4C0JA

Crystal structure of drosophila miro ef hand and cgtpase domains in the apo state (apo-miros)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
404
structure length
404
Chain Sequence
ELTSACKKSLVRIFKICDIDGDNLLNDYELNLFQRRCFNTPLQPQILDEVKAVIQKNVPDGIYNDAVTLKGFLFLHCLFIQRGRNETTWAVLRRFGYNDQLEMCQEYLRPPLKIPPGSSTELSHRGQQFLIAVFERYDRDGDGALSPEEHKMLFSTCPAAPWSYSTDIRKSCPINETTGWVTLHGWLCRWTLMTLIDVVKTMEYLAYLGFNVHENDSQLAAIHVTRERRIDLAKRQSSRSVYKCHVIGPKGSGKTGMCRGFLVEDMHKLIGKEFKTNVVNCINSVQVYGQEKHLILRDIDVRHALDPLQPQEVNCDVACLVYDSSNPRSFEYVARIYIKYYAESKIPVMIVGTKCDMDERRQDYLMQPSEFCDKYKLLPPHLFSLKTNKKELYTKLATMAAFPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords MITOCHONDRIAL RHO GTPASE
publication title Structural Coupling of the EF Hand and C-Terminal Gtpase Domains in the Mitochondrial Protein Miro.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 116
structure length 404
sequence length 404
ec nomenclature ec 3.6.5.-:
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
A PF08355 EF_assoc_1 EF hand associated
A PF08356 EF_assoc_2 EF hand associated
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0jA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0jA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4c0jA03
3WMEA 1A1VA 1WLMA 5FUXA 1ZUZA 1F54A 1XEXA 1JXMA 3W5IA 1G3IA 1NP6A 2YWFA 4NP6A 3CPJB 3OIWA 2CE2X 4FMCF 2H5EA 2LKDA 1P61B 1F2UA 3FIAA 3RLFA 5B58C 3AVWA 1TNXA 2OBMA 2YYZA 4QHYA 3KUDA 1XFZO 1DADA 1IAQA 3CBQA 4PPGA 1OIVA 2CTNA 4P5OE 1D1OA 2VQSA 2W6ID 3BH7A 1W7AA 1Z0KA 2LLTA 1DF0B 2JT0A 4HYYA 2BMFA 2ECKA 3U6BA 2ANCA 2DPXA 1GG2A 4FMBB 4NYIQ 1LY1A 2D8NA 4NZYA 1E2HA 3ZGXA 4BEJA 2RMKA 3TUZC 2ZRKA 1FI6A 5H68A 2D7DA 3SE0A 4GMDA 2KHNA 1NVVQ 2N1BA 4GSYA 4MSPA 3C1VA 5J4VA 4IDOA 1J90A 1R0ZA 3KEVA 3NDPA 3C15C 2EFGA 1QVRA 3PM8A 5CB6A 1K9PA 4L9MA 1BODA 1HT9A 1CR1A 3GLGE 3BFKA 3CX6A 1YZUA 1SCMC 3E70C 1DELA 3KXIA 4JYBA 2ZI4A 3NIBA 2WBLC 3EZ2A 4N0EA 2IX3A 1R5NA 2P67A 2AWNA 1ZIPA 1UBEA 5TARA 5KSYA 5F3WB 1XYDA 3X1ZA 5JS7A 2GVDC 4BFXA 4WZAE 4DDVA 1NJGA 4AKGA 2NO6A 1CJTC 3TDIA 1G5PA 2QMOA 1HT1E 4OI0A 1YRUB 1JEDA 2HYDA 3BIFA 2G9BA 1IY0A 1ZNWA 5KUTA 1KMQA 2FNAA 2WJJA 4A8JA 4FWTA 2AD5A 2V4ZA 4BFSA 4OQXA 5C4GB 2WV9A 4PZYA 1GOTA 3CGAA 2XEXA 1Z2CA 3NH6A 4R7ZA 3PXGA 5GADl 1ZAKA 2XXAB 1LVCD 1S1EA 1AIPA 1DAGA 1IXRC 1A4PA 3CS1A 2SHKA 1G17A 3KDSE 2B8WA 3GFPA 4MLWA 2BBMA 2OCYC 4IDNA 4R71A 1E4YA 3FMFA 5HE9A 1YUUA 1TU4A 5EE9A 1WMSA 2JC2A 2VA8A 3FDIA 4XVRA 3VFDA 4OBEA 4PO1A 1ZNZA 2Y8EA 2Q0HA 2B21A 1KDOA 3BE4A 1RECA 1DTLA 4ZO4A 2PALA 5C18A 2YWEA 4P32A 4G0NA 4BE7B 2O8FB 1PULA 3L0OA 3U44A 3T1OA 3GLIB 2B92A 2WJVA 3MWJA 5JJLA 1L4UA 5AEQA 5L8VA 4KLZA 1JPJA 4XYNA 1XPUA 4PHGA 2XX3A 2OS8C 3LO5A 2OUKA 4HAUA 4WXPA 3EVRA 4MQBA 4BFVA 3BORA 3GLFB 3AGPA 4OHXA 4P33A 2P6RA 2F33A 3GK1A 1DF0A 1SBJA 1LS6A 2X1VA 5KSOA 1Y1UA 1N0YA 2BE4A 1Z8FA 2QEQA 4GGFC 1BOFA 1K9KA 4E68A 2F1JA 3QIAA 1DJIA 4NKRA 4Q9IA 3VR4A 2QPAA 1ZM3A 3A36A 4QJ5A 1QHXA 2ZUBA 2C04A 1FPWA 1QATA 1QRAA 1XEFA 5GVRA 2NO0A 4DLUA 2QP4A 4RY2A 2L2EA 1F4OA 5JWRA 3B60A 5SZKB 1FQJA 2FSGA 5DH9A 2GEDA 4V0LA 5JHHB 5CK4A 4AYWA 4Q9LA 1KSMA 5BPJA 1C7VA 2JNFA 3CR2A 1GRNA 3DF0B 1SXJD 1UKZA 1J7PA 4PDZA 2CNWA 1QS7A 3Q3JB 2ZRTA 1KSOA 1BT6A 4DLXA 5K8IA 4A4BA 4Q66C 4BZPA 4RCZA 4LYHA 4JLJA 3REFA 3CX7A 4U5XA 1H8ED 4C0HA 1KI3A 4QBFA 3BUMB 1KMHA 2ODNA 4KITB 4BLSA 4DSNA 3TSZA 3SJAA 2ONJA 5KNCA 4JZKA 1BYUA 5KOYA 2KJQA 5FOWA 3DVLA 2IYSA 3U6KA 2F3ZA 4CLNA 1XU4A 2QENA 4JLVA 1FP7A 3U7FB 4PC6A 4WQ2A 1VG0B 1KI7A 1IJEA 2V9PA 1CU1A 3SOPA 3TAHA 2CCKA 4BLOA 4B71A 4DSTA 3MWLA 3OEED 1JR3A 2IYTA 4M2OA 1E99A 4LDJA 2WWGA 3PFIA 3NWJA 1YU9A 2WJGA 4PHTA 4LHYA 3TJZA 5CIQA 3AKEA 5D7FA 1FF1A 5CSJA 2BOVA 1DJZA 1MH1A 1KSGA 2G1KA 3K0SA 4QBHA 1LFDB 1GAJA 1NIWA 5EQTA 1TRFA 3CIOA 2KGRA 2HQ8A 3TQFA 1ZCAA 3TSOA 1A5TA 2KWIA 2ZREA 3RDPA 4Q1AA 2JRFA 3W6PA 1ALVA 2ZYTX 5D3MB 2KB0A 5FTMA 2O8FA 1RJ9B 1R10A 2CEAA 4W5JA 3TBKA 5J4KA 1YR9A 3GLIA 2FFAA 1HQVA 4LYJA 4MRSA 1M39A 4N0DA 4QFMA 1PLJA 2ZFDA 5F9HA 4TL9A 2PEZA 4HEJA 3JZMA 1NX1A 5B2ZA 2LANA 1I4LD 4MEWA 4X8MA 3BC1A 3REGA 3GLFA 1YVHA 1IJ6A 1QBKC 2H57A 4JLAA 1SL7A 3BBPA 1R0XA 4ORBB 4DLWA 2TMKA 3AVTA 2ZRHA 2EQBA 1C7WA 4DCVA 2WIAA 3TK1A 1NI3A 3B78A 3L2OB 3D7MA 5FFMA 4OR9B 1A2BA 1SHKA 2K5UA 2NGRA 4PE0A 3D31A 4KODA 3GFTA 2W6IA 2YKGA 5BWMA 2JJ1D 3PLFB 3OB2B 3GJ3A 3TUYC 4KLNA 3ASYA 1KZ7B 2EFDB 3RS0A 1HEIA 3A4UB 3GCGA 1UADA 4XWKA 2XZOA 4HB4A 3LVQE 821PA 2HJGA 2IYLD 2MA2A 1QHIA 5HCIA 1G6HA 1TOPA 2Q9CA 4LV6A 4QGHA 5DI3A 2FPMA 2NOAA 3MJRA 1X8JA 1XB2A 4LC1A 2ZE6A 2I4IA 4LHZA 2GEVA 4MDFA 1JUOA 2YJTD 4YGAA 1NY5A 1E3MA 1MHOA 1DGVA 3AKAA 2Y4QA 3RC8A 4ZDKA 4AQJA 1MF8B 3CR5X 1E1RA 4I81A 1W4AA 2HV8A 1OZSA 1C07A 1AQUA 1VYUA 2AFIE 1KSFX 3Q5DA 3M0WA 3LLUA 3I72A 4A6PA 1SHZA 2KYFA 1F48A 2G0NA 3E1SA 3X1DA 3LFUA 1E0KA 2JA1A 2DBYA 1YR6A 4EDHA 3F45A 4D80A 4O2LA 2OAP1 1YZTA 2VP9A 3EWAA 4OK5A 3RHFA 4KJZA 2DY1A 1NG9A 3W6OA 3R9WA 2ZR9A 5PALA 3EPLA 2NPFA 2OFOA 3GOFA 1N0UA 1NVWQ 3MG9A 2HF5A 2JTTA 2GEUA 2GXUA 4B44A 4TLBA 2KFFA 2ZE8A 5LB4A 4M53A 3PENA 3EZ7A 2G88A 5K8UA 1TQ4A 4B6EA 1TX4B 4PPQA 4BZXA 1TL7C 3ICBA 3CR7A 1U2RA 1QZXA 2G0TA 4POAA 3CKLA 2ZYUX 2W0MA 4JLBA 3TNFA 4DWJA 2KFHA 1W7IB 2MRDA 4NTZA 2ZI3A 2ZVPX 1JI0A 1U90A 2FOLA 3RSOA 4IFBA 4EAQA 5D3MA 4DBLC 4WAUA 1KK8C 3CUEF 4U7DA 1ONBA 2Q4UA 1FOEB 2GNOA 4A92A 4N1FA 2J0QA 1CTRA 3UMSA 1CP2A 4QC2A 3I4LA 4IOLA 4ERNA 5JI2E 2JIZD 3H84A 4MGZR 3PN7B 1CJVC 1D2EA 4OJKA 4P3YA 4D4MA 3FS7A 1TU3A 3X1WA 2LMUA 1XA5A 1QVAA 1A2XA 3LW8A 1GNPA 1E8AA 3LX5A 2J46A 1CJKC 1G8HA 2L5XB 2YHSA 3C16C 4JVNA 4W5WA 5JMTA 3ADCA 4N1GA 4XJKB 1II8B 1ZD9A 2KBFA 2WORA 3I73A 3I8SA 4A82A 4IKEA 1YJ5A 3VKGA 1GRRA 2A7QA 2MJWB 1MOZA 1UF9A 2IYQA 1U8YA 2QI9C 2YVUA 4RZXA 2ORVA 2IF2A 5J40A 3TE6A 2JLVA 1NLZA 1YX8A 1WRKA 4TTRA 4EQ6A 1U5IA 4FD2A 2B7BA 1RTP1 1XDBA 3K0FB 2O8EB 1G20E 1UBGA 3WXMA 3EX7C 5C1BA 3MSEB 1IG5A 4HB2A 5AUPB 2ZVQX 2KI4B 1OXXK 3EK8A 1ZYUA 2EFEB 1IN4A 4M1OA 1Y6WA 2IYYA 4YXWA 2O8CB 3DPUA 2QP9X 5LB2A 3TMKA 4MZJA 1QF9A 2F2OA 5FYXA 2VHTA 3WMFA 1L2OB 1YZQA 4NPHA 4TSFD 4GOXA 4MRNA 3A4LA 1Z28A 3ZDQA 3GQBA 4B3XA 2PEYA 1D9XA 2XZPA 3N2IA 1QDEA 1FW4A 2IS1A 3K0CC 2IWHA 2F55A 3DD4A 2I2RE 3KXLA 2KBIA 4IJMA 2C8VA 2FN4A 3Q5EA 2CLSA 4Q48A 2FZLA 4CW7A 3RRYA 2PZGA 1XCGB 2CCMA 5HCNA 4RCYA 2HXSA 4TT3A 5GJCA 1ZOTB 2LLUA 4FN5A 4Q04A 2RGAA 3G82C 1JNYA 2G83A 2ZXUA 3AEZA 2YV5A 3AVVA 1KDPA 2WWWA 3P4YA 2J7PD 1N5JA 2BVNA 1W36B 1NN5A 2NZJA 3TQCA 1BH2A 3IIKA 3MWYW 1MUXA 2ZEJA 1VHTA 2QORA 4WA7A 5JSZA 4IVPA 4IOJA 3AB3A 1J8YF 3NDBB 1ZACA 1U9IA 5K89A 3PITA 4PAQA 2JLUA 2NCOA 4LZZA 3U3JA 2D2FA 2Z83A 4C2TA 1KNQA 2DYKA 4RFSA 3OFNA 1CR4A 3L8ZA 4NYJR 1UM8A 2HJVA 3W6NA 1UP5A 2GV5A 4LJ9A 1OQPA 5HZHA 4TLCA 1CRQA 2YC4C 1DVRA 1Z6YA 1J7RA 4HZIA 3A1WA 3LWNA 4ZI2A 2O8DB 4NQGA 2GCOB 2P6UA 1E2LA 2W2VA 2HETA 3IEVA 1VYVA 5DKNA 4K81B 1S0UA 4IL1A 2GZAA 1NSFA 4QGFA 2N42A 1II8A 4XJKA 1Z6TA 2OPOA 3VR6A 3X1XA 2VHCA 4IOMA 1E32A 1UKVY 2AWOA 3UATA 3NXSA 2UZIR 4LJ5A 3QPUA 1XMSA 3W3ZB 3W8NA 4LYAA 1J1DA 1D2NA 2FA9A 1X02A 1OFTA 4GPTA 3GJ4A 4B3CA 5IDVA 3QG1A 4ZKDA 3CLNA 4P2YB 2PASA 3D0YB 1CFDA 2ZIAA 3AF2A 1AA9A 2V7QD 1B23P 2OLJA 1XJQA 1MO5A 2LVJA 2CK3A 2JAQA 5G08A 3PUWA 1E79D 1KHTA 3MCAA 2R6GA 1E2JA 5CYPA 3I5HC 1F60A 5HKZA 1NX0A 5HLOA 3BFXA 4MGKR 1OH5A 3G0HA 3BK7A 3ZD6A 2DOQA 4NYMQ 1OFHA 2OFWA 3DZ8A 4CPVA 4PHMA 3TS5C 3OEHD 1CLLA 4F7WA 2F2PA 2ERXA 4BY5A 1CMGA 1JSAA 3UWKA 4A0FA 3K9LA 5L3QB 1ODBA 2NQ2C 1KI8A 1MR3F 2HLDA 2VHJA 2DWOA 2IYWA 3X2SA 4DVGA 2J41A 4V0ME 3BH0A 1A29A 2LV7A 2D06A 4JYCA 2OCBA 4DRWA 2CXXA 4LCBA 1BMOA 2F9LA 1Z5ZA 2Z5FA 2B6HA 3V9PA 1G7SA 2ZNDA 1UDXA 2GRJA 5G3ZA 1DJHA 2W2TA 5IRCD 4CEJB 1MT0A 3GEEA 1G4UR 4Q4JB 5HKKA 4DEYA 4F93B 2CT9A 4QNRA 2EC6B 2G1JA 4AKHA 2Q3FA 1S8FA 3ZVRA 1JBAA 4CFRA 1FL9A 1LNZA 1P72A 1JAHA 4HSZA 1Q0UA 3QKSB 4Q7LA 3TR5A 3BD9A 1L4YA 2ISDA 1KO8A 5F9FA 2O5GA 2KFGA 1JBKA 4YMUA 3OF5A 4IOKA 3QQ5A 3VGOA 5GJBA 2A5YB 2FGKA 1HH4A 4Q19A 1S3GA 2LVVA 5LD2C 2O8DA 2D4HA 5EP2A 1HQYE 2LMTA 3EZFA 2NTYC 4F0ZB 1FX0A 3EVVA 4BFWA 1EG7A 4JBWA 1GDDA 2WMNB 2JQ6A 1ZINA 3VRQA 1BYIA 3TRFA 2C78A 1BS1A 1M45A 1ANKA 3NHAA 1G41A 3B82A 2QPTA 3U7GA 1B7TZ 2NZ0A 4Z1MD 2CHVA 2BM0A 4NYJQ 2OM2A 2WMOB 1KKMA 1DPFA 2CCGA 5CDFE 4CT4B 4IXMA 3TSWA 2MHHA 2IYUA 3PUZA 1LINA 1AHRA 2L50A 2D7CA 3OAAD 3Q72A 4GAOA 3ZWHA 2OZEA 3QPWA 3KTAB 3K21A 2A5GA 4ILEA 3WHUB 1SCVA 1J1EA 3DVKA 1J7QA 3CRRA 4QGGA 4Q02A 1WDCB 2QTHA 4Z8YA 3WRYC 4I99A 2IEYA 1N0VC 4JIMA 3D0YA 4Q1EA 3WP1B 1B7TY 4HAYA 4B2PA 4TYYA 2WOJA 2R6AA 3HCMA 1XXHB 2JLZA 1XPOA 4BECA 1T5LA 1Q22A 4Q4AB 1T6NA 2J59A 1TTXA 2C77A 1IH0A 3THOA 2CLCX 3I61A 1NX2A 2SASA 3DO6A 3PG5A 1VCNA 4TLAA 3CWZA 5FOSA 1B0UA 2V1XA 2W6JD 1IKUA 2ATXA 4ZCLA 3PEUA 1KQVA 1KJYA 3B1ZA 4TSFA 2V6JA 3AF0A 1JEEA 4KYIB 4DCTA 4ZCMA 1SW8A 1Z6AA 3ZIAD 1K5GA 3BOWB 5CITA 4BEBA 3ZVNA 4LJYA 3WNDA 1YURA 1T0HB 2AMIA 4WXRA 4JT4A 1R6BX 5F98A 2IXGA 4M9QA 3AP1A 3CW2A 4DJTA 1KK3A 3C41J 3CRQA 3M1IA 3T5DA 4WOPA 4O25A 3O8CA 4CEJA 1ZM9A 1JPNA 2FFQA 2P6BB 4CVNA 4Q4JA 5P21A 2PX3A 3RABA 3KQLA 1F2UB 4URXR 4OVNF 5AUNB 1HV8A 3U60B 2PJZA 1OXUA 3QKUA 3VU9B 2JPTA 1BKDR 2RB4A 3LD9A 4BFUA 2PRUA 2BE6A 1KKLA 1NPQA 3PUYA 2IA5A 4N5XA 4QL3A 5CM9C 1J7KA 3JVUA 1X1RA 3LRPA 5EXTA 2OE2A 5EXSA 4XH9B 4EPVA 4Q1FA 1VIYA 1Y63A 3P26A 3O8BA 4NCIA 1R5BA 1WY9A 3GJ0A 1E2KA 3QRXA 1J55A 1DVIA 3IPYA 1QLKA 1FNNA 1M34E 4OV2A 3IBYA 1YZGA 4G5QA 3P32A 4Z54A 3AKDA 1JF0A 2IL1A 1JQJC 2YNMA 5FR1A 4OK6A 3U4QA 5JJKA 1E2EA 3B2EA 2JASA 3T1QA 5FUVA 1US8A 2V55B 2LWIA 3BB3A 4G3XA 4Y0AA 1OJLA 4ARZB 4RD4A 1K8UA 4CYMA 2CNPA 1UAAA 2AD1A 2EWWA 1JFJA 1DOAA 4JPZB 2Z43A 5K8LA 2KQYA 3FKSD 1JECA 2PX0A 1PVBA 4A9AA 3KKQA 5BYJA 1DJWA 2CL0X 2QY9A 5G41A 2AHOA 3KTAA 1GVNB 3NBXX 1NWDA 4DDUA 1KFXL 2L0PA 1VIAA 4A2QA 2PJRA 3C5CA 4IDPA 3GJ6A 1TCFA 3TVDA 2QQEA 4FW9A 4QBGB 3KJEA 2PT7A 2MSDB 3QF4A 1M46A 3KQKA 3BUOB 1QG2A 3CB4A 2EHBA 3ICQB 1M2OB 1W4CA 2ZJZA 3HYRA 3R9XA 2O8BA 3OP0A 1RRFA 4LJ6A 4YQFA 3CONA 3QF7A 4MKGA 3GLGA 4JT2A 4PC2A 3EIEA 2V3CC 2HPSA 4LV8B 2OTGC 2ZANA 1NL3A 4I4LA 5ELXA 2NO1A 1B9AA 1GL6A 1KK0A 2VSXA 1P73A 1YUSA 1Q12A 1TQDA 1P62B 1OOJA 2BKEA 3BOWA 4JLDA 2QSYA 3RAPR 1OIXA 3BOSA 4BRWA 1ZIOA 4DCSA 1GUAA 1XEWX 2QTVB 1YTZC 1ALWA 3I5GC 1IWQA 3AF4A 3C7KA 2M29A 2JLRA 4PCWA 2FGJA 1COWD 3WYAA 5AFPA 2BEJA 3A58B 2GGMA 3LLEA 4KVAA 2ZJYA 1Z6XA 3I5IB 1AS0A 1H4BA 2REBA 3EPHA 5I2QA 4S2EA 2MLEC 1CDPA 1YZKA 3E5HA 3VU9A 1MXEA 4C0SA 1H8HA 5EP3A 2ZJ5A 1E9CA 2JATA 3I3SR 1IN8A 1Q57A 1BMFA 3NC1C 4KAXA 4TQAA 4DB2A 1U99A 3WBJA 2ZRMA 4A0GA 3AV0B 4GFTA 3QKRB 3THYB 3VKHA 4WRIA 3FHOA 3WP0A 3VRPA 3RSLA 4MZLA 2UZ3A 3ZVMA 3Q8XB 1KFUL 1SKYE 1G1MA 2XB4A 3HU1A 5C46F 1X6VA 1S4QA 4F4IA 1G7CA 3W9YA 1A82A 2K8MB 1AP4A 1CDNA 3AKYA 4URWR 3IQQA 2CBLA 2QU8A 1ZC4A 1FPMA 5FOVA 2KI5A 5AK0A 4EJSC 1OFIA 1OIWA 1C1YA 3B1VA 3HR7A 3QKTA 2A5DA 4OJQA 3WBKA 3NSIA 1XFUO 3DM9B 4I5JA 4YGEB 3K1JA 4Q9KA 2O60A 4DIRA 1C4OA 2PSRA 1S9HA 2F6RA 1HYQA 1SL8A 1KMHB 1XCPA 4X8LA 2WWYA 4ASUD 1KWOB 2KDHA 1UHIA 4PHHA 4PQFA 5C2JB 2B7CA 1JC2A 4JMPA 4TYWA 4LBWA 1QHGA 3SYNA 1NY6A 1G7RA 4I1UA 1PSBA 3NSLA 4LBVA 1QVIZ 1CFPA 1B8LA 1KK2A 1DJGA 4C0LA 2AX4A 2OV2A 5IHPA 5BN3A 2FPLA 3CF0A 5KU1A 4Q4LA 2ZRPA 5JRZA 1G33A 4CEIB 1BIFA 2LC5A 1P9NA 4LK2A 1G5RA 5D3QA 1TF5A 2FFHA 3BAFA 2GBLC 1E6CA 2BCJQ 1Q44A 3IEUA 4PE4A 3QI2A 3FWCA 4MUAA 4Q1DA 4FTGA 1F4QA 4V0OA 3MGCA 4I5LB 2ZR7A 1IRJA 2M7NA 2GILA 1JJVA 2PBRA 2W6JA 4Y0VA 3I5XA 2IS9A 2CL6X 2ZRAA 2NO7A 2VH5R 2CL7X 1WCV1 1A75A 3CH4B 2G2BA 3RS2A 5AUOB 1YR8A 1IY2A 1FP6A 3F3YA 1RKBA 1TPZA 4M1YA 2ZJOA 4XTRA 2ZR0A 4DXAA 1JB1A 1HE8B 1JWDA 3R7WA 1KQMB 2PMDA 1XD8A 5EUMA 5KHOC 3LCPC 1FTSA 2M1KB 2LHIA 3NBZC 3ZZ0A 1E2GA 1VG8A 2QPOA 1DO2A 2Y1MA 1LXFC 1UHHA 2BL0C 1YVLA 4QKQA 2FDCA 5L3RA 1XD9A 1QIVA 2ZS7A 1T8UA 4JVSB 1XRJA 4KSCA 4AWXA 1S1MA 4IEEA 5G40A 4ZDJA 2J9RA 4GDFA 1S36A 3BFVA 4F4JA 1K5DA 3QKRA 3GPLA 1DG3A 1NVUQ 1N6RA 4E5UA 3THYA 1YVDA 2EFHB 2AAOA 2R6FA 2RH5A 1V5WA 5KNBA 2L0XA 3WNXB 1V1GA 2K2FA 4UNNA 2V54A 3NVAA 4YDHB 3AAKA 2QN6A 1CTQA 4YMVA 1ZNYA 4TYNA 4LBYA 1K95A 2F8PA 1KI9A 3FFAA 1Q20A 4BGDA 1Q21A 3MD0A 1W1WA 1NMZA 1IBRA 1W0JD 1R2UA 2X2EA 4FCTA 2LLSA 2QNRA 5JBQA 2WTUA 3I5FC 4C0JA 2F9MA 4BFZA 4TYQA 4JKYA 1KAOA 2WPDD 4A0HA 2QE7D 2XOKD 2P2LA 2WVJA 3M0EA 4TQ9A 421PA 2WJYA 3PCRB 1R2QA 2CJWA 2IYXA 5DIFA 3TGPA 1XMIA 3AGQA 1TEXA 5B8IB 2LMVA 3FWYA 2LUCA 5ER5A 5DO9A 4HDOB 2AKAB 4QGAA 5JCPA 1G3QA 1ZBDA 3CNLA 4HLQB 5TV2A 1AKYA 1AS2A 4WIAA 1N2CE 2DWQA 2M9GA 1ZP6A 2MMGA 3SJZA 5IF9A 1NBME 1B1GA 1G4AE 4MYCA 4CEIA 3QXXA 1OYYA 5DGXA 1R0YA 2GXQA 2RGIA 2FPKA 3IIMA 2MAZA 4DUGA 1MRSA 1DAKA 4DKXA 4QHSA 3RYTC 2JTZA 4QJ4A 1CIPA 1TNWA 3C5HA 4PC7A 1E2FA 3PEVA 4FCVA 3D10A 2A4JA 4C2UA 1KO1A 4C9BA 4OQMA 1BO6A 2GGZA 1I2DA 3BWDD 5JRJA 2Y5IA 1ZU4A 3JTDC 1N6NA 2H61C 1BU3A 3LX8A 3B1YA 1M6NA 3EKHA 3DMDA 4LJ8A 3B85A 2JDID 4CF7A 2LP2A 3JVTC 4RSGA 1U94A 1Z07A 1K93D 3CWGA 1KI6B 4IHQA 1EFHA 2GF0A 4LPKA 2XTNA 4A8JC 5FH9A 3SDZA 1Z0IA 2BMJA 2D2EA 2PVBA 2NG1A 5B57C 2R9VA 1UURA 6Q21A 4JS0A 2MBXA 4W9MC 4G5RA 3RLZA 5DI9A 3K70C 2IUSA 2H17A 1MO4A 4EQ6B 4IRUB 4JLOA 2A5FA 2ZI6A 4XVQA 1SR6B 1SVIA 1U5IB 1ZM7A 3C8UA 1XNJA 3K0CA 3P4XA 1GWNA 4PR0A 1OMDA 1XFVO 1WXQA 4PHNA 3SS8A 2DFLA 4KFTA 3DVJA 1U0LA 4M21A 2BCBA 1Z0DA 3ZQJA 1AN0A 2GKSA 5L3VA 4W5HA 3PALA 2J45A 5DHAA 1KAGA 1N5KA 2QGNA 3IPXA 2ZM5A 1SVMA 4A15A 2J0SA 2PZFA 4AKIA 2PMKA 4GT1A 1QJTA 1NX3A 2HXYA 4R1EA 2XJ9A 2C9YA 3QG5A 3RANA 2IYVA 1KFXS 1E9AA 3CH5A 3CLVA 1N6PA 3OESA 1X3SA 1TIZA 5FR2A 3RWOA 3UANA 1SPYA 2O0JA 2QP3A 1SXJB 2IXEA 4LJAA 5FBVB 1QTXA 4AY2A 4PE1A 4M2LA 3TW4A 5KNDA 4WZBE 5HYDA 2ZRBA 2E9SA 3D8BA 2QG6A 5JZVA 3CNNA 1II0A 3TAUA 3UIEA 3ZJYA 3HDTA 1OZOA 4B35A 2FEOA 1RYHA 4DT1A 1OT3A 4TZ0A 2I1VB 4CT5A 2IS6A 3ZS8A 1CJUC 4KXFB 2CVHA 2VTKA 4WW0A 3JVVA 4OL0A 4B73A 2WCBA 1K8RA 1RYFA 3FHTA 5FOUA 2HQWA 3QXSA 3SI7A 3A8RA 2Q6TA 2I7AA 1IGVA 2C9OA 5FL7D 2FH5B 5JSZB 1G7TA 1LKJA 2JOJA 5B64A 2XGJA 2H18A 1SVSA 4V0KA 3EWSA 4HREE 1MRNA 3LXXA 3U3OA 2WNDA 5AJXA 3GLIE 2Z6VA 1XP8A 3EARA 3OIVA 5C4MA 5H8WA 4KVGA 2RGCA 3RM1A 2CXJA 4TMVA 4RFSB 4JBXA 2PCJA 5FPSA 1NJFA 5SZHB 4M9SA 1P60A 4LPSA 4WQ3A 4HLDA 4RJLA 2V6IA 3NXAA 4FMDB 4P4SB 1Y1XA 2O0KA 3GLFE 3K0EA 4RFVA 2FMXA 5EJEA 2GZDA 5KPJA 4D25A 1Q80A 3AVPA 2YC2C 1SMGA 2OAQ1 2R8RA 1CKEA 3QNUA 3J81k 1HA3A 4NDBA 1KI6A 2Z4SA 1SYMA 3T5GA 2JGNA 3PEWA 4QM6A 4JLMA 5DI3B 1F3OA 2ZS8A 1XJ0A 5TVKA 4UNQA 3K8YA 1RC8A 4JBYA 2JNXA 2CHQA 2FSFA 4JL5A 4MH0R 2BECA 3TIFA 3FOZA 4OQLA 1KFUS 1P6XA 3KKMA 4TN1A 4XD7D 1HQCA 4G5OA 621PA 3WYFA 5K8TA 4L16A 4BRUA 4NDCA 1VTKA 4XJXA 2VBCA 4FIDA 3W5JA 3E3RA 2K61A 1DT7B 4JL8A 1ZUHA 1JJ7A 2ZRGA 2QT0A 2VL7A 2QGZA 5HKWA 4RZUA 3R20A 1T3LA 2FSIA 5I2LA 4I1VA 3BXKA 2VF8A 4A1FA 2QM7A 1S6JA 1IHUA 1YKSA 3EG5A 3TUIC 1CMFA 1TNQA 4RD3A 2QSZA 1OB2A 2OFXA 2RGEA 4MVFA 1Z0JA 2L4HA 3PQCA 4B2IA 1G18A 3SU8A 4JWQA 5TY0A 3PSRA 1W2HA 3AUYA 4YI8A 1N3BA 1CF4A 1W48A 3FPAA 4NH0A 2ZRSA 4OI1A 1G8YA 1SXJA 4LJ7A 1R8QA 3EVUA 1N6IA 1RRPA 3KX2A 2ZJBA 4LUCA 1UKYA 3LA6A 3AH8A 3ICEA 3KFVA 3LK1A 1U0HC 3K9GA 4ORAB 2XOKA 4MRVA 5FBLB 4OHZA 1H8EA 1QG4A 5GJWC 3WHTB 2IHBA 2VO1A 1GL9B 5DN6D 3CZTX 1W5TA 3EC1A 5EZ6B 1NCXA 1KCYA 5AWFC 5KSZA 1S9DA 2KSQA 4HLUA 1I4TD 1YR5A 2FWRA 3U5ZB 4XIGS 4A2PA 4FMCB 4GBAA 4EPYA 3EXAA 3AVQA 2ASEA 1W5SA 2NO9A 1UFQA 4BWYA 4EPXA 3OEEA 1SL9A 3IO3A 2QM8A 2EFCB 2JJ8A 5E3HA 1IN5A 3TZ1A 4DIDA 1EH2A 1P9RA 3IHWA 3KL4A 1CLBA 3VKWA 1E98A 1W47A 1XFWO 3NH9A 2VP5A 2E30A 4UJ3A 3SZRA 2ZPTX 1OMVA 4P4SA 2A5JA 2ZYWX 4HAXA 1LA3A 1CB1A 4HUTA 4J0QA 2M49B 4M9XA 1YE8A 5KTYA 2BJVA 1M7GA 2QQ0A 3SFZA 4EUNA 3QBVA 2QAGC 1G3RA 1E1QD 1FX0B 3SG3A 2GJAA 4GNKA 1II9A 3VR3A 4ZV4A 2UVQA 4B43A 1F2TB 1F5NA 1VMAA 3GLHB 2H16A 1WF3A 4PQYA 4OQNA 1HE1C 1OMRA 3WYGA 4EPRA 1WE2A 2KAXA 5JEEA 4MITA 4PAOA 3T12A 2JLXA 3U3MA 1QLSA 4D0NA 4I1OA 2QBYB 2FFBA 1PLLA 3RWMB 2YOFA 4MYUA 1K90D 3LLMA 4PHFA 1G16A 4E03A 2YZ2A 1PVOA 2GESA 3A1UA 4FINA 4US1R 2GCPA 4XTCS 2KAYA 5FUYA 4HDCA 2MSEB 2JJ2D 5J3XA 1UWOA 3LY5A 4MKFA 4Q21A 4EPWA 4TTPA 1EJ3A 1G8FA 3F0TA 1DO0A 3O47A 4OKSA 4PQRA 1OSAA 1UPTA 4C0KA 4MRXA 1FUKA 2PH1A 4MRRA 2JJ1A 4Q7KA 1XEWY 4E22A 4EFLA 1LVGA 2WSSD 4D2IA 2OG2A 3IQWA 3NHBA 5BQ5A 1S3PA 4LI0A 5A4JA 4A4DA 4AI6A 3PUXA 2AK3A 2BKUA 3OE7D 4H9GA 5LDDC 1N5LA 4GL2A 1E9EA 2WWFA 3SQXA 1GM5A 1V43A 2Q91A 3B7GA 1CFFA 2ZRFA 3UKDA 3KO0A 4LY6A 1IQ3A 1Z3IX 4IFEA 4ZKEA 2L4IA 3D3QA 3UK6A 5TMPA 3KUCA 4EIWA 2G9NA 2C98A 3U3RA 4GMXA 4YMSA 1EXMA 5SZIA 3RNLA 4K46A 3A1VA 2ZJ2A 1R8SA 2C03A 1E2PA 3VHXA 3VR2A 2JLYA 1TN4A 3THXA 2IYZA 2VSFA 2GJSA 1VPLA 1VYTA 4Q5IA 3WHKA 5DNYB 1E9BA 2PT5A 3FMOB 5AERA 2F1RA 4LHWA 3VX4A 3SG6A 4XWAA 5I2OA 3QBTA 4UNRA 4DHEA 3IQXA 3E2IA 3NSOA 1ESNA 1R7RA 1NG1A 4N3NA 1WRZA 1SCMB 3NSKA 4QNMA 1L8QA 3CR8A 5JFGA 8OHMA 1NUBA 4YDSA 4YI9A 4ON9A 3UG6A 2R62A 1IQ5A 1R0WA 5CB8A 4PAMA 2JXCA 2VP2A 3GJ7A 2ODEA 3U3KA 3IF7A 4OI4A 2ZUDA 2FF7A 4GOKA 2RGGA 5H1YA 1SNLA 2BBSA 1B8RA 2C2HA 4UXHA 5DHFA 4ACBA 1UKEA 1I4DD 1G19A 3B1XA 4AYTA 3U4QB 1F2TA 4ORCB 1F6BA 1US8B 2F3TA 2J7KA 3D6TB 3GLHA 5CK5A 4LBZA 3CPEA 4ICBA 4Q7JB 4R98A 5EP4A 2OESA 2UKDA 2JIZA 3MWKA 2V1UA 2Q3MA 2QBYA 2ATVA 1DAFA 3I92A 4DZZA 2BMEA 2VSOA 4YGDB 2R65A 2I94A 3CX8A 5EP1A 5B30A 3ADKA 2W83A 4NL4H 1P2VA 4Q00A 3VAAA 2WM9B 3GJ8A 2J0VA 1IXSB 3KKNA 1X1SA 3EW9A 1NP8A 4URZR 1U98A 1BF5A 2BHRA 1OH6A 3QF4B 3LW7A 2D62A 2PMYA 2J1LA 5DISB 5FBRB 2P6NA 3K09C 2O8BB 2KBEA 3RRNA 4QXAA 4TMKA 2NMVA 5G53C 3VX3A 5IK2D 3GLGB 3K53A 3FHCB 1AJ4A 1F8HA 1AVSA 1DJYA 1Y3AA 1NLFA 1QIWA 3SJBA 1ESMA 4UJ5A 1IQPA 3T1VA 2WICA 5J4YA 1XO5A 2OS8B 2JWWA 1OE9B 3AF3A 3PR1A 4JKIA 4TL8A 1M7BA 4PSVA 1OYWA 2M3WA 3PN7C 4AOMA 3K70D 3AVUA 1RRCA 1P5ZB 3EZ6A 4M1TA 3EPJA 3ND9A 4DEXA 1YZNA 4BPBA 1DJXA 1KK7Z 1SQ5A 3RRMA 1A7JA 1R4AA 1F71A 2VYFA 2AFHE 1XTKA 1T3SA 1E9FA 1QXPA 2QA5A 5JOLA 4ZDIA 1V1FA 2FCEA 4TNCA 4YBHB 2RGXA 1NBMD 1UEIA 1ZD1A 3AP3A 4KFRA 1XTIA 4MGIR 1KIMA 1FTNA 4WVFA 1G5TA 3LAWA 4KCGA 4P4TA 2BM1A 3M4YA 4ZCVA 2KI4C 2EGDA 1S6IA 1GNQA 4O0MA 5CLQA 5FI0B 1Z0AA 2J7PA 1ZD8A 4PSAA 1MABA 4B6FA 2WWXA 4XWOA 4LHXA 1NCYA 1G64A 2VP0A 2WHXA 1L2OC 3ZLJA 3CRVA 2OO7A 1AJ5A 4D1EA 1C9KA 4I1SA 5TXGA 3SFVA 4RD6A 2OT3B 2MMCA 2R6DA 1HT2E 4DLZA 1N6LA 1NVVR 1UHNA 2GHIA 5AJZA 4TYPA 4TLEA 3OHMB 5KYKA 2KNEA 4G01B 3IUYA 1OXSC 5TDHA 4HRGA 2ZRJA 2RAPA 4V0NA 4A36A 4LV5B 1K6MA 2QROA 1UHJA 3R8CA 1CJMA 5FBQB 2PZEA 2A9KA 2P3SA 2REXB 4URYR 1H65A 4BZQA 1TEVA 3GEHA 4MYTA 3O6BA 1HURA 3AF1A 5KDDA 4LX0A 3FE2A 3I32A 1E4VA 4DLSA 3ETLA 2DR3A 2KQ6A 2ZN8A 2W2XA 3B1WA 1TNDA 1CR0A 3GMTA 2CNWD 3PVSA 3SG5A 5HR5A 4WZ6A 2V8OA 1KO7A 1WBDA 1MV5A 5JWOA 1ZMXA 1DG1G 1OHHD 4IVRA 2R2AA 1DMOA 1XTSA 2BV3A 2JLQA 2WWIA 4UQOA 2F7SA 1D6JA 2KI6C 2Q21A 4C30A 5JCZA 1IJFA 4M1WA 4GP6A 4Q9JA 1XTJA 4DLYA 1K2HA 3ADDA 1ZM4A 4YGCB 2ZETA 4MRYA 1JXOA 1RE0A 2CHGA 1G3UA 1BR4B 2H7VA 3KHEA 2QUZA 2HCBA 2WOSA 2G6BA 2ZSEA 5SZJA 4EPTA 1E9SA 5FL3A 4X8OA 2V7QA 521PA 5GVSA 1PUJA 4KBFA 2V53A 1E79A 2LE9B 4IDHA 4LYFA 1JR3D 1FQKA 4C3ZA 2HDNB 1BG1A 1S96A 3GD7A 3EKJA 2IS4A 4B48A 2D74A 1CFCA 4L9WA 3QY0A 5AANA 2PL3A 5BN4A 1EXRA 4GGFA 3T61A 1L7VC 2ZE7A 3DVEA 1D8TA 2J87A 2JLWA 1A75B 1D2MA 5HLVA 3OEHA 4KHZA 1UBFA 4G5SA 1MWNA 4NDDA 1E0JA 3ZZUA 1JALA 4Z8XA 1W2GA 3R7WB 2LCFA 1MKYA 1RIFA 1NNEA 5J4HA 2ODWA 3QUSA 3AM1A 4KU4A 1JR6A 3BB1A 3TUYB 1E2QA 3UMFA 1AQYA 1L2TA 2NIPA 2X8AA 3TW8B 2EVWX 4CZ2A 1TQ2A 2OXRA 1OXVA 1XJCA 1N0WA 3FWBA 1Q1BA 3I8XA 3G5UA 1DARA 3L43A 1QX5B 3EK7A 2R44A 4HUQB 4NONA 4TLDA 1T91A 1K9UA 4ACAA 1U0JA 2I18A 3ZZTA 1Z0FA 1TF2A 2XNDD 2P5TB 4LJ4A 2IYRA 3WHLA 3H86A 1R5OA 1NF3A 2K7CA 4Q9HA 1ZCBA 1KDRA 1NIJA 2ANBA 2XAUA 3W90A 2BBOA 2VHQA 1Z29A 1T5IA 3GK2A 1U8AA 3V00A 3TDUA 2RGNC 2XTMA 4TMTA 3OHMA 4AIIA 2OCPA 2YWHA 4LHVA 2RHDA 5JHGB 2OXCA 3IBGA 4OHWA 1R6PA 3KJHA 3LQRA 1AGRA 3BB4A 5IT5A 1RZ3A 4TMXA 2ZNEA 4FI3C 2GA8A 4RVCA 2BKHB 3PEYA 3HPRA 1W0KD 5AJVB 4AK9A 2ZI7A 1EG4A 4DCNA 4YRUA 2CLDX 2REOA 5GQQC 2ERYA 2WOOA 4EFMA 5BXQC 1ZNXA 1X8KA 5I8NA 5FTKA 3U7EB 1KI4A 3QOFA 2G77B 4PPFA 2CJWB 1TAGA 4RZ2A 4B32A 3RS3A 2AN9A 3FFBA 3ZQ6A 2ZSDA 2MLFC 1ZC3A 4YMTA 4Z1MA 2ZKMX 2EC6C 1XXHE 4BY4A 2IUTA 1F70A 2I1QA 5DYGA 3THWA 2KYCA 3QXCA 1CRPA 3Q85A 1DGUA 4TQUS 1G8GA 2XNSA 2GAAA 5HZKA 3VROA 1E69A 2A3RA 1XTQA 1E1RD 2ZRNA 3OAAA 4L8GA 1IOZA 4D26A 1QHHB 1KK8B 1B47A 2H61A 1PVAA 2QL6A 1EWRA 1XWIA 3SC3A 4BFTA 1A4RA 1JAIA 3KFXA 3NKVA 1S1CA 5TB5A 1KJWA 3EC2A 2LAPA 1QASA 4A4CA 3NC0C 1X86B 3HWSA 3LV8A 3H2YA 1PRWA 3UWOA 1NKTA 2JXLA 5IK2A 4QJ4B 1QVIY 2JT3A 3MJHA 1E0SA 2QMUA 1BJFA 4MUBA 4NCJA 4O2RA 4RD0A 1SVLA 2GVZC 2GDJA 3LH5A 1WRLA 1QV0A 1Z47A 2KSPA 3VR5A 5AUQA 2IF0A 2DHRA 3P20A 2XJ4A 3ZD7A 2VHUA 2BCAA 1IXZA 4B3DA 2FSHA 5JJIA 3CPHA 1Q1ZA 3ZIAA 5DE3A 4M1SA 3W8RA 3DMNA 4BLRA 4B47A 4M1MA 1T9HA 4II7A 1EFCA 4RKEA 4F91B 2GJKA 4Q7MB 1VDZA 1GQMA 1NBMA 1GKIA 4GZLA 1EL4A 3DKVA 3VTKA 4F4CA 1IONA 1WDCC 2HT1A 4HUQA 1QV1A 3SG7A 3AVYA 3FMIA 1M74A 3MMPA 1PLKA 2WCEA 2RCNA 3IO5A 3BS4A 1RJVA 4GZMA 3FVQA 5EE3A 4MKHA 3FB4A 3HX4A 3WY9A 1B4CA 1M1YE 2R6CA 2AKYA 4MZKA 3LL8B 5EXPA 1TADA 1E9RA 2ZJ8A 4QJ5B 1XCMA 5UKDA 1N6HA 3CNOA 4Q1CA 2M0RA 2FEMA 4R2HA 4B3FX 4DSOA 1W4RA 4QJ3B 1IN6A 2JEOA 1OFUX 3UXMA 1JF2A 1LF5A 1UHKA 3SIBA 1HUQA 3ZH9B 4X8HA 1KI2A 1ZVQA 1GTVA 2C5LA 3K9NA 4GP7A 4L4UA 5HTKA 2HUPA 1NCZA 1I2MA 3DZDA 3H0KA 1WBBA 1MR8A 4HI0E 1KK1A 4ETOA 2QRNA 4D4LA 3KXKA 3IGFA 1XK4C 1VHLA 4AD8A 3L0SA 3MLEA 5ER4X 3CF2A 4AURA 4YXWD 2E6WA 2WSMA 1XX6A 2PCLA 3C4JA 3U61B 1TMKA 4PHJA 2IT1A 3HU2A 4D4JA 1GGZA 5E7IA 1DTSA 4V02A 3GP8A 1KY2A 1E2NA 2OSBA 3SN6A 1E0AA 1J8MF 2QMEA 1S3SA 4URVR 3KQHA 2DB3A 1OXTA 1TTTA 1ZW6A 1FI5A 2CMKA 1FFHA 4JLKA 3FKSA 4ITRC 4P31A 1WDTA 2ZI9A 2LCPA 4MN0A 4OI2A 4QM7A 2AUCA 221PA 4HB0A 2ZYVX 1N6KA 1NIPA 1K96A 2Q9AA 4DT1B 5BYKA 3CR4X 4GGNA 1QHHA 2GAOA 4A6XA 4U00A 2W58A 4RD2A 2ZJAA 1KSJA 1HY3A 2ODBA 4PC3A 2EWVA 3BJIC 1OHHA 4EFNA 4ZI3A 2FV8A 4TT3D 4AG6A 3H4MA 3RRZA 3QPVA 4CRWB 4KV9A 5LBIA 2ZUCA 2ZAMA 3A1SA 1KOFA 5E95A 3O4YA 2M97A 2QAGB 2O52A 5HE8A 2D3WA 4JQ0D 1A2KC 1N25A 1VECA 2VEDA 2X77A 4GRAA 3TUJC 1OV4A 2WAXA 3VMFA 4JLNA 1SKQA 1OLOA 1AK2A 4TL7A 2IC5A 3FTQA 1NSHA 3WXAA 1EX6A 3ONWA 2XXAA 4ESVA 5CLLA 3EASA 4A2WA 1WA5A 2OHFA 2CDNA 4MRPA 1AKEA 3PFVA 1W4BA 1CR2A 1S26D 3MUFA 4AKEA 4CIDA 1XD2B 3P1JA 1P2TA 1IN7A 3EA5A 1VCMA 1BOCA 3BGWA 1J70A 3OFND 4HLCA 4JLPA 2QMHA 3VNUA 4USLA 1W46A 3Q7PA 4Q1BA 1XTRA 4LWZA 4PZLA 1Y1AA 1WQ1R 2EYQA 4GFDA 3DL0A 4CFQA 1COWA 3R8FA 3H4SE 5E7MA 1U8ZA 4KFSA 4Q01A 4W7SA 4B34A 2H1LA 2FG5A 3EAQA 4OHYA 3B5JA 4L9SA 1P4SA 5JLJA 3I5HB 3CWQA 3O78A 1G3MA 2BEKA 3B9PA 3BQ3A 1GFIA 4C0BA 3SG2A 4TWZA 4QJ3A 1H8BA 3F5FA 1VG1A 1G6OA 2XNDA 3TS5B 1NRJB 5KDOA 1EWQA 1ZU5A 4D81A 3OX6A 2F1HA 4Q47A 1XF9A 2NLNA 2FX3A 3SEAA 3V4FA 4FQOA 5FPTA 5E4FA 4ZCIA 1GKUB 1BLQA 1PJRA 4Q03A 5KSPA 2XSZD 1Z6GA 2WKQA 1T4GA 4UNPA 2YOGA 3MRSA 3EIQA 1DEKA 4G1UC 4U02A 1CDLA 2NXQA 1YR7A 3QEJA 4M4SA 4YMWA 2WKRA 1NMYA 2IUUA 1Q3HA 4YLGA 1ETUA 3OZXA 4C0AC 2C9CA 2ZRIA 1ZMZA 1W0KA 3TKLA 1J2JA 1OPXA 2CK3D 1LW7A 1ZUNB 3X1YA 1OH7A 4MYHA 3A1TA 2M1UA 3I5IC 2L51A 5CSNA 1O3YA 2GJ8A 3PV0A 4JJZA 2AR7A 1JR3E 2ZAOA 2ZN9A 1T3HA 2C95A 1UBCA 2GCNA 1RROA 5HKYA 2Q3HA 1LV7A 5D69A 1ZRHA 4ASUA 5FTLA 1RFLA 3KKOA 3DF0A 3A37A 1B8CA 4E07A 2N46A 4DRZA 5BN5A 1IJ5A 3LXRA 1ZJ6A 1QX7A 3GEIA 2RGBA 4IXNA 4LGMA 1CXZA 4KO8A 2IHYA 3KKPA 2HLDD 2LKCA 5LD2B 5KPDA 2LHLA 1CLUA 1E2IA 1ZM2A 3HJNA 5L3SB 1J7OA 2QT1A 1YQTA 2ZRDA 3MAAC 2QAGA 4ZPXA 4NCNA 2BBWA 3NBFA 1W36D 3OIYA 4MKIA 2WZQA 1S5GZ 4DC9A 4E09A 5ANRB 3RS5A 2VP6A 3GJ5A 1Z63A 3JZAA 2IS2A 2BBNA 3W3AA 3SR0A 5HKKD 2WJIA 4QHTA 4LSGA 4XSHA 4DS7A 3GK4X 3OB1B 1GRQA 1XMJA 4HB3A 4TTQA 2KI6D 1OKKD 1XD2A 2B8TA 2HF8A 1DAIA 5E7JA 1KWOC 2ZRCA 3L8YA 2Q9BA 2ZROA 4DCUA 5M04A 4GNKB 4MA4A 4P4UA 4QG7A 5J5CA 1S5GY 3KPXA 1KZGB 2JCSA 2X2FA 4FXPA 1EG3A 5EUQB 4BFYA 2F1IA 1EFRD 1NSTA 3EIHA 2FCDA 2IWRA 4PFSA 1CEEA 4RZ3A 3AKBA 3AKCA 1DS6A 3PUVA 3L0IB 3R9IA 3KQUA 1NMXA 2W0SA 4ZDWA 3N70A 1RJ9A 5EE1A 4OK3A 4BQSA 3QSYA 2HYIC 1YRAA 2BBTA 3NTUA 2QRZA 2B1UA 3DM5A 2JU0A 5IBWA 4GOJA 1SVWA 1FNMA 1RPZA 2ZU0C 4KI0A 3MSXA 1F55A 1KYIA 1KSHA 2BIFA 3RS7A 1WB9A 2C96A 4F38A 1U81A 2WC8A 3LBIA 1MO6A 2A78A 4B76A 3CZQA 4CEHB 3A4MA 3LK0A 3AAJA 1XBTA 2OBNA 2P0EA 2VLIA 1SK6D 1JQLB 2IBMA 4MGYR 4B74A 2VIIA 3U7HB 3SQWA 1GNRA 2ZI5A 3PATA 1QX2A 2VF7A 2W00A 4OKHA 1UJ2A 3BERA 1SRAA 3I5YA 3T15A 1N65A 2Z0MA 5FOTA 4DDWA 4MBEA 1XFAA 2XTZA 5KDLA 4OHVA 1G8IA 1KQMC 1XFXO 1W0JA 2BDTA 3I1FA 4NYMR 1VKJA 2IXFA 3U2QA 1NLYA 4HZUB 3S1AB 2F3YA 2K7OA 2M8UA 3FMPB 2WPDA 3N2EA 3FKQA 4JVMA 2ONKA 2H8KA 2QE7A 5F2EA 2ZU6A 2OBLA 4DSUA 2GXAA 3OX5A 1VRKA 3SBDA 4DCKA 1MXLC 1P75A 4S35A 1G21E 2AXPA 3BRWD 1KI1A 5CIWA 2BCXA 4PSKA 1NKSA 1GGWA 2J0UB 4PO8A 3THXB 4C7OB 2P65A 2CBZA 3VNVA 3WNBA 1NN0A 5A5GA 2XB2A 2LM5A 3BUNB 121PA 4KBGA 2DWPA 4D0GA 1XZQA 3KF9A 3ZNIA 3SJSA 2EYUA 5L3SA 1GZSA 1SULA 1FMLA 5FPHA 3VQTA 1WRBA 1LB1B 1E2DA 2IK8A 3CM0A 3BUXB 3N5CA 3H1TA 5F6TA 1AM4D 4JSYA 4EKDA 4IW3B 2ORWA 1Z06A 2KOTA 2HEIA 1AZTA 1TUIA 3C14C 3KQNA 1GIAA 2F3RA 3L82B 2RGDA 4L15A 5FOXA 4WBSA 1A03A 2GETA 4DLTA 2WIBA 3DDCA 1NVXQ 3NEJA 2H92A 4OQFA 1QHNA 4V0MA 5J4LA 4GBMA 4D82A 5LPNA 1CM1A 1TNPA 1S2MA 2F43B 3BH6A 3ASZA 1DBSA 3KB2A 2RKOA 1SY9A 2VP4A 2YOHA 3UPUA 2LVKA 5GJVC 2JDIA 1SKTA 3K09A 2ZS9A 4KSBA 1T8TA 3K9HA 5EE0A 3QXHA 1ZUIA 3AP2A 3QENA 721PA 3EK4A 2LVIA 2KAVA 1EGAA 2FOTA 2KE5A 3BXZA 4AQIA 3DHWC 4NU0A 1T0JB 4D6PA 2BC9A 2OTGB 4OCIA 1D5CA 2Y1NA 2BJWA 2VPPA 4H1VA 1LA0A 2DCUA 4KYUA 5BW8A 5FPKA 4O3MA 5DSZA 3FGNA 3SBEA 2WJHA 3DOFA 1YX7A 1RK9A 4XOIA 4DDTA 3O8RA 4I5NB 3BYAA 4ARZA 1IM2A 1GITA 1FW6A 4CEHA 2MSCB 2NZ8A 1GILA 2NCPA 1PK0D 4NDZA 4PALA 1OW3B 4Q18A 1SXJE 4PE7A 3Q7QA 1Y0VH 3I5GB 1AZSC 1UEJA 2FU5C 4D0LB 1RW4A 1P2UA 3ADBA 1SZPA 3SG4A 4M1KA 3CZPA 3K0FA 2O8EA 1YHNA 4KFUA 2PLRA 1W44A 1EX7A 2BCGY 2I3BA 2KGBC 2XSZA 3BUWB 1GP2A 3IHLA 2DFNA 2A2ZA 2GJ9A 4NMMA 5EE5B 3S1AA 2O8CA 1UDWA 2AXNA 1RVDA 2DFTA 4GUKA 3TDZA 5CDFA 1YZLA 2H2KA 3SYKA 1SGWA 3T1TA 1NYAA 3SHWA 1L7ZA 1M31A 5DKRA 4HDQB 4JL6A 3EZ9A 4HRHA 3A4NA 3WRXC 1Z2AA 3UG7A 2J0UA 1M8PA 3SJCA 4A0RA 4AG5A 1PV4A 2XITA 4C7OA 2CE7A 4HAZA 1SR6C 1G291 3W34A 3B13B 1E94E 1KJZA 3EA0A 3NBYC 5EZ5A 3ND8A 3K0AB 2WCFA 5A0FA 4CDGA 4N1AA 1CM4A 1P2SA 1CBUA 2R2IA 4IDQA 4RKFA 4TMZA 3DVMA 4RD1A 3GJXC 3VHLB 1DAMA 1OE0A 2QZ4A 3IKJA 2IEZA 5FPYA 1MABB 3HPQA 4PTLA 2X19A 4Q4HB 3VRNA 1UUSA 4HATA 1FBVA 4US0R 5FL7A 1YRTB 4C0QC 4EJSB 1M7HA 3B9QA 3CRW1 2EU8A 4M8NE 2JT8A 3AVOA 3MFYA 1PUIA 4HAVA 4TMWA 3HYTA 4AYXA 1OB5A 1H8HD 5JEDA 2VRGA 5JWHA 4XSGA 2BWJA 4AC9A 3HP1A 4HAWA 2O5VA 1CLMA 3QXJA 3WNCA 2XZLA 1SXJC 1BMFD 2EW1A 1XMVA 2F43A 5EXXA 4BLPA 2E87A 2DFKB 1KTVA 3CRMA 4Z51A 5J47A 4TL6A 3CF6R 1GKYA 2L98A 1EFTA 2A30A 3RVBA 1OKKA 1YUTA 3EPKA 5CJ2A 2HCJB 3V4RA 1KGDA 3OIUA 1HTWA 2G3YA 2GK6A 3SHFA 1KO4A 1LS1A 4OYHA 4HLUC 1EFRA 1GSIA 1PSRA 3TLXA 1XVJA 2JZIA 4R9UC 1CDMA 1QHSA 2GCOA 1XZPA 5CPVA 2YWGA 2WKPA 3RC3A 1E96A 4U8DA 4NCKA 4PX9A 4XD7A 2AK2A 2BMDA 3Q9LA 2K7DA 4NBSA 3PJRA 4DB4A 5DLQC 1U9IC 3A8TA 1X8LA 4V03A 4PHKA 1BR1B 4M2QA 2GK7A 3U44B 1W7JB 5AXIA 1SKYB 1O87A 4FCWA 2NPIA 4ESHA 5TNCA 1AJEA 1TQ6A 4M0LA 1MO3A 3CTNA 2OILA 1AK8A 1NN1A 3M6AA 4I5KA 3GFOA 4D4KA 3AVXA 3ZS9A 4M2PA 5FUWA 1VCOA 1XPRA 1RWYA 4UXIA 4IVQA 3SNHA 2ZSBA 1Q3TA 5H70A 3RS4A 3HR8A 1KY3A 1RFJA 2FJUB 2HT6A 2BL0B 2OCAA 1K94A 2QTFA 1N6OA 2ZTSA 1N2DA 1VCIA 1FZQA 2QACA 2GTPA 1VG9B 3UMRA 2K7BA 3KJGA 4NCHA 2GWHA 4L5BA 1S6CA 3VRRA 2ZSAA 1YRBA 3FYHA 2KBMA 1P3JA 1EK0A 2ZQ5A 3HU3A 5FBWB 3ZVLA 3KJIA 3LQQA 4NHOA 1XFYO 2FZ4A 4JJKA 3IILA 1GJYA 1LTQA 5DN6A 3AUXA 4DUQA 2RGNA 1TF7A 2BKIB 1RRGA 1Z22A 1Z83A 3K0AA 5DKQA 4MDEA 2ZITA 4NE2A 1KK7Y 4BUJA 2OEPA 3O2PA 2P5SA 1KDTA 5L3QA 1ELOA 4URUR 4DIEA 4B33A 3LDAA 4UPGA 1DAHA 2PLFA 4Q4HA 5AJWA 3NEYA 3I5FB 3AQ4A 1Z08A 4NYIR 4EJSA 4ZIRB 1IY1A 2GXSA 4C4PA 2LNKA 4QRHA 4TZ6A 1ODFA 2GZHA 2RHMA 4PC1A 4GI7A 1ZFSA 5HPYB 4QBIA 2ZE5A 2WWHA 3IDQA 1XEXB 1FMJA 4YGBB 3GLHE 1E2MA 1CKKA 3F8TA 5FTJA 5JS8A 1CULC 1DE0A 2GF9A 3ZYCA 1TCOB 3NG1A 5CYOA 5KO2A 1GL7A 1QHYA 3DKPA 4JVLA 4CGZA 4LC0A 1AUIB 3ECCA 4ZCUA 1J99A 2SCPA 3QKSA 4PXAA 3CO5A 4BLQA 1E9DA 1WP9A 5G3YA 1N5IA 3LVRE 1E1QA 2J3EA 2YINC 4ABYA 4JSTA 2HF9A 4FMDF 1D9ZA 2FE4A 4B2LA 1W36C 1G8PA 4K8OA 3QJYA 4F92B 2GBLA 1SVOA 4PANA 4M22A 2K0JA 3DOEA 2TN4A 2ZSFA 3THWB 1JFKA 3SIAA 2OLKA 1M63B 3WMGA 1Q1EA 1P9WA 3P27A 2LUXA 4B3GA 3QVVA 2COLB 3DEFA 1LF0A 5CM8B 5CSFA 4HZUA 1NN3A 4R2IA 5AR1A 3T34A 1CS4C 3PIRA 1OH8A 3JTDB 2JJ2A 3IIJA 4BLTA 5JI3E 3B8HA 3LBNA 1AGPA 5JJGA 1OSNA 1PZNA 4UXJA 3L0PA 3A6PC 3QVUA 3T35A 2CCJA 3JVTB 2AL7A 2WSSA 1CNPA 3QEOA 3IQOA 2M7LA 2C99A 1AS3A 2O0HA 4M9ZA 4P0TA 4PPNA 1G4YR 4UKDA 4QOSA 4YC7A 2FJUA 3OE7A 2VRWA 4A8JB 3B6EA 4UNSA 5AJYA 1PALA 2IW3A 4US2R 1WLZA 5FI1B 4DUGD 1MQ1A 2E1RA 1G9XA 3LNCA 1XXHA 4FWIB 5JECA 3K70B 1Q1QA 4Q4AA 4H1UA 4DLVA 4XVUA 3SYLA 5CJPA 4B75A 2J5XA 4YONB 4PO9A 1SVKA 4IEIA 2ZRLA 5CSIA 2LP3A 3T06B 4DLRA 4B3BA 1P7CA 1DAEA 3QE0A 4LRWA 3O8DA 1OF1A 4LOAA 3KZ1E 1FUUA 2JLSA 2ORIA 2CVFA 3TH5A 1EESA 2JULA 4BASA 1TUEA 2K2AA 3LBHA 1KNXA 1W49A 4HSEA 3VR1A 2QAJA 5DYIA 3KB1A 2WAYA 4GPLB 1EFUA 4PZZA 1XK4A 5FTNA 4ZIRA 3TR0A 2Z4RA 4G5GA 1KO5A 3I62A 3TVTA
chains in the Genus database with same CATH superfamily
4PNPA 3LC1O 1NUSA 1XI2A 3HB9A 1F2UA 4KQXA 3NHPA 4QQRA 2LLTA 4HYYA 2I7VA 4YIKA 3D0RA 5M2QA 4R1MA 4FMBB 1DRWA 3EGXB 1X70A 4RK1A 4D3XA 1T14A 1BHO1 4PZCA 1BRMA 4QOFA 2YTZA 5M5BA 4EFDA 1ZIPA 2O3SA 1CF2O 4DDVA 4HRXA 1RWBA 4I50F 2JG3A 4ZOBA 1YQUA 1P81A 3NBUA 3CCFA 3JQQA 1TO1E 1P4RA 2AZMA 3BK2A 2FZKA 3QA9A 2CBXA 2ADFA 5F12A 2B21A 1U9YA 1K5HA 5AEQA 3GDHA 1T4CB 3E9ZA 4I5DA 4EY7A 3GLFB 3MWDA 5M34A 5A1TA 2A58A 1BOFA 5EWMA 4NKRA 3TWOA 1XEFA 4JJ8A 5ALWA 1TA0A 4J0DA 1KARA 3RHTA 1CFZA 1H8ED 4AU1A 4KUGA 2DX7A 5AXDA 3ZW7A 4U2EA 4D79A 4BLOA 3RBZA 4ZCTA 1TM1E 1OI2A 1JHUA 3LBYA 2O8FA 3TBKA 2ZFDA 2PBZA 1XDUA 3BC1A 3DE3X 3P9PA 3DMYA 1ABBA 5BWOA 3UAYA 4OR9B 2ERCA 3MA0A 4TWIA 4IQ4A 4W8OA 3RS9A 2VDVE 3FBGA 2OYRA 1G6HA 4LV6A 4RFLA 1X8JA 1I3CA 3EXHA 1Z4JA 4I81A 4ZCSA 3G8YA 3WX0A 4O2LA 2MOKA 4CCAA 1FMFA 4KJZA 5G0WA 4G2TA 3EPLA 2Y92A 1TM3E 1QKJA 3CUYA 3EZ7A 4PPQA 5B1DA 4Z4QA 4D7AA 2I2DA 3A6ZA 4K9DA 4NTZA 2WKSA 1LBQA 2IP1A 1KK8C 3OSZA 5T5QA 2VTEA 4PRLA 2HLHA 4ERNA 4MGZR 5AW4A 3FS7A 2Z6QA 2FPOA 1YVUA 4LZOA 5F21A 4JCCA 2H52A 4WERA 3A10A 4BJ6A 5AICA 4C89A 4ND5A 1GRRA 1OX6A 1V8BA 1UF9A 4XUCA 1U5IA 2Z4TA 2XVMA 3T1NA 3FDXA 2O8CB 3QYJA 2QNIA 1U7PA 2VHTA 3E9EA 2L5YA 4B3XA 3A4LA 2NSDA 1LNQA 1MGOA 3TFQA 5IXSA 3D7SA 2OAGA 1ZOTB 2LLUA 1A95A 3W5BA 4MV7A 1EE1A 2QORA 4IOJA 1M1NA 2G8LA 1QUFA 3WV4A 2Y1XA 1DKUA 2QI9F 5ECYA 1X9HA 1U1IA 5E9JA 2Q2QA 2W2VA 4NJEA 5JXGA 4QLBA 3FLMA 3ED5A 4QGFA 3UGKA 8ATCA 1X92A 2Y1WA 3QVTA 1ZJZA 4FK8A 5DKFA 2Q4BA 4DQUA 1ZITA 3TNLA 3PRYA 1V7PC 4Y0NA 3P9YA 1NX0A 1TVKA 2AVNA 3OEHD 1M2EA 1CLLA 2C4VA 2FHPA 5BMOA 1CMGA 2PANA 2CMFA 2VHJA 3ZTWA 4PS0A 2E6UX 2QDKA 3LHKA 1MW9X 1M33A 3QFRA 1JBAA 3QVSA 2DAPA 1FDRA 3LCRA 1Q0RA 1BJKA 4IGFA 4HVLA 2Y1DA 2R6R1 4NYJQ 1IM5A 4Z8YA 4KQGA 2QVXX 4JIMA 4HAYA 4Q4AB 1GPWB 1IH0A 4TLAA 2V1XA 2DE0X 3COSA 5HL1A 3T6KA 4MQ5A 4TSFA 4EVRA 3ZVNA 4WXRA 2VQ3A 2IXGA 2C3OA 1O94A 4YRQA 3JR3A 4FEEA 2OXIA 3KQLA 2NVUB 4NHEA 4L6AA 3TGWA 3VU9B 3LD9A 3QV1A 1T9AA 5A3SA 5JE8A 4JYAB 4EPVA 4EHJA 2PMBA 1QX3A 2N3ZA 3UWMA 5ALSA 4NU8X 1M1YB 2AQIA 1US8A 1ZISA 3ET4A 3KHSA 1EE2A 2G7ZA 3HN2A 3VUEA 4CF4A 4IIFA 2R8ZA 4C5BA 3G0BA 1X42A 5CVEA 1PBTA 1PR6A 1JDZA 3KQKA 1QG2A 2EHBA 3GLGA 2V3CC 3PVCA 2ZANA 4OX9B 1NL3A 4X7RA 1HG1A 3PF9A 1OIXA 1ZIOA 3AF4A 3L0YA 3WK7A 2MINA 4I08A 5ALHA 5CDTA 1SC1A 3COJA 3D3WA 3E5HA 3SF8A 4ENQA 1PNRA 3I3SR 1V5IA 4L76A 4KBYA 3WBJA 3LUGA 4LG1A 1U5BA 3Q8XB 4ECAA 1UEXC 3HFJA 1P80A 4G41A 1Y5IA 3Q98A 3DEAA 4EJSC 1TUZA 3NSIA 3K1JA 3N8DA 1KMHB 1XCPA 1UHIA 3K5IA 2H4ZA 3NSLA 4Z7QB 3BHIA 4LDPA 1HFWA 1G5RA 4W7IA 4Q1DA 2JCGA 1U6JA 1E3DA 2ZR7A 1RJFA 4XB1A 2NO7A 3SKXA 1LTKA 4XTRA 2ZR0A 4RH3A 3PFBA 3WAGA 1XDDA 4Z7NB 4OATA 1JKXA 4EYOA 3BMNA 5JH7B 4N3AA 5NLLA 2AG0A 1V1GA 4HDRA 4LTDA 3TOVA 4X24A 3F6CA 4MMZB 1UIRA 1RT9A 1CB0A 4YJHA 5DBIA 5I7AA 2NXJA 2I62A 4AF6A 5DIFA 1IULA 1X38A 4GMGA 5MDHA 2NU7B 3RTGA 1ZVKA 1EWKA 3LT0A 4PLCA 3IIMA 5CT4A 2JTZA 1IMJA 4QJ4A 1TNWA 4KOAA 1RWKA 3L6RA 1KO1A 1H3FA 4OQMA 1M6VB 2IBSA 3NIWA 3TDMA 1H9BA 5F52A 1NBWB 1K93D 3OM1A 3PR2B 5B57C 3RLZA 4IRUB 5BPHA 1OMDA 2HU2A 4J16C 2PX5A 1QGUA 4KAJA 4LC9A 3PC7A 1BN7A 3JSAA 5FR2A 3VPDA 2JAPA 4G1CA 1ESEA 4WZBE 2D0IA 4Z4FA 2ZRBA 4X84A 3KYJB 3PXDA 2WA1A 3G9UA 3QNMA 3HDTA 5BMVB 4PYRA 4EMSA 3IDZA 4YPFA 3ORHA 4KXFB 1VKNA 4GEKA 5DTJA 3DZIA 1G7TA 2QX6A 4GI2A 3ZJ4A 1LKJA 4HREE 3LXXA 2EQ5A 2IYNA 2NTNA 4RF4A 3A7DA 3DZJA 1PG5A 4RJLA 2P9YA 3M3DA 2OAQ1 2R8RA 3J81k 3D4NA 1TAQA 1GQSA 5ITVA 4OQLA 1J0BA 4L22A 3ITEA 3V8EA 1JJ7A 2I29A 2CZGA 5EIFA 1B6RA 4A1FA 3K92A 3JW8A 1GPAA 2WTNA 1XCOA 2O48X 3L1JA 3JQAA 2EKPA 4YI8A 1TW3A 1XMOB 3OECA 3KM0A 3D75A 3KX2A 2GERA 1ZR4A 3RJ5A 4DQXA 1GL9B 5C5EA 1XQYA 4RKWA 2V6BA 1GPH1 5HJ2A 3CLUC 5AI5A 2FR8C 1I4TD 5JYCA 2E55A 1ZMTA 3HXLA 5IJAA 3PPXA 5DM1A 3HCDA 4DIDA 3F7NA 3AMVA 2H7YA 3VTZA 4ER7A 4GPIB 2YR0A 4EARA 3HK2A 1J39A 4Z0PA 4NI5A 3QVKA 2Q5EA 5C1OA 1Z4HA 2YYYA 4HDCA 5ARCA 4EPWA 2B82A 2PH1A 4E22A 1GT6A 1OLSA 3NHBA 5A4JA 2FZEA 2BEWB 5DNDA 2ZRFA 2WAOA 4U9IS 4JQYA 3OFVA 5D7NA 2CMGA 1T3ZA 2OWDA 3PGVA 4B85A 4Q5IA 3MTIA 9LDBA 3NSOA 3EG9B 2ATCA 1WRZA 5CXUA 4GI3A 3SQNA 3GO4A 4XI9A 1R0WA 5D01A 1HOXA 3GJ7A 3TI7A 1QNFA 3MZ0A 3ZZMA 4BNGA 2YXNA 5DHFA 3U4QB 4KQ6A 1JJFA 3QX9A 4KN9S 4OFXA 2JIZA 3TI9A 5E1MA 2BMEA 1T2DA 3QMWA 4XX1A 3VNAA 1KH1A 4B8ZA 5F5LA 2YWXA 1GPYA 5IG2A 2G76A 2J1LA 4B81A 4O1HA 3S2ZA 2QDIA 3RRNA 4UJ5A 3TBFA 1XO5A 1JWAB 1UZUA 4TL8A 4FYIA 3EPJA 2H7CA 1DJXA 1NNLA 4KFRA 4JR0A 1NPTO 2W2KA 1PDWA 2KLDA 1G64A 3O4XA 1OWMA 5JFOA 1KC3A 3ER9A 5JV5A 1M1UA 1JFFA 1DX9A 4G01B 2ZRJA 1NRWA 4LV5B 1K6MA 1RABA 2AF4C 3WLOA 2JZOA 4KMOA 3GEHA 4Z9XA 5LYJA 1R9NA 3IUQA 4WNYA 1ZJWA 1T3TA 3HXQA 3BQ9A 1PZFA 1SC4A 2I2XB 4EGCB 1IJKA 3RU9A 2JLQA 4MUJA 2HIMA 4YECA 4MRYA 1U3TA 5SZJA 4EPTA 2F9FA 3T5MA 2LE9B 3OZDA 1S96A 4X6XA 4WZAA 1V3QE 2XZTA 4YRZA 1SKUA 4R6XA 5DNVA 3VC2A 3G2MA 3UMFA 1SBZA 3B20A 2H5JA 3DT6A 6LDHA 2R44A 1USGA 4I55B 1Z0FA 4YCLA 1P1CA 1ZCBA 2AVDA 2YH2A 1Z29A 3M6FA 4KVZA 1YDMA 2AMLA 1RZ3A 1ST2A 4TMXA 1IZ7A 2ERYA 1MJGM 4HVCA 1M6HA 3Q85A 3HH8A 1DGUA 4TQUS 2LR0A 4RPKA 1E1RD 3VISA 4L8YA 1H6AA 4MWEA 1IZYA 5JAIA 1D1QA 2JXLA 2YNMC 4RD0A 1EXWA 3U56A 3H4IA 3IRUA 5LOVB 2PSSA 4G6ZA 2YBEA 1EFCA 4F91B 1K9SA 1HE5A 3TNDA 2R1TA 4BO7A 3DKVA 1U8EA 4HUQA 1QV1A 3SG7A 3WMXA 1E7QA 4MAAA 3CKKA 4D96A 3P9ZA 4N3GA 3SSNA 4O4JB 1UHKA 5DASA 3CW8X 3E3MA 2HUPA 5EKUA 1VL5A 2BF7A 4P7JA 5B7NA 1VHLA 2JS7A 2CUZA 3ANTA 4FYVA 4V02A 1U80A 1N3YA 3WA6A 4WH0A 3K5PA 2QMEA 2YWRA 4P31A 2WDZA 1G20B 2Q9AA 4U00A 4PG6A 3BJIC 4KV9A 5LBIA 4B31A 2ZAMA 2AC4A 3Q40A 2DETA 2VEDA 1NI4B 4JLNA 2JFVA 3TGLA 1AK2A 2AFIA 4Y9DA 1VLLA 1IEWA 5EGNA 2PS0A 3OBBA 2CDNA 1Z4LA 5J5VA 2VDNB 1Z0ZA 2WU3A 4USLA 4XJSA 2V03A 1T2UA 3JYOA 1COWA 5CUQA 4DWVA 1NR1A 1JKFA 3FW1A 3GP5A 1UR5A 3CWQA 4UDNA 1M5TA 1N34B 1TKBA 1UZMA 3CVVA 3K3PA 2MR5A 5CNJA 4YAUA 1DEKA 1YR7A 3TOSA 3T54A 4EVQA 3OOEA 1ZMZA 4OZDA 2ZN9A 3OFSA 5HKYA 4ZHQB 1B8CA 1VB5A 1GUZA 3HKCA 4LGMA 1PE0A 2LHLA 1UJ6A 4YP7A 2CJFA 4NCNA 1O5OA 1KA9H 4MKIA 3C3YA 4E1AA 5ANRB 2PZLA 3EPPA 4LSGA 3GK4X 3IEXA 1I0LA 4ERXA 4WNAB 3L8YA 2Q9BA 1DQSA 4CQLA 3U7FB 1S5GY 1KZGB 4AZ3B 1IB6A 4X92A 3V1TC 2QN7A 2B1UA 4WUVA 3AXSA 3IE1A 1RHKA 4MYDA 2MR6A 3QVLA 1WB9A 2AOTA 1MO6A 4WTOA 5CVCA 4NLLA 1XBTA 1NMEA 3MD9A 2SCUB 4BN4A 4BVHA 3RKSA 4LGYA 3S40A 2OBLA 3DVRX 4PWYA 7REQB 1GA4A 3HGQA 1Y6FA 1F7VA 3THXB 3L8FA 4AIRA 3B51X 2OMKA 4AVYA 1AZTA 2C7PA 3PEEA 1YD7A 3OI7A 2WIBA 3DDCA 4Y7DA 1E6MA 5HVNA 4A7PA 4LTMA 2C2MA 2CLKB 4NU0A 4XKJA 4EZIA 1RK9A 1G6Q1 2E4WA 3GCZA 1XZDA 4FP9A 5BT9A 1U2TA 5KSWB 3RRFA 3U39A 1M67A 4DLBA 5JH7F 2QVGA 1VL0A 4JEUA 1SZPA 4N82A 3ZXUB 3NV7A 1X3LA 4LF4B 4FSDA 3THRA 3LZ6A 4B3MB 4DBVO 4EA6A 3D64A 2CJYA 4PY2A 4CIVA 5EL0A 5FWYB 2QVLA 5F2NA 1PV4A 3W1WA 1KJZA 2XMRA 3GEGA 1VFPA 1CBUA 4BEJA 2XIJA 4CV3A 4XGQA 3TZCA 3NAZA 3I2YX 5FL7A 1DRUA 3BHMA 2BAGA 1YVPA 4D9HA 5BT8A 4RMGA 1AO3A 3HP1A 2EW1A 4X20B 4BLPA 2E87A 3IB3A 5ALKA 3TJRA 2DFKB 1T2FA 5JROA 1NUUA 2G3YA 3AL3A 2HBZA 1Z5VA 1ENYA 4KRYA 3AZOA 2J6BA 1QJCA 2AQKA 3RRJA 1FRNA 5C1IA 3VJKA 4XIJA 4PHKA 1HTTA 4E1BA 4FZVA 1VXRA 2JFXA 3WGQA 5F2OA 2BFFA 4IVQA 4PBTA 3WKAA 3UB2A 1JILA 4BKOA 4L02A 1V6AA 2RGNA 2BKXA 3FWNA 4JX9A 5CFLA 1XZAA 4DR3B 4RABA 5BMVF 1Z2NX 2QYHA 1Y48E 3KYCA 4BQEA 3MAJA 3FPFA 1G55A 1OILA 4CGZA 1E6WA 3H4VA 4PXAA 4BLQA 5G3YA 4BQNA 1U3FA 1FRFS 3WYNA 2TN4A 1E1CA 5TQ0B 4EEXA 2ZSFA 3NDJA 3BL5A 4C6HA 3H2BA 2LUXA 2COLB 4R2IA 2HPAA 3JTDB 4G8BA 3IIJA 2VK2A 1AGPA 2UZ1A 1OSNA 1DTWB 1YA6A 3IQOA 3UJCA 3GROA 3FNFA 5AVVA 3MJEA 1RKUA 1G9XA 1HE4A 3KHTA 5CA1A 3IVXA 2W71A 3OC0A 1DIOB 4QDXA 2A67A 5C31A 4LOAA 1OOHA 3O7MA 3WZLA 2DQZA 2K2AA 4UAVA 3HY6A 1MAUA 1XK4A 5I9BA 5FF9A 4UVEA 1R37A 2X0KA 4J1QA 2R5FA 1S6YA 5IH7A 1CERA 3FIAA 3SEZA 2XDQA 2QRMA 2BUBA 1Z0KA 2BMFA 5HF9A 3RYHB 5ICMA 1UH5A 3T95A 1NVVQ 3KELA 3NDPA 3P2IA 3TOCA 2B4TO 1MBZA 1QIHA 1K9PA 3BFKA 1YZUA 4MR8B 3WWZA 2GNAA 3S2YA 4WZAE 4ZYWA 4AKGA 4JT9A 1G5PA 1QLJA 1HT1E 1HYEA 2AD5A 2V4ZA 1NRXA 4XQGA 5F78A 1SWVA 5EHIA 1ZAKA 5CCEA 3BGVA 2ZXEA 3KDSE 4XUGB 1EP1B 4PICA 4BQPA 1YUUA 1WMSA 4G81A 2PALA 2R85A 5C18A 4G0NA 3ZDDA 3OEWA 3GLIB 1SUAA 4WXPA 3PT5A 4MQBA 4AUNA 4X6YA 3BORA 1CZLA 4UAGA 4ZAXA 3NT5A 2C04A 1FPWA 2CYCA 4ZO7A 5C8XA 2EARA 2QP4A 1EM8A 2FUEA 2SECE 4WMLA 3EY4A 4EK9A 1KSMA 2ZRTA 2RAUA 3S6JA 3RAJA 4BZPA 13PKA 5CFQA 4QYXA 4BN5A 3UM9A 2EFJA 1N9GA 1BYUA 2C29D 2IEAA 1FP7A 2WCJA 2R97A 1JR3A 4ARVA 1F4PA 4PXYA 3JQFA 4WRRA 3ETDA 3UA3A 2JFFA 2F64A 1TK2A 4FZ3A 4MUKA 1EB9A 1UJBA 1VJ0A 1CY6A 5I9MA 4HTFB 4KX5A 3FCUB 3GHYA 4YYZA 3JQCA 3L8GA 4PM4A 2VBFA 1YVHA 1U11A 1SL7A 3IBSA 3AVTA 2ZRHA 1U0BB 4TOIA 5T6BA 1C7WA 4Z5XA 4IJ5A 3JQEA 4CCYA 5CT6A 4ZEOA 2QX7A 1EAYA 3TUYC 1T6BY 3TL2A 1XN4A 821PA 3V3KA 3EJWA 4MLZA 3O3MB 4MDFA 5LJLA 3AKAA 4PYJA 1KWGA 2X4IA 1MF8B 1PDOA 1VJTA 2AFIE 2YXLA 4MDHA 2PZ8A 2BH9A 3E1SA 2JA1A 2ZB7A 2OAP1 3IB6A 2VP9A 2J5BA 4DR4B 1TUJA 1NXSA 2HD4A 3FWPA 4PU0A 4K0KB 2XNHA 1Q7EA 4N41A 5CD1A 2EOAA 6ABPA 1JI0A 4DR7B 4IFBA 3U4GA 3PUKA 4RTLA 2GNOA 4A92A 4N0MA 4RJJA 4FQTA 1U0TA 3C5WP 4ARZB 5CLIA 3ADCA 2L5XB 4W5WA 2ODQA 1K92A 4QT4A 3I8SA 2C2OA 4EG3A 2MJWB 2H11A 5J40A 3TE6A 5TGTA 4YP0A 5H80A 4YXWA 3R7NA 1JHMA 3SZ3A 2QP9X 1BCSA 5BRJA 3ZDQA 4XIYA 4GM4A 1YFKA 3ZTYA 5CNIA 1S2GA 4D97A 3RYCB 2D4AA 2YIDA 4R4JA 4BEWA 3RU2A 4YRLA 2XMPA 2QTAA 1ZACA 3RSCA 4P80A 4UM9B 2XMCA 4YUAA 1L5HA 1UM8A 5CFZA 5LOVF 2C2GA 4YGYA 1CUDA 4MUNA 3H11B 1TUBB 3TZLA 5I7RA 2GZAA 4F8EA 3ROZA 1L4GA 5FI2A 1HF3A 1U0FA 3QPUA 1XMSA 4OXYA 3K35A 1JQBA 4TGLA 4BJ3A 3T52A 4ZKDA 4PLTA 2W4QA 4XEUA 4AMVA 3HY3A 5DRYA 1B23P 2OLJA 3NCTA 2R6GA 4C7MA 1DUVG 1YE3A 5HLOA 4ENVA 1BQ4A 3BK7A 3TS5C 1MHPA 1AURA 4QXMA 4LCBA 3HCBA 4AZ0B 1UDXA 1IHDA 4JU8A 4F93B 2CT9A 1YZ3A 3PC6A 3UC9A 4CI0B 2RG7A 4IAOA 4CXMA 1LNZA 2X1MA 2EX1A 2O5GA 3IKVA 4FR0A 5SV2A 3N86A 2ZSHA 1RI5A 3ZWAA 1WD5A 4EY8A 2JIRA 5LQNA 2JC3A 4K9MA 2WMNB 5JOQA 2QPTA 4C88A 2BF4A 3IJEB 1C7ZA 3UXHA 2Y1LA 2ZCVA 5AVWA 3TSWA 2AFRA 4KIFA 1E20A 3RVOA 3WL6A 2CF6A 3UUWA 1RC1A 2EZ8A 2D8AA 1B7TY 1TZ2A 3VAZA 2R6AA 2VDRB 2YL2A 1NJ1A 3DO6A 4GAEA 2FX5A 1JEEA 1E6UA 5T8KA 4BNUA 2VDPB 1UMCA 5BW5A 3D02A 4DQDA 5P21A 1GEEA 1IEVA 4OVNF 3A9VA 2JPTA 3NWOA 1XYVA 1SUIA 4LW8A 2BTQB 1XIVA 1Y9EA 1X8XA 4N0PA 3IFSA 2AD1A 4COOA 3VBCA 2B4YA 3KKQA 3I30X 1OVGA 5DBOA 1R3UA 1KTIA 1M46A 1I1OA 1KERA 2OTGC 5E0KB 1ZFNA 1EVKA 1TQDA 2VUHB 1ZO8A 2HIHA 2FKNA 4MVJF 5BR7A 3HABA 3WLPA 1XA3A 4KVAA 1NM5A 3EPHA 1QCZA 4QUHA 4FT2A 3FHOA 5K4GA 3GBPA 4ZMSA 1V7QA 4GQBA 4Y2HA 3W78A 3FOFC 2NAPA 2DUNA 2MYUA 3GF4A 2P70A 4HOYA 3LY9A 5I48A 4DDMA 1I2CA 4YGEB 1WV0A 1CIVA 3J7AC 1VP9A 3OQPA 5DHTA 2XIQA 1PJTA 5TS3A 4LBWA 1JHQA 3PJFA 5DU2A 1U2GA 5BN3A 3AEKB 4QPCA 1NVEA 5D00A 3M6IA 5T57A 4MK4A 4I46A 4NFYA 4BNVA 1JJVA 4QUAA 2ZRAA 3DDHA 3CH4B 1RU3A 4FFDA 1PBNA 2UZAA 4MVJP 2PD4A 3RH0A 2JRLA 3R0IA 4RUKA 5IKMA 1H2RS 3LT1A 4RVDA 3DBIA 3WNXB 3TZKA 2V54A 3H17A 4X1YA 1NMZA 1W0JD 2X2EA 3OMXA 4PAWA 2WPDD 4DM4A 1WG8A 3JCZA 1VSVA 5JALA 4B87A 4QFCA 1N5OX 5B8IB 2LMVA 3OM0A 4B7UA 2VYVA 1ZBDA 1AS2A 4I5GA 2J6HA 3DHNA 1G21B 4I6GA 2RGIA 1V7ZA 2XWPA 4LF5B 2H0AA 3SDBA 2V6MA 1DKOA 3HBFA 4JELA 1Z5OA 1H4VB 4QO8A 2VH2A 2O2DA 2E21A 2V58A 1BO6A 3B1YA 4ARBA 3GT7A 4LJ8A 4IDCA 2XV1A 2R1VB 1PTJC 5I4IA 1H85A 2WLTA 2R9VA 3P2OA 6Q21A 2Q1YA 4J75A 3EA4A 4QDJA 4KQHA 3ITNA 5I4KA 1SVIA 1PI3A 4K6OA 3NOVA 3QPBA 3IPXA 1E18A 4KVFA 2J0SA 4Y2VA 3KU1A 2XJ9A 3CH5A 3OESA 2QLJA 2A92A 2A4MA 5E3JA 3JTMA 1U2QA 3O9MA 3ZJYA 3C3JA 4MIYA 3L47A 5JS1A 2FMKA 3D1JA 3N5KA 1RACA 5AJXA 5H8WA 5IMSA 4LY3A 5SZHB 5AW0A 3DE0X 4LPSA 4KE6A 1Q80A 1J21A 3DOJA 1GY8A 1SYMA 3PEWA 1NQ5A 2O1WA 5ENDA 5K99A 4ZRNA 1FXWF 3B89A 1HQCA 2F48A 3KPYA 1Y1QA 4NMHA 4PN3A 2UYCA 1UWKA 3EVNA 4BQQA 3GB9A 3ROKA 2XDAA 1OB2A 3L79A 3JZFA 5TY0A 5FIUA 3Q11A 1XJ5A 1LGYA 4LE1A 3ICEA 4ORAB 1H8EA 5GJWC 1Z3CA 2RGRA 5FV7A 5HG0A 2QLBA 4IP0A 1L5ZA 2P9GA 5AWFC 4HLUA 4I3FA 4OY3A 2HCTA 4X54A 4RLHA 3ITDA 5FCDA 4AICA 3UK2A 1R8YA 4J0QA 4L0QA 1Q7BA 1THTA 2GJAA 3GFVA 4U0JA 3OTQA 3WRYA 3GDGA 1MA3A 4ZVNA 4OQNA 3OJWA 2RGWA 3R4CA 3AV3A 5KTKA 1AN9A 1UAGA 4OB6A 3HGMA 2H8VA 3N2KB 3PXAA 4PQRA 1NT4A 1KQNA 2IIQA 3I12A 3KUCA 1MXFA 2J31A 1LJ8A 4X97A 4YWJA 4A6DA 1E2PA 4KNWA 3ZY3A 4MKXA 1FVFA 4XWAA 1JZSA 1NG1A 3UWPA 1NUBA 2NO4A 1LDNA 1PJAA 4EUEA 3MQ2A 4HQOA 1TTQB 4BV2A 4UMEA 4RJ2A 1UC9A 2X2PA 2RC6A 2Z2ZA 1OLXA 2OCIA 4M8IA 1L4EA 4GQAA 3MWKA 4Y9RA 4KXUA 2RBEA 2DPMA 3TLGB 3BA6A 3TB6A 2R65A 4RVUA 4I50A 4QOHA 3HXMA 2IZ7A 3QF4B 3AHIA 2P6NA 1J42A 3UT6A 2NMVA</