4C0JA

Crystal structure of drosophila miro ef hand and cgtpase domains in the apo state (apo-miros)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
404
structure length
404
Chain Sequence
ELTSACKKSLVRIFKICDIDGDNLLNDYELNLFQRRCFNTPLQPQILDEVKAVIQKNVPDGIYNDAVTLKGFLFLHCLFIQRGRNETTWAVLRRFGYNDQLEMCQEYLRPPLKIPPGSSTELSHRGQQFLIAVFERYDRDGDGALSPEEHKMLFSTCPAAPWSYSTDIRKSCPINETTGWVTLHGWLCRWTLMTLIDVVKTMEYLAYLGFNVHENDSQLAAIHVTRERRIDLAKRQSSRSVYKCHVIGPKGSGKTGMCRGFLVEDMHKLIGKEFKTNVVNCINSVQVYGQEKHLILRDIDVRHALDPLQPQEVNCDVACLVYDSSNPRSFEYVARIYIKYYAESKIPVMIVGTKCDMDERRQDYLMQPSEFCDKYKLLPPHLFSLKTNKKELYTKLATMAAFPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL RHO GTPASE
publication title Structural Coupling of the EF Hand and C-Terminal Gtpase Domains in the Mitochondrial Protein Miro.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase
total genus 116
structure length 404
sequence length 404
ec nomenclature ec 3.6.5.-:
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
A PF08355 EF_assoc_1 EF hand associated
A PF08356 EF_assoc_2 EF hand associated
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0jA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0jA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4c0jA03
1ZUNB 3K0EA 4Q9LA 3T35A 4CDGA 1COWA 1ZCBA 2BKUA 3ND9A 4L5BA 4FD2A 4MGYR 4F4IA 1J7KA 1JQJC 4HSZA 1CMFA 1CR1A 1Z0JA 2VHJA 1XO5A 1GL6A 2QAJA 3JVUA 4HATA 2IK8A 3AUYA 4DEXA 5KNBA 4TN1A 3I61A 1KFXL 1A75A 1AQUA 4H9GA 2KBMA 4A8JA 1KWOB 1GG2A 5M04A 1G3RA 2WAYA 2LVKA 4CEHA 2O8CB 1R2QA 4E68A 3KJHA 1U98A 1G3UA 3KXIA 1IKUA 4NHOA 4LPKA 3HCMA 4MLWA 2ZI3A 1ZFSA 1VKJA 1NG1A 2QA5A 4P0TA 2FGJA 1LKJA 3CX7A 5G3YA 4IDOA 4Z8YA 1G33A 3T06B 4F93B 2LV7A 5TV2A 1IJ5A 2YWEA 1M6NA 1FPWA 1W0KD 1P61B 3LQRA 1E79D 4OK3A 4RKFA 1RPZA 3Q9LA 1T91A 4DIEA 3U7HB 1F4QA 2FU5C 4WRIA 2YJTD 1NP8A 3QKSA 1IH0A 4PE0A 5B8IB 2ZYUX 3TQFA 3ZQ6A 2CHVA 3F5FA 4GZMA 1T3HA 4ON9A 2OS8C 1YJ5A 1EX6A 3GFOA 4PHFA 721PA 1LW7A 2CLCX 2GNOA 1UDXA 4NYJQ 4WVFA 5L3SB 2OFXA 1YUSA 1LXFC 2C9CA 1QHGA 1KI4A 4OJQA 1GQMA 2IF2A 1OHHA 2IHBA 2LWIA 4II7A 1OIWA 2FV8A 2G9NA 3ZH9B 3ZIAD 5DKNA 1DJYA 1EXMA 2BKEA 1BR4B 1A4PA 2MAZA 1E2IA 2EYQA 5FOTA 2C8VA 3MAAC 3EPLA 5I2OA 3EPKA 2FFBA 2JAQA 3I4LA 4L8GA 4ILEA 3WMEA 3U2QA 5JS8A 1OZOA 3GLFB 5ANRB 3OHMB 1TRFA 3RM1A 1F4OA 1OXXK 4GGFA 4HB3A 1A03A 4Q47A 2QBYA 4UNQA 3BUOB 3OIVA 3THXA 3GEIA 4O25A 3QXJA 1ZUZA 1WRZA 2O0JA 1RROA 3GCGA 1NX2A 1DMOA 5EXSA 1E1QD 5TMPA 2R6DA 1QVAA 4HREE 5KSZA 3FYHA 3OEHD 1WDCB 5D3MB 2FPLA 2GBLC 1NMZA 4GOXA 4E22A 3I5IC 4C7OA 4ORCB 3W5IA 3L0SA 2V6JA 4O2LA 1T9HA 2ZR0A 1EG4A 4FWIB 3RS4A 1ZC3A 1P9WA 3B1VA 1HT1E 4MVFA 2K2FA 4D81A 3DVMA 5CSFA 5IF9A 1KAGA 1NN5A 2WSMA 3LVQE 2L0XA 4PZLA 2LCPA 5E4FA 1GKYA 2WJYA 4DB2A 4XH9B 3IQXA 4N0EA 1RRFA 1JEDA 1SVSA 5BN4A 1N5KA 1G4UR 4AQJA 4UPGA 1U5IA 3CX6A 2ZRIA 1JNYA 3M0WA 3O8CA 2RGEA 2LLUA 1F48A 4LHVA 1BOCA 3K0CA 5CPVA 3REGA 4B6EA 3A1VA 1T8TA 3CRW1 2JJ1D 2CL7X 1T6NA 1YZGA 1I4LD 1PLLA 5FUWA 2A3RA 2XX3A 2NO1A 3RC3A 4I5LB 1KGDA 1E9CA 1KIMA 2RKOA 1AS3A 2ZRDA 4UXHA 3X1WA 5LPNA 4HRHA 2B1UA 2BJWA 2H8KA 3IO3A 1KY2A 2D74A 2DFNA 3SYKA 2R62A 1R8QA 1SCMC 1N65A 4NL4H 1IN7A 3CZPA 2P2LA 2FJUA 1N2DA 4LV6A 2IEYA 3RABA 1W0KA 2WAXA 1E79A 1FMJA 3MRSA 1TF7A 4CF7A 3SG7A 1VHLA 3TUYB 1F5NA 2QY9A 4UQOA 1HV8A 3R9WA 1QXPA 3TVDA 4F91B 1XU4A 4ESHA 5JSZB 2NLNA 1D2NA 5FOWA 4A0RA 3SOPA 4K46A 3BE4A 4EJSB 1KMQA 1XEWY 1S9DA 3MWJA 1S6IA 2JJ2A 4JVLA 2VSXA 1I2MA 3T1TA 4MZLA 1TADA 1TL7C 3EC1A 4IVQA 4RVCA 2F7SA 2LUXA 3ZIAA 2CJWB 3A1TA 1TU3A 3MMPA 4R71A 4M53A 3C8UA 1E2JA 4KBFA 2C9OA 2H2KA 3EK7A 2EFGA 2A5FA 2ASEA 2ZE6A 3UXMA 4F7WA 4XVUA 3TKLA 4MQBA 4FMCF 1M46A 4DLYA 2ZRKA 5KDLA 4D26A 5FTKA 3P27A 1A2KC 1JFKA 3EIQA 4LJ4A 5GJBA 4W7SA 1BS1A 1PJRA 4RJLA 3VAAA 3PJRA 2ZUCA 3FHTA 5HKWA 1NUBA 2CNPA 1L4YA 3EWSA 1YVHA 3JTDC 3EZFA 3AVOA 4HI0E 2KSQA 2ZRMA 4MRNA 2ZU6A 4AURA 1XFUO 1N6KA 2NCOA 2BHRA 4LRWA 2MHHA 4DLUA 5TNCA 3AKEA 4GSYA 4MUBA 1P62B 2ZRAA 5F98A 4Y0VA 2I7AA 5HCNA 3W6OA 4CEIA 3SYLA 2BL0C 3KJIA 4KLZA 5AERA 4JSTA 4ABYA 2VSFA 1R5NA 1G18A 3CNLA 3RS0A 2R2AA 2IL1A 3ZJYA 1XCMA 1GOTA 2GEVA 3FKQA 4B34A 1GZSA 1OFTA 2P6RA 3DF0B 3H84A 3DOFA 2PEYA 1FFHA 2XTZA 5C1BA 4BGDA 4YDHB 4DDUA 2CHGA 2XJ9A 4BUJA 2QACA 3LX8A 1ZP6A 5DN6D 4HAWA 3OIUA 2WCEA 2JLQA 4N5XA 2GVZC 2XEXA 4M8NE 4ZI3A 3KQNA 1K95A 4M2LA 2V3CC 3AVWA 2VF7A 2DB3A 2KI6C 2J7KA 1G3IA 2QE7A 3DM5A 5AJWA 3B60A 4LC0A 4LHXA 3K0AA 2Y4QA 1NNEA 4QGGA 1XK4C 421PA 2YC4C 2DPXA 2D8NA 4DC9A 4JMPA 2JJ1A 4E03A 1PVBA 2V54A 1QHIA 2HXSA 1AQYA 4ITRC 4Q7KA 4GI7A 3KX2A 1ODFA 1FX0A 1YHNA 1VRKA 4OQMA 1TCOB 5PALA 5AR1A 4OR9B 4TQ9A 3LBIA 2H16A 4CRWB 4FMDB 2QENA 4YMVA 1Y1XA 2WMOB 2CXXA 2PMDA 3IQOA 3BUNB 4G5OA 2ONKA 1G291 3RSOA 3H1TA 1Q1ZA 4H1VA 2F3ZA 4Q04A 1XMVA 2BCGY 3R9IA 2CTNA 4KVGA 2C04A 3SIBA 4RCYA 4Z1MD 2JLZA 1MO3A 4JKIA 3GOFA 4BFXA 4BLSA 3GJ3A 5JHGB 2RCNA 2PH1A 4XSGA 2HCJB 3VNUA 1WE2A 4ZCUA 2QNRA 5TY0A 3C16C 2WPDA 3LWNA 3GLIE 4ORBB 4EFLA 5KPJA 2WJIA 3B1YA 1E2PA 2ZI6A 4AKIA 1QHHA 4JKYA 3SJCA 3RVBA 4KO8A 5AUOB 3KUDA 4JPZB 1K5DA 3KKOA 3EWAA 3QI2A 5DIFA 5GJWC 1KNXA 1CLLA 4P4TA 1MF8B 4QRHA 4PC3A 4MRPA 3D0YA 2ZXUA 2GF9A 3NKVA 1ZRHA 1OV4A 1G1MA 1HY3A 4RKEA 1HTWA 1CM1A 3SJBA 4Q4LA 4WQ3A 3MWKA 2RMKA 5EE1A 1M74A 4PPFA 4DCNA 2F43B 4M2PA 1G9XA 1RJ9A 2ZS8A 3MSXA 1SQ5A 4LK2A 5JRJA 2QU8A 4DUQA 1WCV1 2J87A 3AKCA 4B48A 2ZTSA 4PQYA 3K9NA 1Z3IX 1BMOA 2DFTA 5HKKA 1T3SA 1L8QA 2FMXA 4B43A 4BZXA 3Q7PA 1N0VC 4W5JA 2FWRA 1EG7A 2PZFA 4YBHB 4MYTA 1CP2A 4A4BA 1VECA 1ZW6A 2YOGA 3I5FC 1Q1QA 4PE1A 2BVNA 3TIFA 4EPRA 3PFVA 1NMXA 2C99A 5HCIA 4OCIA 2XOKD 2CL6X 3EK4A 4C0SA 3B7GA 1L2OB 3HR7A 1HE1C 2KI6D 4ZO4A 1LVGA 2P3SA 4B33A 1GKIA 1E94E 5AANA 4ZCIA 2L0PA 3IKJA 1X86B 2DY1A 1XFWO 3NVAA 1LA3A 2D06A 1X1SA 5C2JB 4EPTA 3HU1A 1S6CA 1PSBA 5DN6A 2ZM5A 1SGWA 2JGNA 4QJ5A 1A29A 3FDIA 2PRUA 1UBGA 3IF7A 1SNLA 2IYUA 1M31A 2GWHA 3TH5A 1KSFX 3ZNIA 1OMDA 3ZWHA 2GCPA 1G21E 2HDNB 1QHYA 4LBYA 2O8FA 2G77B 3PEYA 1A5TA 2Q3FA 4C0JA 2LHIA 3THYA 4FMBB 3GLHA 2JNFA 3T1OA 1OB2A 3EA0A 4ZKDA 5JI2E 1UBCA 5JCPA 1TIZA 3A8TA 2FZ4A 1SXJC 4RFSA 4WBSA 3SHFA 4TL7A 5HE8A 4ZCLA 3EZ9A 1AJ4A 2JATA 2YOFA 1S6JA 4YGEB 2VP0A 1KK8C 2FFQA 2A78A 2YNMA 4PC6A 1GGZA 3K0FB 3I5YA 2ZRGA 3CBQA 1LINA 4BWYA 4CYMA 4LBZA 4D0GA 3W9YA 4TLCA 3E3RA 4IOLA 5FI1B 1JXMA 1N6PA 2AWOA 2PCJA 2RAPA 1CLMA 2IEZA 2FE4A 1IXZA 1OQPA 2WMNB 1XMJA 4Z1MA 4C0LA 3A1SA 3OZXA 1Y63A 3C4JA 4I5KA 1N5JA 3UANA 4AK9A 4KITB 1XD2B 5HE9A 3VR5A 4B6FA 1NCZA 1OT3A 2JWWA 1BYIA 2QG6A 1Z28A 2L50A 4IL1A 2HLDA 2OCBA 3CKLA 3VX4A 1IOZA 3ADBA 3ZLJA 3CRRA 5HZKA 1WY9A 2OUKA 2WM9B 1Z29A 5J40A 3CWZA 4F38A 3NBZC 5KYKA 4AC9A 4F4JA 2JLXA 3K0SA 2JQ6A 3LBNA 3AVXA 4NDCA 2HJGA 2FFHA 3GLGE 2M49B 1G7CA 2GZAA 2J45A 3CM0A 3L0IB 1KFXS 2JASA 1X02A 2OTGB 1XWIA 2ZFDA 5AEQA 4MKHA 4HRGA 1ZUHA 3C5CA 3KXKA 5I8NA 4Q4HB 3T12A 1FUKA 2F9LA 3EW9A 4EPYA 1EWRA 4IRUB 1E2QA 2IWHA 3CH5A 1Z22A 4M22A 5K8IA 2M1KB 4GFTA 1HURA 4OKSA 2COLB 3EASA 3T61A 1T0HB 4MZJA 2RGIA 4URUR 1E2HA 1DARA 1VG8A 4LZZA 3X2SA 4PE7A 1G8GA 3D10A 3EAQA 2ZRFA 1C7VA 2ISDA 4LJ7A 2WOJA 3FKSA 2V55B 2N46A 4PDZA 1VIAA 3AVPA 1CBUA 3RS2A 2ZN8A 3O8DA 4LV5B 3K09A 1JAHA 2K61A 1LFDB 3RLFA 4C0HA 3B9QA 5HPYB 2VP2A 3I5XA 2HEIA 1QHSA 1H8EA 2BEJA 2ZIAA 4UJ5A 4X8LA 5EP4A 3GD7A 4PHNA 3AGQA 2BE4A 2GK6A 2OBLA 2OCAA 4IJMA 4Q48A 2JA1A 1T0JB 2JNXA 5IDVA 3T5DA 4DBLC 4L9MA 1E2DA 1UHKA 1O3YA 2QP4A 3KTAA 1U90A 2VRGA 2LM5A 1QF9A 1XK4A 2HETA 1J8MF 4HB2A 4TMZA 1YE8A 3U5ZB 2WVJA 1KI6A 1BG1A 3FHCB 2NZJA 2ZVQX 1SXJD 3CF6R 2GDJA 3IIKA 2DCUA 4TYQA 4G5RA 4HDQB 2VHTA 1TMKA 3OE7D 1F2TA 4M21A 2YVUA 4GOKA 1G19A 4OVNF 3WXMA 1DAEA 1ESNA 3B85A 1WP9A 2WWHA 4M1MA 1UKZA 1AGRA 1KSMA 1NIJA 4NCNA 1GJYA 3EC2A 2EC6B 1WMSA 1XVJA 1UPTA 2IUTA 2YYZA 3FMOB 2GETA 4TLEA 1NVXQ 4CIDA 2LVJA 1JI0A 2BCJQ 3A4UB 3VR2A 2K0JA 2GJ9A 1NJGA 3KKMA 3Q5EA 5P21A 5JOLA 2REBA 2RGCA 3DOEA 4D4LA 1PVOA 5CDFA 3KFVA 4A4CA 4US0R 1NX0A 3CZQA 3U3OA 4TZ6A 2C95A 3FPAA 4JLBA 2ZJOA 4JVMA 3BOWB 2K5UA 1CJMA 4Q02A 4QJ4A 2FCEA 1SKQA 4AG5A 1QV1A 2G88A 1EG3A 1NRJB 4KI0A 4UKDA 1Y1AA 2XAUA 4IOKA 1ZNXA 1DS6A 2XNSA 1YRUB 3IHWA 4LOAA 4I5JA 1AA9A 2EW1A 1US8B 2G0NA 4HLCA 2IS4A 4XVQA 2YWGA 4Q1EA 2QEQA 3A36A 5H1YA 2O8BA 2E1RA 2R6FA 5FTNA 5BYJA 1UBFA 1XJQA 3M1IA 3H0KA 2IYWA 3CUEF 4CT5A 3ZVLA 4OQNA 4Q19A 1S1EA 1MR8A 4CEJA 5LD2B 3SG3A 1KDRA 4IW3B 4CZ2A 2PT7A 2QGNA 4PTLA 3LK1A 1NBME 1T3LA 4WA7A 5FR1A 2J9RA 2XITA 1KAOA 1DG1G 3ETLA 4USLA 3C1VA 1F54A 1J55A 1OXVA 2ZVPX 3FHOA 1UUSA 1ZOTB 3X1DA 1KQMC 1OH5A 4OI1A 2RGNC 2B8TA 3A4MA 5J4LA 2L2EA 3BUWB 3UPUA 2HQWA 4Q9IA 1C7WA 4GNKB 1XMIA 4PHJA 4YGCB 5JECA 4IXNA 5BXQC 4A0FA 2GGZA 4ZIRA 2L51A 3U3MA 2E87A 1II8B 1IN8A 2FNAA 3BYAA 4HLUC 4K81B 1Y3AA 3I73A 5EQTA 3GLGA 4M2QA 3WNCA 3GK4X 2MBXA 5DSZA 2CT9A 4XJKA 1A75B 3MCAA 4A8JB 1EL4A 1UDWA 2DBYA 4GZLA 4NCHA 1P7CA 2JLUA 1G7SA 2ZUBA 1E4VA 1FUUA 1FW6A 4FN5A 3DZDA 1HEIA 1ZD8A 3PUWA 4BFSA 5EP2A 1KJYA 2KQYA 2VRWA 1E2LA 3AV0B 2JJ8A 1R2UA 1SXJA 1SKTA 4MH0R 2WORA 2AFIE 1P6XA 5JI3E 1N2CE 2JPTA 5K8LA 3GJ7A 1QHNA 2AWNA 1E3MA 2NZ0A 1YR9A 1W4CA 2OEPA 2I18A 1AM4D 1K94A 1KO7A 3UG6A 4AWXA 3KQHA 1KSOA 3E70C 2ZAMA 3W6NA 3TUZC 4A6PA 1Z08A 3I62A 1HA3A 2PCLA 1AKEA 4Q7LA 1GSIA 4PHMA 1JJVA 1D6JA 3E1SA 1PULA 3QKSB 4HEJA 4RD4A 2V6IA 1EFRD 2OLKA 1E0JA 3TSOA 4ZCMA 1Z47A 1OFIA 1JPJA 1MKYA 4BY4A 2BDTA 3IPYA 1R0YA 4NDZA 1XMSA 1KQMB 5CK4A 3PEWA 4M2OA 1W2GA 1CS4C 3CPJB 3DHWC 3A37A 4PAMA 4A92A 1XPOA 2WKPA 3K0CC 1ZM9A 2AL7A 4PZYA 1U0HC 1I4DD 2EQBA 3X1ZA 1MO4A 4AYXA 4DT1B 3I5GB 2L4IA 1OMVA 1SL8A 2Q91A 2RGBA 4YGDB 2AK3A 3DKVA 4B2IA 2QPAA 1DAFA 2KBIA 1NY5A 1W1WA 3QXCA 3HWSA 4QBFA 2VHCA 4C0KA 1R0XA 4QHSA 2P6BB 3HU3A 3LXRA 1JR3E 3KFXA 3LY5A 1K96A 2B6HA 3BB1A 1HQYE 1DVRA 1B0UA 1QTXA 2FCDA 1NVWQ 3SFZA 2QBYB 4KU4A 2AKAB 2BMEA 2QROA 3CIOA 4BEBA 1K8UA 5I2QA 4CGZA 1VCOA 1UF9A 1Z63A 2AXNA 1FOEB 4IEEA 3VQTA 1KKMA 2VLIA 3L0PA 3KPXA 2BMFA 5FFMA 5TARA 1KNQA 2C9YA 4DCTA 4L9WA 3EZ6A 4MBEA 4PALA 1LB1B 1MR3F 1Z07A 3H4SE 1R10A 3M4YA 2WZQA 4DLZA 4PZZA 2D7DA 2ONJA 1V1FA 2HV8A 2QGZA 3FWYA 2Y8EA 3NSKA 2OO7A 3AH8A 2AKYA 1EX7A 4RD3A 2IYLD 1ZVQA 4IDHA 4QGFA 1SVMA 5B58C 5GJCA 4XIGS 3P32A 2IYQA 1J90A 5GVSA 5CIWA 2PJZA 1U5IB 4XWAA 4J0QA 3DKPA 2J0SA 4CFRA 1QATA 2BCBA 1RYFA 2REXB 2R6AA 2HQ8A 3NTUA 2IF0A 1XJCA 1RK9A 2FDCA 4PO1A 2G83A 1S5GZ 1DAIA 2VL7A 4LGMA 3VR3A 1AK2A 4B73A 5FI0B 3QXSA 2ZUDA 2NCPA 3R7WA 2V1UA 3KJEA 3QPUA 1SPYA 5FBWB 1RVDA 4PXAA 3VU9A 1KDOA 3ZS9A 4EQ6B 1WA5A 1PZNA 2QN6A 2FSFA 3AKDA 5JCZA 4I99A 1CJTC 4B3XA 2K7BA 3JVVA 2ODNA 1QIWA 5EXXA 3NDPA 5JS7A 4IEIA 1EFCA 1EESA 2N1BA 3O47A 4FXPA 3NXSA 2FF7A 2FH5B 4S35A 4ACAA 1XZPA 4JS0A 1ZUIA 5FBLB 3NIBA 5DI3A 1U81A 2KHNA 1SR6B 1K93D 1XYDA 1BO6A 2LLSA 4IDQA 1F2UA 4QBIA 1GL9B 1KJWA 2WWIA 3AP2A 4OK5A 2W83A 3PN7C 1EFRA 1CULC 1Z8FA 2JXCA 5E3HA 2V53A 5KSPA 1ESMA 2ODWA 1TCFA 1AGPA 3B13B 2QP3A 4KSBA 5BPJA 4KBGA 3WHUB 1NVVR 1XFXO 3ICQB 3GEHA 1X8LA 3TS5B 3OEED 4RFVA 2ZJ5A 5FOUA 1G5PA 3SR0A 4A2PA 1ZM7A 2KWIA 2F2PA 4US1R 1N6HA 2ZEJA 4L9SA 1IQ5A 2ZSFA 4B3FX 3ICEA 1ZINA 2IXFA 5EE9A 4EIWA 3I72A 5IBWA 1ONBA 1SKYB 3DVJA 1KMHA 1HQVA 4B71A 3TDUA 1XCPA 2XJ4A 4V0ME 5G41A 2ATVA 2L4HA 3NSIA 1DADA 1E69A 3U61B 2ZJ2A 4OYHA 4EPVA 2G3YA 3AQ4A 3GK2A 2O8EA 1JSAA 4YRUA 2PT5A 3B1ZA 4QNRA 3WMFA 4G01B 4BFTA 4JLNA 3IDQA 3EIEA 4M1WA 2BC9A 3N2EA 4POAA 4ZDWA 4BLQA 1UKVY 3WBKA 2LMTA 3BH6A 5J4KA 3GMTA 3ASZA 1SKYE 2PLRA 2XXAA 2JJ2D 2ZJZA 2KAXA 3IIJA 3IIMA 2RGDA 4N3NA 4MN0A 2RGNA 1FTNA 3V4FA 2PZEA 3DVEA 2OFWA 1WRKA 5HYDA 1Z0FA 2XNDD 1B7TY 2Z43A 3GJXC 3CPHA 1XD9A 3CR7A 4CEIB 1SMGA 3IUYA 2HYIC 3I3SR 1GFIA 4LYFA 5FTJA 3FWBA 3WNBA 2OSBA 4D6PA 1IONA 4JLDA 4BLTA 4HLUA 4DSUA 2OM2A 4L15A 3PR1A 5C46F 1D2EA 2J0QA 1IAQA 1MRNA 1HH4A 5E7IA 4QJ3A 4M9XA 4XVRA 3BXKA 1PLKA 3RC8A 4HAYA 2PMYA 2ZRLA 3THWA 2M7NA 2I3BA 2IW3A 2QI9C 2ORWA 2YWFA 2VP6A 5FR2A 2VHQA 1B8CA 1XEXB 2BCXA 2ANCA 4MGZR 3MLEA 2WWXA 1J2JA 2GVDC 1RC8A 3QKUA 3BWDD 2M8UA 4R1EA 3K0AB 3AVVA 1IHUA 1L7VC 5DHFA 2Z0MA 3GLFE 3IHLA 1ZYUA 2PASA 3MSEB 2GJ8A 1ZD1A 1BH2A 1W4BA 2X2FA 5BN3A 4PC2A 1G16A 1CU1A 4PO9A 1G64A 3H86A 3U4QB 2QT0A 1R4AA 2WV9A 3GJ8A 4EUNA 4BFVA 1QVIY 1KFUS 1MWNA 3EZ7A 3I5HC 2CCKA 2GZHA 4YMSA 1CJUC 1CRPA 5EXTA 3BIFA 1YU9A 4U7DA 1DJHA 2JTTA 2OS8B 4OHXA 3SE0A 2YWHA 4NZYA 4XSHA 3NSLA 4I1SA 5FPYA 1XB2A 2KBFA 2O0KA 2E9SA 1ZNWA 1XA5A 2CCJA 1SL7A 2QE7D 2XTMA 4WOPA 4X8OA 1KI8A 1VG0B 3F3YA 1JXOA 1Q3TA 1YZUA 3CS1A 3BORA 3I1FA 2H17A 1S3SA 1AJEA 2VEDA 2XB2A 2I94A 2CLSA 2OLJA 4Q00A 1XTQA 4I81A 1QG4A 2H92A 3HX4A 3TUJC 5A4JA 3KZ1E 1QHHB 1UJ2A 2BBTA 3WP1B 2GILA 2HXYA 2B8WA 3OEEA 2CK3A 3QKRB 4Q4JA 4TMXA 4TSFA 4URZR 5D7FA 4DKXA 1CFFA 4U8DA 3QG5A 4JSYA 4YI8A 1ZD9A 3CNNA 5JHHB 4WXPA 3A4NA 5EP3A 5JWOA 4DHEA 1E96A 2I2RE 4FTGA 2UKDA 1YZTA 1H8HD 3D0YB 2O5VA 2M7LA 2GHIA 2PX0A 3T5GA 4F4CA 3FWCA 2ZNEA 2O5GA 1XTIA 1W36C 2R44A 4AYTA 3OB2B 2NPIA 3W90A 1B47A 1YR7A 3DDCA 1BU3A 3A58B 3ZZTA 3I5IB 4ETOA 4NYIR 1RRGA 3B2EA 1KK3A 2WPDD 1ZIPA 1EWQA 4TNCA 1C4OA 1KI7A 1XEWX 2FPMA 2ODBA 4KXFB 5DO9A 1E32A 1KI2A 3SYNA 1UADA 1UHJA 1I4TD 4LJYA 1G8FA 1FBVA 1IBRA 4TYYA 3O78A 1QHXA 2X19A 5H8WA 3JVTC 1AZTA 3FS7A 2XNDA 3ND8A 5CB6A 4RD2A 1XDBA 1AVSA 2QMEA 1CJVC 4JQ0D 3NHAA 4MDEA 3SDZA 5EP1A 2WJJA 5BQ5A 1DJZA 4FMCB 2A5YB 1CDLA 4AQIA 5G53C 4M4SA 3SFVA 1JWDA 2ZSDA 4DVGA 2D4HA 5EJEA 4MGKR 2QRZA 2NMVA 4NBSA 1CNPA 2WJVA 3VRNA 3QQ5A 4F0ZB 1CFCA 4MUAA 4Q66C 1LF0A 3UWKA 4P5OE 1KK0A 3NEJA 1DOAA 4V0MA 4EPWA 2AAOA 2HT1A 1VDZA 1IJ6A 4QJ5B 1NWDA 5HLOA 4EKDA 2PVBA 3PXGA 2BKIB 2K7CA 1RKBA 3AEZA 4B32A 5HKKD 1G3QA 2Q9CA 3AKAA 1VPLA 1N0YA 2DFLA 2IYRA 3OF5A 5AJZA 2WKQA 3AUXA 5H70A 2O8FB 4Y0AA 3TSWA 2GXAA 1CB1A 1E6CA 1SCMB 3VRRA 3GLHB 4M9ZA 2O52A 1VG1A 3SHWA 2BM1A 2GJKA 2OXRA 5DE3A 3KKNA 4BLOA 3PLFB 1OMRA 1SRAA 1TNPA 2EHBA 3EVVA 2GAAA 4KV9A 2TMKA 2LP2A 1CR2A 3Q8XB 4NYMQ 2CDNA 1Z0AA 3RRZA 3K53A 1HT2E 3P4XA 1G17A 1QJTA 2K8MB 3K09C 1Q1EA 1E98A 2FSHA 2M1UA 5H68A 4CT4B 1NYAA 2MLFC 5L3SA 2IYZA 2DOQA 2AFHE 2I1QA 2ZI7A 1TTXA 2Q0HA 3IEUA 1QVRA 2F1RA 4MDFA 2WNDA 4DJTA 4EFNA 4MRRA 2A5JA 2NO6A 3LFUA 3TMKA 2WWYA 3UMSA 4JLKA 5FYXA 1TQDA 5J4HA 3HDTA 4U5XA 5EUMA 4A36A 3FB4A 5JJIA 1WBBA 1P2VA 2NOAA 3PM8A 4UNPA 1YQTA 1E2GA 1KDTA 3GJ5A 3A4LA 3MWYW 2J1LA 4G1UC 4DSOA 1E2EA 1S36A 1MT0A 4NU0A 1W36D 4OV2A 2BBSA 2MSEB 5KHOC 2JLSA 4FW9A 1BR1B 3IO5A 2P65A 3JTDB 1Z2CA 2VP5A 1NX1A 4Q18A 3DPUA 5FBQB 2JLYA 1H8HA 1P9RA 1G8HA 2OT3B 3ZZUA 2BMJA 4URVR 1FP6A 3W34A 1DJIA 1OF1A 1DT7B 1EGAA 5EUQB 2XZPA 1XX6A 121PA 2BL0B 1U8AA 3VFDA 5KNDA 1E2MA 1G5RA 5L3QA 4NCKA 4QGHA 2H18A 3UIEA 5CJPA 2HLDD 4BECA 2Y1NA 1NIWA 4D25A 1NCXA 4JZKA 3N70A 3O8RA 2WHXA 2QM7A 3IBGA 3TDIA 1EFUA 3VGOA 2LCFA 1W46A 1K5GA 2ZS9A 2J5XA 2ERXA 4IHQA 2A4JA 2BOVA 1FI5A 1A82A 1F60A 4MYHA 3HYTA 3LAWA 2B21A 3HP1A 1QG2A 4G0NA 2RHDA 4EDHA 1N6LA 2IXEA 4KODA 5G40A 1YX8A 3WNDA 2P5TB 4WQ2A 1N25A 2ZPTX 1BMFA 3N2IA 3W3AA 1FZQA 4TYPA 2J0VA 3B82A 3BJIC 4DLXA 3A1WA 3RAPR 5K8TA 3EK8A 4V0NA 3D8BA 2QSYA 4RZ2A 1QS7A 3KTAB 2XSZD 4P4SB 2ZU0C 4MRSA 3CNOA 2VSOA 1SVLA 1KI6B 3AVYA 2HCBA 1BYUA 3SBDA 4YMWA 2AD5A 4JLOA 5KNCA 3FKSD 1SVOA 3K1JA 1F2TB 1SVWA 2MMGA 1F6BA 1ANKA 1KZ7B 2KFFA 5KSOA 3CGAA 5B2ZA 3AAKA 4R2HA 4URXR 4OI2A 1H8ED 2VIIA 1XP8A 2F55A 1DO2A 4PAOA 1FI6A 4L16A 1M34E 4N1GA 3SZRA 3AF4A 1B8RA 2WTUA 3VKHA 1TF2A 1KO1A 1IQ3A 4MGIR 1OXTA 1K8RA 1F55A 3E5HA 4LC1A 2KYFA 5JSZA 2ZSAA 3VHLB 1YURA 2RB4A 1DO0A 1OKKD 2G0TA 3PFIA 2BBWA 2OG2A 2JOJA 3JZMA 4Z54A 1IY0A 4CLNA 2QT1A 2OESA 4M1YA 4A6XA 5CSNA 4F92B 4A4DA 4QJ4B 1R8SA 2FG5A 1XFAA 3LW8A 3WMGA 1K9PA 4BFZA 3QPWA 3AM1A 2DWOA 4NONA 3RSLA 2GA8A 1IY1A 1D9ZA 1E9FA 5AJVB 5DYIA 4DLWA 2KE5A 5JMTA 1NN0A 1H65A 3KDSE 2O8BB 3ONWA 4A15A 2JDID 4DZZA 1Q22A 3KXLA 1OPXA 1YUTA 1YZNA 2OE2A 4OK6A 3LK0A 3NSOA 1V1GA 5JJGA 1ODBA 1OYWA 3IILA 2F9MA 1YZKA 2WBLC 4NPHA 2ZETA 3SJZA 4WAUA 2D7CA 4NYJR 4CEJB 3AKBA 2ZRBA 1OSAA 1KK7Z 5DI9A 4OHZA 3OAAA 2WWWA 3GFPA 4LSGA 2CHQA 3RS5A 4MRXA 4HZUB 4DCVA 1IXSB 4BE7B 1TNQA 1GITA 1U0LA 4KYIB 3GPLA 1HYQA 4OKHA 3I5FB 5GQQC 2J7PD 3OB1B 4MA4A 5CSIA 1CDPA 2QZ4A 2ZSEA 1DG3A 1X8KA 5FOSA 3UK6A 3AGPA 3EG5A 4WW0A 1SHKA 4PCWA 2C2HA 2X1VA 2SCPA 2JEOA 2QQEA 3BERA 1M7HA 1D8TA 2BBOA 3QNUA 4H1UA 4ZIRB 3OP0A 5DKRA 1FL9A 2OILA 5SZKB 4OHWA 4ZDIA 2EFDB 2EU8A 3GP8A 2LC5A 2L5XB 3K70C 3QBTA 3PUYA 3UMRA 4BQSA 1T4GA 1KFUL 1E0AA 2NO9A 3ZQJA 4P33A 4M0LA 2XSZA 4PHGA 1HUQA 4Q7JB 1RTP1 3BS4A 1OJLA 4OHVA 5JBQA 1R6PA 1TEVA 1V43A 1U0JA 2OCYC 3T34A 4UXIA 2W00A 1XXHB 2HT6A 5CYPA 3DL0A 1SXJB 3NC0C 4KVAA 3SI7A 3Q7QA 1Y1UA 1M1YE 3B9PA 1QX7A 3QRXA 1OXSC 4TL9A 4BFYA 4JYBA 5IRCD 1MABA 3C7KA 3LNCA 1KK8B 2ZRPA 1GIAA 1P72A 4PANA 2Z83A 1OW3B 3GLIA 3ADDA 3WYAA 1JF2A 3MWLA 3R8CA 1GTVA 1PLJA 1DAMA 1KZGB 4PX9A 2F3RA 2IHYA 4PSKA 3B5JA 1K90D 4M1SA 4OQXA 4YLGA 2R2IA 4US2R 2XZOA 1NPQA 1BKDR 1IXRC 4ARZA 3ZD7A 3CR2A 5TXGA 4DWJA 3DEFA 3DMNA 4PHHA 2C77A 3TSZA 4ASUA 1FPMA 2WOSA 4M1OA 2PSRA 1W0JD 3LBHA 8OHMA 1OKKA 2EVWX 5JJKA 2QMOA 1DAKA 1S2MA 4LHWA 3EIHA 2EYUA 2LMUA 1U9IA 1AS0A 1KO4A 1GDDA 5AJXA 3SS8A 2CCMA 3ZGXA 3D6TB 1C07A 4HLDA 4LJ6A 1U8ZA 1CIPA 1OH6A 1UKYA 2V1XA 3B1WA 1T5LA 4LJAA 4DUGA 4FWTA 4HAZA 2ZYTX 4Q5IA 3QOFA 4I4LA 2W6JD 2JDIA 1KSHA 1CR0A 3TVTA 1DAHA 2A5GA 2PJRA 1TUEA 2OV2A 4UNRA 2FGKA 4JYCA 2WCFA 4Q4AA 1UKEA 5FPTA 1PUIA 3U6BA 3V4RA 1EXRA 2J59A 1QRAA 1XJ0A 1KOFA 3CLVA 3BQ3A 3EARA 1TNDA 1U94A 1G8IA 3HYRA 1XTJA 2QTFA 3MJRA 4MEWA 1U8YA 1IJEA 4XTRA 4XWOA 3AB3A 3W6PA 5KPDA 2VO1A 1MXLC 3QVUA 4LCBA 5E7JA 1YR5A 1NKTA 1IGVA 2J7PA 3EX7C 5AUPB 1YX7A 2A9KA 3RLZA 4N0DA 1OE9B 3RYTC 1IM2A 3K70D 3ZVMA 2J0UA 1H8BA 1DGVA 1QBKC 1R0ZA 3U44A 1VYTA 4JJZA 5I2LA 1D5CA 2ZAOA 2ZNDA 2V4ZA 3I8XA 3QE0A 3SQXA 2CBZA 1WLZA 2F3YA 2AHOA 2FN4A 2ATXA 4DLSA 2ODEA 3ICBA 1N0UA 1DTSA 4JBYA 5AUNB 1KDPA 2CLDX 4YMUA 2WIBA 3MD0A 1JUOA 5JEDA 1QV0A 5J47A 1DPFA 5L8VA 1RRCA 4Q9JA 1TNWA 2IYSA 1X3SA 1GNRA 5FUXA 1XTKA 2EFCB 1ZNYA 2NTYC 2QL6A 1AIPA 1XF9A 4GAOA 4KJZA 1Q21A 4NYMR 4R9UC 3SG5A 2IWRA 2V9PA 2JLWA 3RNLA 1DE0A 2PZGA 2ZQ5A 3K0FA 3HJNA 3OIYA 3GJ4A 3RWMB 4Q7MB 4XOIA 1KHTA 4C3ZA 1XFVO 1Q57A 5FPKA 4BPBA 2ZRSA 1BOFA 1DJGA 1J8YF 4LYAA 4LYJA 1G6OA 4LY6A 1W7JB 1WXQA 1T5IA 4A0HA 1F2UB 2X2EA 1N5LA 2GCOA 1NN1A 2GJSA 1LNZA 1OIXA 1ZNZA 5KTYA 1F3OA 3QKTA 2V8OA 2CE2X 3IGFA 3WY9A 2C78A 4CEHB 2IS9A 2CL0X 3A8RA 1W0JA 3PQCA 3WHTB 1NBMD 3T15A 2OHFA 4V0KA 1QX5B 1Z0DA 3EKJA 4WIAA 4ORAB 2PBRA 1B9AA 1E9RA 3CRMA 2OAP1 2QTVB 1KMHB 2P67A 1G4AE 4O2RA 4Q4HA 4TMKA 1QX2A 2HF5A 2TN4A 2M9GA 3PG5A 2O8EB 1DTLA 3H2YA 2R6CA 4GT1A 4QG7A 1Q20A 3B6EA 4OQLA 5FTLA 1W5TA 5CJ2A 3NDBB 3EVUA 2W6JA 2MRDA 2IA5A 4P2YB 4B35A 3NBFA 5EXPA 1Z6TA 3W5JA 3C15C 2ZRNA 2BKHB 1GGWA 3VR4A 1IN4A 3ADCA 5FUVA 2VHUA 4LX0A 4UNSA 2JRFA 1WDTA 4WZ6A 1W4AA 4E09A 4DDVA 2AUCA 4RZUA 4CFQA 3O4YA 2ZR9A 1W7AA 3GEEA 3L0OA 3TBKA 5JRZA 4XD7A 3KF9A 1S96A 2GRJA 3CRVA 2QAGC 1G6HA 1OSNA 2WICA 1CLUA 1Q0UA 2R6GA 4KSCA 4UJ3A 5CB8A 4HYYA 2KI4C 4QJ3B 2IYYA 4P32A 3C5HA 5LB4A 4O0MA 2SHKA 5TB5A 3THWB 2ZJ8A 4V03A 5CYOA 3W3ZB 621PA 1F70A 2F1HA 3THXB 5DHAA 1IG5A 2WIAA 3WXAA 2K2AA 3CR5X 1MV5A 1GP2A 2W0MA 1FW4A 1Q44A 3AF2A 2FOLA 3UWOA 5C4MA 4MKIA 3KHEA 3VKWA 3X1YA 1GNQA 4C7OB 4NMMA 5B30A 2LP3A 2YV5A 4GDFA 1XPUA 1AN0A 4GMDA 1VCNA 1S9HA 4JBXA 3SEAA 3T1QA 3CO5A 3CWGA 2P6UA 2ZJAA 4U00A 4DLTA 4QBHA 3LD9A 2O60A 1ZCAA 1ZU5A 3QBVA 4HLQB 4PFSA 3CF2A 3TJZA 2KSPA 4DRZA 1S8FA 3FE2A 1P9NA 3KL4A 4Q9KA 5FBRB 1JR3D 1E2FA 2LNKA 1GVNB 1PSRA 3BB4A 4GFDA 1NG9A 3EKHA 2IUSA 3O6BA 2C5LA 4B75A 4C0BA 1KWOC 5HLVA 4Q1FA 3TAHA 1JPNA 4BEJA 2CVHA 1UURA 2GV5A 3HR8A 5B57C 4RSGA 2NG1A 1Q3HA 1XRJA 2H57A 1SK6D 1M2OB 4AD8A 4TZ0A 4MRVA 3DVKA 1M7BA 3IQWA 1NKSA 4Q4JB 5EE0A 4B2LA 3EPHA 1NBMA 1M39A 1YZQA 2H5EA 4DS7A 1NLZA 2JLRA 2W6ID 221PA 1ZU4A 4LBVA 4LI0A 2HJVA 4NDDA 2ZRCA 1GL7A 2FJUB 2QMUA 3RS3A 3RS7A 4AKEA 4B2PA 5ER5A 3N5CA 2DWQA 4QHYA 4ZPXA 3KB1A 4KFTA 5GJVC 3G82C 2JZIA 4FCTA 1TQ4A 5AJYA 3DMDA 3S1AA 3J81k 4JLAA 2K7OA 2NQ2C 2D62A 2IC5A 3CB4A 1W2HA 2W2XA 5CM9C 2OZEA 5FOXA 2IYXA 2F8PA 1CLBA 3BOSA 4GP7A 1NCYA 4QHTA 1SL9A 4FI3C 1JR6A 2FPKA 2IS2A 2V7QA 2ZN9A 3IBYA 4HUQA 4I1OA 3L43A 1A2BA 1YRTB 4FQOA 4EQ6A 2CK3D 4TSFD 4TLBA 1E8AA 2OCPA 1CDNA 4AOMA 1HE8B 2NZ8A 4KAXA 3VR1A 2LMVA 1II8A 3AVQA 1W4RA 1CKEA 1LS1A 3AKYA 5CIQA 4ZDJA 5JLJA 1JF0A 4GUKA 3PCRB 2IUUA 4TMVA 4EFMA 3FMIA 3CF0A 3O8BA 1X1RA 2Q9BA 5JEEA 4AYWA 1DAGA 2VYFA 1XBTA 4GP6A 1UHIA 4LJ8A 5EZ5A 4TL8A 4BASA 2YOHA 1L7ZA 3PV0A 4JT4A 4ZCVA 2Z6VA 1Z6YA 4RZ3A 1LTQA 3SG2A 1M7GA 3TGPA 1E9DA 3QY0A 4M9QA 1N6RA 3BUMB 1TPZA 4TTPA 1WBDA 1UFQA 1WDCC 1MHOA 2GGMA 2OXCA 3KQUA 1MXEA 3GK1A 1JJ7A 6Q21A 4AKHA 3BXZA 1L2TA 1Q12A 4JL8A 1YUUA 1R7RA 2QPTA 4PC7A 5FBVB 1UBEA 2JULA 1AKYA 2Q3HA 3EXAA 1YRBA 3PN7B 2KBEA 4DB4A 1BJFA 3VNVA 1S1MA 3PSRA 4DDTA 3FIAA 1JR3A 1KO5A 4NTZA 3SJAA 4QC2A 5IT5A 1WF3A 3D31A 4JT2A 2ZROA 5CLQA 5K89A 4NP6A 3BAFA 4ZI2A 5A5GA 5HTKA 1KI1A 2FSIA 4R2IA 5FTMA 1MO6A 4DT1A 1C9KA 3OFNA 4YC7A 4C2TA 3EPJA 1I2DA 5L3RA 4JVSB 1S5GY 2KB0A 2LANA 3PUVA 1GRQA 4TLDA 2JT8A 1RFLA 5D3QA 5J3XA 3A6PC 4HAVA 4IKEA 3QF4A 1FX0B 1PRWA 2Y5IA 3TUIC 3QEOA 4FCWA 3QIAA 4DSTA 1D2MA 4DCSA 2W6IA 5FL3A 1W47A 4O3MA 4Q9HA 2KGRA 1IQPA 1IY2A 1S3GA 4QBGB 3ZDQA 4Z51A 4GGNA 4MSPA 2FZLA 3QEJA 2EFEB 4A0GA 3TUYC 1Z0KA 4G3XA 1PALA 1KTVA 4KCGA 1NSHA 3B8HA 4IFEA 1F8HA 1J7PA 1LY1A 1ZMXA 4YONB 4YXWA 4LHZA 2NPFA 2WCBA 1E9EA 3RRYA 2KI5A 3WHKA 5KDOA 5DISB 3TE6A 5L3QB 4BFWA 1KI9A 3BFXA 4EJSC 2D3WA 1LVCD 2QSZA 2VPPA 3KJGA 4LYHA 5UKDA 3G0HA 4HSEA 2KNEA 2QAGA 1DF0A 2LE9B 3LXXA 1UHHA 3M6AA 3CWQA 1MH1A 4NE2A 1KCYA 521PA 1YZLA 3KKQA 4YDSA 1U99A 1A1VA 4HB0A 1MUXA 1SVKA 2GEUA 5HZHA 3NEYA 1GRNA 4N1AA 5JFGA 2KDHA 5ER4X 1TQ6A 2BMDA 4HDCA 1S4QA 5KDDA 4FCVA 4NCJA 3AF1A 5CITA 5KOYA 2MLEC 4JLMA 4QNMA 2EGDA 4Q21A 1LA0A 3K9HA 3P1JA 3LL8B 4IOMA 2RGXA 1N6IA 3PALA 5FPSA 1BT6A 5KSYA 1CF4A 1WQ1R 3VTKA 5D69A 1AS2A 1KKLA 1NY6A 1ETUA 3BGWA 4D4JA 1EFTA 2G9BA 3L8ZA 3SBEA 1S3PA 2Y1MA 1RJ9B 3C41J 3D3QA 3LCPC 2WC8A 1HT9A 1C1YA 1YR8A 4R7ZA 1K9KA 1CRQA 3OESA 5HR5A 2CVFA 3ZZ0A 2PLFA 1RZ3A 4IVPA 2O8DA 3F8TA 1KQVA 3FVQA 3I5HB 3I32A 5C18A 2R65A 2FEMA 4AI6A 1XD8A 1IWQA 2ERYA 3U3JA 4P3YA 2I4IA 1KSJA 1RW4A 2NGRA 2YC2C 1SVIA 1G8PA 4LDJA 1BMFD 4NKRA 3SN6A 3ZYCA 1SCVA 2E30A 1J7RA 1E0SA 2F33A 1JBAA 1OXUA 2ECKA 3PITA 2LVVA 3WYGA 4DRWA 3W8NA 3U3KA 3QXXA 4HB4A 2J41A 4TT3D 4RCZA 1YVLA 2O8CA 3L8YA 1OZSA 1OYYA 2MMCA 5C4GB 5GVRA 1VCMA 4LHYA 1JAIA 3TNFA 1UEIA 2GCNA 2P5SA 1KSGA 3DD4A 1E99A 2PALA 3G5UA 1DBSA 2A5DA 3K8YA 2JCSA 2ZI4A 3CRQA 1CKKA 1CTQA 3QENA 4Q03A 4TQAA 3NH9A 3QSYA 5KU1A 3THYB 2MJWB 4LJ5A 1IN5A 1G5TA 1QZXA 5AFPA 2LHLA 1FF1A 1CM4A 1RE0A 4TTRA 1KJZA 4RFSB 5SZHB 4ZKEA 1P2UA 2BM0A 2WJHA 2I1VB 1B4CA 2KFGA 2ZITA 2IYTA 1W36B 3RANA 1ZM2A 3FFAA 5CSJA 3DO6A 3VRPA 1DEKA 4OJKA 2ZE7A 2ZSBA 4ZDKA 3GLHE 1EH2A 1OH7A 2JXLA 1G4YR 1NP6A 3L82B 4L4UA 1Y6WA 2AMIA 1E1QA 4XWKA 3AVUA 1VG9B 2CXJA 1IJFA 1RFJA 3KB2A 1NSTA 1P5ZB 3OEHA 1GKUB 1FNNA 2NO7A 3JVTB 4AG6A 4IDNA 1TQ2A 4PPGA 1N6NA 5IHPA 5F9HA 1RWYA 2Q21A 1QLKA 1P73A 1W48A 2KAYA 2FSGA 3QJYA 4KHZA 4E07A 2KJQA 1TF5A 4HZIA 2ZKMX 3GLFA 4JLPA 1E9AA 2LKCA 2ZE8A 3ECCA 5J5CA 4BRWA 3OHMA 1U9IC 1MO5A 2QUZA 3Q72A 1NJFA 3LX5A 1PV4A 2HUPA 2BBNA 3ZVRA 1SHZA 2QM8A 4QGAA 2Q3MA 1YR6A 5DH9A 4M1TA 1NI3A 2W58A 5HKZA 1L4UA 1XEXA 2ZJYA 4IFBA 1YKSA 1JQLB 3PEUA 2J46A 5GADl 3VKGA 2Z4SA 3SNHA 1XFZO 2FEOA 2AD1A 3OAAD 5SZJA 1RJVA 4D4KA 2OBNA 3WYFA 5D3MA 5FUYA 1R0WA 4IDPA 1KYIA 4RD6A 2BEKA 4B74A 3IPXA 3U60B 4A9AA 2D2EA 2NXQA 4IOJA 5B64A 3U4QA 1TAGA 1MQ1A 1EK0A 1E0KA 2XB4A 1X8JA 4YI9A 2Q6TA 1MABB 3D7MA 5AUQA 4D82A 1ZJ6A 3L2OB 5LB2A 2P0EA 3GLIB 1RYHA 5CLLA 1XEFA 4JL5A 1G7RA 4FMDF 4Q1DA 2DFKB 3DVLA 3NBYC 3P20A 1L2OC 4MRYA 2GEDA 3LVRE 3U7EB 4OQFA 3V00A 1FTSA 5LDDC 4HDOB 2QP9X 4DIRA 1IN6A 1F71A 2JT0A 2QMHA 2H61C 2B92A 4I1VA 2KYCA 4QL3A 4LJ9A 4ARZB 3OX6A 4V02A 4OBEA 3KEVA 2BE6A 3IQQA 1K9UA 1KK1A 3BD9A 4HUQB 4C2UA 3FOZA 4LBWA 2OBMA 4NH0A 3MGCA 2FX3A 4TT3A 1K2HA 1B23P 1ZIOA 2M0RA 4G5SA 2G1KA 4XJXA 1E2NA 2E6WA 3QKRA 1WRLA 3NXAA 2ZRHA 4DLRA 3P26A 2Q9AA 3CH4B 4RY2A 3R8FA 2PMKA 4Q1BA 3GJ0A 1TX4B 4P31A 4GMXA 1D1OA 4HUTA 1VCIA 1YVDA 3NC1C 1E1RD 1FQJA 2UVQA 2BV3A 4OL0A 1XNJA 2CNWD 2REOA 3MFYA 5IK2D 5KO2A 3ZD6A 2Z4RA 1S1CA 2C03A 1W7IB 1DJWA 1BLQA 1JALA 2WOOA 2N42A 3M0EA 1SYMA 1R5OA 4B3GA 2ZYWX 2M97A 1N0WA 1K6MA 2GBLA 2RGAA 1TOPA 1P3JA 3QPVA 4ERNA 1LF5A 1P2TA 5TVKA 2MSCB 4Q4AB 4ASUD 1J1DA 4EJSA 5EZ6B 1AHRA 3V9PA 3BK7A 2UZIR 4DSNA 3TRFA 3NH6A 4YGAA 4ESVA 4W9MC 3VR6A 5JJLA 1GM5A 1SBJA 1Z0IA 4S2EA 3VROA 3PIRA 3TW8B 5DKQA 1CXZA 3TK1A 3ADKA 2G6BA 1OB5A 2YINC 4FINA 2CJWA 4URYR 1BF5A 4CPVA 3EA5A 1MRSA 1YTZC 2J0UB 5A0FA 3U44B 1XCGB 1U2RA 1Q1BA 3WHLA 4DUGD 5CDFE 1GRRA 3MJHA 1Y0VH 2GAOA 2C96A 4OI0A 5EE5B 2OTGC 2ANBA 5FL7D 4BFUA 1CDMA 1X6VA 3I8SA 1KK2A 2RH5A 4PR0A 1JC2A 4KFRA 3RRNA 3RHFA 1SY9A 2F3TA 1MOZA 3BC1A 4Q1CA 3U7GA 3Q3JB 5DGXA 5TDHA 1AP4A 3F0TA 4IXMA 3BH7A 1B1GA 3BFVA 4IVRA 4TTQA 4KFUA 3CTNA 3QVVA 3LH5A 3B1XA 1R5BA 2KFHA 3LRPA 2IYVA 1M45A 3LV8A 1WLMA 2C98A 3QXHA 3DF0A 1J70A 4BRUA 4D0NA 3ASYA 1GAJA 4URWR 2GXUA 1VYVA 3LLUA 2QTHA 3OIWA 5JWHA 2YKGA 5FH9A 1KI3A 2W2VA 4LUCA 2KQ6A 4W5HA 4TWZA 3GLGB 3UKDA 4PPNA 4GOJA 2GXSA 2ZE5A 4XJKB 2GCOB 3LO5A 1NSFA 1FQKA 1XTSA 3MG9A 1FNMA 1PVAA 1AZSC 3SU8A 2CCGA 4ZV4A 5DNYB 3PATA 5L3VA 4BZQA 4PE4A 1NVVQ 1NL3A 1TNXA 4RZXA 2GXQA 2JIZD 2RGGA 4LV8B 4XTCS 1QLSA 3KQLA 2R9VA 4B47A 3RWOA 2GESA 1EJ3A 4UNNA 3U6KA 3NG1A 1TUIA 5CK5A 4GBAA 2H1LA 2O0HA 4DIDA 2JLVA 1DVIA 1E1RA 5IK2A 2FOTA 3KO0A 4I5NB 1QASA 2EC6C 2CNWA 4LPSA 1P60A 3CX8A 4GRAA 3OX5A 3DM9B 1M63B 1NVUQ 3A1UA 821PA 4RD0A 5F3WB 3SG4A 1XXHE 4QM7A 2KGBC 1ELOA 1M8PA 1SXJE 4R98A 1G41A 1N6OA 3SQWA 1Z5ZA 4YQFA 2ZRTA 4PAQA 4TQUS 2GZDA 3VHXA 5AXIA 3NHBA 2GJAA 4QM6A 4NDBA 2QPOA 1OIVA 1TN4A 1CEEA 5JWRA 2IXGA 4NCIA 3RDPA 1VYUA 3WP0A 1CR4A 5J4VA 1RRPA 2ZI5A 4PQFA 2IS1A 1AK8A 4PSAA 1CJKC 2XZLA 4PPQA 4C4PA 1UM8A 2JTZA 1KO8A 1A4RA 2IT1A 4CW7A 2J3EA 2XOKA 1J1EA 1W49A 1E9BA 4MYCA 2B7CA 1LV7A 1NLFA 1OFUX 2DWPA 2GKSA 3VRQA 3C14C 4DDWA 3K70B 5AK0A 2IBMA 1ZACA 4KLNA 2X77A 1NMYA 1UWOA 4JJKA 2A7QA 1NN3A 2FA9A 2X8AA 4LWZA 4P4SA 3I92A 2R8RA 2NIPA 1DJXA 4JVNA 2WWFA 2F43A 4C30A 1GILA 3FGNA 4WXRA 5FL7A 2G2BA 4NQGA 4HAXA 5SZIA 1II0A 2Z5FA 4N1FA 3W8RA 3EVRA 5LD2C 4K8OA 2W0SA 2PL3A 1RECA 3DZ8A 4BLRA 5DYGA 3QUSA 3PENA 1VTKA 1ALWA 1WRBA 2QQ0A 1N5IA 2ZS7A 1KK7Y 4AY2A 4XD7D 2ZYVX 5K8UA 4FIDA 1SW8A 1JBKA 5G08A 4JLVA 4AKGA 1OH8A 2M29A 3PVSA 2LKDA 2VF8A 3NBXX 2WSSD 4MZKA 1GUAA 2H61A 4HAUA 3CZTX 2AR7A 1ZMZA 4D80A 2F1IA 4ICBA 1YRAA 2OPOA 3B78A 3GQBA 2WWGA 4C0QC 3K9LA 2KAVA 4D1EA 1JECA 3REFA 3U7FB 4D0LB 2YHSA 3AAJA 1XZQA 4C0AC 1W5SA 5J4YA 4A8JC 1ZBDA 2VH5R 2QRNA 4PO8A 4DEYA 2B7BA 3TDZA 2Q4UA 1DELA 2AK2A 2MA2A 2DR3A 1AJ5A 1WB9A 5E95A 3R7WB 3K21A 1TU4A 4QKQA 5F9FA 4M1KA 1KY3A 4I1UA 3VU9B 2OAQ1 2GK7A 3BFKA 1BIFA 2JIZA 2XTNA 4B44A 2XGJA 4YMTA 1VIYA 4QXAA 3EZ2A 2WKRA 3NWJA 5G3ZA 1GWNA 5BYKA 1Z6AA 4PSVA 3SIAA 1FP7A 1Z2AA 1NF3A 3UMFA 4P4UA 4Q01A 2WJGA 1UHNA 4MITA 3BB3A 1GNPA 1R6BX 5DI3B 3S1AB 3SC3A 4TL6A 1CTRA 4G5QA 4KFSA 4OHYA 4HZUA 3LA6A 4PHKA 3P4YA 1XD2A 2VP4A 4NYIQ 4B3DA 1UP5A 4E5UA 2AN9A 2VP9A 4EPXA 1V5WA 2F1JA 3HPRA 1SULA 2JU0A 2KOTA 1PK0D 4M9SA 4B76A 1NIPA 4B3CA 4QOSA 3FFBA 1G3MA 1NLYA 2BJVA 2PX3A 3CONA 5FOVA 2SASA 2GF0A 3I5GC 3R20A 3PUXA 1Z06A 3WBJA 2ZR7A 1JB1A 4JWQA 2BCAA 1CMGA 4RD1A 4A1FA 2GTPA 4GBMA 4W5WA 4MKGA 4ACBA 4A82A 5BWMA 3O2PA 2IS6A 3WNXB 1T8UA 3FMFA 1TTTA 3TR0A 1Z83A 1JFJA 1EFHA 2ZRJA 4GGFC 1XFYO 1XPRA 1D9XA 3BH0A 4MYUA 4AIIA 1J7QA 3GJ6A 5CM8B 3AP1A 4YGBB 1P4SA 5EE3A 1ZAKA 1E9SA 1XXHA 2D2FA 2XXAB 3THOA 1VHTA 3LDAA 2V7QD 4PQRA 5F2EA 1II9A 2AXPA 4X8MA 1RIFA 3OE7A 1JEEA 1DGUA 1S26D 4DCKA 4U02A 3ZVNA 1W44A 4V0LA 1COWD 2EFHB 3LW7A 3WRYC 3QG1A 1UAAA 5LBIA 1QIVA 3FTQA 5JZVA 1H4BA 1PUJA 1Q80A 3UATA 2ORIA 3SJSA 4JLJA 1S0UA 2JT3A 3TR5A 4PC1A 4DCUA 2WSSA 2ZI9A 3HU2A 2JC2A 1OFHA 2RHMA 4GL2A 3LLEA 1A7JA 2A2ZA 3AF3A 2K7DA 1SZPA 2DYKA 4DLVA 1Z6GA 4OI4A 4JIMA 1G20E 1G7TA 4C9BA 4MKFA 4V0OA 2AX4A 1NX3A 1N3BA 3BRWD 2F2OA 4GPLB 3IEVA 2ZREA 1TEXA 1J7OA 3QF7A 3K9GA 4GPTA 3X1XA 4D2IA 1VMAA 3LLMA 1HQCA 1P2SA 4XYNA 3GFTA 3HPQA 4TMWA 2IX3A 3Q85A 2G1JA 4TLAA 3CPEA 3QF4B 2LVIA 2CMKA 2LLTA 3BBPA 2HPSA 2NO0A 3AP3A 5BN5A 1UEJA 4Z8XA 2HF9A 3AVTA 2CE7A 3CLNA 3SG6A 2VQSA 3Q5DA 3T1VA 4TYNA 2YZ2A 4EAQA 2F6RA 1IRJA 1ZC4A 1G8YA 2OFOA 1B7TZ 5FPHA 4DXAA 2HF8A 1ALVA 1SR6C 1OHHD 2FFAA 2ZANA 3MUFA 3VMFA 1CFDA 5DLQC 3TAUA 2H7VA 1A2XA 3BOWA 4BLPA 1E2KA 3ZS8A 3OFND 1OLOA 1Z6XA 3LQQA 3E2IA 5BW8A 1B8LA 3JZAA 5ELXA 3KUCA 5HKYA 1DF0B 1ZM4A 2EWVA 3F45A 2MSDB 2QAGB 2ZJBA 4G5GA 5E7MA 3RRMA 3WRXC 3TS5C 3TZ1A 3KQKA 1CFPA 2KI4B 4WZAE 1US8A 2VTKA 1AUIB 2L98A 1E4YA 2A30A 2VA8A 4Q1AA 4X8HA 3AF0A 2W2TA 3VX3A 4WZBE 2QORA 3TQCA 4TMTA 3H4MA 2P6NA 3BUXB 3R9XA 1J99A 1OOJA 2DHRA 4B3BA 2BWJA 3PUZA 2EWWA 4JL6A 5KUTA 1FMLA 2BECA 1LS6A 3CR8A 3TLXA 4A2QA 2LAPA 3CW2A 4QFMA 2PEZA 3KKPA 4D4MA 4BY5A 3UG7A 4YXWD 4PHTA 3U3RA 2CBLA 4UXJA 4BZPA 2VBCA 1QVIZ 3CR4X 1QDEA 2HYDA 1O87A 3TW4A 1OE0A 4CVNA 5F6TA 4TYWA 4KYUA 5AWFC 1ZM3A 1P75A 2BBMA 2LUCA 3PEVA 2ORVA 2CEAA 3FMPB 4A2WA 2O8DB 4JBWA 2BIFA 4GNKA 2M3WA 1BODA 2UZ3A 1XTRA
chains in the Genus database with same CATH superfamily
3CJTA 2OO3A 2ZIUB 3ANLA 3IDOA 2G04A 3Q7TA 3QBJA 1LI7A 3N74A 3PDIB 3DB2A 3CZRA 2QA5A 1U7TA 3RHSA 4H7IA 1RPZA 3G8DA 1T91A 3RTBA 3L1IA 3IVRA 4RK0A 2CHVA 5ICMA 4YRKA 2IHBA 1OHHA 4II7A 1EP3B 4FKMA 3ZIAD 1ISSA 1Y33E 2JAQA 4BVGA 4P3NA 3DTVD 4BATA 1CF2O 5SYAA 2PGLA 3NCHA 3QPBA 2PLNA 4WKBA 5EXSA 4QGSA 4BQPA 4HREE 5KSZA 1DKQA 2YHIB 3X0DA 2GBLC 2EG9A 2G09A 3R5SA 4RF5A 2VXYA 4CCYA 2PD4A 3WGHA 2L0XA 3R3JA 3DE7X 3MILA 4YMIA 2WF8A 4P53A 1A0OA 4UVIA 3REGA 3A3PA 3OQNA 2OWEA 2JJ1D 1T6NA 4FQ8A 2NO1A 1KGDA 3PD0A 2H8KA 2DFNA 4BJ5A 1IATA 4BV9A 5K05A 4PXYA 4EEZA 1VHLA 2EBHX 3BGOS 2WB2A 3SOPA 1XEWY 1S9DA 2VSXA 4KPUB 3WRXA 3WQHA 4N49A 4RVCA 3MFQA 3ZIAA 3H2GA 1Y6GA 2VZ0A 2PGIA 4OHRA 3AHGA 2GN9A 3DTVA 1J42A 1O7JA 5HKWA 2CNPA 4INJA 2ZRMA 2KLEA 2IIVA 3H87A 3RVQA 1XC7A 4A0SA 1MGOA 2UUOA 2HSEA 2VT2A 2EBFX 1T29A 4E21A 1QQTA 3CR3C 4M89A 2R11A 1NYQA 3BRSA 1P2FA 4E03A 2JJ1A 2HM7A 4ITRC 3FE8A 2QV7A 1S2OA 2JI8A 2XWJI 4WEOA 1QXSA 2H16A 3DWGA 5JSUA 4FMDB 1Y1XA 3BUNB 5BW4A 2BCGY 2CTNA 1IB0A 2WF5A 3A05A 2Q4DA 1T0BA 1QWOA 1LK7A 1QHHA 4JKYA 1V37A 4AX8A 4JPZB 1K5DA 4CTJA 3LDUA 2ZZNA 3R1IA 4KRGA 1UC4B 1JLMA 1THTA 1L5LA 4EG5A 2VK2A 4DUQA 2FMXA 5G1PA 2GFIA 4BFCA 1Z4MA 3MW8A 4X84A 2Q6KA 3AEYA 4PWYA 3F6YA 4IS2A 1WETA 3V80A 5JSHA 1LA3A 4II2A 3TIIA 5COQA 4GPAA 3UGJA 4M0FA 1JKJB 1KSFX 3WWZA 3D02A 2Q2OA 2V0NA 2H2DA 3OCYA 1U9YA 2HY7A 4Q3NA 3FPJA 3GA5A 3V7YA 2FZ4A 2IPOA 1AJ4A 2VP0A 2DBQA 4G0MA 4LBZA 1EI9A 1CLMA 1NT4A 1UWLA 3JWIA 2Z8XA 1NDUA 3DD1A 1M1ZA 4E14A 1V3QE 1Z29A 1JHRA 4F38A 5KYKA 3N2KA 2J45A 1AQLA 2XMGA 4KAJA 1X02A 1T35A 3K1ZA 3ND5A 2F9LA 1F12A 3I9V1 3KPUA 3SVLA 5E6SA 4CM4A 1ILEA 1CUWA 4URUR 1DARA 1TMOA 3DV2A 1NNUA 2CXHA 2YY6A 2ZRFA 2WOJA 4IQGA 3I5XA 3GJTA 1Q92A 3QEAZ 1DEOA 4QUHA 2JA1A 4MVJM 3UGKA 5A2QA 1J9EA 1OI2A 3STWA 3PIDA 2HLHA 3IIKA 4PW0A 1PSZA 3DE4X 3F5SA 1ZJ4A 1WP9A 3LPLA 2EKBA 1WMSA 3NTRA 2IUTA 3FMOB 3HJHA 5IT9A 3UJAA 4B8WA 3SS5A 1DNPA 2BZ1A 1JEYB 3FCXA 3D43A 1QTNA 5P21A 4P4GA 2JLBA 1R4MB 1K86A 4PF1A 2IFTA 1ULBA 4U9HS 4LOAA 3R7NA 2J6HA 4YT5A 3DVQX 3MPUA 5KYXB 3DFFA 1OGJA 5PGMA 3PM2A 4Z3OA 3FZEA 2HNKA 4L75A 5CDUA 3A4MA 5CT9A 2YW2A 5EA2A 1YA6A 1YS2X 1QX4A 4HLUC 2YL2A 1RXEA 1UDWA 3T4PA 1HKHA 3R5TA 5E1OA 1O94A 4FX5A 3LUKA 1E3MA 1K3FA 3O2JA 1IMOA 4QYXA 2I3ZA 1HA3A 2PCLA 2A84A 1EJBA 1MKYA 2IW1A 2BDTA 3BFHA 3VGPA 4A92A 4LOIA 2AG0A 4LRQA 5AVOA 4HVCA 4F9EA 1UXIA 1K96A 3BB1A 3W1VA 3UC5A 1J20A 4MVJG 2IP1A 5KINB 5HIJA 4UDNA 5DGHA 4O2BF 4P4NA 2GRUA 2FR8A 3G9XA 3NSKA 1ZIYA 4RMHA 1X1EA 4EGSA 3FPHA 4O6VA 3T1HB 4G4GA 4L22A 4FFBB 3K2IA 4B73A 3DDOA 5B3AA 1C0KA 1XDZA 1JH8A 2JD2A 4WINA 1WA5A 4HFNA 4QJIA 3NDPA 5TF0A 2OD2A 5DI3A 3MJCA 1IHPA 2P8JA 4QBIA 1KY4A 3KR0A 2WWIA 3AHFA 1Q0QA 4YRTA 5KSPA 4XWGA 1L5YA 1G5PA 2B1RA 3WKDA 2F2PA 2QTVA 1ZSNA 2XJ4A 3DTVB 3UAVA 2BKVA 1TECE 3OJEA 3B1ZA 4LOLA 1NQUA 4UAVA 2JJ2D 4E3WA 4XFJA 2V7TA 1GFIA 2OSBA 4LTMA 1IONA 1MRNA 3D6UA 4JYMA 4HAYA 2WF6A 3JQ6A 4EF4A 1Z4OA 1HTBA 2VQEB 3BWDD 4R1EA 3GLFE 3EGOA 5KZMB 2B0JA 2I7CA 1G64A 2UYHA 1CT9A 3I9LA 1QO0D 2Q0XA 1MAUA 2OS8B 2XVZA 2IQIA 4YP9A 4WOPA 3WNQA 3F3YA 1JXOA 1YZUA 3BORA 1RIIA 1E20A 2V8BA 3ORYA 1ZUWA 1Z34A 4MW4A 4KTVE 1QHHB 3QKRB 4TMXA 2CJPA 2OYCA 4ZQHA 4YQYA 2UKDA 4D4HA 4MIKA 4WK2B 4JBIA 2QI9F 3KT8A 4L5YA 5E1BA 1KDZA 3IBFA 3GRZA 4NC9A 5H8WA 4KUHA 1C3OA 1FFBA 3JVTC 1DJZA 3UHPA 1T10A 2A1TS 1CFCA 3D3NA 4P5OE 2ONYA 2R79A 4V0MA 3ET4A 5IFKA 4B32A 2COKA 1TVMA 1RBZA 5EQDA 4D6YA 3PLFB 2UXCB 3AZQA 3RG8A 1SOAA 3HMQA 2C9ZA 3C3MA 3C87A 5LDHA 2A9OA 1U1FA 4ZAWA 1GQOA 2AJDA 3HDTA 3VOAA 4UE3S 3PM8A 2VNSA 4GX2A 1E2EA 3OPVA 3R09A 3N2KB 3ZIDA 3NHPA 1ZSYA 1PR5A 1FS6A 3NNNA 4CTMA 3E9MA 3PFGA 2BMJA 1XYYA 3C98A 3DAPA 5E6SB 4CM4B 1EDZA 1UP4A 4H6VA 4DM3A 3HO1A 3X2EA 3KZCA 4EKEA 2XB9A 1W46A 1K5GA 1A82A 5T4BA 1QG2A 3DGFC 2ZIWB 4WQ2A 1N25A 4TYPA 3QELB 1XR3A 3OX1A 2CYCA 3ZHBA 2ZTHA 3DBOB 4Z7JA 2I5PO 3A2NA 3R6TA 2YY7A 3KD3A 1LSSA 2OAGA 1IQ3A 1OXTA 4C4XA 1QYDA 2D0OB 2Z8YM 2YWRA 2OG2A 3RAEC 1E5XA 3LW8A 1ZK2A 2OO5C 4ED9A 3BZBA 2DWOA 2VNIA 1Z36A 2WE8A 2DSNA 3AG5A 2GCIA 4GLJA 4DZZA 4FYIA 2EERA 4XIFA 2H1SA 2ZB2A 2OGTA 2JIMA 2O6HA 3EEQA 8MHTA 3UK6A 3ZWCA 3TSYA 4AS2A 1L9KA 1YIDA 3OP0A 4IQ0A 4EFKA 5MHTA 3QBTA 3V34A 4PQEA 2HX1A 2ZOSA 3LM8A 2PVSA 1OJLA 2XUJA 4OHVA 2ZBEA 3KEGA 3NC0C 3SI7A 4LDZA 3WGVA 5K4HA 1PJAA 3K0BA 1PT5A 3GLRA 3MWLA 4X20A 1PLJA 4O29A 5B6IA 4I19A 4HAOA 2RJOA 3ZD7A 4DWJA 3MOIA 3WHPA 3HN6A 4J43A 4C1NA 2EYUA 4QYSA 5AI8A 1Q95A 3IESA 1PG0A 3G2HA 1KP3A 3CVVA 2KW5A 4OX9Y 4AO8A 1TUEA 1J2RA 5GV8A 3PPYA 2Q2QA 2Z4TA 3FNEA 3MJRA 4DPKA 1A9TA 5HIIA 1BVUA 4ZI7F 3EX7C 4FGLA 4N0DA 2WUEA 1E1MA 3N76A 4RTQA 5AOBA 3BCUA 1YBHA 4JXKA 2I8LA 1Q21A 1DE0A 2ZQ5A 1KFCB 2AVNA 1O95D 4C3ZA 1AKQA 3HBJA 5LYJF 1J7JA 1ULAA 3WG9A 4R40A 1Y8CA 4N03A 4YYZA 3PGKA 4MAFA 5JMPA 4J2TA 4V0KA 5HX7A 4WOBA 2QTVB 3PIIA 4TMKA 3IUNA 4I2VA 4GT1A 1YJBA 3OLVA 4GIBA 3NDBB 5DBIA 2PMBA 2YZNA 2BKHB 4ZHSA 1R0KA 1GZ4A 1RJFA 4UEWA 4WBNA 5AVWA 1W7AA 1S96A 3C4VA 4RXMA 3AKZA 1CLUA 4R8KA 1K5PA 3ZDRA 3M34A 1JG3A 1XA0A 4L95C 1NF8A 1VJGA 1BEZA 3ZU3A 2D00A 4C7OB 4MPJA 5CDTA 2I4LA 3ZJUA 2P40A 5A4KA 4P58A 1W93A 1VBNA 1JLKA 3CF2A 2JPDA 4U0KA 4JSRA 1O95A 5KNBH 4JI6B 1WNFA 1GSAA 1JDVA 3H5VA 2C3PA 3TE7A 2XBLA 3TLZA 3LCMA 5AW3A 2JLRA 2J48A 2H1IA 2IZ1A 3AHIA 5CDHA 1ZOSA 3AMVA 2FJUB 5A9SA 2EKLA 3OZAA 1JPVA 5LYYA 4KOEC 1CUDA 3DBHA 1GA4A 4K9NA 3KWFA 1C3OB 2FEXA 1D7OA 1X39A 1N2CA 1LDGA 2RAVA 3GJRA 2E1PA 1L7ZA 3AHHA 1BGXT 2Z6VA 3I6ZA 3TRHA 4HSGA 1ZH2A 1YA4A 2IY9A 1UPCA 3FNHA 1F2VA 4WACA 1STOA 4BNKA 4PC7A 1H2WA 1N5DA 3UN1A 3BWBA 4LTDA 2GNAA 3BTUA 4ZI2A 5HTKA 4C2TA 1SZJG 1I2DA 4PYNA 3DC7A 1D2MA 4IF4A 4S04A 3AQIA 2I6TA 5C7OO 5HFAA 2ZT6A 4Y6RA 5LN1A 1KTVA 3KTFA 4NZOA 4CG3A 1X7HA 2QJWA 4ZOLA 3KL2A 2KNEA 4AMZA 2RCYA 1KCYA 3EEBA 4GOMD 2EFJA 4NBRA 4TWAA 3FPGA 5J1TB 3P96A 1XQ9A 4YALA 1M6VB 1ETUA 2IZOA 3L8ZA 1RYMA 3PFBA 2Y1MA 3N2GA 5DP1A 1DDGA 2O8DA 1UK9A 3MJDA 3I5HB 1EWVA 1IWQA 4NKRA 1G8PA 3PITA 3GHHA 4DRWA 4MA5A 2OPHA 2RK6A 1H5UA 3RVJA 1P7VA 2WSLA 2PALA 2A5DA 3AW8A 4UEQA 5A9TA 1QZXA 2GEBA 2EXXA 3D0QA 3E53A 2DG2A 3U1VA 3VNAA 2DHQA 3KSUA 4L4UA 1EUYA 1IJFA 3MWDA 1KQOA 1QKIA 1SQFA 2EP8A 2QX6A 5F5XA 2QUZA 1MQ8B 2ZJYA 2A9QA 1V71A 3OAAD 3OQ6A 4E3ZA 1UXHA 4ETMA 2YTZA 3ASVA 1ZJ6A 4A1OA 4X20B 2PUVA 3Q5GA 1IQRA 2X9GA 4QL3A 2OBMA 3OCWA 4QBKA 1BQ3A 3V5NA 4P31A 3G02A 4Y9UA 1CC1S 4FHGA 1B76A 3DY9A 1N2HA 3BK7A 3NIDB 2CL5A 5H82A 3VROA 3WSWA 2E4ZA 2G6BA 4NAHA 4CT0A 3W2FA 3ELDA 2J08A 1IRIA 3TX2A 1NM5A 1YJ8A 2R87A 4NFYA 2QG4A 3IH5A 2PU7A 4D4GA 2AFHA 3RJ5A 4FE4A 4YRDA 3R1PA 4OEHA 5THXA 4MPTA 1UKCA 4AJJA 2BFEA 3U7IA 5BMVF 4ZCSA 1XLWA 2GXUA 3TLAA 3JARA 2EBUA 4DAOA 1YRYE 5LL6P 2X4DA 1C8KA 2VUIB 4HS4A 1UBNA 3LQFA 3VVBA 5JS2A 3KWJA 4UNNA 4K3UA 2BONA 2O0HA 2X1LA 5C8ZA 1TVEA 3DM9B 4OCZA 1Q14A 1D1TA 3ISTA 4R98A 3U40A 1TN4A 3DT8A 1VYUA 1JFTA 4W8HA 4PPQA 4WBNB 3CLRD 3LLVA 2W22A 4YREA 4DDWA 1QQBA 2LCQA 3LZ6A 5AK0A 1P5HA 2QQGA 4LWZA 4WY5A 3HS3A 3O3MB 1AKRA 3EOZA 1Y5NA 4JB3A 4U7PB 1OWLA 1VTKA 3KEOA 1NBOA 4XD7D 1SW8A 3A1NA 5HKBA 2J09A 1KL7A 1K7CA 2YMPA 4HAUA 2ID4A 4ICBA 3C8DA 3PKZA 4MRMB 2B78A 4CMIA 1TO6A 1NW6A 1AJ5A 1ZGCA 4X85A 2GF2A 2WJ4A 4LOHA 5BYKA 3SIAA 5AW2A 2OK7A 5EG5A 4AJLA 4TL6A 1UZUA 4E5UA 3DBHB 3AEKB 4YLEA 1EZZA 2G71A 2PX3A 1TJ4A 3PQ6A 4GOND 4I4IA 1JB1A 5B4UA 1N2CB 1Y1QA 3H0EA 5C81A 3PR2B 4R0MA 2IZZA 1XPRA 1DDIA 4MWTA 1J7QA 2X6RA 5CM8B 4YNBA 5IAJA 2L17A 1DGUA 4U02A 3QOXA 1SC3A 1FYWA 4IEFB 1MFZA 1N77A 5LBIA 2X7JA 4JC0A 3TR5A 1WDKA 1L3IA 3QUAA 5EUCA 5DGDA 4R5HA 1MJHA 2BGRA 4P0PB 6GPBA 2C4KA 2ZBVA 3B8EA 1P2SA 3GFTA 5EVJA 4RHTA 4YCBA 2X42A 1Q2XA 3HKCA 4ER6A 3LSYA 2HF8A 4J1NA 2C5SA 3ZS8A 1V39A 3F4LA 5HKYA 1N5RA 2EWVA 4A1FA 2ZJBA 4X65B 3TS5C 4O4HB 4ZGGA 4ND7A 2DTXA 3DTYA 3BUXB 4G56A 4LRXA 1BOOA 2BWJA 3USZA 5JZ9A 3CR4X 1RKQA 1A27A 4KYUA 2ORVA 2O8DB 4MLZA 4D0RA 3E9YA 3DTNA 4YMGA 1ZXXA 1W5FA 2HK7A 3PUJA 3ND9A 5ALXA 1JQJC 4CBVA 4TN1A 1FLVA 4H7DA 4HR7A 1OCEA 3U4HA 1E6WA 2C5BA 1ZFSA 2SNIE 4QOGA 3ZBUA 2FUG6 1QIJA 3IAAA 2HC9A 1N7HA 5B8IB 3ZQ6A 3GFOA 1CQJB 4WVFA 1IPHA 4PU0A 1G20A 3RIMA 3MWDB 3EPKA 4BMYA 3YASA 3RM1A 4MV0A 5J2UF 1PT9A 1VRCA 3QXJA 2PVCA 1PR1A 2V7GA 5JD6A 5HJEA 3V8RA 2BSAA 4WKCA 2XUZA 1L5VA 3K0CA 2J9YB 3Q3GE 3K9CA 1ISRA 2BGWA 4OHBA 4ZK6A 4XQ9A 4QYMA 1K0UA 4X9XA 4ZV4A 2WCMA 4V0QA 5LPNA 1OXMA 4H3HB 4RDIA 1LPNA 5AKKA 2X3FA 2PV0A 4UBNA 4N18A 1MH9A 2YYYA 2ATIA 1NXWA 3QPAA 3JWJA 2NN3C 4YS6A 5AHOA 2YIMA 3PDCA 2ZYAA 3CG4A 4KBFA 4ZEXA 5DWQA 1I5EA 5K8VA 1A9SA 5BOVA 2R4QA 4OMUA 4NJOA 2J5RA 3MIZA 4MUBA 4CMJA 2AFHB 3RIXA 5AERA 3LA8A 3WDMA 3AUUA 1G42A 2BFEB 1YRQA 1AXGA 4DDUA 5TRTA 3LX8A 1S3IA 1KC3A 4LZAA 3JARB 2I4MA 4L9AA 4LHXA 2WRZA 1GVHA 4I4TF 4IUDS 3UK7A 4Y1GA 1QHIA 2RJ3A 3KX2A 4MV5A 5PALA 5CNJA 4Y7CA 4MQ6A 5GY7A 2ONKA 4UHEA 4HF7A 2H00A 3SIBA 4RCYA 1TIPA 2DLCX 5JHGB 1MVLA 1P3DA 4NICA 2EHJA 4WLUA 4XSGA 5ECYA 4AP9A 4FR2A 2WKSA 2YIJA 4WFJA 3EVCA 1MF8B 3LDGA 3DF9A 4KP7A 3D0YA 4AY5A 3Q2IA 3BL8A 4WQ3A 1M74A 1MCZA 3K9NA 1BMOA 5HKKA 1EWTA 4B43A 3NQ41 2IPNA 3Q7PA 4I08A 2N3ZA 2BVNA 3ESYA 1CB0A 2C99A 3QP9A 1LVGA 2NTNA 2D3TA 5JCJD 1SUEA 1N2EA 2GLXA 3BICA 4CMIB 4JI5B 4WLOA 3G2NA 5FLXA 3N3BC 1JG4A 1X7YA 1QF7A 5ADUS 2A78A 3I5YA 1X19A 2VH1A 1PW5A 4DUYB 3HE3A 3E3RA 1N6PA 2PT9A 3PLAE 1YVEI 2WA1A 3CKLA 4BLUA 3VX4A 2P78A 4H77A 5B7QA 3TMAA 3ADBA 3GRPA 1Y3BE 2JGFA 5CAEA 1IE3A 1Q84A 4Q37A 3EASA 4PE7A 3JYQA 5FBZA 1R16A 2NV6A 2ISDA 2YIVX 2XQKA 1Y89A 1DV1A 1SOWA 4ZVPA 1PZXA 1C4XA 2PUJA 3O8DA 4C0HA 2HEIA 2QW8A 2PKYX 3VHRA 4PHNA 1L7AA 3E7DA 2V97A 1ZA1A 2JEZA 5IDVA 4JYPA 4DZTA 1U31A 3HK2A 4HB2A 3WTCA 1YB1A 3GZNA 3DBLA 4G5RA 3AHCA 5CFQA 1RQGA 2FKAA 2MSWA 3QVOA 4BAZA 2FFJA 3O2SB 4M76B 1NYTA 1T4BA 4OXNA 5B4TA 3A4UB 2IV7A 2GJ9A 5JAQA 3KKMA 3Q5EA 1E3JA 5JNUA 2ZWVA 2PBFA 1MTZA 2K5UA 3VOBA 4EVIA 1W73A 1EG3A 3AZPA 3OU7A 5BSUA 3IHWA 2L19A 2ID9A 4JC5A 5FTNA 1RHQA 3DDUA 3HJUA 1BX1A 2WV7A 3I42A 1IG3A 1SXQA 3OMXA 4XLLA 5K09A 3A1EA 2RGNC 1W581 3BUWB 4Q9IA 5TX7A 2E87A 3R8XA 2CLIB 5DRYA 4M2QA 2IGBA 5JO0A 3BJMA 4NCHA 3OD5A 3ZEAA 1I0ZA 1TLLA 2PBZA 1V5FA 2JPTA 1XYVA 2AT1A 2NZ0A 1O96A 3EQ7A 4MS4B 3MRXA 3OPQA 3TUZC 1C7RA 4L3WA 4CTNA 3I62A 3WXBA 1U2PA 4N6GA 1UUFA 1X0XA 1KQMB 1RWQA 4YGDB 4XGKA 4FSHA 2P6BB 5A6SB 4XLTA 1OC4A 4YFYA 1WCIA 2OCGA 4N5NA 1FOEB 3C7AA 1KNQA 4NXMB 5ABPA 4PALA 4ZEOA 1RI2A 1WZNA 2WZQA 3WWYA 2D7DA 4XWYA 1TWOA 1NI4A 2IYLD 4PRYA 3V6LA 3WIUA 3MINA 2HQ8A 4GGOA 3M4XA 1XJCA 3RCBA 4XYLA 4G4SO 4J16C 4P1ZA 3L4JA 3NOVA 4C3VA 3OICA 5FB3A 2C82A 4FFVA 5TQ0A 4BNVA 3RKUA 3NXSA 4WXYB 4S35A 2QR2A 1Z5PA 4QXMA 4QJBA 4E2XA 5ICEA 4G81A 1AGPA 1KBZA 1QV9A 1X2EA 1ECLA 3RZSA 4DR3B 4L9SA 1IPFA 1ZINA 4AJHA 2J67A 4V0ME 3B3FA 1NNLA 1PGPA 2WG0A 3EIEA 4UBLA 4OX9B 4FKBA 6REQB 3NYQA 5HYDA 3C74A 3GJXC 3ZK9A 5FTJA 3GROA 4BLTA 3DZHA 4GPIB 4DQXA 1Z39A 2ACKA 1KTIA 5E7IA 1U2GC 4XVRA 1S7GA 4OD0A 1N8TA 3IR5A 1G5QA 3V8VA 3BKWA 4QAQA 2Q5EA 3AYZB 5BN3A 3S0FA 3P9SA 2QT0A 2WR8A 2WV9A 1V16B 3HB1A 1IEXA 4UHFA 1HG1A 3G0OA 1QV7A 1SL7A 2G8LA 2BEWA 4HQKA 5KTMA 1AJEA 4M8KA 2XADA 2A86A 4XARA 1LZLA 1G8KA 1QNFA 1YH3A 2Y1CA 4AX4A 1MA3A 3QG5A 4NOLA 4QNNA 4MW5A 3MAJA 3AIOA 4AWBA 3HV2A 3D0YB 3U3XA 2M7LA 1GO2A 2DTEA 2YHAA 1L7RA 1KK3A 1UADA 3IJ5A 1I4TD 1ODCA 5TQVA 3TLYA 2J31A 3IBSA 2QMEA 4BFLA 4CU2A 2WJJA 1ND5A 1PDWA 4W1PA 2QRZA 3QQ5A 4F0ZB 4EPWA 4QPNA 3V8QA 1QRTA 3PDIA 4BN4A 3KZMA 3PXGA 1H6DA 4G36A 3CG0A 4KIJA 2GXAA 2AXEA 1SCMB 4YROA 5DE3A 2ZKIA 2TMKA 3HYSA 1QMGA 2FPPB 1KPGA 1Q7RA 3I6IA 5HF6A 2VZ8A 4QLOA 2DOQA 1ZKMA 2VXCA 3NV9A 1ZQ1A 2Q5JA 3UMSA 3KHUA 3T5MA 2HJHA 3ROXA 3FB4A 4G1CA 1YQTA 1TIKA 3VC3A 2VP5A 4Q18A 1NJ5A 1P9RA 4MIYA 3W34A 2P8SA 1DT7B 1EVIA 121PA 4R51A 5KNDA 5FLKA 1G5RA 2H18A 2HLDD 4GM1A 4X7RA 2Y1OA 3BA1A 4F2HA 3DC2A 3N2IA 3LRXA 1AXRA 5E3JA 1KYQA 3GZNB 3DBLB 2FOXA 2HCBA 4JLOA 3FKSD 5HKLA 5KSOA 1M83A 3AAKA 4JUAA 4PAOA 1Y37A 1A72A 4QOEA 1RQXA 3TI7A 3UK1A 1K8RA 1NYLA 1A3CA 1SQGA 1U6KA 1C7EA 4M1YA 5IH7A 1QDLB 5C5DA 3ZE6A 3GEDA 5KB3A 3M1AA 2OE2A 4CF3A 5JJGA 1RXYA 4NPHA 5LP6C 2EQAA 4NYJR 1DB3A 3DZBA 4LSGA 4L27A 1QUFA 3N28A 3IJPA 4UM9D 3E61A 1DG3A 3WZ2A 3WQBA 1WV1A 3AZOA 5BR8B 1C1XA 1D8TA 3F9RA 2ECQA 1YOBA 2EFDB 1VKZA 2C2GA 3OPYA 3GRKA 3BS4A 4BGVA 2QQFA 2Z6QA 1U0JA 2M2IA 1A8UA 1Y1UA 1QX7A 3TCXB 1OWNA 1Y1LA 5ENZA 2WYIA 2DPGA 5BSWA 4IGFA 2MYUA 1P1HA 1M6HA 1JVBA 3LI2A 4M1OA 2PSRA 3LBHA 3BIWA 5CB4A 5AJXA 2CV0A 1Z7EA 2C8JA 3KD2A 2H5LA 3N5KA 2R7KA 4H27A 3T3GA 3WLLA 4JYCA 1PO7A 1WCIB 5AKIA 1YBVA 5KPDA 1SD5A 2OZKA 1YR5A 3RLZA 3K70D