4C0JA

Crystal structure of drosophila miro ef hand and cgtpase domains in the apo state (apo-miros)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
404
structure length
404
Chain Sequence
b'ELTSACKKSLVRIFKICDIDGDNLLNDYELNLFQRRCFNTPLQPQILDEVKAVIQKNVPDGIYNDAVTLKGFLFLHCLFIQRGRNETTWAVLRRFGYNDQLEMCQEYLRPPLKIPPGSSTELSHRGQQFLIAVFERYDRDGDGALSPEEHKMLFSTCPAAPWSYSTDIRKSCPINETTGWVTLHGWLCRWTLMTLIDVVKTMEYLAYLGFNVHENDSQLAAIHVTRERRIDLAKRQSSRSVYKCHVIGPKGSGKTGMCRGFLVEDMHKLIGKEFKTNVVNCINSVQVYGQEKHLILRDIDVRHALDPLQPQEVNCDVACLVYDSSNPRSFEYVARIYIKYYAESKIPVMIVGTKCDMDERRQDYLMQPSEFCDKYKLLPPHLFSLKTNKKELYTKLATMAAFPH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL RHO GTPASE
publication title Structural Coupling of the EF Hand and C-Terminal Gtpase Domains in the Mitochondrial Protein Miro.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase
total genus 116
structure length 404
sequence length 404
ec nomenclature ec 3.6.5.-:
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
A PF08355 EF_assoc_1 EF hand associated
A PF08356 EF_assoc_2 EF hand associated
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0jA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0jA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4c0jA03
3VU9A 3QPVA 1GGZA 2JAQA 1L4UA 1QVIY 2KQ6A 2J9RA 2JLXA 3WRXC 2AK2A 4M1TA 2ECKA 5G41A 5FPTA 1U5IA 3VHXA 4MZJA 4NP6A 5FI1B 4KXFB 3BGWA 2ZRGA 1ALWA 1K94A 1KK7Y 2EVWX 2G77B 3UK6A 1UJ2A 3RABA 4BZQA 2YYZA 3NHAA 2BCGY 1A5TA 3QJYA 3OB2B 1W47A 3BFKA 1R4AA 5FL7A 3PLFB 2XAUA 1XD2B 4NHOA 4B6FA 1E32A 2P6RA 2O8DA 4U7DA 1KFUS 1KAOA 4I4LA 3BUWB 4TYQA 4FMBB 3AF2A 2G0TA 4OK5A 1GL6A 5F2EA 3TSZA 1BMFD 1N3BA 1OH6A 3PN7B 1E2GA 1LFDB 1P2VA 2ZRJA 4DVGA 3K70C 3QG1A 4V02A 3VROA 4JT2A 2QY9A 3OX5A 5C2JB 1DGUA 1P2UA 1R8QA 1YZUA 2AWOA 1XF9A 2RAPA 4PHHA 4ACBA 4PC3A 3GMTA 1G3IA 1K90D 4JJKA 1LVCD 2O5VA 5AWFC 4RD2A 1E2JA 4AG6A 2CLSA 1SXJD 4OHWA 3K0CA 1YQTA 4DLRA 4KBFA 4US2R 2D7DA 3KQKA 4GPLB 3TAUA 1NP6A 3BFXA 4QJ5B 2GXSA 2QL6A 4HUQB 4BLSA 4FQOA 4EPTA 3GLIA 4O2LA 3RS5A 3FHOA 3PATA 2C5LA 3FPAA 4QHTA 1P60A 2W0SA 4E22A 1BOFA 3OESA 2F1HA 2P6UA 4V03A 5LB2A 1CMGA 3H0KA 3CR4X 4NCIA 2GAOA 1ODFA 3B78A 5AJWA 1DARA 4PPGA 1DGVA 1P72A 1HE8B 4PPQA 4BFWA 2WKPA 5KUTA 3V4RA 1S5GZ 3I1FA 2QRZA 3RAPR 3KB2A 1TU3A 4DB2A 1Z6XA 4WVFA 1DADA 2RCNA 3U2QA 2WTUA 2PMYA 1X8LA 2M0RA 2BKIB 3LXRA 2AKAB 1KIMA 2VYFA 4L15A 4LYHA 3W6PA 3WRYC 4DSTA 621PA 2ZSFA 5J4HA 1OE9B 1T8UA 1MQ1A 2IUTA 1MO5A 3B1XA 3EASA 1ESMA 2WSMA 4OK3A 2PLFA 5EXXA 2DPXA 5AANA 4IFBA 1KI2A 3KKMA 4OBEA 1EX7A 4Q1AA 821PA 3TDIA 2PZGA 1N5JA 4QNMA 1PV4A 2I18A 4CFQA 1G291 4QOSA 4R98A 2OFWA 3LDAA 2K7OA 1XZQA 4K8OA 4FN5A 1UURA 4HDCA 1Y1XA 1G64A 2CCKA 2N46A 2WORA 1RVDA 2FCDA 3MSEB 1FP6A 1SVMA 4TL9A 2GVZC 4R7ZA 2ZYTX 1PUIA 1FBVA 2CE2X 4WAUA 4MKIA 5EE0A 1GUAA 2YWEA 3ONWA 3QPUA 2BHRA 3PR1A 2VIIA 2OAQ1 2FA9A 4TQUS 4DC9A 2CBZA 4IEIA 4ZDKA 4XSGA 2HXSA 2JLRA 4QJ4B 2CCJA 2V1UA 4JLVA 2PMKA 2FFHA 1RRGA 5DO9A 4BLQA 4C3ZA 4X8MA 3CR5X 3QF4B 1IAQA 1G7SA 5EE3A 3D3QA 5IDVA 1G6OA 2I7AA 5J4KA 2QN6A 1KO8A 1UM8A 2ERXA 3PJRA 1JI0A 1TNQA 5FBWB 4PQFA 2GXUA 4MQBA 4D4LA 5DN6D 2Z6VA 1AQYA 1N5IA 1ZACA 4F4IA 2MRDA 1IXZA 4UNNA 2ZI3A 1KGDA 2ZU6A 3K0EA 4ZDWA 5L8VA 1CF4A 1PUJA 1RRPA 1UKVY 1WDTA 1P9RA 2OAP1 2GF0A 2QAGA 1Q57A 5DYIA 2FGKA 2JA1A 2OZEA 4M1SA 3WP0A 2A4JA 3CRQA 1HV8A 2OO7A 2P6NA 2GRJA 1NNEA 1E2IA 2WZQA 2ZRPA 3OEHA 2XTMA 3LLEA 1VMAA 1TF2A 4WOPA 5CB6A 2IYUA 3SQWA 1DS6A 2BC9A 4DLSA 1PVAA 1YKSA 1Z22A 3LLUA 3NSLA 1GP2A 2J46A 2CXJA 2VSOA 3ECCA 5FUWA 1Y1AA 4GDFA 1UBEA 1T4GA 3K21A 3T1QA 2ZFDA 2WBLC 1IKUA 1TPZA 3CX8A 4IEEA 2HXYA 4HATA 5HYDA 1TF5A 4LYFA 3GOFA 1KZ7B 4YGAA 1QHNA 3VX3A 4EJSB 2FOLA 1NSHA 2ODWA 3PQCA 1U9IA 3NHBA 1YX7A 1KSGA 3ZQJA 1RC8A 1ALVA 3ZNIA 4PHJA 3GJ5A 3J81k 3O4YA 1VDZA 2DCUA 1RWYA 2DFTA 1IN8A 2WV9A 1E98A 3LW7A 4Q02A 3VKGA 2B21A 2B1UA 2MLEC 5DKRA 1LINA 2XEXA 1BF5A 2WIBA 5AUPB 2WWYA 2OSBA 2J0QA 1KDRA 2CBLA 1S8FA 4KBGA 3KQHA 2PCJA 4O25A 2WNDA 1Y1UA 3EIQA 2JPTA 5DKQA 4JSYA 1YVLA 1N0YA 1NLYA 1YU9A 2W2XA 3I8XA 2WPDD 2HT6A 4PE4A 3LH5A 4CEJA 1BG1A 3KPXA 2GJAA 4FMCF 4IKEA 1KI7A 2YC4C 4QC2A 2Y1MA 2YJTD 4O3MA 2OCYC 1KMQA 1U98A 1FFHA 2IHBA 1N6LA 2Q4UA 1Q44A 1XZPA 3AV0B 4IXNA 5F98A 1YE8A 1BU3A 4Q9JA 4XVUA 5JHHB 3EA0A 4C4PA 1D2EA 1ZW6A 1IOZA 2QGNA 2ZUCA 3IHLA 3IQXA 1EFRA 3EZ6A 3THYA 1IXSB 1BODA 4JVNA 2J1LA 4BFYA 3H4MA 1UADA 5UKDA 3AVQA 4LHYA 5J47A 1U0LA 2O8BB 3NSIA 1DF0A 2M7LA 4HSEA 1GOTA 2OG2A 5KDDA 2NG1A 5HR5A 5JS8A 1SBJA 1G33A 1GIAA 3RS7A 5KNBA 1UDXA 1DJWA 4PO9A 3LAWA 4A15A 5SZKB 3HWSA 1F5NA 5AUOB 1YX8A 5IT5A 2J0UB 1COWD 1P4SA 4L4UA 3CZQA 4PZLA 3NBZC 4DJTA 2QBYB 4BY5A 221PA 3KTAA 1J70A 5CIQA 2GV5A 3FMIA 4AOMA 4IFEA 4B48A 2O8EB 2JIZA 3QEJA 5DH9A 1G7TA 4B44A 4KI0A 4RVCA 4E07A 1DTSA 4TLBA 1LKJA 1KO7A 1R7RA 2L4IA 1G17A 1IONA 1CULC 3EVVA 5G3ZA 3IO5A 1G18A 4B3CA 1SL8A 4AYWA 1GRRA 1R0ZA 1YRAA 1II0A 4MYCA 2AD5A 3CLNA 3FFBA 5DISB 5FI0B 4BQSA 2PEYA 2C03A 1Z8FA 2ZYVX 2VP0A 2P0EA 2JRFA 4Q00A 2MMCA 1NIWA 3E70C 1CTQA 2WPDA 3PG5A 1G5PA 2CMKA 2BBSA 4JL5A 3F8TA 1CR0A 2NO9A 3VKHA 3K0AA 1CDMA 2JT3A 3K9LA 4D80A 2ISDA 1SK6D 4RZ2A 5I8NA 3VR5A 2BVNA 3EK7A 3KXKA 4L9SA 2ZRBA 3WMGA 4DHEA 1KJYA 4LZZA 3CF2A 1QTXA 3V4FA 5AJZA 2H1LA 1KK2A 1R5OA 2YWHA 4LBVA 2GJSA 1VYVA 1S26D 4MGZR 3S1AB 3LBHA 4E03A 2QMOA 1TX4B 4QGGA 1R5NA 4HLCA 4B3BA 1XK4A 4TLAA 2JLSA 3AF1A 2NZ0A 3CKLA 3HU2A 2RHDA 4LJ6A 4ARZB 2RHMA 2JOJA 1KI1A 1W4BA 2IBMA 4M2LA 2OCBA 1QVIZ 1N6OA 2HLDD 3A37A 2GK7A 4DDTA 4JZKA 4OJQA 1NX3A 1CKKA 1SMGA 4GFDA 1C7VA 2ZVQX 5CB8A 3VRRA 2ZE6A 3CNOA 3MJRA 1QVRA 4MKHA 2AUCA 2LMVA 2QQ0A 1OXSC 1Z0FA 1G8PA 3ETLA 5HPYB 2BCXA 1B7TY 1E8AA 2PLRA 2CXXA 4DDWA 1J2JA 4RKFA 5BXQC 4OCIA 3VFDA 3LK0A 1Z29A 2REBA 3DZ8A 2NPFA 2O8CA 4YI9A 1E0SA 2VLIA 2NZ8A 5FPYA 4OI2A 1UHKA 1M2OB 4YMSA 2M7NA 3K70D 3DO6A 2ZTSA 1JUOA 4JL8A 1RROA 4GI7A 2BL0B 1IN4A 1HA3A 5DKNA 4LBZA 5LD2C 2ZI6A 1SHZA 4PO8A 2G9BA 3UWKA 3FWCA 4ETOA 1CB1A 4TQ9A 3QRXA 1G4AE 2GJKA 1YR5A 3AP3A 2CJWB 3AF4A 4L9WA 3SHWA 2F9LA 3R9WA 2IXEA 2WMNB 1U90A 3FB4A 1VCNA 1WLZA 3GK2A 3DF0B 1TADA 4C0JA 1SGWA 1GGWA 1YVDA 3PEYA 2ZRDA 5BQ5A 4IHQA 1SKYB 3D10A 3HPQA 4C0SA 5KNCA 4XH9B 2A2ZA 4UQOA 1NN5A 3CO5A 3FKQA 2R44A 3RDPA 1GL7A 1V43A 2ORVA 4PHTA 5J4YA 2OXRA 2WHXA 2JJ8A 1CIPA 2VHQA 3CNLA 2KHNA 1OXUA 2Q3HA 1P3JA 4B34A 1JFKA 1Z3IX 1XO5A 2ZQ5A 4Q9LA 2HLDA 4OVNF 4MRXA 2I94A 1JBKA 1II8B 1G9XA 4OHVA 3AP1A 2V1XA 4XJKA 2DY1A 2OLJA 4Q19A 3FDIA 3K0CC 1PSBA 1N2DA 2X19A 1KMHA 2NMVA 4E09A 3SYKA 5HKZA 3JVTB 2NOAA 4USLA 2KI4C 1DJXA 4J0QA 1GM5A 1ZNZA 2B7BA 3QXJA 3GFTA 5LBIA 2G9NA 2LVJA 2ZJZA 1CXZA 1OZSA 1D2MA 4US1R 1ZUZA 1X86B 4PX9A 2BDTA 1S1EA 4YGCB 1CJVC 2VPPA 4RFVA 5DLQC 1OHHD 3O8BA 2J41A 3CH5A 4GP6A 2L0XA 2O0KA 4QBGB 1IY1A 4MSPA 1T3LA 4LK2A 1E2MA 1QHHA 4EQ6B 5D3MA 4FINA 4O0MA 1WB9A 1S6CA 2IX3A 2IUSA 4RCZA 1CFCA 5SZJA 1ZC4A 4PFSA 1YZLA 5JI3E 3SG4A 1GQMA 1W7JB 5JHGB 5GJWC 4PTLA 5IK2D 3KL4A 2GHIA 2EQBA 4OI1A 4DEXA 1ZRHA 3LX8A 3E2IA 4RJLA 2DWOA 4PE1A 1JQJC 2BKUA 1KI6A 3HU3A 2NLNA 2LLSA 1P75A 1TQ6A 2ZRAA 4UPGA 2YWGA 4GOJA 1NY5A 4V0ME 3SR0A 5C4MA 2WWIA 3KZ1E 1WF3A 1ZIOA 3DDCA 1Z0IA 1KI4A 1N6HA 2QM8A 1ZD9A 4C0AC 2ANCA 4C7OA 1W7IB 3SJCA 3C16C 3GLHA 4DLXA 3REFA 1IJEA 2M49B 4LHVA 1R2UA 2GZDA 3SYLA 3OHMA 4MEWA 2D3WA 3CRW1 3VR3A 4U5XA 4MRYA 5P21A 1R8SA 3CGAA 1X1RA 3OIUA 1A82A 2QMUA 3B7GA 3ND9A 3BUNB 5CYOA 3M1IA 2Q6TA 4IVQA 2K2AA 1W0KD 4OK6A 2ZAMA 2LAPA 3UWOA 4II7A 1E69A 4LHXA 4YMVA 2WWHA 3EK4A 5CDFE 1AZTA 4Q9HA 3VAAA 1F71A 5D69A 1FPMA 1OHHA 1S5GY 3DZDA 5HZHA 1NVVQ 2ZANA 4AG5A 3C5CA 1H8BA 3U7EB 4HUTA 1XMIA 3CF0A 3DVEA 3AAJA 1GDDA 2QAGC 2SHKA 4TTQA 2ZRTA 3OZXA 4LJ9A 5KSYA 3EPJA 1RJ9B 1QV0A 5JI2E 3SG6A 1YZTA 1NF3A 4IDHA 4JWQA 1D2NA 4RD1A 1G8HA 3MWKA 2J5XA 4URYR 3VR2A 3ADBA 2MSEB 2BM1A 1Z28A 4LX0A 5JJGA 4E5UA 1B47A 3QKSB 3QKUA 1FL9A 3RS4A 2HPSA 3W90A 2G2BA 1G4UR 1N5KA 1GKIA 2VSXA 3SE0A 4G0NA 2FMXA 1E9RA 1A2KC 3C41J 1E9DA 1KJWA 2JLVA 4DIRA 1KNQA 3AKYA 4W7SA 2JT0A 1U9IC 2FG5A 2ZEJA 4HDQB 4PCWA 2GGZA 2GCNA 5F6TA 2REOA 2ZR7A 4KSBA 4DCUA 3TAHA 4DKXA 5E3HA 4GFTA 4WXPA 5CSFA 4K81B 4BFVA 1G20E 4QG7A 1KCYA 3FYHA 1JR3E 4ORBB 2M9GA 3I73A 4N1GA 4MGYR 1GTVA 3X1YA 4ZCIA 3RHFA 4PQRA 2KYCA 1UHNA 4IL1A 4BFXA 3SJZA 4GGNA 4YONB 5IF9A 1KO5A 4PHFA 3BH0A 4MYUA 4TYYA 1Z6AA 4NZYA 1E0KA 1X8JA 2P65A 2QUZA 3W5IA 1OMRA 3C4JA 3RS3A 1YVHA 1Z0DA 4JT4A 1SKYE 1D1OA 1JXMA 3UIEA 1EK0A 1L2OC 3DMDA 1EGAA 2QNRA 4IXMA 2COLB 4D6PA 1NX0A 3L0PA 5JEDA 4RFSA 3ZZ0A 4OI0A 4Q4HB 2LE9B 5AUQA 1KO1A 3L8YA 4PHNA 1P9WA 3U7HB 4JVLA 1OFIA 5FOUA 4EKDA 2AX4A 3I72A 1NLFA 2BEJA 4N1AA 4B3DA 5HKKD 4FXPA 1S6IA 1E96A 3BB3A 5CK4A 4YXWD 2JDIA 4Q66C 2WWFA 1CRPA 5C4GB 1E3MA 1IY2A 1ZM4A 2JTTA 1W36B 3FKSA 3A58B 2FZ4A 4NDDA 2GTPA 1QX5B 1KK0A 3CRVA 3O2PA 2NTYC 4TYNA 4ZCLA 5TY0A 1H8HA 2Q3MA 4ICBA 2L0PA 2BJVA 5D3QA 1IGVA 2OUKA 4KFSA 2G1JA 2IYZA 5CYPA 1XTIA 3C1VA 1FNNA 2NGRA 4BZPA 1IJ5A 2Z43A 4PC6A 1S3PA 5TNCA 4FCTA 3REGA 2FCEA 2D74A 3GEIA 1BYUA 4UNQA 5G40A 3B82A 2Q91A 4QJ3B 3W5JA 4LC0A 2Z4RA 3ICQB 4P33A 2ZIAA 3IIJA 4QBHA 1DELA 1XFVO 2RH5A 3GFOA 1O3YA 3T1TA 2X77A 1KI9A 3KFXA 1KAGA 2FOTA 2FSFA 1PJRA 1BS1A 4GGFA 2PH1A 4L16A 5DNYB 3HJNA 3PENA 3TJZA 1P6XA 2DYKA 4PHMA 4KU4A 1OXTA 4D25A 2QP9X 2G3YA 1AJEA 2R62A 2V54A 4TMVA 1TRFA 4MVFA 2ZI9A 4Q4AA 1XFAA 3OAAD 2IS4A 1SYMA 1JBAA 3LQQA 1A75A 4EFMA 2VP6A 3NKVA 4EPRA 2F43B 3WNCA 4ITRC 1B7TZ 5M04A 3BXKA 1M46A 2RB4A 1K6MA 3SFZA 3BUXB 3I5GC 3SG5A 1UBCA 4LJ7A 2IYYA 3VRPA 2YC2C 3BB1A 3KX2A 1K8RA 3RSOA 3M0EA 1XK4C 3VX4A 3MG9A 5IHPA 3N2IA 1KFXS 1HE1C 1B1GA 3RC3A 4KLZA 3WHUB 3SS8A 3C15C 3KQLA 5IBWA 4LSGA 1IN6A 3I5HC 4TTRA 5ER4X 3MFYA 3LCPC 5CSJA 1CM4A 2VTKA 2ZUBA 3SBDA 1FQKA 3T5GA 2QM7A 1AGRA 2QROA 2AK3A 2JLZA 2GXAA 4FI3C 2R6GA 1DEKA 3KXIA 4TMWA 1NCZA 1K2HA 2PT5A 3GEHA 4UNSA 1EFTA 5BN3A 1OH5A 5GJBA 3KKNA 2F1JA 3VR6A 2QEQA 3ZVLA 2FWRA 2R2AA 3FOZA 5HLOA 4DCNA 3ZZUA 3P27A 4QGFA 1CJTC 1SVSA 2KBFA 5H68A 1CJMA 1QHIA 2ZSAA 3B13B 2BMEA 2WJGA 3QEOA 4DB4A 1OB2A 2EHBA 1EJ3A 2KI6C 2KAYA 2PRUA 4WQ3A 1G16A 2RGGA 3Q7QA 2UZIR 3Q8XB 3EXAA 4RY2A 521PA 1TU4A 1KWOB 2GXQA 5EQTA 2GGMA 4CF7A 3K53A 2YINC 1N6NA 1QLSA 1ZVQA 1LW7A 5JEEA 4Z51A 3PIRA 4TYWA 2ZKMX 2OCPA 3WXAA 1XTKA 4JSTA 5I2LA 5PALA 1KO4A 2HCJB 2ZRIA 2KAVA 5FOTA 4B32A 2CNWD 3CRMA 5H8WA 3I62A 2LWIA 2XB4A 1U8ZA 1MABA 1FX0A 4JKIA 2WKRA 1YTZC 3B85A 3DOFA 4LRWA 3B6EA 1A4RA 2ZSDA 2W6JA 2GZHA 1XFYO 2NO6A 3SZRA 3FIAA 3GJ3A 1AUIB 3MUFA 4ERNA 4OQFA 1WRBA 2M3WA 1ZC3A 3WNXB 2Z5FA 2JXLA 1WY9A 1KKMA 5JRZA 1KK8B 2MBXA 3SU8A 2DBYA 4G01B 4M4SA 3EIEA 3U60B 2KSQA 4DCKA 1BT6A 4QJ5A 1ZNWA 3U7GA 1FW6A 3KUCA 4HUQA 4KVGA 4PE7A 1LS6A 2IK8A 2VRGA 2P3SA 4I1OA 3W3ZB 3K0SA 1X6VA 3SG3A 1ZMZA 1HQCA 1N6KA 1WMSA 3O8RA 2WCBA 1NMZA 3L0OA 3NH6A 2NIPA 5CLQA 2A5GA 4LJAA 2RMKA 2HQ8A 1OV4A 2Z0MA 4UXJA 5A4JA 4OR9B 3BUOB 1NRJB 1E1RD 1P5ZB 1Q20A 3WBKA 2B8WA 4QKQA 3IF7A 4AKHA 1T5IA 2ZI5A 2EC6B 1JJVA 3AH8A 4A0FA 3TNFA 1O87A 1G7RA 2ZJ8A 3CF6R 1B0UA 4Y0AA 3T35A 1SCMB 1S1MA 3RS0A 2ANBA 4M21A 4EAQA 2V53A 1SY9A 3B9PA 1ZUHA 1CEEA 5TARA 1XWIA 3OF5A 4XD7D 3FVQA 1NJFA 2KWIA 4X8HA 4ZIRB 3CRRA 4EIWA 3E5HA 4AKIA 1AK8A 1D9XA 2IF2A 3HX4A 4TL7A 3ZH9B 4JLNA 1KQMB 2IYWA 4BWYA 2QAJA 5DI3B 2CNWA 1LA0A 1JC2A 2PZEA 5AEQA 2F33A 2RGIA 1E9FA 2PCLA 1K9UA 4C0KA 4GZMA 1HYQA 1Q0UA 3F5FA 4LC1A 2IS2A 2IWRA 5BN5A 1RZ3A 1WDCC 1RRFA 4QHSA 3TGPA 3EPKA 3AVPA 2QA5A 5BYKA 3KF9A 1DAHA 1H4BA 4QJ4A 1M7GA 4CFRA 3Q9LA 4YBHB 2ASEA 3BWDD 4G5RA 4QGAA 3VU9B 3ZVRA 3I5IB 4BPBA 4JBXA 1B23P 3FWBA 1N6PA 1GKYA 2WJYA 5L3VA 2KBMA 1U5IB 3SDZA 3PUYA 3SJAA 1WA5A 5KSOA 2OS8B 4YGBB 3OEHD 1W2HA 1IJ6A 1XP8A 3IEUA 5ER5A 1VG9B 2OTGC 2GEDA 4H9GA 2ZRMA 1Q1EA 2O60A 2ZI4A 5KHOC 5GJVC 2FF7A 3TMKA 1TCFA 2J87A 3UANA 3CLVA 4AY2A 1CDPA 2MMGA 2CCMA 4NYIQ 4BRWA 3ADDA 4QM6A 4DUGD 4QRHA 1E1RA 4PPNA 2O8DB 4CIDA 2I1VB 1E2PA 2H17A 2HUPA 3WYGA 1IN7A 1LV7A 3LY5A 2QRNA 4KFTA 3TBKA 2R6DA 3AM1A 2MLFC 3UMFA 5D7FA 3TUYB 1IY0A 4N0EA 5FTLA 1L8QA 4TN1A 5CJPA 3L82B 2OM2A 2WOSA 2H18A 1JJ7A 4XD7A 1M34E 1DE0A 4JL6A 4ABYA 1E9EA 4QGHA 3K0FA 1UDWA 4AYTA 1E2FA 4I1SA 3D0YA 1GKUB 5HCIA 3A1SA 2ZRNA 1FTSA 2C8VA 4M1KA 6Q21A 1Z06A 2M1UA 1OXXK 1T0JB 2BMDA 3CH4B 1SW8A 1NCXA 3BUMB 2F3RA 1SVKA 1XJCA 5AJXA 2JCSA 5AK0A 4AYXA 1HURA 2HDNB 3WNDA 4C9BA 3GLIB 2MAZA 1Q12A 1MKYA 3QQ5A 1DT7B 1N0VC 1H8ED 2AXNA 3IHWA 4NPHA 1D5CA 1X8KA 4WZAE 4DRZA 4Q48A 3K9HA 1G8GA 2LUCA 2UVQA 1P2TA 2Q3FA 1ZCAA 2YHSA 1YUUA 1EFRD 5TXGA 1E0AA 4OL0A 1JECA 2ZRFA 4F91B 1IWQA 1DVRA 3X2SA 4KITB 4JBWA 2GVDC 4X8OA 5TVKA 5KDOA 1CDNA 2C9OA 3LQRA 3ZD6A 1J55A 1FOEB 2F1IA 4M2OA 2WJHA 4HAWA 2KYFA 4DRWA 1WRKA 1CJUC 3RLZA 1XJQA 2ZR0A 5FBLB 3SJSA 1F70A 4Z8XA 2DFKB 4UNRA 5L3QA 4DUGA 1R0XA 1DAMA 4G5QA 4GZLA 5KO2A 5FPKA 5GQQC 3DEFA 2KOTA 4QBIA 2JIZD 4XVQA 1E2QA 1EL4A 3TRFA 3ZYCA 5HE8A 4R2IA 4NYMR 2AFHE 2I1QA 4F0ZB 3B1YA 3UPUA 3U4QA 2ZE7A 3WHLA 4RD0A 1SR6B 2BCBA 3MCAA 2LVIA 3B1WA 2LANA 3BORA 4LPSA 4I1VA 2J0UA 3FE2A 2P6BB 2ZI7A 4Q4JA 4ZO4A 4XWOA 2GAAA 4YGDB 2REXB 2Q9BA 1BYIA 4Q47A 5JSZA 1GFIA 4A0GA 1M39A 1CR1A 2ZYUX 2ZM5A 3WY9A 1HT2E 1SXJB 2VO1A 5LDDC 1BO6A 1DAKA 4LJ4A 3B1ZA 5FFMA 1DAEA 4Q1FA 2JJ2A 1GITA 4M1YA 4ZCVA 4ZI3A 1H8EA 2KQYA 4RKEA 1UEIA 1PVOA 4V0MA 2FJUA 3BBPA 4PAMA 1TN4A 4A8JC 4NH0A 3NXSA 3PUZA 1G8FA 1MO4A 2BV3A 1H65A 1G7CA 2WAYA 2ZNDA 1GILA 1OFUX 2DWQA 3G5UA 5EP1A 3T1OA 4AIIA 5FH9A 2D2EA 2VSFA 1KJZA 1XEXA 3OP0A 2ERYA 3GCGA 2ZPTX 4CGZA 3ZS9A 2WOOA 4GGFC 1XA5A 1RK9A 1S36A 1Z0JA 1OJLA 3H86A 2QPOA 421PA 2ONKA 4OYHA 2JNFA 1NIPA 1W4RA 1G1MA 4JBYA 4O2RA 2D8NA 3JTDB 1CR2A 3C8UA 1KSHA 3NIBA 1BIFA 5EP4A 4M22A 2D06A 1E94E 3DPUA 3ZD7A 1AQUA 3LX5A 4TLCA 3NBFA 2Y4QA 1F2UB 3EX7C 3NC0C 2EFEB 2MSCB 1L7VC 1F54A 4BRUA 2M97A 1YR7A 3AUXA 2CDNA 2P67A 3LA6A 4LJ5A 1TUIA 4A6PA 5FTNA 5BN4A 1KZGB 2TMKA 1N5LA 4D2IA 2ZS9A 4P2YB 1XXHA 3BXZA 5JLJA 4AURA 4LJYA 4QL3A 1F2TA 2VHCA 4UJ5A 4Q1DA 3WMFA 2KI6D 3FWYA 3EKJA 1EG3A 2H57A 2OFOA 4A0HA 1R0WA 3MRSA 4HEJA 1ZINA 1XNJA 4P3YA 2QPTA 1E2LA 2G0NA 4CPVA 4ZKEA 5TB5A 2QACA 1ZP6A 3P32A 3CZPA 2QE7A 4B76A 1Z5ZA 2RGNC 4IJMA 2HQWA 3RWOA 5CITA 4S2EA 4FCVA 4M8NE 2OLKA 4GNKB 1YRUB 2J7PA 2P5SA 1GAJA 2IXGA 1M8PA 3TS5B 3PVSA 1OXVA 1Q1QA 3AVYA 3I5FB 2FSGA 4NCNA 4HAZA 4ESHA 2EFCB 2WWGA 1CDLA 2NZJA 5FTMA 3V9PA 2J0SA 1E6CA 5E4FA 2K7CA 4JQ0D 2R65A 2BE4A 4FD2A 2F1RA 4LV6A 3THYB 4MYTA 1JR3A 4IRUB 1SHKA 3LL8B 1SPYA 2ORIA 4MH0R 4M1MA 5GVSA 4Q01A 2NPIA 2CJWA 1LS1A 3E1SA 1LF0A 1QASA 1LTQA 1QHGA 3TQFA 5KNDA 3CTNA 1NY6A 2ZRSA 3DF0A 1E79A 1P7CA 1XU4A 3LBNA 1Z08A 3QXSA 4LJ8A 4A2QA 2L98A 3P26A 4BLTA 5H1YA 3RWMB 3GLIE 1CLBA 3IDQA 1GG2A 1P2SA 3QNUA 4TLDA 3PM8A 3TDZA 4AK9A 1SVIA 1YR9A 4HAVA 3PN7C 5FPHA 1VG0B 2WOJA 1NVVR 5KSPA 3I5YA 4KJZA 3THWA 2YNMA 2LKDA 3BAFA 1RYHA 2AD1A 2Y5IA 2NO1A 2ZS8A 4LHWA 1II8A 1NVXQ 4CT5A 1BH2A 2NCPA 1NVUQ 4NYMQ 2XGJA 4UXIA 1S9HA 5KU1A 1ESNA 1U2RA 4ACAA 4Q21A 2W6IA 1X3SA 1NBMD 1EXMA 4F93B 3DVJA 2GBLA 2R6AA 4TT3D 3W6NA 2PASA 3BOSA 1JFJA 1TTXA 2HETA 3ASZA 2O52A 3CX6A 3R9IA 4C2UA 4D0GA 1IQPA 2FU5C 2LCFA 3KUDA 2I3BA 4EQ6A 1PSRA 2ZROA 1YR8A 3PEVA 1N6IA 2JLYA 4AQIA 3O8DA 4TL6A 1U8AA 3AGPA 4TSFD 2JJ1D 1NLZA 2XB2A 4YLGA 1HTWA 4XVRA 3TZ1A 3TQCA 4V0KA 3B5JA 3GJ8A 4JYBA 5B30A 1HT9A 1VECA 4DSNA 4BFSA 1SXJE 5DGXA 4JKYA 1KSMA 4MA4A 1A2XA 1XEWX 3DL0A 3RRMA 2ZSEA 3U44A 2X2FA 4AKGA 1SCVA 4BFUA 3W8NA 3K8YA 1XFZO 5BWMA 4B2PA 3H2YA 4V0OA 3BFVA 1Z63A 5KPJA 4DDUA 3VNUA 4QHYA 2VHJA 4F7WA 5LPNA 1DJIA 2WWXA 1RRCA 3AQ4A 4LWZA 5EXPA 2OXCA 3UMSA 3BC1A 1NWDA 2OCAA 3VQTA 1K9PA 1W49A 1S96A 3TIFA 1AS0A 4G5OA 4H1UA 1UPTA 3EVUA 1W48A 4DWJA 1S3GA 1K95A 2A7QA 5B57C 4W5JA 2O8CB 1OMDA 5I2QA 1P62B 2Y8EA 2ZJ2A 3DM9B 3TE6A 2B92A 3EC2A 1BLQA 2DFLA 1ZUIA 2YZ2A 3KEVA 4HRGA 3EPLA 1E1QD 2DFNA 2BOVA 4MRNA 3TH5A 3U3KA 3VR1A 4K46A 4R2HA 2X1VA 1NBMA 1DAGA 3QIAA 4Q7KA 2EU8A 4QFMA 1KOFA 4HZUA 4TT3A 4HLUA 3Q5EA 3GLGB 4EFLA 3EC1A 4P5OE 4BLOA 3QPWA 1Q21A 3G0HA 1FUUA 2BE6A 1MXEA 3LFUA 2ZXUA 2HEIA 2MJWB 3NBXX 3SI7A 1W0JD 5EE5B 4DT1A 2Q9CA 1QHSA 3A4UB 1AP4A 1K5GA 4HAXA 3LRPA 1QG2A 1NUBA 2WJVA 4UXHA 1KSFX 1OIXA 3BH6A 2HV8A 3GLFB 2KFGA 2FZLA 5CM9C 1CM1A 2CT9A 1EG7A 1NSTA 1C07A 2EW1A 4LGMA 4PANA 5EE1A 5G53C 3T06B 1G21E 1QHYA 2R6CA 5KSZA 1N2CE 3T61A 2K2FA 4TSFA 2JJ1A 1ZU5A 2YKGA 2O5GA 2BKEA 1Z47A 4JVSB 4JYCA 1ZM7A 3SC3A 5JJIA 3KFVA 2NCOA 1II9A 1NN0A 2ZRLA 1Z6TA 2CLDX 2QP3A 3LW8A 3QSYA 2XOKD 1WQ1R 2FN4A 3QKSA 3FMPB 2IHYA 1T8TA 3GEEA 4KFUA 4OHZA 2BBTA 2F3ZA 3WHKA 2LMUA 4Q7JB 1E0JA 2FV8A 5LB4A 4A0RA 2AWNA 4XJKB 3BIFA 4B2LA 2R9VA 4WRIA 1SKQA 2KJQA 4D4MA 1PLLA 4GPTA 5JCZA 3HYTA 4PE0A 3PV0A 1MRSA 1CMFA 1CBUA 2HJVA 4A82A 1HH4A 2ZVPX 1IBRA 1VRKA 3IPYA 3X1DA 3WP1B 1KDPA 4EUNA 5I2OA 3ADCA 5GADl 2A5FA 4OKSA 1QIVA 3SIAA 2A3RA 4GAOA 4I5JA 1ANKA 4B6EA 4WW0A 1MR8A 3DVMA 4FW9A 5K8LA 5A0FA 2FSIA 5C18A 1T3SA 4LOAA 1ETUA 4Q1CA 4B74A 3ZVMA 4KCGA 2OEPA 4NL4H 1E1QA 4P4SA 3K70B 2MHHA 2B8TA 3OFND 3T12A 4XJXA 2HF9A 1QHHB 4FWTA 1IQ3A 2JDID 3QF7A 4WZ6A 2PX0A 2ZSBA 3CUEF 1VHLA 4G5SA 1NKSA 2C95A 1DOAA 1Z0AA 2WSSA 3FKSD 2RGXA 2RKOA 1VCMA 3HR8A 4M9QA 4WQ2A 3A36A 3AVUA 4TTPA 5FUXA 1A4PA 3OEEA 1QLKA 1G6HA 1W0JA 4LYAA 1J90A 1H8HD 3PCRB 4C30A 3PEWA 4Q4HA 4F4CA 4LYJA 2NO7A 121PA 1W2GA 1A2BA 1WRZA 2L5XB 2ODNA 3OE7A 4PQYA 5AR1A 2VH5R 3VTKA 4URXR 1OYYA 2BIFA 4MKFA 1AJ5A 1XX6A 4U02A 2GCOA 2W00A 2XNSA 5KOYA 1KYIA 2CTNA 3TDUA 4D1EA 3SOPA 4NBSA 1CFPA 1E4VA 5CSIA 4M1OA 2XSZA 721PA 2V4ZA 1U0HC 2QGZA 2KBIA 1TNPA 1WLMA 2E6WA 1RYFA 2N42A 4MITA 1AGPA 3MWLA 2XOKA 1F4OA 2ZRHA 3FMOB 5AJVB 4JLAA 5L3SB 4C7OB 4A4DA 4I5LB 1IH0A 3AKEA 1OIVA 2H7VA 4BLRA 3BRWD 2B6HA 3OHMB 3JZMA 1RJVA 3D7MA 3K1JA 3EA5A 1XMVA 3P1JA 1EFCA 1LY1A 4L5BA 5AXIA 3O8CA 4YC7A 4NU0A 3U61B 4QJ3A 3AGQA 2H2KA 2ONJA 5SZIA 1OMVA 4FWIB 3DD4A 3UG6A 1RFJA 1NI3A 4ZI2A 1KFXL 1CFFA 1QDEA 4TL8A 2BBWA 2OE2A 3LLMA 1MRNA 1W5SA 1MT0A 5K8UA 4AD8A 2CK3D 4XWAA 2KDHA 4YI8A 4OI4A 1M1YE 3OFNA 4URZR 4YRUA 2VL7A 1QJTA 3KKOA 4IOKA 4OJKA 1SL7A 4M9SA 4A4BA 2M8UA 4F4JA 4GMDA 5HTKA 1IG5A 3FS7A 1NP8A 3ZIAA 3DKPA 4ESVA 3CR8A 3IKJA 1TEXA 1M63B 2BBMA 3CS1A 3KKQA 2F43A 1C7WA 5IRCD 4DSOA 3TUZC 2XXAB 3OIWA 4GL2A 1ZM9A 2WCEA 4TMTA 1J7OA 4YDSA 4IDQA 3AVOA 1XJ0A 2XJ4A 1V1GA 2V6IA 3ZS8A 2SASA 3GJ7A 3MAAC 5DYGA 3AKAA 1TNXA 4A8JA 2QP4A 2R2IA 2R8RA 3PITA 1UKYA 3DHWC 4RZXA 2FFQA 2W58A 1G4YR 1I4LD 2C04A 1ZOTB 2ATVA 1C1YA 1GNPA 4HDOB 4PZZA 3ZDQA 3A4NA 1XPOA 3T34A 3GLGE 3EVRA 2EYQA 3THXB 2OBNA 2IT1A 2D62A 3NSOA 4N3NA 2LNKA 3KO0A 3C14C 2UKDA 2VRWA 5HKWA 2IYXA 3WBJA 1E2DA 4GBMA 1AS2A 3QUSA 1ZM3A 3KDSE 4LUCA 1UBGA 3GLFE 1PVBA 2C9CA 1NYAA 3EW9A 3I4LA 3SBEA 1OF1A 3C5HA 3UXMA 1T5LA 4FTGA 3JZAA 4RZUA 1E2EA 1QBKC 1XFXO 1YJ5A 4W9MC 4HB3A 2W6JD 4G3XA 4IVPA 3AUYA 1MUXA 1T9HA 4KV9A 4XIGS 2LCPA 4A36A 4RFSB 2BL0C 5JMTA 2IS1A 1FMJA 3ASYA 4PXAA 4Q18A 1MOZA 1QVAA 2CK3A 4N0DA 4B73A 1SL9A 4I81A 5DIFA 1F60A 1W5TA 3BOWB 1CP2A 4YMTA 2PJZA 1F6BA 4YGEB 3QE0A 4LY6A 4BFZA 4CDGA 2FEMA 2GJ8A 1LVGA 2O8FB 2EGDA 1RECA 2J7KA 1MHOA 4MGIR 2BEKA 4A6XA 5A5GA 3QXCA 1KFUL 1PULA 2C78A 3DVKA 5GVRA 3GJ4A 4A2PA 3GK4X 1Z2AA 2D4HA 2RGNA 4NYIR 2IL1A 1UHHA 3HYRA 4OQNA 4WA7A 3CX7A 4YDHB 1J8MF 3TSOA 1ODBA 1KDOA 1M74A 1WRLA 3MGCA 4R9UC 1F3OA 4BASA 1RFLA 1OPXA 2IXFA 2IYQA 5K8TA 4CEIA 3HPRA 3AF0A 4FMCB 4KODA 1HUQA 1T91A 1S1CA 1US8B 2L51A 1G3MA 1XPRA 1NN3A 5HLVA 3MMPA 4WIAA 3OX6A 2K7BA 3R8CA 3EIHA 5B64A 3VRQA 1M6NA 3O47A 4W5WA 2LP3A 4PSVA 5ANRB 3GPLA 1NKTA 2Y1NA 4NE2A 4R71A 2QENA 3R8FA 4EPWA 4DEYA 1DJGA 1QATA 1NSFA 3Q3JB 3CB4A 2F55A 1QRAA 2FPLA 2QTHA 4PC7A 1G3QA 5JCPA 5JS7A 4ZV4A 4P4UA 4A2WA 3JVTC 1XBTA 3W6OA 5K8IA 1XD2A 3SQXA 1PRWA 5G08A 2GBLC 3CWQA 4C0BA 4FMDF 4NONA 5J4LA 2C98A 3BH7A 4HLQB 1U81A 2LLTA 1R6PA 1XTQA 3AVVA 1SRAA 4D82A 4TMXA 5EP2A 1R6BX 1S0UA 2AR7A 3QKRB 2HF8A 3VR4A 1WP9A 4M9XA 3GJXC 3U3JA 3BB4A 2PVBA 1A75B 1E9BA 1Z2CA 3CR7A 4B47A 4MGKR 1A03A 2M29A 1ZBDA 3NSKA 2PL3A 3A4LA 3CWZA 1UF9A 4GSYA 4V0LA 4ZIRA 1YRBA 4MKGA 1OB5A 2GNOA 4BGDA 1TNWA 3RRYA 4L9MA 2YWFA 3QENA 4M2PA 4ZDIA 3WHTB 2ODBA 2Q9AA 3R7WB 3JVUA 2CHQA 5BYJA 1M7BA 2KFHA 2RGBA 3JVVA 2PALA 4HRHA 3OB1B 1IN5A 4B43A 1SKTA 2CVHA 2W2TA 2WAXA 1YRTB 2J0VA 4M2QA 1EXRA 2HYDA 1W1WA 3TW4A 2H61A 4XOIA 3W8RA 1RPZA 2AXPA 2P5TB 2GILA 4CEHB 2LVVA 1DG3A 1JR6A 1JEDA 2LUXA 4RSGA 1WCV1 1GJYA 2BMJA 2FX3A 1DBSA 3IEVA 4QNRA 3THOA 1PALA 4ORAB 5F9FA 3CW2A 3NVAA 4PHKA 1Q1BA 3VKWA 5L3RA 2N1BA 3ZJYA 1M45A 3VRNA 1AZSC 3A4MA 4GUKA 4MRSA 3BQ3A 4KSCA 2ZN9A 1F48A 2PZFA 3I3SR 1DJYA 3UMRA 2GZAA 1MR3F 4N5XA 1UKZA 2WC8A 5FOSA 3RRZA 4NDBA 2H16A 2XX3A 2YOGA 4LV5B 1WE2A 2A5JA 2FNAA 1XD8A 2EWVA 4GOKA 4HZIA 1OQPA 3M0WA 3EZ7A 2DWPA 3KJIA 1Z6YA 1J8YF 2FGJA 3NDPA 4HLUC 4DZZA 4U8DA 5K89A 1CKEA 4A92A 3MJHA 3PXGA 4YQFA 4MRPA 1JPNA 4Y0VA 3N70A 2JT8A 3NDBB 4KAXA 1XMJA 1KY3A 2PMDA 2FPKA 1MABB 1FX0B 4Q1EA 4B3XA 3IQQA 2PX3A 1ZYUA 3D6TB 1I4DD 4Q5IA 4KLNA 4OQLA 4KHZA 4HB0A 3KQNA 4MN0A 1U99A 2VA8A 5FBVB 4GRAA 4P31A 1QV1A 1AVSA 1KQVA 4DLZA 5DHAA 3QF4A 1NG9A 1OSNA 1DJHA 2LVKA 5SZHB 4MBEA 2K7DA 1ZCBA 4RD4A 5LD2B 2XZPA 3AVXA 3H4SE 3Q5DA 1SNLA 3ZZTA 1OKKD 1UKEA 1S9DA 2H5EA 3A8RA 4JLKA 1NMYA 1U94A 2FEOA 1OYWA 5E7IA 1IM2A 2RGDA 4B71A 1UUSA 2P2LA 3BJIC 3NEJA 4C2TA 3H84A 1YZGA 1TEVA 2GESA 5FR1A 5FOVA 1XTJA 4I99A 1G8IA 2K0JA 1IJFA 2VP5A 4PHGA 4XYNA 5JBQA 2A9KA 3VGOA 3EARA 2GK6A 2WKQA 3K9NA 4QBFA 1D9ZA 1QX2A 1Q22A 2VQSA 1FI6A 1K93D 5B8IB 4MYHA 1MWNA 3IQOA 3MWYW 2GJ9A 4ILEA 1V5WA 1OLOA 4AKEA 1N65A 1G8YA 4Q7LA 2FE4A 4C0HA 3QXXA 1BR4B 4R1EA 3VHLB 3TR5A 1JB1A 3O6BA 1OFTA 2HJGA 1KSOA 2KNEA 3G82C 3M6AA 1C9KA 4GOXA 1D8TA 3U7FB 1JF0A 2CL7X 2WM9B 3LVQE 2KI4B 1NVWQ 4DLUA 2BCJQ 2LHIA 2LLUA 1BMFA 2JJ2D 2Q21A 2YVUA 1BMOA 3LBIA 2QMEA 3NWJA 1JPJA 2ZS7A 3U6KA 3B8HA 4B33A 3KQUA 1IRJA 2C77A 2CEAA 4RCYA 2CL0X 3SHFA 4OQMA 1TQ2A 3BERA 4U00A 5AERA 1W36C 2HT1A 2CLCX 1R2QA 1QHXA 1SXJA 5J5CA 1PLKA 3MWJA 1XEFA 2KB0A 5CJ2A 4A1FA 3U5ZB 1HY3A 1SVOA 3GQBA 5DI9A 4BEJA 1Z0KA 5KPDA 1OKKA 4JLOA 1K9KA 1P73A 3LNCA 4UNPA 1TL7C 5KTYA 3TSWA 5C46F 2E87A 4KYIB 2VHTA 1FQJA 1WXQA 4KFRA 4UKDA 2F9MA 1RE0A 1ONBA 3I61A 1XDBA 1J1EA 1F4QA 3AAKA 2O8BA 2QZ4A 1XRJA 4TZ0A 1XYDA 2TN4A 1TF7A 3GD7A 4AQJA 2C96A 3KKPA 3I92A 5EXTA 4D0NA 4GP7A 2JATA 2ZRKA 1J1DA 4BLPA 4Q9IA 1AHRA 2LC5A 1PK0D 1W4CA 4URVR 1DO0A 2M1KB 3QY0A 3CPHA 3LD9A 5FTKA 5HE9A 1MXLC 4Z8YA 2QBYA 1F2UA 4CYMA 4XSHA 3MLEA 3K0FB 4Q1BA 1EWRA 4I5NB 2JLQA 3D0YB 3R20A 4AC9A 4MRRA 2QE7D 1I2MA 1T0HB 2O8EA 3EZ9A 5TV2A 2LP2A 1HEIA 2GEVA 3ZQ6A 4TQAA 3EAQA 5JWOA 2D7CA 3TW8B 1W44A 1TCOB 3SYNA 1AS3A 2J7PD 1OOJA 3PFIA 3WXMA 2K8MB 3PALA 4P32A 4EFNA 3PEUA 1AIPA 1FMLA 3LK1A 3WYAA 4LBWA 5GJCA 3KJHA 3GK1A 2QMHA 4PAOA 4ON9A 2KAXA 1UHJA 4AWXA 3L43A 2HF5A 1DO2A 1YURA 3EWAA 1JAHA 3EZ2A 4PSKA 5AFPA 2OHFA 2GCPA 4P0TA 1AA9A 3QKTA 4W5HA 1JR3D 2ZNEA 3B2EA 5EE9A 4BEBA 5E7JA 1ZJ6A 5EUMA 2W83A 4DLYA 2QAGB 3MSXA 1MF8B 2BWJA 4GNKA 5TMPA 4ZPXA 2ZN8A 2GEUA 1TAGA 1BJFA 1E79D 4PAQA 5FR2A 5DN6A 2H92A 3T1VA 1S6JA 1UP5A 1NL3A 1R10A 3S1AA 2QPAA 5CDFA 4M0LA 3B1VA 4M9ZA 5L3QB 4LI0A 2A5YB 4CW7A 1J7RA 3AB3A 5BW8A 5EZ5A 3IILA 2A78A 4ARZA 4I5KA 1Z83A 2XTNA 4PPFA 1KWOC 1TQ4A 4PZYA 3SJBA 2EFGA 3U4QB 3B60A 3TK1A 4XWKA 2YOFA 4LDJA 1AM4D 3AKCA 2IEYA 3DKVA 4M1WA 4Q4JB 5FL3A 2W6ID 3A1VA 1EFUA 4TMKA 1FP7A 2BCAA 1RW4A 2EWWA 2FPMA 5JSZB 1YZQA 2OILA 1BR1B 2J3EA 4IDPA 2YOHA 1GSIA 1GZSA 3K9GA 2DR3A 4CEJB 3A8TA 4RD6A 2ZR9A 4WXRA 1IXRC 4JLBA 2H8KA 3ICBA 2ATXA 3K09C 2V7QD 3TUJC 1L2OB 4B2IA 3RYTC 1KK8C 4URUR 2ZETA 3A1WA 1JEEA 1EG4A 2FJUB 4F38A 3IBGA 3RS2A 1FUKA 1U8YA 1CLMA 5CSNA 4XTRA 4D26A 3UKDA 2JWWA 2DB3A 1ZNYA 1XMSA 1Q3TA 3HP1A 1BKDR 1XEXB 1VHTA 1XTRA 3DMNA 1DF0B 3SG2A 1KDTA 1TMKA 1TQDA 3KJGA 5FTJA 3T5DA 4B75A 2CL6X 4CVNA 4DIEA 5J4VA 1WBBA 1E2NA 5CM8B 2SCPA 1B8LA 1S3SA 4HSZA 2WMOB 2ZUDA 3AEZA 2WWWA 2ZJAA 3HU1A 2F2OA 2IA5A 3KJEA 5B2ZA 3RVBA 1LXFC 1TTTA 2JEOA 4NYJR 1G5TA 1YZNA 3SFVA 2EC6C 3RNLA 2MSDB 1ZM2A 2PT7A 2VP9A 3KTAB 3CBQA 4PC1A 4N1FA 1SCMC 5JOLA 3EPHA 1CRQA 2ZAOA 1KK3A 2XTZA 1E2HA 3IIKA 2JULA 2WJJA 4OHXA 5C1BA 1EESA 2D2FA 4NQGA 3SIBA 2XITA 4FCWA 2FDCA 3VMFA 3CWGA 1XXHB 2QT1A 2K61A 1CLUA 2GKSA 3PFVA 3DVLA 3IBYA 2F8PA 4TMZA 4LBYA 1F2TB 5FBRB 3QVVA 1KQMC 2EFHB 4US0R 3L8ZA 1COWA 1G3RA 1T6NA 1YUTA 4TYPA 4B3FX 5B58C 5JZVA 4HYYA 1KK7Z 1XCGB 1QZXA 1ZAKA 3SEAA 2IEZA 2CCGA 4MUBA 1MO3A 4ORCB 1MH1A 2H61C 2CE7A 1KI3A 2C2HA 1S2MA 1SZPA 3NG1A 5FBQB 5F9HA 1R5BA 3I32A 2DOQA 1AKEA 2J59A 4HLDA 3K0AB 1TNDA 4IVRA 2ZJYA 3ND8A 4C0LA 3EK8A 4EPYA 4RZ3A 2G6BA 3LO5A 4POAA 4CLNA 3RC8A 3F45A 2V7QA 3DOEA 3PUXA 2G83A 3CPEA 1OH8A 3VNVA 1AJ4A 1CTRA 1JF2A 2V55B 4DCVA 2XNDD 3I5IC 1N0UA 1ZD1A 1YUSA 4C0QC 3FMFA 2NQ2C 4ZDJA 2ZITA 2KI5A 2E30A 3I5GB 1Y0VH 4PALA 3CNNA 3FGNA 4KO8A 2C9YA 1LA3A 3AKBA 1XB2A 2OS8C 4MUAA 4NDZA 3LWNA 1EFHA 1GRQA 1A29A 3KB1A 3GLGA 2F3TA 2OBLA 2QG6A 2QTVB 4RD3A 3W9YA 1G41A 1VYTA 3IO3A 4V0NA 4JJZA 3X1WA 1T3HA 1FZQA 4IDNA 4AI6A 2UZ3A 3NTUA 1R0YA 5CLLA 3EZFA 2F7SA 1FF1A 4TNCA 3IGFA 3SN6A 3TVDA 1PZNA 3I5HB 4A4CA 3GLFA 4EJSA 1E4YA 3U3OA 2B7CA 1J7QA 1ZUNB 1NN1A 4MZKA 1YZKA 3V00A 1VYUA 4NKRA 1Q1ZA 3TUYC 2CHGA 3NEYA 3PUWA 1CU1A 3PSRA 2V8OA 3P20A 2KFFA 2I4IA 2IYLD 5CPVA 4HB2A 3WMEA 1G5RA 1KTVA 3THWB 1Z07A 1E2KA 4IDOA 4BZXA 1QXPA 4JPZB 1E9SA 1MO6A 2LKCA 1E99A 3LXXA 2K5UA 2OPOA 5FOWA 3ZLJA 1XFUO 1JAIA 4DDVA 2FSHA 1B8RA 4NCJA 1CJKC 4I1UA 3BS4A 3FFAA 3Q85A 3AVWA 2WSSD 3W3AA 1XEWY 1QS7A 1KI8A 1YHNA 3AP2A 3OEED 1QF9A 4FMDB 4BY4A 2LMTA 3KHEA 3QG5A 3D8BA 3QXHA 3ICEA 3RRNA 1N0WA 2GWHA 2QI9C 3FHTA 1UBFA 3HDTA 1NCYA 3OE7D 4MDFA 1Q80A 3W34A 4NDCA 2OV2A 2XNDA 2R6FA 1RKBA 1Y6WA 1L4YA 2E1RA 1DJZA 4LHZA 1UFQA 1RJ9A 4MDEA 3HR7A 1SVWA 1W36D 2CNPA 2C99A 2XSZD 1VTKA 3RSLA 4Z54A 3A1UA 2CVFA 3BK7A 3RM1A 2ZYWX 3FTQA 3A6PC 2GETA 1C4OA 2O0HA 4Q9KA 1UHIA 4F92B 1W46A 3F3YA 4HB4A 1NJGA 4YMWA 5HCNA 2JLUA 3NH9A 2F6RA 4HAUA 4PR0A 3U44B 2VEDA 5HKYA 2JGNA 5JJLA 2V6JA 3CM0A 4HI0E 2VHUA 4HAYA 1U0JA 4Q7MB 2VF7A 1KMHB 5EUQB 3U3MA 1CR4A 4JVMA 1VPLA 2IYSA 5G3YA 1TUEA 4JS0A 4A9AA 5KDLA 1LB1B 1SR6C 4Z1MD 4NYJQ 1F8HA 1RTP1 4OHYA 5BPJA 4BECA 1L2TA 1B4CA 4CZ2A 1YR6A 1FTNA 3IQWA 4JLMA 5KYKA 5L3SA 2BECA 3EWSA 4TWZA 4B35A 4DLVA 4D4JA 2QSZA 2BBNA 2JASA 2KGBC 3HCMA 4JMPA 3GFPA 1SXJC 5F3WB 3GP8A 5D3MB 4DBLC 2EFDB 5EZ6B 1BOCA 2EYUA 1JALA 4MRVA 4EDHA 8OHMA 5EXSA 2IUUA 3AF3A 4IOLA 5JECA 3ZIAD 1KK1A 2J45A 3B9QA 2V3CC 2RGCA 4HZUB 3RANA 3EKHA 1NPQA 5DSZA 2L4HA 5E95A 3P4XA 1GVNB 1D6JA 2AMIA 1UEJA 3L0SA 2Z83A 2W2VA 3O78A 4DT1B 1N6RA 4BFTA 2ZREA 2GF9A 1VCOA 1Q3HA 4PDZA 1EH2A 3AKDA 1KI6B 5E7MA 1XXHE 1Z6GA 5CIWA 1QIWA 1X02A 1WDCB 2IF0A 2VF8A 3C7KA 3Q7PA 1SULA 2W0MA 2L50A 4CRWB 1HQVA 2IYTA 2AAOA 1A1VA 1UWOA 4EPVA 2JLWA 1B9AA 3JTDC 2O0JA 3U6BA 1AN0A 3TVTA 3F0TA 1S4QA 2BMFA 4OV2A 1SQ5A 4PSAA 2IYRA 3GLHB 5IK2A 4WZBE 2ZRCA 2XXAA 4GBAA 3H1TA 2FFAA 3I8SA 1TIZA 5JWRA 2ZU0C 1IQ5A 2IWHA 4OKHA 4ZCUA 1WBDA 2PBRA 3T15A 4ASUD 1EX6A 4JLPA 4DIDA 2OTGB 2ORWA 1JNYA 2ODEA 1E9AA 5DE3A 2ZJ5A 3E3RA 5J3XA 1JXOA 1OE0A 4BE7B 2HYIC 1HT1E 1KKLA 4BUJA 4IOJA 4Z1MA 3GJ0A 1JWDA 3X1XA 1ZD8A 5JFGA 1KSJA 4ZKDA 1ZU4A 4TLEA 4GMXA 3WNBA 2QU8A 1DAIA 2NO0A 3THXA 1DG1G 3SG7A 1P9NA 4Q04A 1NIJA 1ZIPA 2QTFA 1JSAA 1G3UA 1VKJA 4JIMA 1K5DA 2BM0A 4URWR 2XZLA 1XVJA 2BJWA 4P4SB 4MZLA 3LVRE 3WYFA 1EWQA 3ADKA 2OT3B 5J40A 1DTLA 1W0KA 1XCMA 3TS5C 4H1VA 1PLJA 4HREE 1VG8A 3I5FC 2WJIA 5JRJA 1ZMXA 3TUIC 2KBEA 1XFWO 2F3YA 3CPJB 4NMMA 1J7PA 2ZJOA 5FPSA 3QVUA 5FUVA 3BOWA 1G19A 4Q03A 2RGAA 2IS9A 2JZIA 2VP4A 2FH5B 2O8FA 2GCOB 4IOMA 4NCHA 3UG7A 3RLFA 3D31A 2XZOA 2XJ9A 4DLTA 2E9SA 1CLLA 3BYAA 3ZVNA 2QSYA 3NXAA 4G5GA 5ELXA 4DXAA 3TR0A 4WBSA 2L2EA 1GRNA 4X8LA 4DS7A 5FYXA 5AUNB 1KY2A 4KVAA 2V9PA 3QBTA 2NXQA 1OIWA 4GT1A 1CS4C 1IHUA 2AL7A 3NBYC 1US8A 4ASUA 4EPXA 2KE5A 1K8UA 4D81A 2CHVA 2AN9A 1I2DA 1J7KA 1M7HA 2JQ6A 1CNPA 1X1SA 1FW4A 2GA8A 4NCKA 3EG5A 2HCBA 1DPFA 1M31A 2IYVA 1UAAA 3ZWHA 3L0IB 4MLWA 1DAFA 1I4TD 4OQXA 3MD0A 3SNHA 2QQEA 2F2PA 4LCBA 2JTZA 3LV8A 4YMUA 1ZFSA 4FIDA 3R9XA 1OW3B 2IC5A 3BD9A 1W7AA 1ELOA 1FI5A 3PUVA 3TLXA 1XCPA 1N25A 2A5DA 2PEZA 1V1FA 3NC1C 4CT4B 3OIVA 1NX1A 4S35A 4PC2A 3ZGXA 3Q72A 4JLDA 1GNRA 2VP2A 3QKRA 4QXAA 2JXCA 1FNMA 4QM7A 2X8AA 2PSRA 2KSPA 1JQLB 2G88A 3KXLA 5FUYA 4DCSA 1NG1A 3I5XA 4M53A 5JJKA 2WCFA 2AKYA 1AKYA 1NMXA 4IW3B 1OT3A 3A1TA 1RIFA 3K09A 3N2EA 4DSUA 2ZE5A 3QBVA 3AVTA 1NX2A 2MA2A 3CONA 4ZCMA 2OFXA 5HKKA 3R7WA 2KGRA 2BKHB 1VCIA 4YXWA 1K96A 4A8JB 1W4AA 5FOXA 2WIAA 4Q4LA 5TDHA 5AJYA 2LM5A 1Y3AA 2OESA 2FFBA 3GJ6A 5EP3A 4JLJA 3IPXA 1VG1A 4D4KA 4CEHA 1NBME 4PO1A 1OFHA 1VIAA 5CK5A 1L7ZA 1Y63A 2ZE8A 2G1KA 2A30A 1GNQA 1GL9B 3TKLA 2PJRA 2AHOA 5HZKA 1DMOA 1AK2A 3CR2A 2GDJA 5FL7D 1ZNXA 1DVIA 1CFDA 2I2RE 2LV7A 2OBMA 1XPUA 2ZJBA 4L8GA 2JU0A 1A7JA 3QI2A 2LHLA 1LF5A 4XTCS 5DHFA 3OIYA 2IW3A 4UJ3A 4DUQA 1FPWA 4Q4AB 2JC2A 2Q0HA 1QG4A 3QOFA 2BBOA 1OSAA 1QX7A 5EJEA 4E68A 2RGEA 2IS6A 2QT0A 3N5CA 3P4YA 2AFIE 3L2OB 3FHCB 4G1UC 4D0LB 4LPKA 5H70A 3GLHE 5JWHA 1P61B 2DHRA 3CIOA 1VIYA 2QORA 4B3GA 3IIMA 5DI3A 4DCTA 3IUYA 1J99A 2VBCA 1E9CA 4NTZA 2WVJA 4LV8B 3OAAA 2Z4SA 3X1ZA 1XTSA 1GWNA 1MV5A 4EJSC 3DM5A 4KYUA 1B8CA 1SVLA 3CZTX 1HQYE 1LNZA 1XD9A 2WICA 2YV5A 1KHTA 3U3RA 2JNXA 1F55A 1KNXA 4P4TA 1OZOA 3BE4A 4DLWA 1OH7A 4CEIB 4TZ6A 3M4YA 3UATA 1TOPA 2X2EA
chains in the Genus database with same CATH superfamily
3EVEA 3EDQA 3GL9A 1OFVA 1VIVA 1CUJA 2WMDA 3DQPA 1E32A 4U7DA 2PH3A 4AX4A 1WY7A 1M8FA 1BMFD 4NV3A 1LFDB 3QG1A 1ZOPA 3OSUA 4X1KA 1P2UA 2RHOA 2XUQA 4LGYA 3KE8A 4AG6A 3EAGA 4Z9YA 3VYRB 3LZCA 1U0NA 2ZBQA 4X1OA 2ECPA 3FPAA 4F6RB 4EENA 5LB2A 2P6UA 3G7UA 2GAOA 4QFDA 1G0OA 1HE8B 3HJBA 1OASA 3M3DA 2ZWVA 3T0FA 1AMNA 2O20A 1OE9B 3AHCA 5JO9A 2QJRA 3VBEA 3AR9A 3GEBA 1E9VA 4XFDA 3ORFA 2YCLA 4ZYXA 4OM8A 4O1HA 1XROA 4QT4A 2WTMA 3RHTA 4X71A 3MSEB 1FBVA 1VIDA 2CE2X 1VBMA 1K68A 5EE0A 1E58A 4CM4A 3PR1A 1M8KA 2Y2VA 3K9WA 3OJXA 2CCJA 2PMKA 2FFHA 3CR5X 1LPAB 5ITWA 3CUYA 3IVAA 2ERXA 4HVCA 2EKZA 3ICOA 4F60A 3CCCA 3NHTA 4ZI7B 4M0MA 5I4CA 1QGZA 2IJGX 4LMRA 3RVPA 1XRPA 1F0YA 1VMAA 5CB6A 1DS6A 4JQSA 3H4VA 1FS6A 1YBFA 3AB7A 4G4JA 2WU3A 1YX7A 3O4YA 4CMEA 1GD1O 1G21A 2XUOA 1H6BA 2PUCA 3HM9A 2CBLA 4QYIB 3OE1A 4BAZA 4YQYA 5DKQA 4LZLA 3ICCA 2BFFB 4IKEA 4PQGA 5EJMA 1Q44A 2D5LA 4Q9JA 3EA0A 3T1HB 4RF3A 2O8BB 4DUYB 1T6BY 4KHPB 2BKVA 2ADFA 1Q2XA 2R86A 1SC1A 1HYBA 4DJTA 3WL3A 5K4GA 1DTSA 5D3ZA 5HF8A 3HB5X 3CEJA 5G3ZA 4IJQA 2EAUA 2YQ4A 2DC1A 4BQSA 2DUNA 1TCBA 4WZBA 4PZEA 1CR0A 2Y68A 1T29A 1SK6D 2BVNA 3CF2A 2QE6A 1UMBB 1GHTA 2Z9BA 5LZ9A 3RF7A 1TX4B 1RZRD 1E1KA 1I24A 3D8RA 3GIDA 2E49A 1KI1A 5LC1A 1R9NA 4AZ3A 2D54A 1NX3A 3WGUA 1Z4MA 4ED9A 4W8OA 3IALA 5F35A 3Q11A 1GUYA 3LK0A 1YMVA 1JBQA 2GPJA 2D8MA 4GI7A 5LD2C 1H3NA 2VJKA 2CJWB 1IXKA 3GK2A 1XJ5A 2Q2QA 5M29A 3SP1A 4RQUA 3QLJA 2OXRA 2ID9A 1OXUA 3LXMA 1JGTA 4B34A 2ZQ5A 1V48A 1JBKA 3AP1A 4LY3A 1ZHOA 1MDFA 1GM5A 4H3SA 2VPPA 4KWIA 1DIOB 3IMFA 1LC0A 2B4TO 2JFQA 4V38A 3ETEA 1PV2A 1FMTA 4RSHA 3K6JA 3PQ8A 5L3ZA 3WYBA 2VNHA 3CZ9A 1BMQA 1MAAA 2YWGA 2GMWA 2QQGA 3LGXA 1ZIOA 4M3NA 3FZEA 1X19A 4KMRA 3AEUB 3CNQS 2OD7A 5HEKA 2R2GA 3CGAA 4ZI5A 3H5OA 1E69A 5CDFE 1L5GB 5BW5A 3JASB 4G9EA 1I4EB 2WA2A 2IOYA 2QAGC 5AHWA 4YHHB 1ZW1A 3Q3HA 1Z28A 4EWLA 4E5UA 3O74A 2WU1A 4C7XA 4KIJA 3P2JA 3R3UA 4F7FA 5LYJB 1MAWA 2QXUA 4HDQB 3BHMA 2VPYA 5F6TA 1O96A 2TMYA 4NNOA 1ADBA 3DLAA 1XMXA 1GTVA 3AR3A 3LM8A 2KYCA 4R9RA 5TGZA 5IMBA 4HDKA 2GO1A 4TYYA 4AU1A 1Z6AA 1E0KA 4CGYA 2J6IA 1T43A 3RS8A 1YDWA 1TKRA 1EFDN 1XDGA 3L05A 3HJCA 1UMCB 2BEJA 5C4GB 1E3MA 3UT5A 2NTYC 1N7GA 1T5TA 5CHEA 3GPDG 3U16A 6PFKA 1S3PA 3JSAA 4ZZIA 3WIOA 3A4VA 2GHTA 2QRKA 4E5YA 3F1KA 4H3VA 2FSFA 1GSHA 1P6XA 3E9CA 5JNSA 4MVJI 3GC6A 3GRCA 1ULHA 1EFLA 2IS4A 3E7XA 5CR9A 1FS5A 2V96A 3U26A 1B7TZ 1NU8A 1QXSA 1BH6A 3IB6A 1XN1A 3GY0A 5SY6A 1O6CA 5IM5A 5KYWA 1IN6A 1JKXA 3OG9A 4JJGA 2XT0A 1JLSA 3GEHA 7MHTA 1T9GS 1GN9A 1ZQ1A 1VJ1A 1HTBA 3NBKA 1O9GA 3CEPB 3IT3A 3BXEA 1JLKA 3FFWA 2WU0A 2BZ0A 1TU4A 3UW3A 4JI3B 3PD7A 2NU8A 3QVKA 4X6LA 2IYAA 2WHPA 2G7ZA 3B6EA 1X77A 5AXCA 1LK7A 2ZIWB 1ZC3A 2TRSB 4FEAA 4QNNA 4P3OA 1B3BA 2XGOA 3EIEA 2KSQA 3W9SA 3KUCA 3O1JC 4EBBA 1D6NA 5EG5A 2JLAA 2CNNA 2WCBA 2QTBA 3NCTA 4LJAA 3FNRA 3GAZA 2ONZA 4NS4A 4QKQA 3OGNA 2ZJ8A 2BI7A 1ACMA 3FPEA 4I50B 5DNWA 5IBCA 4FFDA 1FRFS 1E9FA 2PCLA 4CMIB 4NBTA 4C4OA 4HQOA 3IAM6 3AEQA 4MYSA 4ZFNA 3Q9LA 2VTVA 5AVXA 4YBHB 3VO1A 3N2YA 2WJYA 1PQ4A 2I7VA 3FZNA 1U5IB 4I9FA 2O60A 2J87A 3O8NA 3G0DA 3OPYB 1RWWA 5CPFA 2ZIVB 1J9ZA 4RZSA 2CT8A 5D7FA 4TN1A 4NU6A 2Q4RA 4J91A 4IP0A 4GKJB 3DUFA 3CH4B 2I4RA 3U19A 5DFAA 1W9ZA 3SKVA 3SOZA 1X8KA 1FFDA 3QTTA 3EIWA 3W9UA 3K9HA 5E1MA 2KW5A 1DVRA 2PUBA 3ZD6A 1JYEA 5EJAA 3P19A 4UNRA 3KRTA 4YACA 5FPKA 3K9FC 4ZC8A 3KQTA 3B1YA 5I3CA 4C03A 1JQKA 3AESA 4PZ0A 4FSHA 3DTYA 4RTLA 4LIPD 1FU8A 4JB8A 4FFSA 1AGYA 3BBPA 3NXSA 2NP6A 3L7CA 3UHOA 1WXEA 1DX4A 5H9VA 4M9RA 2WOOA 3BHIA 421PA 4BTEA 1TVCA 5EP4A 4KQEA 2ZZMA 5K03A 5IAOA 1P6UA 3EF0A 3PQ4A 2YJ5A 3REQB 2ZS9A 5G0TA 4UJ5A 3T0IA 1YF3A 1ZINA 2C5SA 4CPVA 3TTSA 4ZO8A 1Y4ZA 1LNSA 1R6VA 1QIKA 3AVYA 2PUWA 3ZLUA 2GI4A 3V9PA 1ZJ4A 5E4FA 3ONVA 1ZNQO 5IYZF 3THYB 2GK4A 3LL8B 2NPIA 4IICA 3B3AA 3EWNA 2OQ2A 4G2TA 3L02A 3E8SA 2H5IA 3R7NA 2NTVA 4HAVA 2ODPA 3WL8A 1SB8A 4G0XA 1B2RA 2NO1A 4LHWA 5M7EA 1N2OA 5AHKA 2BR3A 4J0EA 3DVJA 5IKXA 3PL1A 2FPSA 3FN4A 1YVUA 4HNVA 4JUDX 1N34B 3P9IA 1YR8A 4N40A 1OLSA 1HTWA 1YJXA 4Q4DA 2B9VA 4HFRA 2RAFA 1FTYA 4PY2A 1BJRE 1PN3A 4AKGA 1VSTA 1IIOA 4N03A 2JANA 3RUEA 4B81A 2I91A 4ND8A 1ZUIA 3KEVA 3C5WP 5CCBA 2RE8A 4CR8A 3GLFB 1P80A 1ADGA 2IELA 4JYCA 1UM9A 1JDPA 4RTSA 3LY7A 1QV7A 3KPUA 1PL7A 3K30A 4KFUA 5D01A 4GOLD 2XVMA 2DTEA 4D4MA 5EHNA 5JCZA 4GPTA 7GPBA 1DQNA 1CBUA 4A82A 5ITZB 2ZVPX 1KDPA 3GVIA 1GPYA 1T3SA 4LOAA 4MS4A 4P4SA 1E1QA 4H1WA 1NXXA 2WSSA 1Z0AA 4BTVA 4EJ6A 4FNMA 4LYAA 1J90A 4WLFA 3AR8A 3FI9A 2DHQA 3BGIA 3VTKA 3JD3A 1P0CA 2QR5A 2XNSA 4D1EA 1W25A 1MB2A 1F4OA 3RFTA 4UD2A 4B7ZA 5D8DA 2IV2X 4O02B 3LQYA 1KEEB 3JVEA 1KFXL 1OBHA 1E20A 3A9WA 3PQ6A 3PNQA 4IOKA 2M8UA 4F4JA 5EL0A 4XR4A 2FI1A 1FEZA 1I3MA 1NVKA 3EIUA 1CVLA 1MPXA 1C7WA 1U28A 4X3PA 5F2KA 3G2LA 2R2IA 4JLSA 2C83A 2CLHB 1XQYA 1YTLA 4S1NA 5HS4A 3TS1A 2F8TA 2IIQA 3KHSA 5KWVA 4BNWA 3ZCVA 2QV7A 3S28A 2LNKA 2Q3LA 3A14A 1KA9H 3H1AA 5E9AA 2WP8J 5J23A 3I4LA 1L4KA 4HQLA 3CLRC 3DBIA 3HB0A 5A5GA 2Z2IA 4LE0A 1YXMA 1OPXA 4CEIA 4KODA 3L1IA 4O59O 5B64A 1R6DA 4W5WA 4XJSA 1AO3A 1Q50A 2A0XA 3B9RA 4MX8A 4D5GA 1W29A 4PC7A 3T7CA 3DFFA 3DEJA 1KBQA 1K3FA 2I2DA 3BWEA 1DOZA 4MVJF 4E51A 1M2HA 3BB4A 1YGPA 1JEYA 3L6CA 4IH9A 1F4PA 4G24A 2GNOA 2DBQA 4KR6A 2ODBA 2KFHA 1UXJA 2PALA 3PJIA 2CVHA 4J0CA 4PONA 3DB1A 3C1AA 2G7MC 4QNRA 4D56A 3BJRA 4CTOA 4GM0A 2LZ0A 1AZSC 3A4MA 1F48A 5DN9A 2PZFA 2GZAA 3RBAA 4IHAA 2WHRA 3RRZA 1WE2A 1ECLA 4D9IA 1XD8A 5AM0A 2EWVA 4K1LA 3V8VA 1CKEA 4A23A 3T9FA 4Q5IA 2YJGA 2XBLA 5IH7A 3H4SE 1QGOA 3Q87B 2OAEA 1DIBA 4KQFA 1JHMA 5KOHB 3HXQA 4XZ3A 4F1WA 1J1ZA 1VE7A 1BS2A 4P4NA 4F3CA 3M6AA 4JMLA 4X85A 2CL7X 4JFRA 4MQEA 1NVWQ 4UPDA 4LYEA 4KLRA 3LHSA 3JD2A 2CEAA 1W36C 5E6UB 1SXJA 1C9EA 3PSAA 1J33A 1EA5A 4U7GA 4JQOA 3GLTA 4BNVA 5KPDA 3W5CA 2WUEA 2YX1A 4R9SA 4W5QA 1NA5A 2H4JA 4OU4A 4MV0A 3NO4A 1D7OA 1P0IA 1DGQA 3OLWA 4GP7A 5JPIA 2JATA 4IJUA 4BVEA 2CNDA 4J49A 2B98A 4AC9A 2I54A 1I2MA 2OZLB 2D7CA 3RUFA 3SYNA 3GB9A 3UJBA 3GK1A 3SLGA 3ZCUA 2W90A 1DO2A 3IQEA 1JSLA 1FDWA 4IQ0A 1C0PA 1G5IA 2Q6IA 2IOFK 4ZVQA 2FZEA 1E79D 4ZEOA 4AJIA 3F71A 3FRIA 1NL3A 2QPAA 1RNLA 1ZK2A 2QN8A 4U7HA 4MR9A 4E4YA 3ZI7A 4X62B 4LJKA 2WYHA 3TK1A 4E12A 3BCRA 3AKCA 3DWGA 5BVHB 4XSVA 1M6WA 4NOLA 3V8QA 1YDEA 2WAMA 4CPDA 2Q45A 2PE5A 3VZQA 5A62A 4OMDA 5EMKA 3RYIA 4F38A 2H1SA 4JLUA 3HP1A 3TB4A 3SG2A 1JQEA 3KJGA 1NMSA 4HSZA 3QVOA 2NUPB 2F2OA 4Z2AA 3OZVA 3SFVA 1KK3A 1SM4A 2XH8A 4D44A 2ZUEA 1MN6A 1XXHB 2PX2A 5T7BA 4LBYA 1RJWA 2MJLA 1COWA 1G3RA 1YUTA 2CCGA 2CE7A 1TNDA 4RDIA 1OXMA 3S4YA 1I14A 1YUSA 3ENQA 4NBUA 2W22A 1EFHA 2F3TA 4BEVA 1G41A 5FA5A 2SNIE 5K5EA 2CKDA 1E4YA 1GEEA 2CXSA 3NAZA 2OP1A 5EJ9A 4MZKA 1XRQA 1J5EB 5HMLA 3QY9A 1LVUA 1FYEA 4UQLA 4KLAA 1UK8A 2FSHA 4B4KA 2Z56A 5KTPA 4EB6A 3LT5A 3BJEA 1E0DA 4HQKA 3QG5A 3D8BA 1DKRA 3PUJA 3JZDA 2BONA 2XNDA 5KJEA 1L4YA 5JATA 2W6ZA 3DV0A 1VTKA 2J6CA 5GM2A 2ZYWX 2XY4A 1AY0A 4HB4A 2H2DA 5HCNA 1QVVA 3R3SA 1RXCA 4D79A 4JVMA 5DKFA 1OAAA 2JBHA 3W2EA 1Y6RA 4B35A 2GEJA 3GYGA 3Q7SA 2AMFA 3ZQUA 1Z4OA 1FJHA 4RDHA 2EYUA 1JALA 1PWHA 1SZJG 3ECSA 3S5UA 3ZIAD 2HA0A 1FDOA 5KTNA 1ZD3A 5GZ1A 2JGEA 3MRVA 2AMIA 3N2KA 1VMIA 3C7KA 3KVYA 1LBHA 2O0JA 3LC0A 4M83A 3ZDZB 5IK2A 4GNRA 2ODTX 4XYMA 2ORWA 3EVBA 1V8FA 4JJ4A 3VDMA 1A8PA 4CQNA 4H77A 5JISA 1EBUA 2QU8A 3KT8A 1DG1G 4CMKA 5EN4A 2XZLA 5HUQA 4HXYA 3I5FC 1ZMXA 4H7EA 3UN1A 2OHOA 3LDFA 2IS9A 5AVQA 3UG7A 3JQ8A 5AXAA 2Q0SA 3RLFA 4E5DA 2E9SA 4BVLA 2PL1A 3U56A 1A9OA 2QAIA 1OWOA 4EI2A 3B6MA 5DHUA 4W63A 1LBQA 1LGYA 1US8A 4EPXA 3OJFA 1X1SA 1IUNA 3EG5A 4ODIA 4EX6A 2G17A 3CUWA 4R4JA 4R01A 1NVFA 2YN4A 5AVJA 5GONA 2OVFA 1RDFA 2BGMA 1JIIA 4YRLA 1GNRA 3QKRA 3GCZA 4QXAA 3JQEA 4QM7A 1TYDE 2W2LA 1QIGA 1JE1A 3VYVA 4KB5A 3HKEA 2WIAA 1O57A 5F1KA 3WLMA 2G63A 3WLOA 3SXJA 4PO1A 3S44A 1EFPB 4HS4A 3PE3A 2X8JA 3ONEA 1LK0A 3GNLA 1N7JA 4AUNA 1T34A 3ET4A 1H94A 3GLHE 3QNMA 3NUQA 4OATA 1BDBA 3E3NA 1OLXB 1Y5NA 1JJAA 5ESRA 2OXIA 1GQ2A 3X1ZA 1LNZA 3DTVB 1OWLA 4AQYB 3V8NA 2Y4OA 3UATA 3VU9A 1GGZA 1ZQ9A 4J16C 4PYOA 3NHAA 4ND5A 4G1FA 1R4AA 2XAUA 1VSBA 2WC5A 1BTOA 1M83A 1KAOA 3AF2A 3HGTA 1T8WA 3PN7B 2EDAA 1U8EA 2R5WA 1ZO8A 4ECEA 1JLLA 1C4XA 3U4GA 1KQPA 3SXPA 3MS4A 2EQAA 5EWMB 1MNQA 2QL6A 2B2NA 1O4WA 3RS5A 5KVVA 2W0SA 3OESA 1O94D 1CMGA 3H0KA 4J2OA 3HCOA 1KJ9A 1ZISA 3HH8A 5KUTA 3WIBA 5IULC 4IDBA 2ATEA 3WRYC 4JI7B 5HM8A 5B37A 2JH3A 5I9TA 2Q1XA 5ELMA 3CC8A 4FN5A 1Y1XA 4NFLA 2CCKA 5BW6B 1TQ8A 1RZUA 2OY0A 1SVMA 1PIWA 4R7ZA 4AKTA 4TQUS 1IVNA 5EWJB 1X7HA 4NC9A 4U6QA 3CWCA 3OZEA 4GWGA 5DO9A 3ABZA 1WY5A 1G6OA 3SJUA 4UZSA 4D4LA 4I6JA 3B1FA 2R1ZA 5LQNA 2I80A 2FGKA 5EMHA 2NZXA 3OEHA 1U31A 1TF2A 2C2WA 3RVLA 2J46A 3T1QA 5F51A 1DKOA 2ZBFA 2KPOA 4CIVA 1SKBA 2FZVA 3J81k 4KACA 3NJRA 3FSEA 2XEXA 1STOA 1L7OA 2Q5FA 4J4HA 2PMFA 3CE6A 5IZCC 4RNDB 2OA0A 2DZDA 1JF8A 1KI7A 2XBMA 3JR7A 3H83A 4I4TB 3ZDFA 3FF1A 1ZW6A 5BMOA 2G4CA 2XHZA 5UKDA 1FP2A 1DF0A 4EGQA 4I46A 2B5WA 4INWA 4LE1A 2VP3A 5AUOB 5CNKA 3C6MA 3LUCA 1KL7A 3FMIA 4OYRA 8ATCA 3ND6A 2PKYX 3AY6A 3CN9A 2RARA 5AICA 2RHRA 1ICIA 5I45A 1GRRA 3N8DA 3EGDA 1Y3CE 2OHIA 3BQNB 2BGJA 4UQOA 1VL5A 1HL3A 3B5IA 3AFNA 2GJSA 4LVUA 3LBHA 2EBWA 1FUYB 2JLSA 5GIOE 2QTVA 3VZRA 1W4BA 5A6SB 1ZGGA 2OCBA 3R3JA 4DDTA 3SQLA 4EG3A 1E1MA 1CZUA 5CB8A 1ZUNA 2JAUA 2IITA 3DR5A 2PG3A 1GZ6A 2REBA 2XCIA 2O8CA 2GSDA 2W8BA 1Q1NA 1RZVA 3RADC 1ONPA 3N75A 1RROA 4LBZA 5LZ7A 3E84A 4B4VA 3D0KA 4YRSA 5JALA 4L9WA 3KSZO 3DCNA 4ZALA 3QW4B 1NLMA 3RK4A 4I4CA 4GICA 2VHQA 3BHJA 2Q3HA 4J16A 4HR7A 4HN4B 1D0VA 4Z4GA 1A50B 4MRXA 2B2XA 2I94A 2EG5A 3PF9A 4O8ZA 3I9NA 3W5BA 4YGXB 3SIRA 3VYUB 3VTAA 4DPMA 5ALNA 4IV5A 4BO8A 3KR9A 4ZRNA 5DLQC 2VHWA 4AG3A 2OO5C 1IY1A 1HC7A 1AKRA 1QZUA 5SZJA 5EJ6A 4HGQA 3NHIA 1JA1A 4GKBA 1AHPA 5B1IA 2CEKA 4XGRA 2OV4A 4CL0A 3SR0A 2YWJA 3OMWA 3M7IA 1QYCA 2X5KO 2VDRB 3VISA 4DLXA 1EZ1A 1R2UA 4O4HA 5CEEA 3CRW1 3VR3A 4QAQA 4HGYA 4U7TB 4BKPA 2NQTA 3E9NA 2LAPA 5KTTA 3A6JA 3VAAA 4KVFA 3TIIA 2VYVA 5EIEA 3CF0A 3DVEA 4HC4A 4CKXA 2LV8A 3FYCA 2A4MA 3GRYA 1DOHA 3DOIA 1FBTA 1GRVA 3OA2A 4ZICA 1XYYA 2JAXA 3OQHA 4G0NA 1QLHA 1Y42X 2YV2A 4DKXA 4PCLA 5E3HA 4INJA 1XG5A 1E1YA 4N1GA 3GOQA 4FYPA 1JQ5A 2QSUA 4IL1A 1UHNA 5EHGA 1BWSA 1OILA 3BH0A 1OQAA 1YE3A 4RM3A 4ARAA 4B79A 3NX4A 2BGRA 5AUQA 4EKDA 2JDIA 1TKAA 4GPAA 3IEMA 3A58B 1YS9A 1NBWB 4RH0A 1D09A 4ICBA 5DNAA 2DCMA 3PFNA 1NURA 2Z5GA 5TNCA 1C7IA 1SEVA 1Y3DE 2I7XA 3RIMA 3SLRA 1XFVO 1GGJA 1GV1A 2JEZA 4GGFA 2PH1A 2XQIA 4KU4A 3DBVO 4EHJA 4X5OA 4MVFA 2X0FA 1WXWA 5IVHA 2RB4A 5CDUA 1UBCA 1VCHA 2BEWA 5FNZA 3F9RA 5JD5A 4OXXA 1HE1C 1C8BA 3JAKA 1PWXA 4WKBA 4MR8B 2E5LB 4IGAA 1K2HA 2QEQA 1SQFA 2FN3A 1SVSA 3OD5A 3B13B 1I0ZA 3E15A 2MINB 1WPRA 2FSSA 4BFYA 2KAYA 3Q8XB 1TO6A 3SE7A 1KWOB 3AW8A 2OGTA 3K53A 1GGVA 1J2RA 1TMYA 3WXAA 1TTHA 2AXEA 2QJFA 3A9UA 4NQRA 2ISCA 3DOFA 1C3ZA 3PVZA 3DLPX 5CP8A 3EXEA 1KMNA 2JFFA 4MUNA 3E18A 5MHTA 1D2CA 2PZBA 2JXLA 5BQOA 4C22A 1NVDA 3RUDA 1BT6A 1LX6A 2I4TA 4TRNA 2O8NA 3E7WA 2A5GA 5A4JA 3QE4A 2XV1A 3BUOB 2C3MA 3PFWO 2FFRA 3OQ6A 4MQ5A 4PX5A 3IF7A 2QLMA 3D5EA 3P2IA 4ZJYA 1FPQA 3AH8A 1ABFA 4EAQA 2V53A 4LWQA 4XD7D 2V59A 3AUJB 3E5HA 3F3SA 2Z3WA 4QQRA 4TL7A 3H5RA 1CDDA 3ZH9B 1RHRA 4PBRA 2D00A 4KEAA 1NV9A 1XP5A 3RTDA 2FK7A 3U40A 1RZ3A 1XTBA 3TGPA 3EPKA 3AVPA 3WB9A 5FI3A 3DTTA 3VPDA 3FWBA 4GW3A 4ZCQA 4YT5A 5MFZA 2C2BA 2O1XA 3HKCA 4WTOA 2FF7A 5HFJA 2VPZA 2OPHA 4DUGD 3A28A 2R6DA 1IY0A 4ZRMA 5CJPA 2J3JA 2OM2A 5TS3A 5ADWA 3RFFA 2PSHA 2ZRNA 2C8VA 3IUJA 2M1UA 5IKMA 1NQAO 1NCXA 5F2OA 1S2NA 1WNFA 2C7QA 4C9BA 1POXA 1WX1A 3D4IA 5A5FA 3MTBA 1IJBA 3LHDA 4GS5A 4EYEA 1B2LA 3HVRA 1RQXA 1TECE 1THGA 1TTPB 5BQFA 3ZWNA 5ARBA 1YB2A 2DFKB 4L2IB 4QBIA 1SD1A 5F12A 2BF4A 2C0QA 3ZK8A 2LANA 1VSUA 3ICWA 3WQRA 3KKKA 4BDTA 1BO6A 2CBXA 1FFEA 2X0RA 2JJ2A 4RKEA 2FETA 2HCTA 1EEHA 5G4LA 2WK1A 5AI4A 3ESCA 2BAGA 5HA5A 2H31A 2HU2A 1RWMA 5KQGA 5ERYA 3M6XA 5AW0A 4QODA 4O2RA 3NT2A 1YASA 3ZD7A 4MS1B 1U4NA 1KTIA 1REQB 4MQFA 2OLEA 4KQHA 2C20A 4X7BA 3GX1A 2O2XA 2QPTA 4Q16A 3P32A 3T38A 1AC5A 4B85A 2Q1YA 2O7SA 3FYDA 3H5WA 2J7PA 3MN1A 1CY2A 4ESHA 4NCNA 2QUAA 2J0SA 4GE0A 4A6DA 2K7CA 5IJAA 2R65A 4IJ6A 1HFWA 3GGSA 4M0UA 3FA2A 4RK1A 2Y71A 3S68A 3PT9A 3QXSA 1I6WA 1KYYA 5KC8A 1T9CA 3QNUA 2V7UA 3V7WA 1J0AA 1FU4A 3KYCA 1KXZA 5C8VA 5KX5A 4MW4A 4DM4A 1O54A 1ESNA 2W6IA 2CUTA 4R41A 1QVWA 3QA3E 2XIJA 3TQSA 3UWSA 3DW1X 3CX6A 3R9IA 1RXWA 5KWSA 2IIVA 2I3BA 2Z09A 2E4ZA 4UUAA 2Q50A 5IC5A 3NHLA 4OXNA 1ZZGA 3DYVA 3IA7A 2OV8A 1JHPA 3W79A 1XYVA 4G85A 2YFHA 3RRMA 1BD4A 3H2YA 4XE5A 4OM7A 5F3RA<