1DG3A 1ZUIA 1P61B 2OFOA 1CB1A 1XF9A 3GJ7A 3N2IA 1N6HA 2REBA 2HJGA 1L2OB 1LXFC 3RM1A 1J99A 4IFBA 4HAUA 2IW3A 3THYB 3O4YA 1R5NA 4PC3A 3CR7A 1KO8A 4KBFA 2Q9CA 2ZANA 3AVTA 2NXQA 3PEYA 3TNFA 3RHFA 2YHSA 3ZYCA 4POAA 1IY1A 2JRFA 2AXPA 1NVVQ 2OLKA 5EZ6B 1NI3A 1XP8A 2NMVA 4EQ6B 3P26A 1DGUA 1W7IB 3NDPA 4TMZA 3VHXA 1DEKA 2MSEB 4KBGA 5BWMA 1FTSA 3C16C 2W2VA 3AKBA 5DKRA 3K9LA 3TK1A 4JLJA 1ZUZA 3WMGA 421PA 1S1EA 2IYWA 1Q3HA 1V43A 1NBMA 4LJYA 1XJCA 4YDSA 2DBYA 3CKLA 1E8AA 1KY2A 2K0JA 2AXNA 2GEVA 2QP3A 2KSPA 2WPDD 2ZJ8A 2DYKA 2ERYA 1OFTA 2EQBA 1EL4A 1EFUA 1NX1A 3T12A 1JI0A 3DMDA 1T3HA 4NTZA 4DZZA 4MYCA 5L3SA 1B8RA 4B34A 1LVCD 2ZNDA 4II7A 1BU3A 3KUCA 4A2QA 4BQSA 5K8UA 4B44A 2ZI6A 4DCKA 4PE7A 1NN5A 1P9WA 4M1WA 4Q9JA 5CYPA 4HUQB 4RD1A 1B8CA 2HXSA 2ZRGA 3BD9A 4FINA 4R7ZA 4TYWA 5GJBA 2CE7A 1F60A 2ODNA 1FNMA 1FUUA 1SXJC 5BN4A 2VPPA 1H8HD 2WJIA 5F9HA 3IBGA 1JB1A 2J7PD 3AVQA 1UHKA 1KKMA 3C14C 2ANBA 4UNRA 3I5HC 2QSYA 1K8UA 4K46A 3HX4A 1G6HA 2FFQA 2V6IA 4B71A 5B30A 4CEIB 2PMKA 1ZD1A 1FPWA 1G8FA 4ZCUA 3KKPA 2NO6A 3C7KA 2GWHA 1RJ9A 3U5ZB 5D3QA 4JPZB 5CITA 5FTLA 4ZO4A 2R9VA 2KB0A 4LJ5A 4MYHA 5EE3A 2QMEA 2IT1A 5HE8A 4L9SA 2F6RA 2ZE6A 3CNLA 1XFXO 2QA5A 2ZS7A 2K2AA 4ZI2A 4OQXA 2ZI7A 3X1YA 1XVJA 1UJ2A 3AKEA 3CX6A 1PV4A 4XVUA 1AZSC 3Q3JB 4R98A 4OR9B 1RE0A 2JNFA 3FHOA 5CK5A 4ORBB 2BKUA 2H5EA 2BCGY 1N0UA 1EFRA 1B7TZ 1D2EA 4LZZA 1US8A 1RYFA 1IJFA 2CCKA 1OLOA 1M46A 4NYIQ 2GK6A 4QGFA 3TRFA 2FF7A 3KKMA 5AR1A 1LA0A 4YQFA 1MXLC 2GEDA 2OCBA 4LV5B 5FOSA 5PALA 4ZKDA 4A15A 1N6OA 2EFDB 1SCVA 5BN3A 3IGFA 3KFVA 4L4UA 2IHYA 1XBTA 4MDEA 1SVOA 1AS3A 1ZD8A 3CF6R 4KFTA 2ZR7A 1P62B 1WLMA 3OZXA 2V3CC 3GFPA 1YR5A 5FBRB 2WHXA 1B9AA 5HKZA 3GLFB 3VR6A 1ZNWA 1TF5A 2BMDA 1G17A 5GJWC 1E9EA 1NN3A 2IHBA 2NO9A 3IKJA 4K81B 1OJLA 2J5XA 4XSGA 1W36B 4PSKA 3RANA 2QRNA 1M8PA 3AF1A 4Q7KA 4N3NA 4IOMA 4TSFD 4JT4A 3VQTA 3TUZC 2M1UA 2ZU0C 4PHJA 5I2QA 4TZ6A 4W7SA 5EE9A 2FFBA 1YX7A 2J87A 3U61B 1SR6B 2AD1A 2CVHA 2L2EA 2OTGC 3ZS8A 2NZ0A 2PX0A 3FDIA 4D0NA 1I4DD 4PPQA 4YONB 1QS7A 4EUNA 4OK3A 4IOKA 2WTUA 4QJ4B 5EUQB 3JTDB 4BWYA 5B58C 1QATA 2LLUA 3SG4A 3KHEA 1T8TA 4BLRA 3ZD7A 1UUSA 3UIEA 4B6FA 3IDQA 1E1QD 1Q3TA 1W0KD 4GP7A 5A5GA 2N1BA 5E3HA 3QENA 4EKDA 3AVYA 4DUGA 4JSYA 3AB3A 1YKSA 2O0JA 3SEAA 3OAAD 3TH5A 5CJPA 4PALA 3FE2A 2Z83A 3HR7A 2EW1A 4S2EA 3UG7A 4DLUA 1P73A 1QDEA 3D31A 2SCPA 3I1FA 3U3KA 4CZ2A 3CRMA 3K8YA 3SN6A 3EPKA 3B13B 4I1OA 2WAXA 2R2AA 1NN1A 3K70D 1RFLA 2WKPA 5E7JA 1EG7A 3CZTX 2Q21A 1D6JA 2QY9A 5HPYB 1PULA 3SHFA 1J7RA 4DEYA 3I92A 2ZKMX 1HYQA 4KAXA 4C0QC 3R8FA 3SBEA 2LKCA 5K89A 3U4QA 1DE0A 2DFKB 2EC6B 3BC1A 5FL7D 2PSRA 5DSZA 2K61A 2ZIAA 3TQFA 3GLFE 4QJ5B 2XXAB 2V55B 2LVVA 4XWKA 2E1RA 1UKZA 1GKYA 2BIFA 5L3RA 3SYKA 1F5NA 2C9YA 2QM8A 3BWDD 1E0KA 1HQCA 1D1OA 2F43A 3FMIA 2MMGA 2W58A 4C2TA 1XFWO 3BE4A 2BEKA 4GSYA 3OIVA 2RMKA 4I1VA 2AHOA 1C1YA 4G0NA 1FNNA 1Y1UA 2ZYUX 3CRW1 4KO8A 1GSIA 1WE2A 3GJXC 3L8YA 4YMSA 5HCNA 2IYTA 2AFIE 4H1VA 3CR5X 5CJ2A 1PVOA 4YGDB 2XJ9A 4FCTA 4R1EA 2H1LA 4DHEA 3H84A 1NVXQ 4RZUA 5FUWA 4D0LB 1GJYA 1RYHA 4ABYA 2O8DA 4V0KA 4Q21A 1KDPA 4KFRA 4O0MA 1S1MA 2K7CA 4MKGA 3SYLA 3UATA 2LMVA 1GGWA 1IQPA 5AEQA 3KFXA 4TT3A 3K09A 1BJFA 5HTKA 3D6TB 4AWXA 1N6RA 2J3EA 2ZTSA 1JQLB 1QG2A 1ZOTB 4E09A 4G5GA 5CLLA 4RJLA 3IIKA 2YZ2A 2WSSA 2Q0HA 1U81A 4DLTA 4FWIB 3FHCB 4Q1DA 2ZUBA 4D4LA 1KSJA 3MRSA 4M1YA 3LBHA 4ZDJA 1IM2A 5D3MA 5LD2B 4URUR 3E2IA 2QBYA 5L3QB 2FPMA 3ADKA 2Y4QA 1HURA 2KI4B 4ZPXA 2Q9AA 4C30A 3I5XA 2WC8A 4Q9LA 4LBWA 5JFGA 5E4FA 2DOQA 1IHUA 1YZQA 1BOFA 3VKWA 1F8HA 1JPNA 3GJ3A 2CNPA 1OIWA 2E9SA 1XMIA 2WMNB 5FPYA 4V0OA 2JNXA 3IILA 1Q22A 3OHMA 3MAAC 2ODBA 3L43A 4UNPA 2ZR0A 4IEEA 3THXB 3HCMA 3KKNA 3GFOA 5FUVA 1IQ3A 3NHBA 3NH9A 4NYMR 4DLYA 3PLFB 2XNSA 5KSZA 5IF9A 2BKIB 2KQ6A 4PHKA 1JSAA 1N25A 2HYDA 4GZMA 3WBJA 4C7OB 1LA3A 5AERA 2A7QA 2OCYC 2YWFA 1EFRD 1XZPA 3GEHA 4HUTA 1DMOA 2FN4A 2PEZA 2P67A 3TMKA 4R2HA 2ECKA 5H1YA 1EXRA 1A75A 2KYCA 1MV5A 1CR1A 2CDNA 4DKXA 1T3LA 4A4DA 2Q4UA 4FCVA 1RK9A 5KNCA 3AVXA 4LBVA 3K0SA 2F55A 3A4UB 4LCBA 4MGKR 5FOVA 4ARZB 2BECA 3A8TA 3L82B 3VR5A 1Z6GA 3S1AA 2QROA 4HB4A 2BL0B 2MLFC 1HV8A 4PTLA 1KDRA 1G5TA 2BCAA 2KHNA 3K0CC 1E9AA 1PSRA 1N0VC 3WHKA 2CXJA 2WNDA 4NDCA 1HUQA 1VHLA 4P4TA 2IF0A 4RVCA 1IJ5A 2RKOA 2ZVQX 1CTRA 4EFNA 5H70A 4ZIRA 3VRRA 2C03A 3NKVA 1WB9A 4ORAB 2V53A 1X3SA 4A0FA 4E5UA 3SNHA 1M1YE 3O8BA 4DDVA 3CWZA 3OIWA 3I73A 3FS7A 3PENA 5DN6D 1AGRA 4BLQA 1E2HA 2JJ1A 4IDNA 1VRKA 3EC1A 5AANA 1DJGA 2FSFA 1TL7C 4OHYA 2OS8C 2LE9B 1TQDA 4YLGA 4CIDA 1KFUS 4B32A 1G8PA 1VCOA 2G3YA 2YNMA 3PFIA 3QVUA 4PQFA 2D06A 4ASUA 1ESMA 1NBMD 4HYYA 2A5DA 1E9RA 1TIZA 1Z6AA 2FSHA 3QXXA 4TMTA 1UPTA 4DLVA 3BUXB 1GL7A 2K7OA 4MVFA 1G3MA 2ZE7A 2ZS9A 1VHTA 3EARA 2NZ8A 3Q5DA 2L4IA 1L2OC 1YRTB 3UPUA 1NX0A 2WOSA 1VTKA 2O8FA 3BH0A 3DVMA 2LVJA 2NTYC 2BBWA 4AG6A 2QNRA 4FMDB 4RD3A 4ILEA 3LK0A 2WCBA 3PALA 4NCHA 2LLSA 1GITA 4Q7MB 3TR0A 1T8UA 4MA4A 4WZBE 4Q19A 1BODA 1Z8FA 2FZLA 2WMOB 4HZIA 1CR0A 2P6RA 4D25A 4CEJB 1X8KA 2GXQA 3OP0A 3IPYA 4FQOA 1Q21A 4CYMA 4EJSB 3U7GA 1TUEA 4D2IA 3IPXA 2KI6D 1W4AA 3QEOA 3QF4A 2JLUA 2HJVA 2MA2A 4TTQA 1LVGA 2B8WA 4NDZA 3EA5A 2ZRAA 3NVAA 4RZ3A 3GJ8A 2WWHA 3LH5A 5CLQA 4EFLA 2KSQA 1DAKA 4JT2A 2Q3MA 5DHAA 4MRSA 3D7MA 1S0UA 5H68A 2A5FA 5H8WA 2HT1A 4BFXA 5C46F 3QKUA 1PUIA 3LW8A 4B35A 2H18A 1I2MA 1UDXA 1QX7A 3MD0A 2J0UB 3MUFA 5EP4A 3WP0A 2R65A 4NP6A 1UHIA 1FZQA 4TYPA 1Z5ZA 4M4SA 2OV2A 2WWXA 4ZCIA 5EXTA 2ZRPA 1J1DA 2BJVA 2GBLA 4NYJR 1NCYA 3RS2A 4DSTA 5JOLA 1XCGB 4JMPA 4DSUA 2XOKD 2RCNA 3X1DA 2F2PA 4JQ0D 4B2IA 1OKKA 3AGQA 2WSMA 4XD7A 4BASA 4X8LA 4F4JA 4IRUB 4HEJA 2QENA 3EZ9A 2ORVA 2ZYTX 2OCAA 3FKSD 4OHWA 4OQFA 1LKJA 1K9KA 4LWZA 4QM7A 4DWJA 2Z43A 3NIBA 2A78A 4Q48A 5HE9A 3KQLA 1XEXA 5DN6A 1SKYB 1ZUHA 4OHZA 1YZKA 3MG9A 3O78A 2I7AA 3TS5C 3AQ4A 4L5BA 4ESHA 5ER4X 2IL1A 1P2VA 4DCTA 2F1HA 5JEDA 1E2JA 3QKTA 3GLHE 4ERNA 4ZDWA 2KNEA 3SI7A 2FU5C 4F4CA 2J0SA 1W49A 2JLWA 2IXFA 2YKGA 3X2SA 4KFUA 2IUUA 1CDPA 4CLNA 1S2MA 1X86B 1KMHB 3PITA 3M0EA 2L5XB 2CJWA 4Q9IA 3LVQE 4RY2A 1U0LA 1ZFSA 4I4LA 4L15A 1OMVA 1UFQA 4M8NE 5EP1A 4X8HA 1XK4A 5EQTA 2OT3B 1OXSC 1V5WA 2FFAA 1BKDR 2GJ9A 1GIAA 4W5JA 3DO6A 1YZTA 3HYRA 4UXIA 3F45A 4LGMA 3K0FA 2REXB 3GJ4A 2ZETA 3QY0A 4KCGA 1GOTA 2HV8A 3V9PA 2OAP1 3RSOA 3T06B 4Q1AA 1T0HB 5EXSA 4M9SA 3EG5A 2QQ0A 2OZEA 4P32A 1FX0A 2OSBA 4YI8A 1KK8B 1WMSA 2PH1A 2PT7A 2ZJZA 1LS6A 4PC7A 4CDGA 2R62A 1RRCA 5DGXA 1G7SA 4A36A 1LV7A 1HEIA 3IIMA 4JL6A 1UP5A 2PVBA 1F70A 3AF0A 3T35A 4A0GA 3QQ5A 1P72A 2D3WA 2N42A 1KI3A 3NSIA 2WBLC 3FKQA 1YVHA 4F93B 1G8GA 5DI3B 2ZE5A 1OSAA 1XNJA 2GCOA 4US1R 1N3BA 3CX8A 2BM1A 4Y0VA 5G08A 1I4LD 1NF3A 2Q6TA 2C96A 2MMCA 5DO9A 5JHHB 2HYIC 1D9ZA 2KJQA 4ZDKA 1VCNA 2EFCB 1UKEA 1OH8A 4JKYA 5CM8B 4A82A 1G5PA 2XZLA 2K2FA 2KGBC 4GBAA 5B8IB 2AWOA 3CONA 3FGNA 3FTQA 4PFSA 1U90A 1WRBA 2GJ8A 3DF0A 4LJ6A 4DT1A 3BBPA 4P4UA 4BFTA 1QVIZ 2M29A 5AK0A 4M1TA 4A8JB 2FDCA 4BPBA 3BFXA 1DAFA 2P6BB 2HQ8A 1XB2A 3F5FA 3ZDQA 3VROA 1OT3A 5JSZB 4FXPA 1AHRA 1JPJA 4LI0A 2GGMA 1PLLA 3EWAA 2HETA 4PHNA 2NQ2C 1IXZA 1OB5A 3Q7PA 3SG6A 1KYIA 1Q1BA 5JWHA 1NSFA 1WRZA 5I2LA 2KBEA 2KI5A 4D0GA 1YQTA 4CEIA 1LTQA 5KHOC 1OXXK 1RVDA 1MHOA 5JCPA 2FSGA 2CBLA 1J70A 3AKAA 4PE0A 3TSOA 3ZVRA 1AIPA 1CKEA 2DY1A 2B8TA 3H0KA 1SXJD 1LNZA 1ZM7A 1NWDA 1SVWA 3ZGXA 4BFVA 3KUDA 1YUUA 2YOHA 4Q03A 121PA 1R0WA 1W2GA 2M1KB 4LBZA 3EIHA 4GPTA 2G2BA 3OX5A 1R8QA 1W2HA 1YE8A 1QASA 4I81A 4E68A 3VR3A 3JVUA 2IUSA 4PAOA 3GJ0A 2A3RA 2I18A 2OHFA 2P65A 1GZSA 2JTZA 3B1YA 3U7EB 2XB2A 4PXAA 1WBBA 3DVEA 1CMFA 1KK2A 1OSNA 1ZM3A 2IXGA 2F9LA 1M6NA 3LLMA 5AUQA 2Y8EA 4TLEA 2XSZD 2J1LA 3CB4A 3PUZA 3CBQA 1CJMA 2VHTA 4OBEA 3RLFA 821PA 4CFRA 1QV0A 2QMUA 1L4UA 1KI4A 2ZJBA 2KYFA 4WZAE 4OK5A 5JJKA 1KSOA 1GWNA 3SJZA 4Q4JA 3MSXA 1Z63A 3I62A 4LPSA 1JJVA 1MO5A 2X19A 4MYTA 4UJ5A 1FP7A 4QNMA 4N1GA 2AWNA 1DG1G 1UADA 4EPRA 2J59A 3VR1A 1NBME 2CHGA 1DAMA 4OCIA 2L51A 4EPTA 5GVRA 3GD7A 3TSWA 1M39A 3C1VA 5JMTA 4JYCA 1WLZA 3QNUA 1TCFA 2W6JA 2IEZA 2H17A 1YUTA 4TNCA 2PZEA 4QNRA 1QHXA 4C0BA 1ZM9A 5L8VA 3TS5B 3BXKA 4FCWA 1XFVO 1Q57A 2OILA 2BCXA 4L9MA 2ZROA 3GLFA 2LVKA 2KI4C 2KAVA 4BEJA 4ZDIA 2FWRA 1W0KA 2RGEA 1CRQA 5AJVB 3O8CA 4NDDA 5DLQC 1W1WA 4ZCMA 1E9DA 1KI6B 4OI4A 1E2EA 3SQWA 1A03A 1ETUA 3UWOA 2NO7A 2OCPA 2BHRA 2IEYA 2X2EA 3NBYC 3QG1A 5DIFA 1QJTA 1NVWQ 2ZRCA 1XO5A 3GLIA 3VKGA 3QXSA 1NUBA 4L16A 5JHGB 2R44A 2ZSBA 5JRZA 1ALVA 1RW4A 3FWCA 3C4JA 3K09C 5BPJA 2XB4A 2JATA 1HH4A 2AD5A 2BBOA 2UKDA 4HZUB 1IRJA 1SZPA 3MLEA 1JALA 3R7WA 4YC7A 2D7CA 1C7VA 3EXAA 1DOAA 1HE8B 4RD2A 1MO6A 4ZCLA 3ZZTA 3SDZA 2REOA 2CBZA 4YXWD 5C1BA 2FPKA 2JLYA 3ASZA 3QKRB 3RABA 1RPZA 3NBXX 1K5GA 1UBCA 3CR4X 1GRQA 1SMGA 5IDVA 2F1IA 1OXUA 4IOLA 4Q9HA 3VU9B 3ADCA 4PCWA 4HSEA 4XWOA 4B3GA 4G5SA 1GFIA 2QP9X 1JC2A 5FL7A 3ZH9B 1TN4A 2GILA 2OO7A 3AVPA 4F38A 2ZITA 3WXAA 1PSBA 5JBQA 2ZU6A 1XFYO 3TDIA 4PR0A 3ZVMA 2JZIA 3AF2A 3ETLA 5HLVA 3K0EA 1ZD9A 1CF4A 4MRNA 1F6BA 3B9QA 3CRVA 4Q66C 1TNPA 4PC2A 4AIIA 4KLNA 2VHQA 1DF0B 2BVNA 2CVFA 3REFA 3ZWHA 1S9HA 2WCEA 1Z47A 2A5JA 1B8LA 1CR4A 2F9MA 2J41A 3SC3A 2JTTA 4R9UC 1ONBA 4Q47A 2CXXA 4AKHA 3LA6A 3AP1A 4BY5A 2C99A 1S8FA 2AUCA 4Q4HA 3VHLB 3I5GC 3KL4A 2JC2A 3TSZA 2Y1NA 4BLPA 4MRVA 2D62A 1E2DA 2ZFDA 4IVPA 1ZACA 1JBAA 3F3YA 4C3ZA 2MHHA 3EVUA 2F33A 4A6XA 1KNXA 1ZRHA 2PT5A 2YWHA 3B60A 3CW2A 4M1KA 2R2IA 4URVR 1WCV1 2EU8A 1W4CA 4DC9A 1RRPA 2G1JA 1VDZA 4BE7B 1EGAA 4DIEA 3RS0A 2LWIA 3LWNA 1CJTC 2I1VB 2GV5A 5GJCA 4IOJA 3RRYA 3U3OA 1BO6A 3P4YA 3AVVA 3CGAA 1ODBA 3EK4A 2V6JA 2XX3A 4HDQB 4P4SA 4URZR 3THOA 4TL7A 1FI5A 1IKUA 2KBFA 2WICA 4LC1A 4TSFA 3ZQ6A 3P1JA 3RSLA 5J4HA 2ZEJA 4LHWA 4PO1A 1YX8A 2JLQA 2C8VA 2RGNC 3MWKA 5C4MA 5F3WB 2AAOA 3SU8A 1JXOA 3TVTA 3VKHA 1TTTA 2PZFA 4M1OA 1SULA 1NIWA 1II8B 2B6HA 2ZVPX 2IK8A 2V54A 4QBGB 3LQRA 3N2EA 1MRSA 4A92A 1FW4A 1ZU5A 3SG5A 2FEOA 4AYXA 1KQVA 1CTQA 5EXXA 3SJSA 4A4BA 1XTQA 1TF7A 5FL3A 1N0YA 3C5HA 1V1GA 4FN5A 2KBMA 1EFTA 2WPDA 1HY3A 3AKDA 1QLSA 5FOTA 1H65A 4I99A 4TLBA 1ZUNB 3WRYC 3FB4A 1XXHE 1RJ9B 3RWOA 3W90A 2KBIA 3THWB 1NLZA 2EWWA 2L0XA 1E9BA 2YOGA 1A2KC 2B92A 4QHTA 3EPHA 2IF2A 2CHQA 1CU1A 1NX3A 1S5GZ 1D5CA 1YJ5A 3BJIC 2NLNA 4RZ2A 3EKHA 3RYTC 2QAGB 3LVRE 3PN7C 1F2UA 2YWEA 3F0TA 4LJ7A 4WA7A 3W8RA 3WNCA 4A6PA 2IYZA 2CLDX 2BL0C 2QAJA 3ICEA 4U7DA 2KGRA 1XDBA 1OPXA 1PZNA 1N0WA 1E6CA 1RRFA 1EG3A 2KAXA 4PAMA 3AAJA 3S1AB 4ZCVA 1BLQA 4AQIA 1TEVA 4TLDA 2XJ4A 5G3ZA 2O52A 1B23P 2C9CA 4F7WA 3EIEA 1OMDA 4BFZA 4MKFA 2E6WA 1KKLA 4IW3B 2J7PA 5K8LA 1B7TY 3KO0A 1MABB 1U0HC 1E79A 3SE0A 4I1SA 1UM8A 2DB3A 1S6JA 1W4BA 3I5HB 3PSRA 4PAQA 4Q04A 3TW4A 1GUAA 4CW7A 4NYMQ 3AAKA 4PHHA 1DS6A 2PCJA 1N65A 1YRUB 3WRXC 4F0ZB 2JT0A 5FYXA 1XD2B 1CEEA 3LFUA 1WRKA 1OW3B 1CM1A 3WBKA 3KQHA 4JWQA 1A82A 1S1CA 2VH5R 4GOJA 4NONA 1DJIA 1XPUA 1AS2A 1DELA 1T91A 3Q72A 3IO3A 4W9MC 2ZSAA 1KY3A 2QPAA 4ON9A 1OKKD 3A1VA 3B85A 3MWJA 1D8TA 4BLTA 4YI9A 2D4HA 2W6ID 4EQ6A 5HYDA 2FFHA 5AFPA 2JAQA 3EZFA 3IEVA 2D2EA 1U5IA 3LK1A 4G5QA 1PALA 5JWRA 4EPYA 4D1EA 1QLKA 4RCYA 3FMPB 1R7RA 1DTSA 4QJ4A 2CLSA 1VMAA 3AP3A 2IYSA 3OE7D 5FR1A 5KNBA 1IJ6A 2CNWA 5CIWA 4BFUA 4IEIA 2FGKA 2NOAA 2PX3A 3EK8A 1Z6TA 3B9PA 4M9XA 3KJIA 4PX9A 3X1ZA 4CF7A 4RKEA 1UF9A 3BOWA 2XNDA 3BUNB 3WNDA 2HCJB 3O8RA 1J8YF 3VTKA 1IN4A 2I1QA 2ZSDA 1ELOA 1KGDA 2QEQA 3A1UA 2LMUA 1BYUA 1TAGA 1AQYA 3PQCA 4PHTA 1B4CA 3EA0A 4MEWA 1JR3D 3C8UA 1UURA 1E3MA 1FFHA 1CXZA 1AGPA 4MGZR 3LDAA 3LX5A 3Q5EA 2FJUA 5EE5B 3U2QA 1QIWA 2JCSA 1JWDA 2VRWA 4TL6A 4FTGA 1MR3F 1AKYA 1CJVC 2LKDA 3OFND 3TR5A 2BCBA 2IC5A 2KFHA 3SHWA 2NCPA 1G291 3M4YA 2O5GA 1OXTA 1G4UR 1KI9A 4D6PA 1BMFA 1J1EA 3VAAA 3VNUA 3GK4X 4YDHB 4AQJA 2BC9A 4HLCA 5UKDA 4HLUA 2WKQA 1QXPA 3GMTA 5FFMA 3SZRA 1BH2A 4HLQB 2GXAA 5DHFA 3THYA 4C0HA 1XFZO 1R5BA 4JL8A 3ICQB 2RGCA 3JVTC 3TE6A 2JLVA 5E7IA 2WM9B 4Z1MA 4HSZA 1T6NA 1KK7Y 1WBDA 1FPMA 2OLJA 4JVMA 3IQXA 3NTUA 1TNWA 1E9SA 2DFLA 1GAJA 3EIQA 4YGBB 1CS4C 4OHVA 4NYIR 4KJZA 1XYDA 2GZAA 1XCPA 3LRPA 4JSTA 3SG7A 4LJAA 4BZQA 2BE4A 1PVBA 3RS7A 1RTP1 4DS7A 4HAWA 1OH6A 3B8HA 4MUBA 4YXWA 1YU9A 3CTNA 1AJ4A 3AEZA 1W0JD 2YWGA 2LP2A 3D10A 1R4AA 1G64A 4URWR 5FI1B 3DKPA 3BIFA 4P3YA 3QF7A 4XJKB 3SBDA 1MR8A 1MO3A 2QORA 4HLDA 1M7BA 3WMEA 2JJ1D 1E2PA 2O8CB 3I61A 5L3SB 1AQUA 1BR1B 3ADDA 4RFSB 3CNNA 1F2TA 1DTLA 3EZ2A 4I1UA 2RGXA 5AUNB 4K8OA 4ACBA 1CP2A 1O87A 3KJEA 4A0HA 5HKKA 3SOPA 2BV3A 2BJWA 3CRQA 1VCMA 3FFBA 4QHYA 1U0JA 1DGVA 1XFUO 3LLEA 1CLBA 1N6KA 4H9GA 2VP6A 2HT6A 3N70A 4IJMA 1NSTA 3HR8A 1LW7A 3UANA 2DCUA 2W0MA 3GLHB 4WXRA 1OXVA 3EZ6A 3KX2A 4EAQA 2COLB 1J90A 4OVNF 1G9XA 1OYYA 1A5TA 5E7MA 2ZAOA 2ZRMA 2WWGA 4N1AA 5BXQC 2C2HA 3P20A 2ZRDA 4GNKB 1OZSA 1Z2AA 2OXCA 2RH5A 1QHHB 2VIIA 1HT2E 3ONWA 5HKYA 2CJWB 2WJGA 3EVRA 3FFAA 1NKTA 4MRPA 4DLWA 3KTAA 3KXKA 3AF4A 2V1XA 4BZXA 2I94A 2ODEA 2QACA 1N5IA 1G41A 3LW7A 3J81k 1N2DA 1TMKA 1N6LA 2FG5A 2X2FA 2EHBA 1UAAA 4Q00A 3GJ5A 1IN5A 3LV8A 3U44B 3CWGA 1P75A 4XSHA 4JLKA 1TF2A 5TMPA 4W5WA 5BQ5A 1VYUA 1U94A 4A0RA 1KK7Z 3PV0A 3W8NA 4MLWA 1YTZC 3RLZA 1ZC4A 3AUXA 2MRDA 2IBMA 4JIMA 4Q18A 3VR4A 2QT1A 1COWD 3CM0A 4BFSA 2D8NA 4ARZA 5FBVB 1Z0KA 3GLGB 1WDCB 5HR5A 5K8IA 2CCMA 2D7DA 2WWFA 1DAEA 3KZ1E 1SVLA 2WIAA 2ODWA 3TGPA 2OTGB 3DVLA 3AF3A 3E1SA 3QKSA 4MYUA 2JEOA 1P2TA 1U98A 4BFYA 1G16A 1NY6A 1Z0FA 4GFTA 1FBVA 3SFVA 1YHNA 1Z08A 2GAAA 4XWAA 2MJWB 1Q1QA 3EAQA 2B1UA 1M45A 1UEJA 4DCUA 3KDSE 1F4QA 1B0UA 1E2KA 2IYLD 3W6NA 3CPHA 1JBKA 1XMJA 721PA 4JVSB 4TL9A 1W7AA 3G82C 2IYRA 2OUKA 2JT3A 1XEFA 1TX4B 5FBWB 2Q3HA 1OF1A 3B82A 3OIYA 1M2OB 4DUQA 1SVKA 3R9XA 2BBMA 1YURA 3DF0B 4DT1B 3PEWA 4DXAA 1P9RA 3X1WA 4UJ3A 5IHPA 4B43A 5DNYB 1ESNA 1IY2A 1SRAA 4UNNA 3RNLA 4NZYA 1E4VA 3ZJYA 4B3XA 4YGAA 3A6PC 3TDUA 5LDDC 2FA9A 3FOZA 3PEVA 1T5LA 4FI3C 1VG8A 1KFXL 1D2MA 3ZNIA 1WXQA 1Q1ZA 2SHKA 4IHQA 4JVLA 2P5TB 5JCZA 2LV7A 3L0PA 3QVVA 4UXHA 3DEFA 1M7HA 4WQ2A 3KB1A 4GZLA 3RS4A 2O8FB 2GZDA 5JZVA 3EVVA 4YMVA 1FP6A 1XTRA 1KOFA 1R0YA 3LCPC 1BS1A 1Q0UA 4BEBA 5HKKD 2FMXA 2A9KA 3A4NA 4GAOA 1AZTA 2M9GA 1CDNA 1KO7A 2H7VA 1E32A 1NKSA
chains in the Genus database with same CATH superfamily
2AKAB 1E61A 5FFFA 5J3XA 1W52X 2CJPA 3WO1A 1XVIA 4B4WA 1TT7A 2C57A 1DCTA 5IJ9A 1G6OA 3QMVA 3OE5A 1EWVA 3GNTA 1AQNA 2G70A 3T7RA 2ZB4A 1Z33A 2G9NA 1T9KA 4MVJD 4DWWA 3C3KA 3H86A 3L8ZA 4I4IA 5I48A 3LBIA 1TEHA 4TLMB 1KAGA 4NZNA 3LL4A 4CG3A 2WE7A 2DSTA 2C94A 1A8HA 1BNCA 2ZREA 2IZOA 4KFSA 1GTL1 2WJZB 3EVTA 5FI5A 2CE2X 3NANA 4KAFA 2B8EA 4BJ5A 3B70A 5J2UF 4FFNA 1Z13A 4KI0A 1BU8A 4IH1A 3VRPA 4MRRA 4F21A 2XWSA 2VXCA 4EPVA 2Z8XA 3X2EA 3T7DA 4IGFA 4RMIA 1YR9A 2VTBA 3VHQA 4HNAA 3H5RA 3AVUA 3I5FB 1EJ3A 2OFWA 4FQTA 2GBIA 3IEXA 1G6KA 1IN6A 3OIFA 4KRGA 4MVJE 2ZRNA 2A2ZA 2XMBA 1XGKA 3HU3A 4GLJA 4R81A 4BMYA 4FI3F 4YCMA 3BHNA 1GYPA 5D7FA 5J59A 1RQNA 3HCBA 3BYAA 2DKFA 2X0NA 4AOMA 3SF8B 3WNBA 2G07A 2YCLA 3ED5A 1R0CA 4GMXA 1EP1B 1LLDA 1X14A 5EA2A 3V4PB 1BR4B 3SIAA 3PJEA 1Q12A 1U1CA 3Q1LA 1K2WA 8OHMA 2XQVA 2C7GA 2QMQA 2VR1A 3ZV3A 3OT4A 1MXEA 2QU8A 5HDQA 1JHOA 1Y4AE 4B33A 3BERA 3O90A 4KC0A 1K7YA 3IKLA 3MQ2A 4NNOA 4WQMA 1P45A 5BV1A 1GFZA 4NOJA 3UXMA 4NJEA 3F49S 3OC0A 4MUXA 2GSWA 3DGFC 2A5YB 2JASA 2WCFA 4PG6A 1KSMA 2R1VA 1ADCA 2VAVA 2VDRB 2XT6A 4H6PA 1K8ZB 4R2MA 4B6EA 4AJLA 1XJ0A 1KA9H 2VJQA 3K5PA 5DHPA 1NUTA 3MFYA 4LYFA 4OG2A 5BURA 5AJVB 2ZJ6A 4GOXA 2G1PA 1I2AA 1EEXB 2DHRA 3INNA 1E3WA 2VQSA 3K4HA 3FTCA 4H1UA 1NT2A 3EK7A 3PKZA 1H9AA 1KEVA 4OGFA 5IAOA 2H48A 1NCXA 2DETA 1C2TA 1IOZA 1L4MA 1H0SA 1LBEA 5D5PA 1DC6A 2IE8A 1TPZA 4IRMA 4R8MA 5I5EA 3DEKA 4O29A 5HKLA 3QEMA 2DJIA 5DHTA 3WRWA 4BOYA 4EUKA 2C2KA 5LYYA 5BMVA 2QJOA 2QLMA 5CEFA 5HEKA 4JC0A 2Z5FA 1QQ5A 2QN7A 4NEHB 1IY0A 1E7WA 1E5TA 5FOQA 3O6VA 4N65A 4QRDA 4XUEA 1KMHA 4YRDA 3NBKA 4DEXA 1S4QA 1RAGA 3F3MA 3PUXA 4QUDA 3ICCA 4U7FA 4HVCA 4FYWA 5BV2P 2BFBB 3WP1B 2HIGA 5L3VA 2X2OA 1OOGA 4LV6A 4FKBA 4K3VA 5JCXA 2NUAA 3DEJA 3G2OA 3TLBA 3UHFA 1USIA 1RT9A 1KAOA 3TZLA 4B79A 1ZU4A 3A1DA 1W93A 3JQFC 5HQ3A 3O2JA 2VJBA 2QJFA 4YGEB 5LZ2A 4OUDA 5EESA 4HLUC 4J2TA 3E58A 2ECPA 3OCWA 2AK3A 2XXBA 3DKRA 3K1AA 1J06A 1E89A 2Q9UA 4D96A 5CDUA 5LXTB 2JJYA 2VZLA 3B1ZA 4GX0A 1P7ZA 1ZA2A 5HW0A 3PIRA 6REQA 4MDYA 2KFFA 2YZNA 3NNSA 1II0A 5A62A 3UGTA 1M31A 4JKTA 1MO2A 1T0IA 1JAHA 3ZQJA 1KO1A 2IEGA 2H51A 4LY6A 3RUPA 5GJVC 1PL7A 3NAZA 3ER9A 2AZXA 4GKVA 3ONDA 4TWIA 4EG4A 1EFDN 1M10A 1ZBDA 3B2EA 3E84A 3EIUA 2JGNA 3KXIA 5BUZA 3LZDA 1EGQA 3MYYA 1OXMA 3QI2A 4PS1A 1SQFA 2P6MA 2WSYB 4NKRA 4Z9AA 4DA9A 3M6XA 3BM5A 5IBPA 1YIAA 1Y7TA 1MFPA 3OZBA 2IH2A 1XTSA 1WBJB 3U81A 4FR5A 5CBPA 4DJEC 3AVWA 4Y1FA 1B73A 2BMWA 5F98A 4HXGA 4ND1A 4TWAA 5HIIA 1G7CA 3JASB 5JVDF 1QUEA 2LHIA 1J7PA 1QZXA 1YCGA 2JLRA 5ALIA 3RTGA 4FD2A 2NTEA 3WA6A 2L50A 3PFVA 3KZXA 5HMLA 5KOHB 2IYQA 1MOQA 1PWXA 2FMIA 4RUKA 3W6UA 2NPIA 1Q7BA 3RASA 2IXDA 1B0ZA 2EJTA 1ZIXA 2GHRA 4JI5B 2CLKB 3WGTA 3M6FA 2AXQA 3FIAA 1YKGA 4H3HB 3G9QA 1P6UA 2XTZA 5EWMA 4Z3OA 5J5VA 4CR7A 1KFXS 1O6CA 2CNWD 1F17A 2QU7A 3C4QA 2WLTA 3DUFA 3N39C 4MUAA 2PGDA 2XUZA 3I8XA 3QY9A 3D6MA 4YJDA 4OX9B 3DTNA 1JS1X 2WD7A 3Q15C 4WOPA 5FQNA 3HSKA 4TQUS 3RT9A 1WIWA 4KBYA 1YL6A 2FP4B 2W37A 2VBIA 2AK2A 5GVSA 1E59A 1NU8A 3VO2A 1BCRB 1DRJA 4KR0A 2BWJA 2Q4RA 4YBRA 1Z68A 2HUNA 2E5WA 1PJ8A 1JHQA 4RHXA 4A23A 1KYQA 4I9GA 3W7BA 4WUVA 1KZHA 1JQJC 1UJNA 1WW2A 4WCFA 3BOSA 3NWJA 3PG5A 2IYYA 2NO1A 5FJJA 3U0BA 1H5QA 1NG1A 4O2LA 3VOBA 5IM4F 3T34A 3OG9A 1JNXX 1WU7A 5ADWA 3V7UA 5D3MB 4QUBA 4EJSA 4LMPA 2F3PA 1AKEA 1O94D 3U16A 4EHAA 2Q46A 3GJTA 3ET4A 3SSOA 4BVKA 1U8YA 2D00A 4EATA 3BHMA 3UV3A 2ERXA 3FWZA 4QG7A 1NW7A 3NP9A 3T9CA 2RBEA 2X6TA 4LFBB 1TAUA 2QE7A 4EY7A 4N47A 3DVKA 5JMWA 3OQNA 3EIWA 1UH5A 4P83A 2UXCB 2VKTA 1C30B 1NQXA 2PZLA 4EJMA 3GLVA 5LC1A 1M0EA 4WD3A 4O33A 3RUAA 4YRAA 2QMOA 4FQ5A 4IILA 4U7GA 2Q7DA 3UW1A 3ZHVA 4KR7A 5K05A 1XMXA 1HC7A 1AK8A 1ULBA 2I2FA 3L7YA 4DDHA 3V5NA 1XK4C 4F5DA 1JZQA 3E9NA 3EYAA 4BZPA 1YL7A 5CVEA 5FXMA 1ZCFA 1GTJ1 2HL6A 2O7VA 2WTMA 5ULLA 1DBIA 3KRTA 2PH3A 1RKXA 3RC7A 3WK8A 3H17A 1TNDA 2XF8A 1GDHA 1QIDA 5MHTA 1NPDA 2IUTA 3I72A 5KC8A 5IBWA 3O47A 1X9IA 3NG1A 1SKUA 1SM4A 2JGMA 4HUJA 4N4AA 4UNSA 1CDDA 1M2EA 8MHTA 2AFHB 4L75A 4YRSA 3TLGB 5KTNA 4JBHA 3ODGA 3RUIA 5MN5A 1W6UA 3ROPA 1BEUB 2HO4A 4BRSA 3PR3A 3PYXA 4AF8A 3GFTA 1CLLA 1FS5A 2P30A 2RG7A 4JY7A 1H85A 2GTHA 1MB0A 2GZ2A 3H5IA 4GC9A 4EW3A 4QDKA 1X87A 3WQRA 2H16A 3OZVA 3VC2A 1I4EB 1Q19A 4K9KA 3CX4A 3N5CA 4EDHA 1T1EA 4EKGA 4P0PB 5AVTA 1Z0AA 1SL7A 1NJSA 1O0SA 1CUHA 1FY2A 1R37A 1U7WA 1VRCA 2CJXA 2CLHB 2Z95A 1X9HA 3IMCA 4JBLA 4RFVA 4B6OA 1YV9A 4IFTA 2HU5A 3FZEA 4I3GA 3EB9A 4XJVA 2GAOA 2I2CA 4HDMB 3TD6A 3W9YA 4ZWNA 3G2LA 2BF4A 1JFKA 4JEHA 5TQ2B 3GVCA 2ZUTA 1BFKA 3QKRA 4ZN6A 3W6OA 1WZCA 2B3TA 3KQOA 5F6TA 3L07A 3QFFA 4GYWA 5IJXA 3S0JA 5A4AA 4C2UA 1G7TA 1E7MA 3ZJ4A 5JWOA 5CPBA 4WADA 3AM4A 3BGIA 4HGQA 2WF5A 1XLTC 3OJ0A 1BHSA 3OZIA 4O2AF 4PT1A 1MB9A 5DJ5A 2ATXA 2VTKA 4GI7A 1K5PA 4CT5A 1NQTA 4WLFA 1V9CA 2P6NA 3PUKA 2WJ4A 3UAVA 3H4SE 2WTBA 5JD6A 4ZYUA 3O4VA 5C7LO 2C4NA 2DPLA 2CDAA 3ZWCA 3TDZA 5B55A 1TU4A 4DABA 2KE5A 1XCLA 3VVBA 2YUIA 4GP6A 1H8ED 1JXAA 2X8BA 3NBZC 3Q2OA 3TSAA 1PTKA 3UO9A 1Q91A 4H59A 3VPDA 2O3RA 4N5NA 2O05A 4B6RA 2AOUB 1N1GA 1W5FA 1WDKA 1OROA 2G08A 2HUPA 3EVDA 2H7YA 4IUBS 2QPTA 1K93D 2OAGA 1ORWA 1W2WB 2A0FA 1OAAA 1MEJA 4Y6GB 1E2IA 4BNHA 3EBPA 3OQHA 2H4JA 1ULUA 3UMRA 4BNIA 3VV2A 2QLNA 3CYFA 3DLTA 3G7NA 3IDOA 3KQYA 3LCUA 2DPXA 3PWKA 4OQMA 1QE5A 3GUYA 2FW6A 4Y6SA 4B3CA 2FZVA 1ODSA 2ZYSA 3F8WA 1U5CA 1MF7A 1XD8A 3NW9A 1KH2A 2NVUB 3K70B 5KYKA 4JI6B 1SL8A 3RHSA 1GUBA 4Z54A 1UBFA 1LF5A 5JO9A 3I5UA 4ZI7B 4GBGA 2QZ4A 4BKOA 3TECE 4Y2RA 2VUUA 2IWHA 1NAHA 2FWIA 4I7EA 2P2LA 3N8KA 1ZMOA 3HVKA 3RT7A 5KJ1A 3OA2A 4KLCA 3KEQA 4CLEA 1ZP6A 5DP2A 4MUKA 4HNVA 5FHRA 2H92A 3LMKA 4GX1A 5ILGA 3TLJA 2IPAB 1V25A 4W4TA 1T9CA 4BCDA 3PNVA 3RV4A 5JXWA 1XPOA 3GHYA 2O7RA 3AIMA 1NJFA 4Q34A 4GI2A 2XCRB 2PRJA 2ZK7A 4Y9RA 1QG4A 1GPKA 3ICBA 3EJ6A 3MMNA 3OOSA 3RZSA 2Q8PA 4OQZA 3REQB 5F7JA 5K8UA 5C8YA 4PZLA 3AOGA 3OEHA 3NLLA 5TGDA 3AR6A 1Y89A 2IS9A 1V41E 1UPBA 1RFJA 1EHCA 1P0IA 2VJDA 4B31A 2FWJA 2PXAA 4EPWA 3PNBA 5TMBA 4PCUA 3MB8A 3MJDA 2PA3A 3FDXA 1AN0A 3L79A 3BFAA 1BE1A 3KSAC 3JQBC 2QTFA 4LAFA 3BE6A 1U8XX 5B4UA 3F5SA 4IIXA 3WLQA 1REQA 2FOIA 1P7PA 1XTKA 2QIPA 5LWQA 1K7EB 1PRWA 3JQ9C 4IWNA 4X1OA 3HP4A 4KIJA 2X4IA 3CW9A 5BN4B 5L3QA 1SKBA 3ITKA 1K75A 3FPCA 4KRYA 5I7FA 1CBUA 2ZSEA 2QY6A 2GNPA 1X77A 2DWPA 2PU7A 3AJEA 1L4BA 4EHNA 4EJ6A 3AYZB 4XJSA 1ZRSA 1W25A 4UTRA 1QYRA 5CB6A 2HFKA 1VG1A 4K0KB 1R9NA 2H2WA 1KC1A 1NBIA 3ZLTA 4BRWA 1R5OA 3L8MA 3W1WA 1GZ7A 5FEMA 3FTFA 1JQKA 1M1YA 1OLXB 4PE4A 2JC3A 3CKMA 1PYGA 3LU1A 4MMZB 4RVSA 1ZS9A 5I9LA 2GEBA 2HR1A 5KTOA 1PQYA 3NTRA 3QBVA 1DARA 4UBKA 3V9AA 2FTKE 2G71A 2KAYA 3ZXYA 4U7TB 2IHKA 3CHYA 4UNIA 3I5GB 1M0TA 1S2LA 3C85A 1XJQA 2AZTA 2EHDA 1KEEA 2VPXA 1CF2O 3FUTA 1LSJA 3SX4A 3EC2A 1PJSA 4H4EA 4JEMA 5FTNA 3EVEA 4F1WA 4B6PA 5AJZA 4M87A 5A1JA 4BQFA 4EIWA 4RVNA 1GU0A 4AJNA 3BFPA 1DKNA 2X4LA 2PKYX 1GUZA 5CB8A 4OREX 5FI7A 3VR4D 3JR3A 1KQOA 1RLTA 2VUHB 5DCUA 5HVNA 4LC0A 2KX7A 1SPXA 4FYJA 2I9KA 3ICOA 4V2UA 4U39A 2GESA 4B2LA 2O6HA 1PX0A 2ZSJA 3MTQA 2VJNA 3ZHYA 2FRDC 2GI4A 3B3JA 2IVZA 5E7QA 1DWUA 2A0UA 3A6LA 3LO8A 4IDHA 4EKYA 4AN4A 4KVZA 5B5SA 2LM5A 1XMQB 1Y6WA 2NSLA 2BJHA 4QG3A 2MJLA 5JMOA 1NLUA 3GEEA 5KQMA 4TTRA 3PGKA 3PGMA 4DN6A 4X7BA 2Q49A 3TFQA 2G5TA 1N2EA 1WVIA 3KSZO 4HGPA 2FW1A 3QMWA 1RJEA 1KDZA 1OQPA 2YUTA 4TTTS 2IV3A 3TLKA 3ZXUB 3UGKA 2GSDA 1QFJA 1R8SA 4I66A 1KYVA 4URFA 3SS9X 2X2PA 5T4BA 2HSWA 1FRFS 2UZ1A 5TR9A 1TEZA 1U8AA 3D3QA 4EK9A 1VPTA 1RRGA 2NZXA 5CG2A 3AINA 4W5NA 4EI7A 4A0SA 4DV6B 3MJFA 2HQWA 4AZ0B 2ZVJA 2ASVA 5J1SB 3RDPA 5DMXA 5I9SA 4A27A 2QUHA 2CD7A 2GBCA 1T43A 1XP5A 1EDEA 2OPOA 3KU4A 5J47A 5DHSA 4J6FA 1NYAA 3WLTA 5IJ9B 1M34A 3H1GA 4MEBA 4PEVA 3I12A 2H1IA 3JVTB 2XA2A 2Q5HA 3VHRA 1R6XA 3AB8A 1VBNA 3NGXA 3P27A 4EF4A 5AW3A 5KB3A 1RYYA 1JF2A 1ZJJA 1RYMA 1HZJA 1HXHA 3C4VA 4J4BA 3T3NA 1M6YA 2QAGC 4P31A 3RJ9A 2G25A 1IWBB 3F1KA 3BULA 5JEEA 4DB2A 2F2OA 1XTZA 4RH0A 2JU0A 2HTFA 4NJOA 4GPBA 3QP9A 3C6QA 1NX9A 2OHVA 2YY7A 4US2R 2CJYA 2PMDA 4KLAA 1NVAA 3I2HA 3RGWS 3FF1A 4I46A 5EVCA 1M1NB 4I5IA 4AZVA 5LLTA 1KJZA 4FOSA 4XQGA 1F6WA 3ZN2A 1XQYA 1O1YA 4AJHA 5HUHA 2YZGA 3DTYA 4CUKA 4LY3A 1C1XA 1LY1A 2C2BA 3DDUA 4CMEA 3U4QB 2Z3WA 4KXFB 3RVRA 1VJ0A 7AT1A 1EG4A 1OU0A 1QHNA 1RFGE 3LQ1A 4KVAA 3UJPA 4BJHB 4D4IA 1FYXA 1XMVA 1MEEA 2R6DA 2XYHA 1NULA 3CGWA 3G6KA 4CIBA 4BB6A 2AI3A 2B21A 1T9HA 4QICA 2J5BA 1U0FA 4RFSA 3KQKA 3HLTA 4KDCA 4PC1A 1RAHA 4HAVA 2CHUA 1U6IA 4K86A 1ZJ5A 4PGMA 5E4JA 5KDLA 1DQYA 3AZOA 4Y2GA 5GGXA 1P74A 3T5CA 4M7RA 3F90A 4LA4A 4PC6A 3BTVA 1YF3A 3RU3A 4MKZA 2IH4A 3DOIA 3TAUA 2R6HA 1F12A 1DIOB 1YFKA 2BFCB 3SYNA 1RIFA 1EWRA 2W2TA 3LKDA 3PI6A 4KITB 1M83A 5JT1A 3FWBA 2V3VA 1MA3A 4C0KA 3WQBA 2CT9A 3OCJA 4UAUA 4AJ2A 5BMVB 4AUMA 1SUWA 1G20A 2ZTHA 3K9GA 4DMFA 2ZYWX 1KI7A 3BMOA 3HU5A 1WQ1R 3ROFA 1BGVA 2OBLA 2ENWA 1MA0A 1YA4A 4NU8X 5C7YA 621PA 3GLIE 2JLXA 1KHTA 1SH7A 2AOXA 1E8NA 2EOAA 2IXAA 2I4MA 5GQQC 2CFOA 2EJCA 2P3LA 3COPA 3A1NA 3GF4A 3NHWA 1E1MA 2DQSA 2C58A 1S3IA 5ITZA 2F4VB 4GICA 1AC5A 3CXRA 1IZ8A 1AF7A 3VNAA 2J5RA 2VWHA 1G2QA 3IXMA 1NYQA 4ZGGA 2VDKB 5LVAA 1G8SA 1NG9A 1GADO 1LTHR 3W5JA 4HVAA 4F1JA 1F8FA 2OHJA 4B3FX 4OPMA 3IEPA 3IVGA 3KE8A 1YQUA 3E6AA 5LOVF 1IOVA 4WV3A 2OENG 3ODPA 4JJ6A 3GBVA 4LBYA 4RANA 5BUSA 1WMDA 3JAMA 3T1YB 1T1SA 2VS1A 3K9CA 3N2KA 3NEAA 1DBQA 2AJ8A 2CL0X 4GFDA 2PUJA 3KTOA 4PLZA 4JD9A 2C4VA 1IY8A 5B1IA 3RBXA 4LHZA 1XL1A 2LIPA 2NXCA 2VTVA 2BKXA 2GPTA 3KQMA 3ONNA 5DDIP 7REQA 1M74A 1QVIY 1CUDA 3C74A 1SRQA 4GDMA 4CLOB 1TPYA 3SJCA 4CV0A 3Q8MA 1CUYA 2RAUA 1NMEA 2BHTA 4V0RA 4HRHA 3DWEX 3ZIAA 5B2ZA 3PFNA 3W2GA 4LFAB 1B0AA 1Z07A 4M76B 5K5EA 4BLVA 3KDAA 2L18A 1RXUA 5CHEA 3RJTA 1FQJA 3O94A 2B5VA 5A9SA 3L1UA 3QFTA 4HWOA 2WWYA 1GLVA 3M1LA 1KI6A 2OHIA 3OLZA 4FGSA 4A0QA 3LUBA 4CETA 4G0WA 3URKA 1K92A 1R6TA 2WIGA 3KUKA 4YN3A 3WRYA 4BNGA 1FXUA 4MNTA 1B76A 1J56A 5TDHA 1M1ZA 1P3DA 3IMFA 1F7VA 4B3TB 3QLEA 2GK4A 2H6EA 4I1RA 4MI1A 3I05A 4G1UC 5ANRB 3W1EA 2YY6A 3FMFA 1JAYA 1M2KA 3LWZA 3WXMA 1KSFX 3OB2B 1BZYA 1NRIA 4II3A 4W99A 3RODA 4G4GA 4PLWA 1BVYF 1F51E 2CK3D 1JHDA 2W7TA 1CNEA 2CYCA 3O8QB 5T6MA 2XUKA 1SPBS 1ZMBA 1K8XB 1PRYA 3NTXA 1PS9A 4AD8A 2F3TA 4R0VA 3X2FA 1PT5A 1ZJYA 4IIJB 3D6NB 2BSQA 1IK6A 4ZU1X 5ERYA 1LZLA 1C9YA 1M6EX 4GX5A 2WKRA 3S8MA 3CE9A 2PG3A 5B6JA 2R8ZA 4WY8A 3IA2A 3JALB 1GA4A 1CUVA 3DEAA 2M98A 3R75A 4A2PA 1NE2A 3UMVA 2C7BA 4PPGA 3IQEA 3C48A 4U3JA 5FPPA 3V4VB 1GILA 1VYHA 3TVDA 1FNBA 4PZUA 3USCS 5I2OA 2IS1A 2W8ZA 1YQXA 5LPNA 4WXPA 1JIIA 4NABA 3K4QA 3QIAA 3TUYC 4ZP1A 1JSXA 4LHYA 3VU3A 2RGRA 1G4HA 1ACLA 4RQBA 3PPVA 2RGWA 3BQMB 3EMDA 4G2TA 4D4MA 2W6ZA 2WNHA 1TQ4A 5E6UB 5CDYA 2XF2A 2IJGX 5HP4A 4DCSA 1N4AA 1X8JA 1NI4B 4B45A 1WHSB 3NXSA 1L7AA 1O2DA 4U5XA 1QE3A 2HRRA 2GD6A 3AB7A 1N5JA 2H4XA 3AVTA 4UEJA 2I7XA 1SR8A 4RNDB 5KIAA 4HWKA 3K53A 2VHJA 2HNKA 2Z5GA 3B7PA 5I9TA 4EA9A 1X15A 1LD3A 3FR8A 4FYHA 4LUCA 3I34X 2UXDB 2Q1SA 1E4YA 5EQFA 1E2MA 1HETA 4YRNA 2I54A 5U4QA 3GV0A 3SQXA 1P2DA 2B1JA 2L4HA 2YV5A 3EVZA 4GUAA 3SR4A 1PJQA 2QRPA 3FJOA 2QI9C 3QEJA 1T5OA 2N46A 3KT0A 4WGGA 3V7NA 2P5SA 1XRMA 3MS7A 4OBBA 2EIHA 2JL1A 2ODQA 1EB8A 4G36A 4UVGA 3RF7A 1CY8A 4Z51A 5A5FA 2TMKA 4KYNA 4MJ7A 4ZEVA 4QDUA 2W2MA 1QH8B 2X0EA 2QVXX 4TTIA 3IVAA 3FSRA 3JTDC 1RXYA 4CLRA 5JR3A 4IG9A 2HF5A 4HJXA 1N4DA 1IHXA 3R9WA 4MZKA 4N0EA 2FNAA 4JYMA 4B1FA 2HLDA 2JWWA 2RB4A 1DPFA 3K9QO 4ZQEA 1BJRE 3GFRA 2R7NA 3K9FC 2GJKA 1FLNA 3VX3A 2WJ3A 2MBXA 1CUAA 1ZI6A 2B94A 1GZ5A 4K1LA 1EXDA 2DBRA 3A6HA 4RFLA 1G8IA 1ECBA 3PTLA 1PFWA 3EA4A 3GJSA 3P0JA 1D4AA 4FW8A 3WGHA 3WZ2A 1U7UA 4XZ3A 2LMTA 1M6VB 2HMWA 2IEIA 3NSLA 2VKQA 3MM4A 3TIXB 3LXRA 3AIIA 3VPCA 2PJRA 4JBYA 4MLZA 4IV8A 3DR5A 1P3JA 1E1QA 3Q85A 1KFCB 4H2DA 2WJAA 1ABFA 1PWYE 3R20A 4YX9A 3AH8A 3AEKA 3JZMA 1EUZA 3WWEA 5KREA 2YRFA 2YVQA 3JVDA 3CH4B 4DYVA 3DZKA 3TS1A 4F92B 3WGJA 4LNAA 5FTKA 3QVGA 2NU9B 2JLZA 4N41A 4RORA 4JJEA 1KI1A 1GDDA 1SD5A 4BN0A 3ZGYA 2BEWA 2MIIA 3IF7A 2YQ4A 1ZWLA 3TQOA 4ARVA 1G33A 3DD4A 2KYRA 1FUKA 2X8WA 4E5MA 1KS9A 2QAIA 1R3DA 1LJUA 1UC8A 1XK6A 3KOOA 4MW9A 2C8LA 3JQ6A 1PD0A 1Y48E 4QLAA 3WIEA 4ENWA 2HADA 1H22A 4EL0A 1QE0A 2BFMA 2H4FA 2G88A 2EFEB 3GDFA 4HZUA 5EFZA 5JS2A 4HR7A 4KK4A 3RS3A 1XVTA 5EHIA 5B1HA 1E3TA 3IULA 3BFHA 2C95A 1RRKA 3G5UA 4QEZA 4YALA 4ZQCB 5SZJA 4KQCA 1DMSA 1AXRA 4R2WA 1RJVA 1KNQA 1ZESA 4UAJA 1PDVA 2BFOA 1TXGA 2QZSA 1W46A 3DP9A 5FORA 4A10A 5AH0A 4CODB 4WOJA 1Y34E 5HLOA 4GMDA 4JXJA 1L5MA 3OICA 4JI4B 1A9RA 4J43A 1UWOA 4FDMA 3PFGA 3OB1B 2YMLA 1UBHS