4C0JA

Crystal structure of drosophila miro ef hand and cgtpase domains in the apo state (apo-miros)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
404
structure length
404
Chain Sequence
ELTSACKKSLVRIFKICDIDGDNLLNDYELNLFQRRCFNTPLQPQILDEVKAVIQKNVPDGIYNDAVTLKGFLFLHCLFIQRGRNETTWAVLRRFGYNDQLEMCQEYLRPPLKIPPGSSTELSHRGQQFLIAVFERYDRDGDGALSPEEHKMLFSTCPAAPWSYSTDIRKSCPINETTGWVTLHGWLCRWTLMTLIDVVKTMEYLAYLGFNVHENDSQLAAIHVTRERRIDLAKRQSSRSVYKCHVIGPKGSGKTGMCRGFLVEDMHKLIGKEFKTNVVNCINSVQVYGQEKHLILRDIDVRHALDPLQPQEVNCDVACLVYDSSNPRSFEYVARIYIKYYAESKIPVMIVGTKCDMDERRQDYLMQPSEFCDKYKLLPPHLFSLKTNKKELYTKLATMAAFPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Coupling of the EF Hand and C-Terminal Gtpase Domains in the Mitochondrial Protein Miro.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase
molecule keywords MITOCHONDRIAL RHO GTPASE
total genus 116
structure length 404
sequence length 404
ec nomenclature ec 3.6.5.-:
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
A PF08355 EF_assoc_1 EF hand associated
A PF08356 EF_assoc_2 EF hand associated
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0jA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0jA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4c0jA03
5HYDA 3BH0A 1AIPA 1BR4B 4LPSA 2J7PA 5EJEA 1YUUA 1Z2CA 2EFCB 3SYNA 2R2IA 4Q9HA 1XD2B 2JC2A 3KO0A 4OI0A 1QHNA 5FBQB 4XVRA 1D2EA 2IYSA 2ZRHA 5KPJA 3NBFA 1PV4A 2HCBA 4ICBA 1JJ7A 3WRXC 1RJVA 1Q21A 5FOWA 2GJ8A 4URWR 3AEZA 3E3RA 2C03A 4LJ7A 1F6BA 3GLGE 2ZRAA 4BEBA 1Q20A 1TEVA 4RFVA 2NOAA 2LMVA 2WVJA 5B57C 2WIBA 2GJKA 1TNWA 1P7CA 1NMYA 3NC0C 3KQKA 2XSZD 4B3GA 4PC6A 4ORCB 1K9PA 4MLWA 2GTPA 4DLUA 1YX7A 4TTRA 2AK3A 1OB5A 3EPJA 3RDPA 5AJWA 4ON9A 3KX2A 4B33A 2OCAA 1F2TA 3BGWA 3U3JA 4II7A 4DCVA 1YR6A 5CLQA 2JNXA 2IHYA 2ZR9A 3I1FA 4NBSA 1Z0AA 2NO9A 2CL6X 2BCGY 4JQ0D 5I2OA 5J4HA 3I73A 1T91A 2NO1A 2IW3A 4ACBA 3KDSE 2W2TA 2KHNA 2GHIA 1Y1XA 3W9YA 5D3MA 4A0RA 3SI7A 1MHOA 3VRRA 2FH5B 1LB1B 2NPIA 4WQ2A 3KUCA 3ZZ0A 4PE4A 3C7KA 4GOKA 4TLDA 4RSGA 1M39A 3E70C 2O8BB 1N5KA 4GPLB 4NYJQ 1NY5A 1FW6A 3VU9B 2F1RA 4RCZA 2V53A 2H7VA 3F45A 2D62A 2IYZA 2V55B 4LI0A 4NCKA 5G53C 2ZPTX 4ZDWA 1OMRA 4TT3D 3O8BA 2ZN9A 4M9ZA 1L2OB 4PC2A 2WJYA 5TNCA 1US8A 2ZRBA 2CBZA 2QENA 2ZSAA 5FBWB 4BE7B 1VG9B 1EGAA 4YBHB 4PZLA 4PE7A 4A8JB 2JZIA 4E22A 1P6XA 3QF4A 4OQXA 1DBSA 3O8RA 2X2EA 2ZJ2A 2ZIAA 2FPKA 3A1VA 3CW2A 2JASA 1J7RA 4G5GA 4EAQA 2KI4B 1TTTA 5DIFA 1AK8A 1P4SA 2ZAMA 1L7VC 1QIVA 4MRNA 2PBRA 5PALA 4CIDA 4Q66C 5DI9A 5EUMA 2ODWA 1KZ7B 4F91B 4JKIA 1Q57A 3KEVA 5EP3A 1NN1A 3V00A 2AN9A 1QTXA 4O2RA 4KFRA 4YDSA 4CEJA 5F9HA 1EH2A 3ZVMA 4M9QA 4YQFA 4DIRA 4M53A 3SQWA 3GFPA 3ZQ6A 1H4BA 1T6NA 1ALVA 3QG5A 1PLKA 2H17A 3E2IA 3TW4A 4PPQA 4BEJA 4OJKA 4EJSC 2RGBA 3P4XA 5KNDA 2XB4A 3NSOA 4Q4HB 2NZ0A 3NHBA 4NYMR 4NTZA 4FIDA 2HF8A 4TMVA 4DLZA 4HRHA 2F1HA 3B2EA 3GLFE 2X2FA 2QSYA 2WWWA 3MLEA 2EWWA 3SQXA 2CJWB 5FTNA 3HU3A 4NYIR 1E98A 4CEJB 3L0SA 1T5LA 4U00A 2MBXA 3CM0A 1DARA 1M74A 1IXSB 2ZQ5A 3P27A 2L0PA 4TNCA 3MWLA 2H61C 1G4AE 1ETUA 1ZRHA 221PA 2JLZA 2HETA 3C15C 4JLNA 5CYPA 4A4CA 3CPJB 4JJKA 3QSYA 1W4CA 1JR3A 3KQNA 2KSQA 2Q21A 3MMPA 2ZKMX 2G1KA 1J70A 4P4SB 1CMFA 3A37A 3TW8B 3L0IB 2WPDD 2BDTA 2ZROA 3OZXA 2KYCA 4AYTA 2PLFA 1U9IC 1RC8A 4QJ5B 3MCAA 3FGNA 1J7PA 1YURA 1RJ9A 1Q1ZA 1ZBDA 2XZPA 3N2IA 1E1RA 1VG1A 3OX5A 2V1XA 3M0WA 1JBKA 1YZNA 2YHSA 1HEIA 1CLBA 3MSXA 1GRRA 4JBWA 1QV1A 3QEOA 5CB6A 3CRVA 2CHVA 3LFUA 3RRNA 3GK2A 2J0VA 1VCIA 2QP3A 3ZZTA 4LWZA 4KJZA 2ANBA 3I5FC 621PA 5JHGB 1ZW6A 1C9KA 3TUYB 4LHXA 3RYTC 1ESMA 2KGBC 4AD8A 2K61A 2V7QA 4KHZA 3GJ0A 1E0SA 1G33A 3Q8XB 4A82A 4HDOB 2DHRA 2IXEA 3SIBA 3OEHA 1PLJA 2CXXA 1FI5A 4LBYA 4XIGS 2YC2C 2JLXA 5FBRB 1YX8A 3U7HB 1N0YA 3SN6A 4DLTA 4KLNA 2WCBA 1Z2AA 3MGCA 1KO4A 2JNFA 4DXAA 2IS1A 1JALA 5JOLA 2NLNA 1CDNA 1HH4A 1ODFA 1VCMA 3OEHD 1II8A 4IOKA 4DEYA 3BIFA 1ZINA 2M97A 4YI8A 2PASA 3EPKA 2ZVQX 3T5GA 1O3YA 3LLEA 4EPWA 2O8FB 2JAQA 1QV0A 4M9XA 4DDTA 5FUVA 5AJXA 5SZHB 1LS6A 3RS2A 4BY4A 3LW7A 1SY9A 3EIHA 2CVFA 3BAFA 2OTGB 4D82A 2QY9A 1FUUA 4AKHA 3CH4B 1XBTA 4Q47A 1II9A 3VR1A 1KDPA 3EPHA 4MITA 1SKTA 4KITB 1NP6A 2H61A 1SW8A 3LK1A 1KI6A 1NMZA 2DWQA 4L16A 1SR6B 3IEUA 2IS2A 3TLXA 2WM9B 2M7NA 3D10A 4TLEA 4XYNA 1QVAA 2FSIA 1M2OB 1OQPA 4HAYA 4Q21A 3CR4X 3CR8A 2PJRA 3LBNA 4A2WA 3PUWA 3SJCA 1VYTA 2J87A 4CT5A 2H16A 1TF2A 4FMDB 1JECA 1VTKA 1XFYO 2ZR7A 3PENA 3UXMA 1ZAKA 1S0UA 1DG3A 1II0A 4LRWA 1N5IA 5DHAA 3BORA 2LUCA 2BE6A 2ZS8A 3AV0B 2R6AA 5J47A 4PCWA 1DOAA 2VF7A 2YJTD 3EZFA 2L98A 2NZJA 2WWYA 2ORVA 3UMSA 2LC5A 2CT9A 2BCJQ 3WY9A 1BF5A 2J0UB 1K9UA 4I5NB 2OILA 1YRBA 1HURA 1ZIPA 5L3VA 3L8YA 3K70C 1F70A 2BE4A 4PHKA 2Q3HA 2WBLC 2EYQA 2K7CA 5D69A 5KDDA 4E03A 5HCIA 3RS5A 2IUUA 2G9BA 1ONBA 4IDHA 4L15A 1D9XA 4PDZA 1A75B 5AJVB 3FPAA 2BC9A 1NPQA 3LBIA 4HYYA 4JIMA 1XK4A 1M1YE 3WRYC 4FCVA 5FR1A 2ZM5A 3D3QA 2P5TB 4TYQA 1PULA 2ZNDA 1ZACA 4DIDA 5LB4A 3CR5X 2A9KA 1DJXA 4FMCB 4G0NA 3K0AA 3K70D 2ZR0A 4DWJA 1KY2A 1NKSA 1V1FA 4IVRA 4NDZA 1N5LA 3PEWA 1U8ZA 1N2DA 1NN0A 5C4MA 4I99A 4DDUA 4NQGA 1WA5A 4G3XA 4PO8A 1GDDA 3GLFA 4LUCA 2RGXA 1IRJA 3FYHA 1G8GA 2BEKA 1U0HC 3QUSA 1RRFA 2C9OA 5J3XA 2QQ0A 1SRAA 1NL3A 1QG2A 2F3TA 2OLJA 3IHWA 3VAAA 1E32A 4BFUA 1AJ5A 2A30A 4EQ6B 3DF0A 1R0ZA 1S2MA 2IYUA 1KFUL 2PLRA 4C0KA 4ZI3A 1G3QA 1GG2A 4UXIA 2E6WA 1FPMA 1GRQA 3K0AB 2FCDA 5BYJA 2H2KA 4ESHA 3KFXA 1WRLA 4OVNF 4OBEA 1CP2A 4DIEA 1XD2A 3IUYA 4M1SA 5FL7A 3O2PA 3T1OA 2J7PD 4TL9A 3VR4A 2LHIA 1XTQA 2QRZA 2M1UA 1L2OC 3KFVA 2ZRMA 4B32A 4Q48A 1VCOA 4LJ9A 1FL9A 3EA0A 5AERA 4F7WA 2AFHE 1Y6WA 3PSRA 2O8EB 1UWOA 4TL7A 3QIAA 1E0KA 2WJGA 3DM9B 4TSFD 1OXVA 3SBEA 1E3MA 4OQMA 3NH6A 3QXSA 2COLB 2IC5A 1TOPA 1YR8A 4PFSA 3IHLA 4FCWA 4I81A 1KK7Z 3AF4A 3HU1A 2C2HA 2EFEB 3RS3A 2A78A 4OKSA 4DUGA 1FMJA 5B8IB 4OKHA 1K6MA 3FKSD 2Z6VA 1P9RA 1NSTA 2G9NA 4I5LB 3VMFA 1OV4A 3OFNA 1E96A 4LX0A 1F2UB 2BMEA 3VKWA 3GLIB 2VSFA 2RMKA 1W1WA 3MWKA 2REOA 3N5CA 4QOSA 3ZVNA 2F55A 4PO9A 5DYGA 1XD9A 3CB4A 1D6JA 3IDQA 3AVVA 1SXJE 4EJSB 1S4QA 3HPQA 1JAIA 3U2QA 1DJIA 1E8AA 1GVNB 1JQJC 2DWOA 2QROA 3I5GB 1NJFA 1W0KA 2WJIA 1Z6GA 3K0FA 4AIIA 3HJNA 4IVQA 2X19A 4ABYA 5J4LA 1WB9A 3QEJA 4CFRA 1J1DA 1II8B 1SL8A 2QUZA 3LXXA 3KTAB 4JVNA 2PMDA 4WZAE 2BBTA 1U0LA 1N6RA 1XCPA 3ND8A 1DTLA 2BL0C 1E9FA 3KKNA 1IQ5A 3QKSA 2K2FA 3B82A 2Y1NA 3PEUA 1HT9A 3DD4A 3WBJA 1T0JB 3HP1A 3U44A 3QQ5A 1ZM3A 4A8JA 2VP9A 1XTKA 4EJSA 1R5BA 2JDIA 3CR7A 4PR0A 1GWNA 2ZRKA 2YOGA 1W7JB 1KHTA 4IHQA 4D1EA 1SNLA 1T3HA 3KKPA 4LYJA 1BIFA 2F43B 1E9CA 4PSVA 1WLZA 1JPJA 2ZE6A 3ZGXA 5HR5A 1KMHA 5KHOC 1YZUA 1GZSA 2QEQA 4XWAA 4D4LA 3H2YA 4U02A 1DE0A 2GBLC 2CE7A 2Q91A 3A1WA 1KNXA 1X1SA 3IGFA 5CYOA 2XITA 1KAOA 2JJ2D 3AKYA 2OBLA 2V6JA 3GCGA 3EARA 1W5SA 2YOFA 1JJVA 4LYAA 5L8VA 1D8TA 3KQUA 2QMHA 3U3KA 3AVUA 1G5TA 4IEEA 2F3ZA 3RVBA 2KOTA 1W7AA 2CLCX 3ZNIA 2ZJOA 3DM5A 5JHHB 2MMCA 2PX0A 4XSHA 2KBFA 2TN4A 2BKIB 4M22A 4Z8XA 3PXGA 3OEEA 2ZYTX 3GJ8A 4JT4A 3TR5A 4NMMA 4Q7JB 4A0GA 3VNUA 1MV5A 4GSYA 3X1XA 3HYRA 1YZQA 1C07A 1CDLA 1HUQA 1EWQA 2WCEA 1KDRA 3CF6R 3AKAA 5CSNA 1YVHA 2AMIA 2SASA 2GETA 3FHOA 4JPZB 1WRZA 4CFQA 3THXB 4ZCUA 2AX4A 2OS8B 2PZFA 3FFBA 3ASYA 1CJTC 5GQQC 1FZQA 4RKEA 1QDEA 2P5SA 3GLGB 1LY1A 1OB2A 3LNCA 2ZUCA 1MO3A 4MRXA 2C96A 4BLOA 4DCNA 4BLRA 2ZETA 4P4SA 3PLFB 4WZBE 1G21E 1E2PA 1CMGA 2LM5A 3PJRA 2ZSBA 2ORIA 5JSZA 5L3SA 4WXRA 4B48A 2QSZA 4RFSA 1OXTA 2FGJA 4DT1A 3K09C 3W6NA 2ONKA 2HYIC 1IN6A 3SG5A 4LBVA 1A03A 1I2DA 4GNKB 4OHWA 3DZDA 1K9KA 2ZVPX 1TAGA 4DEXA 1RVDA 2D8NA 1GILA 4AKGA 1XJ0A 3ZS9A 3I5GC 3LRPA 1HYQA 2BKEA 4BPBA 1EX6A 4NCHA 4RZXA 3VR2A 4B6FA 1OMVA 3SU8A 3UKDA 2VRGA 2VHJA 3FFAA 3L43A 3WMEA 2O8EA 2HLDD 1SVIA 2FFBA 4X8MA 3ADCA 2MAZA 5GJCA 5HLVA 3M1IA 1CS4C 1Z5ZA 2B6HA 2K8MB 4LSGA 4PC1A 1RK9A 2RGNC 1XCGB 3GLHA 2I94A 1R5OA 4HLCA 4I1OA 1VKJA 2PZGA 2J59A 2WKQA 4IOLA 1IN5A 5JS8A 5JWRA 2A3RA 4NPHA 5AWFC 2RGGA 3BOSA 1B7TY 3CIOA 2QPAA 2Z83A 4PHMA 3MG9A 3Q7PA 1BS1A 1KMQA 2FGKA 2OFXA 5FUWA 2PH1A 1LW7A 4HAZA 4YGAA 2OBNA 2PEYA 3I5IB 1V1GA 1BYUA 4TZ0A 1G4YR 3THYB 4RCYA 3I4LA 1Y3AA 3CX7A 5FL3A 2HUPA 4W5WA 1HQYE 2FJUA 2OUKA 4EUNA 3C14C 3D0YA 3HU2A 1ZM9A 3UWOA 4NL4H 1KK2A 5JRJA 3THWB 1QXPA 2GZAA 1XF9A 4BLPA 2ZYUX 5JCPA 3AGPA 3IF7A 3IO5A 2ZU6A 3QF7A 4LV8B 5M04A 1NCXA 3KXIA 1J55A 3I5XA 2VL7A 2RH5A 2FZ4A 3EZ9A 1XU4A 5EXXA 3JTDC 2VTKA 3BS4A 4B71A 2RKOA 3GMTA 3WYGA 2GNOA 1W36D 1LKJA 2QPOA 1RKBA 2QAGB 5AR1A 3RABA 5JBQA 2OV2A 3PN7B 1KI3A 1NVUQ 1UKYA 2MSDB 4YGDB 2ZJAA 4LBZA 4P31A 4CEHB 4K8OA 2LHLA 1P62B 5DI3A 3ZD7A 3U6BA 2O8DA 4JLMA 4LJ8A 3THWA 1E2MA 2A2ZA 5DYIA 1KJYA 1E1RD 2B21A 2OS8C 1E6CA 1NLYA 1CJKC 2IUTA 1G41A 2GAOA 2JIZA 4FMBB 1AM4D 5I2QA 3B8HA 4M21A 3EVVA 1KDOA 4V0LA 4D4KA 5CITA 121PA 1OJLA 1X8JA 2GCOB 2TMKA 4TN1A 4GGFC 1KJZA 2D7CA 2WPDA 1ODBA 2JXCA 3LXRA 1OMDA 2CCJA 5ANRB 4YI9A 4PHNA 4BFTA 1T5IA 4Q18A 2BJWA 3LAWA 3T1QA 3BB1A 3G0HA 4AOMA 3P20A 2GRJA 1Q3HA 3DOFA 1SKYB 4DRWA 1G3RA 1KK7Y 1IJ5A 2M29A 1OLOA 3RRZA 4HSZA 2M8UA 2Y5IA 1IY1A 2J46A 5TY0A 4UJ5A 4Z1MA 2HXYA 4ZCIA 2QI9C 4URYR 4U7DA 3NXAA 4G5QA 3C4JA 1LF5A 2CCKA 2RGDA 5CK5A 3DVJA 3CX8A 1CM4A 3SFZA 4NP6A 1Z07A 2F3YA 2L4HA 4W5HA 4MDEA 1KQMB 4MDFA 5CSIA 2I1QA 1YRTB 3TS5C 4Z54A 2OEPA 4YONB 4P3YA 2EWVA 1F48A 1VG8A 2CDNA 2ASEA 1OH7A 1Y63A 2IYQA 3PFIA 1R0WA 2HDNB 5H70A 1EFCA 4URXR 5KYKA 3C16C 3OE7D 4MYTA 1WP9A 2P6BB 4A36A 5FTKA 2GCNA 2LMTA 3KXLA 4DB2A 3ADBA 5GVSA 2UVQA 1P2SA 3NHAA 3VRPA 1CULC 4PZZA 5FTMA 5C4GB 3VGOA 2H1LA 3KJGA 5EP1A 3TSOA 2I3BA 1R8SA 1DJGA 4KCGA 4KBFA 1E2DA 4CRWB 2PSRA 1VDZA 2Z43A 4RFSB 4JJZA 4GDFA 1CFDA 2PL3A 2FOTA 3BUWB 1DGUA 1FI6A 4LV5B 1UDXA 1CTRA 1E9RA 1G5PA 1TF5A 2I1VB 3N2EA 3HX4A 3BK7A 4UXHA 4OL0A 3A4LA 2ZRIA 4KV9A 2YWEA 4LHYA 4UJ3A 1K8RA 4LY6A 3VNVA 1P3JA 3IQQA 2OZEA 5IF9A 2C98A 2DFKB 4MGYR 4GGFA 1B8CA 1LA3A 5DN6D 5JS7A 1PVOA 4FQOA 1OZSA 3H86A 2D2EA 3K9LA 3U7FB 4Q1DA 1UF9A 2GJ9A 4AYXA 1M8PA 4WVFA 2ZN8A 1AKEA 2ODNA 3CGAA 3QENA 4HI0E 5KUTA 4TL6A 3E5HA 3Q85A 4TLBA 1Q0UA 4BLTA 3PG5A 3QBTA 4JVLA 2WKPA 1M6NA 1G19A 4G01B 4AQIA 1KI6B 2YNMA 4QGFA 4A8JC 1BOCA 2J5XA 1N6KA 1RW4A 2AXNA 2ZRTA 4HUQB 1CEEA 1V5WA 1HY3A 3T34A 4LJ6A 1AVSA 1SKYE 3QPVA 1AA9A 2QZ4A 1GTVA 3QBVA 2G0TA 1OFUX 2KFFA 2GAAA 2HF5A 1UEJA 3L82B 4MYCA 1S9DA 3AP1A 4N0DA 2ERXA 3KKOA 2OCBA 5JZVA 2RAPA 2ATVA 3A1SA 1G8IA 1NCYA 2W6JA 1PSRA 2BCXA 4YXWD 1U90A 4E5UA 2FFAA 4I5KA 2ZRGA 4JLBA 4MRRA 1M7GA 1E1QA 2E30A 4ZDJA 1JNYA 1SKQA 1K95A 2FCEA 1NVVR 1OIVA 5JLJA 5E4FA 1BH2A 2PT7A 3CR2A 1M7BA 4NE2A 4NH0A 1A29A 4XD7A 4DS7A 5E95A 4TMTA 4CT4B 2J0UA 2QRNA 3GLHE 3AP3A 4G5SA 5FI1B 1NKTA 3QY0A 1G64A 1XVJA 1W5TA 1DF0B 1XXHB 2RGEA 2ZJ5A 1B8RA 1G3IA 3NBYC 5EZ6B 1AQYA 4RD2A 1UHKA 1HE8B 1TMKA 3EK4A 4WQ3A 3VU9A 3OB1B 4JMPA 1GKYA 3KPXA 1ZNZA 1MR8A 1Y1AA 3B6EA 1K2HA 1U5IB 3CUEF 3KKQA 1DJHA 4QBGB 1NJGA 5CM9C 1E2LA 3VTKA 1UURA 5J4YA 5TMPA 1X8LA 1FNNA 2VYFA 3AVYA 1SMGA 4ZDIA 1XFVO 1OE9B 1U98A 1UPTA 1KFUS 3FKQA 2QG6A 2QT1A 1XZQA 2L2EA 4EFNA 2PRUA 1GAJA 4DLXA 5F98A 3Q3JB 3VRQA 1GNQA 2H8KA 4X8OA 3QVVA 4C9BA 1SVKA 1CB1A 4PANA 1CDPA 2JDID 2WOOA 3AGQA 3TUJC 3L0OA 1ZUIA 2O5VA 2RHMA 2VLIA 3ZYCA 1IJ6A 4P2YB 2BKUA 4RKFA 5E7IA 2KFHA 1GL6A 3GLFB 2G6BA 2REBA 2IWRA 4OI2A 3THXA 4QXAA 1FOEB 2FSFA 2F2OA 1DAFA 3CPEA 3RNLA 4BZQA 1UBGA 1C7WA 1GGWA 2JULA 1BODA 2Z0MA 3JZMA 4BFSA 1KAGA 5A5GA 1E0AA 1ZD1A 1ZD9A 4GOXA 3AVWA 1KSHA 1W0KD 1QBKC 1FP7A 4ZI2A 4QRHA 2MRDA 2P67A 3JVVA 3HCMA 2PALA 2WHXA 3BE4A 4JL5A 1VPLA 2HT6A 1G3UA 4Q4HA 4DJTA 4A2QA 1EFRD 1J99A 1W36C 1JC2A 2SHKA 3W5IA 4XWKA 1Z63A 4IOJA 2N1BA 1Z6XA 2OXRA 1SR6C 1FQJA 3GJ3A 3F5FA 3U6KA 4GNKA 1ZVQA 3ND9A 3U4QA 4IDNA 1XTRA 5JJGA 4Q4JA 5FI0B 3ZWHA 3AAJA 2DPXA 4KO8A 4LGMA 1SVSA 3T15A 3LVQE 3ICBA 1KI9A 4M0LA 5H1YA 3ZH9B 4D0NA 4TMXA 1NYAA 3Q9LA 1Z3IX 3X1YA 1DJZA 4TL8A 5G08A 4Q03A 1W47A 3VX3A 4DLWA 1E4VA 3DVKA 1C4OA 1EG7A 1NVXQ 1T3SA 1Z0FA 5L3QA 1QHHB 2FG5A 4OK6A 2R8RA 4BY5A 1S1EA 2F6RA 2KE5A 3LWNA 4NDBA 3TVDA 4FWIB 5KTYA 1FP6A 3HWSA 4OCIA 1M7HA 4QL3A 4QKQA 1DJYA 1MXLC 3GLHB 1YR7A 3VKHA 5KSYA 4DCKA 1F4OA 5ER5A 2VPPA 4CVNA 1EG4A 1XTIA 2R6DA 1TQ6A 3OIVA 2XJ4A 1CR1A 1N6PA 2XTMA 4MKHA 1DS6A 3D0YB 4QHYA 2KYFA 3BB4A 5SZKB 2YKGA 4KFUA 5G3ZA 2ANCA 4UPGA 1N6OA 2QA5A 1C7VA 1VECA 1M34E 4B6EA 1E1QD 2AKYA 4CYMA 2DY1A 2G0NA 3C41J 5JJIA 1SL7A 2GJSA 1L4YA 4M1KA 5KPDA 2D3WA 1XFXO 2NPFA 4Q9JA 2ORWA 3K9NA 4A6PA 2J0SA 3FMFA 2GZDA 3TZ1A 2OHFA 4CEHA 1OSAA 2CVHA 4MH0R 1S5GZ 2IS4A 2GF9A 5GVRA 4URUR 4ZCVA 4JLJA 1JXOA 5GJBA 2QORA 1DVRA 2IS9A 4HZUB 4ILEA 4JBYA 2O0KA 3TQFA 1CJMA 2FMXA 4CW7A 5BPJA 5DKNA 1RFLA 4FXPA 5K89A 5IHPA 2M0RA 3EPLA 4BFZA 3ZIAA 3ZDQA 3UATA 1TTXA 2DFTA 1NG1A 1B1GA 3BYAA 4HAXA 3VQTA 3WHUB 1G291 2JA1A 1R6BX 3B1WA 2NMVA 1N6HA 5FH9A 4OYHA 2PMKA 5JWHA 4KVGA 3TDIA 2JJ1D 2WWXA 3D8BA 1NBME 1CDMA 4QJ4A 1G5RA 1MUXA 4RD1A 3MFYA 2GGZA 5EE0A 5AXIA 3QE0A 1Y1UA 1YVDA 3SIAA 3EAQA 5JECA 2IYTA 1G7TA 1TEXA 1LXFC 4C30A 3PIRA 4YMWA 5DN6A 5C2JB 2CK3A 2QAJA 2GILA 1WDTA 1QHIA 1IAQA 2WJJA 2A4JA 1ZNXA 4HDCA 1AS2A 3SG4A 4HB4A 5FBVB 1DAIA 2VHQA 1YRUB 1OPXA 3WP1B 5JI3E 1B47A 1OH8A 2LUXA 3LQQA 3VHXA 3FHCB 5CIWA 4E07A 1KI8A 4RD6A 2WAYA 1EFRA 4F93B 4ZV4A 4NCJA 3P26A 3ZVRA 3MUFA 4G5OA 4Q7LA 2WAXA 1CR0A 3TH5A 1H65A 5GADl 4PC7A 3DVMA 1TPZA 4LJ4A 2L51A 4IDQA 1QLSA 1QATA 3PITA 1WXQA 1LA0A 3AB3A 3BFVA 3TUYC 1IM2A 2NQ2C 3U44B 2A5YB 1DO0A 1AGPA 3LLUA 2XNDD 3BWDD 1OE0A 5JRZA 1QG4A 1SK6D 6Q21A 1UKVY 3DVLA 3R20A 4EPTA 1ZU4A 3OE7A 2EVWX 4P5OE 1DPFA 4BRWA 4C7OA 2AD5A 4K46A 2NXQA 4MGZR 4R7ZA 1QS7A 1DAKA 1O87A 3JVUA 1NX2A 4TYYA 4AKIA 3BUMB 3BH6A 4PHFA 3ZS8A 4RD0A 1DO2A 3B60A 1NVWQ 3FDIA 2ZEJA 3FTQA 1ZP6A 4M2QA 1J8YF 3TBKA 4R71A 2DWPA 1OFHA 3TJZA 1KKLA 2BBMA 4ZCLA 4KYIB 1E2FA 1UKZA 3MAAC 1AK2A 2FOLA 2WKRA 1P5ZB 1VCNA 1ZJ6A 4W7SA 1XDBA 5H8WA 3OB2B 1E2IA 2WSSA 4A1FA 3NSKA 4A2PA 2IYXA 4B2PA 1KOFA 4A15A 4D6PA 2C5LA 2YC4C 2R44A 2C8VA 4FD2A 4DDVA 2KB0A 5AUPB 4G1UC 1KTVA 2C77A 1PALA 3D31A 2J3EA 3B13B 1I4LD 3TKLA 3SJBA 1I4DD 1ZD8A 2ZE5A 1XCMA 1SXJD 2HYDA 3KXKA 1G7CA 3LLMA 4L9WA 5BW8A 4YMSA 2XTZA 2LANA 1UFQA 3X1ZA 3BOWA 3DVEA 4ZIRB 5JSZB 5AK0A 3RWMB 2QE7A 1GGZA 5TDHA 5E3HA 1EESA 1XTSA 2QP4A 3V4RA 2B92A 2RB4A 2V54A 2L5XB 2W2XA 3THYA 3BERA 1EFUA 2RGAA 1TU3A 4Q7MB 4PAQA 4MKIA 4MKGA 4YXWA 2GK7A 1EXMA 1NSFA 1SULA 2DYKA 2LWIA 3TAHA 2IX3A 2F2PA 5L3QB 1N65A 2DFNA 2W83A 3A8TA 4I4LA 1KWOC 2EC6B 2LP3A 3RM1A 1DADA 2CL7X 2Z4SA 3RRMA 3SG7A 3G5UA 1XFZO 1R10A 1NI3A 821PA 1QF9A 1RTP1 3BOWB 1ZMXA 4IRUB 2O8FA 1CBUA 1RE0A 4PALA 4W5JA 3H4SE 1HE1C 2K7OA 1IH0A 5K8LA 2VHCA 3NG1A 1RJ9B 2QU8A 5HKZA 2Y8EA 1KK8C 3DKPA 4O0MA 5LD2B 1Z0DA 1J7KA 5FTJA 2QTHA 2VP2A 3BQ3A 2O0HA 1S8FA 4JBXA 2DR3A 2OAQ1 1D5CA 5HKKD 4CEIB 1VYUA 2WWHA 2O8DB 3RLZA 1S96A 1A4RA 2ZRCA 4EPXA 3I8SA 4I5JA 1FUKA 3ICEA 2CE2X 3GFOA 2B8WA 3AF2A 3KZ1E 5K8TA 2NCPA 1F71A 4UQOA 3JVTB 3KTAA 2AWNA 2LP2A 1YR9A 3KJIA 1P73A 3IO3A 2CNPA 4R98A 1QVIZ 2ZI9A 3CO5A 3DEFA 4JYBA 3X2SA 2BBWA 1DJWA 1CJVC 1QIWA 1G17A 1K5DA 3BJIC 4MZJA 1XFAA 1Z0JA 3EC2A 2YINC 4HRGA 3A8RA 4GL2A 3LCPC 4YMVA 1ANKA 5LBIA 5JMTA 1IY2A 3LW8A 3WP0A 3DMDA 1TQ2A 4XJKA 5FR2A 3U60B 4HLQB 2XGJA 1IN7A 1MO4A 2GEDA 4P4TA 1TNPA 5JI2E 4N1FA 2NGRA 2OT3B 2K7DA 1S6IA 2G2BA 4HLDA 1A2BA 1IG5A 3HDTA 1U9IA 2HLDA 2V4ZA 3IILA 4OQFA 1U99A 1NN3A 1R2QA 5F2EA 5B2ZA 3PUYA 1QZXA 2MMGA 3QXCA 4DLRA 2QAGA 3FWCA 4QM7A 1KZGB 2MLEC 3KF9A 2FWRA 1IWQA 4LBWA 4QNRA 2G88A 3U7GA 3SS8A 1UHNA 4TYPA 1TIZA 2KAVA 1US8B 1S36A 2M49B 3FWYA 4GP7A 4HB2A 2F43A 1U8AA 1UADA 3UANA 1K93D 2I2RE 4DSNA 1XEFA 1BOFA 1R0XA 1U0JA 2IYYA 2WWFA 1KCYA 2KJQA 2KAYA 3HR8A 1L7ZA 3SYKA 3Q7QA 2FZLA 2XNSA 5JCZA 1UBFA 2QTVB 1QX2A 4DCUA 2FEOA 4XSGA 3NEJA 4FCTA 2KBMA 5DO9A 4B74A 1MO6A 3W6PA 1G7RA 2A5GA 4R2HA 2OPOA 3X1DA 2NCOA 2IL1A 3QG1A 3OAAD 2WJVA 4I1UA 2JATA 1E2EA 2BVNA 4UKDA 4POAA 1NX1A 1Z08A 2I4IA 3O47A 3W90A 5TVKA 3CNLA 1E9SA 2P3SA 3EZ2A 3VR6A 2YWGA 4Q19A 2GDJA 1WY9A 3GD7A 1B8LA 3PQCA 2R65A 2VHTA 4OR9B 2GF0A 2IYWA 3PEVA 1OHHA 2CXJA 2OFOA 4YDHB 4QG7A 1NP8A 4C0HA 4D0GA 2GWHA 4Q1AA 2OSBA 2J9RA 2ZS7A 1JFJA 1KSJA 1NF3A 2QBYA 1EWRA 4C7OB 2GBLA 3K0EA 1S3GA 2P0EA 4N1AA 3PFVA 2CJWA 2Z4RA 4ARZB 1B4CA 3LX5A 3O8CA 5CSFA 3THOA 1XO5A 1CM1A 1RZ3A 1N0UA 2E87A 4IL1A 1KK8B 2JIZD 3RHFA 3LK0A 1ELOA 3J81k 2ZE8A 2LAPA 3LO5A 4EKDA 1QHHA 2CLDX 2JJ2A 3AVPA 4B76A 1DAEA 2BKHB 4Q00A 1FMLA 2AKAB 5ER4X 2IYVA 1XEWX 1MR3F 1VYVA 3NBZC 4UNQA 2GESA 2EFDB 3Q5EA 4YGEB 3FE2A 3KB1A 3OF5A 4IXMA 3TGPA 3VX4A 1X6VA 1OZOA 1P2VA 2OAP1 3RANA 3UG6A 1K96A 4ACAA 1NIWA 2JLWA 2GVDC 1SXJA 1NSHA 3WXAA 4C0LA 1J2JA 3CBQA 1E2QA 4CDGA 2CLSA 2GK6A 1KSOA 1KSFX 2KBIA 3T1TA 1AZSC 3U3MA 2JCSA 4OHZA 3AP2A 1UP5A 3AAKA 4GBAA 1W0JD 4UXJA 1F2UA 1G7SA 1AS0A 2Q3FA 4JT2A 1XMJA 2K0JA 4IEIA 2JQ6A 5F6TA 5HZKA 3K0CA 4DCSA 4XJXA 2FNAA 1K90D 3ONWA 1A5TA 4C0AC 4A0HA 1OF1A 1K94A 1MQ1A 1UKEA 4HLUC 5HE9A 1F2TB 2KBEA 3AF0A 4XTCS 3O78A 2FE4A 4I1VA 3OESA 1SQ5A 3CONA 3SG6A 1BR1B 3UMRA 2C78A 1IXRC 3F0TA 3FMOB 2YOHA 1U94A 4TTPA 5FOTA 3UWKA 1CFFA 2ZRJA 4C0SA 4QJ4B 4AKEA 3RSOA 3I72A 4L9SA 1N6IA 1MH1A 2VSXA 2ODEA 1UUSA 3QOFA 1VMAA 1PSBA 3H1TA 1N2CE 4QHTA 4N5XA 1C1YA 2QQEA 3FVQA 4BFVA 1E9EA 1BYIA 1M31A 3GK4X 1IBRA 1IQPA 1KI4A 1T8UA 3BXKA 2KI5A 2XNDA 3DDCA 4US0R 5AJZA 3C8UA 3I61A 4O25A 2FDCA 5EP2A 2HQ8A 4XJKB 2BJVA 2BV3A 5E7JA 3R8FA 3IKJA 1B0UA 4TQAA 3CF2A 1QRAA 1KQMC 2XB2A 3RC3A 3EVUA 2Q9AA 1E94E 5BYKA 1S3PA 2BM1A 2ZRFA 4HLUA 2E9SA 4TSFA 3U3OA 1CF4A 1ZMZA 1H8HA 3EWSA 4GGNA 1TQ4A 2E1RA 2R9VA 4Q01A 2I7AA 2VHUA 3F8TA 1XFUO 3TDUA 1R4AA 1XEWY 4GZMA 2Q6TA 4NU0A 1ZYUA 1GL7A 1CFPA 4PHJA 1ZC3A 2OG2A 4UNNA 1G6OA 2FU5C 3WBKA 4A0FA 1YHNA 2HPSA 4M1MA 2VP6A 1PVAA 4L5BA 1OYYA 2Y4QA 2M1KB 1JWDA 1QHXA 1T4GA 2BWJA 4AYWA 2GXSA 4LHWA 3LY5A 3CPHA 2LV7A 1FQKA 4YLGA 4MRSA 4Q1BA 4ORBB 1AN0A 4M2LA 1LVCD 2REXB 1NIJA 3T1VA 4TYWA 1TL7C 1DG1G 1BMFD 5HZHA 3IEVA 1U81A 2BIFA 2ZITA 5E7MA 1CIPA 1FPWA 4OK5A 1EG3A 4PSAA 2NTYC 1CFCA 2YVUA 4R9UC 3ICQB 2AWOA 2HT1A 4N3NA 4C2UA 1PUJA 1YJ5A 2WOJA 4X8HA 3S1AB 4MGIR 1NLFA 4NONA 1BKDR 3SE0A 2ZRDA 4FTGA 3ZIAD 1T9HA 4IFBA 3UG7A 4IFEA 3CF0A 3KKMA 3JVTC 4PHHA 3WMGA 2Q9CA 2D7DA 2C9YA 2F33A 4MRYA 2ZAOA 4JLDA 4DT1B 2WC8A 1QHGA 2HJVA 1QJTA 2W0MA 4F4IA 2XOKA 1XPUA 4KLZA 2KNEA 3FMIA 4HSEA 2LE9B 1D2MA 3AVXA 2IEYA 4DUQA 4M1WA 1KSMA 5D7FA 5C18A 3LX8A 3EWAA 4BWYA 4H1VA 1RECA 4RVCA 4KFTA 3E1SA 1D2NA 1BO6A 3IPYA 2ZSFA 2OCYC 4OHVA 4LDJA 1GFIA 4F92B 1MT0A 4HB3A 1F8HA 1DTSA 2QBYB 2WJHA 1MKYA 3PUVA 4KU4A 3NEYA 2H92A 3UPUA 1ZOTB 2GGMA 4BLSA 1X02A 2AHOA 4M2OA 1E2HA 2W6IA 2C9CA 3NC1C 4ARZA 2AUCA 2YV5A 4PAOA 1QLKA 3TSZA 5F3WB 2IS6A 3EZ7A 5JJLA 3SZRA 3CZTX 5KNBA 4D0LB 3TUZC 2IEZA 1R0YA 2H57A 2FFQA 4Q5IA 1MXEA 4HATA 1YE8A 1UJ2A 2A5JA 3EASA 1U2RA 5JWOA 1OIXA 3QNUA 2ZRPA 3I62A 1OFIA 4HDQB 5DSZA 1H8HD 3ZJYA 4MKFA 4QGHA 5JFGA 2WMNB 4GMXA 3PUXA 1AGRA 2VF8A 2O5GA 4YMTA 4F4JA 2JLQA 4X8LA 1J8MF 4QJ3B 2BMFA 2PVBA 1L2TA 4PSKA 2ZJZA 3K70B 4U5XA 3TE6A 3KL4A 3CKLA 3IQXA 5AEQA 1UHIA 4QHSA 4MVFA 1MRSA 4ETOA 4TZ6A 4N1GA 5KSPA 3GLIE 1OH5A 4DZZA 3DKVA 5FFMA 4QBHA 4EDHA 1WRKA 2W00A 1KYIA 3BB3A 3C5HA 2IT1A 1ZFSA 3EXAA 1GNRA 1XPRA 3BUNB 1LTQA 2WNDA 1E0JA 2PX3A 1XFWO 5DI3B 1GJYA 2RGIA 1IONA 3B1XA 4XH9B 4AI6A 1SCMB 3K53A 4NYIQ 1GP2A 2WOSA 4UNRA 1R6PA 1HA3A 2CMKA 2D06A 3B5JA 2NO0A 2R6CA 1VHLA 2OFWA 2GCOA 3I92A 3R9IA 5EP4A 2N42A 3CWZA 5HCNA 4IOMA 1Q80A 3LBHA 5C46F 1TCFA 4LHVA 1FNMA 1XTJA 1SL9A 1FBVA 2WTUA 1Z22A 3F3YA 1R5NA 4GPTA 1T0HB 3OAAA 5FL7D 4PE1A 4MGKR 2ZS9A 1M63B 2KI6C 3BRWD 3WNBA 4AY2A 2IXGA 1IJEA 2EQBA 2ZI6A 4LJYA 2PEZA 5G40A 5KO2A 5KOYA 4A6XA 1TNQA 2QN6A 3AF1A 1CR4A 1Z0IA 2V3CC 2QMOA 1P9WA 2L0XA 3ZQJA 3GFTA 3QXXA 5BN3A 4BQSA 1W36B 4PTLA 1SVOA 5B30A 3GP8A 3A1UA 4V0OA 4V0ME 2Q0HA 5BWMA 2JRFA 1DGVA 1GRNA 2IHBA 1AJ4A 1OFTA 2B7BA 3A36A 3GJ6A 4WOPA 4XD7D 2IYRA 2QNRA 3AVQA 3M6AA 4DSTA 3W5JA 2ZI7A 1Z47A 1YTZC 3QKRB 1G8YA 2XJ9A 4B73A 1TX4B 5UKDA 1YUSA 4JWQA 4NDDA 2VP5A 3UMFA 2ONJA 2PCLA 2W0SA 1NIPA 1KY3A 3AKBA 5HKWA 3M4YA 4BASA 2VA8A 4GOJA 4RJLA 2O0JA 3NSLA 1F5NA 4PO1A 5G3YA 4D4MA 1Q44A 1Z06A 3I5FB 3EIEA 5HLOA 1SXJC 3HYTA 3S1AA 2HXSA 2QAGC 1Q1BA 4I1SA 4LPKA 1JB1A 2A5DA 1E79A 2ZYWX 1GL9B 3GEEA 3NTUA 4TLAA 2QPTA 3QKRA 1XMVA 4FW9A 1EX7A 2V8OA 4V0KA 1MABB 2H5EA 2BCBA 2LKCA 2OXCA 1NUBA 1N0VC 4Q04A 1E4YA 4IKEA 1Z6YA 1ZU5A 3KUDA 4MYHA 5BQ5A 1WBBA 2ZI3A 3GEIA 2IK8A 4FMCF 2JXLA 3VRNA 1S1CA 2GXUA 2GXQA 4XVQA 3A6PC 3R9WA 1W2HA 4DRZA 4URZR 5FBLB 2HJGA 2BCAA 3DZ8A 1XX6A 3BFXA 3PR1A 3DF0B 2R2AA 5A4JA 1JF2A 1AQUA 2AK2A 4MZKA 4JKYA 4S35A 5GJVC 5DHFA 4NZYA 4B44A 2IWHA 1KNQA 1FX0A 1WMSA 2VO1A 1JXMA 3GEHA 4L4UA 4KYUA 2C99A 4JSTA 2VP4A 3NH9A 1E2NA 1S26D 4GI7A 4M1YA 4O2LA 421PA 4UNSA 4CF7A 1VIAA 1XB2A 5AUQA 1EJ3A 4FWTA 1KK0A 2WZQA 4M2PA 1XZPA 2JEOA 4KSBA 1X86B 1HQVA 1NRJB 1SZPA 3AM1A 3OHMB 3QXHA 3L2OB 1E9AA 2GEVA 4WXPA 3DO6A 1JEEA 3A4UB 3ZD6A 1CRPA 1XPOA 3WNXB 1L4UA 4PQRA 4OI1A 3VR5A 1ZCAA 2OLKA 4HUQA 3SNHA 1G8FA 2KQYA 4JL8A 3CLVA 2ZU0C 1BJFA 1SYMA 3PALA 2QM8A 4HAUA 4NHOA 1QVIY 5HTKA 4TYNA 4GAOA 1Y0VH 3GJXC 2CCMA 2HV8A 5FUYA 2JT0A 3VFDA 1XNJA 5DGXA 3ADDA 3UK6A 1YVLA 1XMIA 3AVTA 4QJ3A 2V9PA 4YGCB 2F1IA 3W34A 4JVMA 3EW9A 2D74A 3NKVA 4ZIRA 1WLMA 1J7OA 5HKKA 4DVGA 1W4BA 1NN5A 1KO7A 4HZUA 4PZYA 3DHWC 5BN4A 1WDCB 2YWFA 4ZO4A 2J45A 1ZIOA 2Y1MA 4C0BA 1KK1A 2CTNA 2FPMA 1Z6TA 1KK3A 1SGWA 1CKEA 3ZVLA 1XK4C 1P72A 4Y0VA 2JLVA 2X1VA 4DLYA 1R8QA 4OV2A 2CCGA 2ZNEA 2GKSA 2XZOA 2XSZA 1DF0A 1KI7A 1WE2A 1JEDA 3QJYA 2GXAA 1G16A 1PK0D 3CNOA 4TQ9A 2OESA 1FW4A 4MSPA 1P75A 2JLRA 1RYFA 1MO5A 2P65A 4G5RA 4Q1EA 4QGAA 5LB2A 1SBJA 4L9MA 3MJRA 1S3SA 1KWOB 3I3SR 3KHEA 5BXQC 4XWOA 3NDBB 1FFHA 3KJHA 4GZLA 3LA6A 2QT0A 3L0PA 1QHYA 2P6RA 4Q9KA 2Q9BA 1GKIA 4A9AA 4LZZA 2MA2A 1JR3D 3KB2A 4B3XA 5DKRA 3QF4B 3FWBA 4Q9IA 4DLVA 2K2AA 2R6FA 3AH8A 2JPTA 4ERNA 2EYUA 1Q1EA 1N0WA 5IK2D 4MBEA 1N6NA 1A75A 721PA 1XEXB 3LDAA 2JJ8A 4YRUA 4EFMA 2LLTA 1WDCC 2J7KA 3NDPA 4PPGA 1ZM2A 1NX3A 4PHGA 5I2LA 2ECKA 3CTNA 2GJAA 3TRFA 3VKGA 4LJ5A 3CWQA 5CJ2A 3CRW1 4B43A 1CU1A 1DELA 1OKKA 1QASA 1YU9A 2YWHA 5B64A 1F60A 1UAAA 2BEJA 2EU8A 4BUJA 2M7LA 2HEIA 2AR7A 1XXHA 4AC9A 4P0TA 1P9NA 4FINA 4EFLA 2CHQA 5FTLA 4D26A 4OHXA 2RHDA 2AFIE 3MWYW 3RAPR 3WMFA 3VROA 1VHTA 3QRXA 3RC8A 2EW1A 1GSIA 2JLSA 3A58B 4EPYA 5FYXA 3VHLB 1EL4A 5HPYB 2WICA 5DNYB 4ZCMA 5AANA 4BLQA 5KNCA 1VG0B 2G3YA 1G9XA 1UM8A 1A2XA 1CLUA 1YZKA 2ZUDA 3QXJA 2JLYA 4RY2A 3U61B 4QM6A 1G6HA 4Q4JB 2KQ6A 4RD4A 1BU3A 2LKDA 2V1UA 2V6IA 4JSYA 3BUXB 2H18A 1UHHA 2NG1A 3OIWA 4EPVA 2FF7A 3P4YA 5L3RA 4D80A 4PPFA 3CLNA 1W44A 5L3SB 3EC1A 3L8ZA 1R7RA 2XXAA 3EIQA 1JUOA 5F9FA 1M46A 2F3RA 2J1LA 3CZQA 5CM8B 3X1WA 1L8QA 2ZUBA 3CS1A 4BFYA 5HKYA 3O4YA 3K21A 4RZ3A 4WAUA 2Q4UA 4TT3A 1MABA 1SHKA 2KI4C 4WZ6A 3CX6A 4B47A 1JR6A 3SHFA 3REFA 3MJHA 4MUBA 5AUNB 2L4IA 3RS4A 1LV7A 1UDWA 4HEJA 3TAUA 2ZE7A 2GV5A 2RGCA 1XYDA 2MJWB 1T3LA 2JJ1A 1G18A 5HE8A 2SCPA 2BECA 3OHMA 3H0KA 2OCPA 1FX0B 2K7BA 3FMPB 1OSNA 5DH9A 1P2UA 3FHTA 3T12A 1ALWA 4XTRA 1B9AA 1SPYA 2M3WA 2NO7A 5J4KA 1NMXA 3K9HA 4AG5A 4BZPA 1CRQA 3U5ZB 4CLNA 5KSZA 2ZANA 2LVKA 2BHRA 2VEDA 4DDWA 1UBCA 2IXFA 4MN0A 4DSUA 4CEIA 2EFHB 3B9QA 2XTNA 4ORAB 1CJUC 2ZJYA 4RD3A 1OXXK 2GVZC 2YYZA 3G82C 1HT2E 3IBGA 2P6UA 2DBYA 4BGDA 1H8ED 3TS5B 4JLOA 2XX3A 1JSAA 2JTTA 3QI2A 1WRBA 2ZRSA 1AHRA 2D2FA 1UEIA 2OBMA 2ZTSA 5H68A 3W3ZB 1AZTA 1OYWA 1KO1A 3QKSB 5IT5A 5CB8A 4XOIA 2XAUA 1OXUA 1RFJA 2QGNA 2VP0A 2DOQA 1ZUNB 3TDZA 4ITRC 2QMUA 3OEED 1E69A 5D3QA 4B3BA 8OHMA 1H8BA 4ZKEA 3IQOA 4KFSA 1EFHA 1OT3A 1U8YA 5EE9A 4Q4AB 4U8DA 1N25A 4JLKA 3SOPA 4GT1A 2PT5A 4KXFB 4MQBA 1W2GA 3DOEA 4NKRA 3SG3A 1SCVA 5EZ5A 5AJYA 1IY0A 1RYHA 4AG6A 2IYLD 2KGRA 1G20E 4YC7A 5FPKA 3CRRA 4R2IA 3BFKA 3BH7A 1N6LA 1W0JA 4MA4A 5CJPA 3GLIA 2M9GA 2XEXA 1Z28A 3QPUA 3RS0A 1CLMA 2W58A 1B23P 1ZC4A 3B1VA 3JZAA 4KBGA 4HUTA 4MUAA 1YR5A 3WYFA 2B1UA 3SHWA 2GA8A 2GCPA 2ZJBA 1R2UA 3TMKA 1AUIB 1V43A 4WA7A 4BECA 1JI0A 4TQUS 5LD2C 4JVSB 2Q3MA 1BG1A 1GKUB 4RZ2A 5EQTA 4PX9A 3K0FB 1ESNA 4C0QC 4OK3A 1DAMA 1PVBA 2ATXA 2VIIA 5IK2A 1Q1QA 2ZJ8A 5TARA 5CPVA 2OO7A 4A92A 4BFWA 2JTZA 1ZNYA 1CTQA 1P2TA 4TMZA 4BFXA 4P4UA 3EX7C 1WBDA 1F54A 2BM0A 1VRKA 4MEWA 1PUIA 1W49A 2F9MA 3QVUA 1W48A 1KI2A 2PJZA 4M8NE 2ZRLA 1XD8A 1G1MA 3LQRA 4USLA 1NLZA 1OW3B 3AF3A 4HAVA 4IJMA 3WHLA 3M0EA 1P61B 4M9SA 2QP9X 1E2JA 4D25A 3RLFA 2FPLA 2QGZA 3B9PA 5BN5A 4IDOA 3NIBA 2FX3A 1OHHD 2JWWA 2VQSA 4PHTA 5FPYA 2LMUA 4FN5A 521PA 3SG2A 1ZCBA 5AFPA 1PRWA 2CBLA 5ELXA 2W6JD 1K5GA 3FIAA 1DT7B 2KDHA 2AXPA 3FKSA 1JQLB 5I8NA 4C3ZA 4Z8YA 5DLQC 4Z51A 4OQLA 1TN4A 4JLVA 1HV8A 4NYMQ 2KSPA 1FF1A 1T8TA 4V03A 5CDFA 5K8IA 2XXAB 2LNKA 2ERYA 1E2GA 1TCOB 2CHGA 2ZSEA 1IOZA 3I8XA 4US1R 3EVRA 1TNXA 3PN7C 5EE1A 5FPSA 4TMKA 2ZXUA 4B34A 4KVAA 5TV2A 3EZ6A 4B2IA 3MSEB 2JGNA 4Q7KA 3IIJA 2B7CA 4Q4LA 3SJSA 3T5DA 2PMYA 4TLCA 4HAWA 2D4HA 2BBSA 4UNPA 1CXZA 5LDDC 1OIWA 4NCIA 1WQ1R 4ASUA 1IGVA 1P60A 2ZRNA 4LHZA 4Y0AA 2NO6A 3TUIC 3AQ4A 1DVIA 2IA5A 2VSOA 3IQWA 3SJAA 3VR3A 1IXZA 5LPNA 1A1VA 3AUXA 4B3CA 1AS3A 1IN8A 3EA5A 4OJQA 5EUQB 1SVLA 3PVSA 2JT8A 1S5GY 5CK4A 5IRCD 4QBIA 4S2EA 2WWGA 1CLLA 3K9GA 2HQWA 2PZEA 4YGBB 2NIPA 1RWYA 1DEKA 1GUAA 4DKXA 3SJZA 4M1OA 1Z29A 1GQMA 1AKYA 5KDOA 2JOJA 1COWA 2LLUA 1G4UR 1IKUA 1XRJA 3KJEA 4TWZA 4ESVA 4GFTA 3A4NA 3SBDA 2Z5FA 2CNWD 1K8UA 1NY6A 1Z8FA 5KDLA 1KO8A 3V4FA 5G41A 2KI6D 1J90A 2VH5R 3K1JA 3I5HB 1AP4A 4OI4A 3LL8B 4V0NA 2MSEB 1Z6AA 2C04A 3HR7A 1LVGA 3SDZA 4CGZA 3T61A 2DB3A 4MYUA 4H1UA 1J7QA 2NZ8A 1KO5A 1A2KC 2FSHA 2AL7A 4OHYA 2LCPA 4B75A 2LVIA 4FMDF 3U7EB 2QMEA 1EK0A 3GPLA 3PM8A 3EKJA 3GJ4A 3H84A 4LK2A 2ZSDA 4LJAA 3R7WB 3FOZA 2O52A 1XP8A 3V9PA 3GJ7A 4M4SA 4Q4AA 4MRPA 1D1OA 2MSCB 4KODA 3SYLA 3K0CC 1NBMD 2QL6A 1TU4A 1HT1E 1EFTA 1KFXL 2C95A 1XWIA 4OQNA 4PXAA 4WBSA 1W7IB 4DHEA 3IIMA 3BBPA 2HF9A 1YZTA 1S6CA 2KFGA 2UZ3A 4E68A 1RRCA 1A4PA 4C0JA 3ASZA 3ETLA 5CSJA 3PV0A 2P2LA 4MRVA 3QKTA 1XEXA 3A4MA 1U5IA 4AQJA 3NBXX 3O8DA 1S1MA 3MD0A 5EXSA 5DE3A 5J40A 1CR2A 1YZGA 5JJKA 3R7WA 4HREE 1W46A 2QE7D 5DKQA 2JT3A 3BC1A 4ZPXA 4AURA 1ZM7A 4GMDA 1X1RA 4AK9A 3NWJA 1SCMC 1TF7A 1LF0A 1XXHE 3Q72A 4A4DA 1NWDA 4CZ2A 1W4AA 1KSGA 2VBCA 4URVR 4JL6A 4IVPA 4J0QA 1JPNA 4PAMA 4ASUD 5DISB 3CWGA 1KJWA 4Q02A 1Q3TA 4DLSA 3K8YA 4R1EA 1YRAA 2FA9A 1IHUA 4P33A 1JFKA 1B7TZ 1E99A 1CNPA 2WSSD 5EE5B 1QHSA 3HPRA 5FOUA 3GJ5A 3R8CA 1GITA 1HQCA 2FFHA 2UKDA 4K81B 3ZLJA 4DCTA 1BLQA 3C5CA 1G8HA 2A7QA 2ZI4A 2QACA 3CRQA 4B2LA 2OE2A 3GK1A 1Z0KA 5K8UA 5FOXA 3TQCA 5J4VA 1KGDA 2X77A 4B3FX 3ZZUA 4LC0A 1X8KA 1MF8B 1JBAA 4Z1MD 1KI1A 1MWNA 2MHHA 3GLGA 2AAOA 2F1JA 1FTNA 1E9DA 3AKDA 2LVVA 3DMNA 3Q5DA 3TSWA 5GJWC 4DB4A 4IW3B 1UBEA 2HCJB 3B1YA 4M1TA 1PZNA 2BOVA 3AUYA 4QFMA 5EXPA 2OM2A 1NVVQ 4ZDKA 4ZKDA 3MWJA 2ZFDA 4EQ6A 2V7QD 1LS1A 4W9MC 1TRFA 3KQLA 2B8TA 4F0ZB 2CEAA 4LV6A 2BMJA 3AVOA 1LINA 2WORA 3I5HC 4JLPA 3LVRE 2PCJA 1OXSC 2WIAA 3K0SA 1Q22A 4L8GA 5CIQA 1BT6A 2J0QA 4HZIA 4XVUA 3IIKA 4GBMA 4EPRA 3WHTB 5KU1A 1Q12A 1SVWA 1F3OA 3OX6A 1ZUHA 3A1TA 3LD9A 3T35A 4LOAA 1NNEA 1G3MA 2WSMA 3AKEA 1F4QA 1KFXS 1DMOA 3N70A 3PCRB 4DSOA 3REGA 5C1BA 2QTFA 2CK3D 3EK7A 1NBMA 2WMOB 4GP6A 3WNCA 4YMUA 3JTDB 3CH5A 4F38A 2LCFA 3W6OA 1FTSA 4F4CA 2F8PA 1I4TD 1GIAA 4HB0A 3OP0A 1RRPA 3LV8A 4KSCA 4EIWA 1JAHA 1HTWA 1E9BA 2K5UA 5EXTA 5SZIA 4WRIA 1YKSA 1DAHA 3QPWA 4PQYA 1TQDA 1IQ3A 1KIMA 5P21A 3AKCA 3RS7A 5CDFE 3NXSA 3EKHA 3B85A 3QKUA 1RROA 1D9ZA 2FEMA 2BBNA 3D7MA 3DL0A 3R9XA 2EGDA 4JZKA 4B35A 1YQTA 4BZXA 4KI0A 2DFLA 4QC2A 2KWIA 1XA5A 1S6JA 1E79D 1ZM4A 4JLAA 1TNDA 1WCV1 2BMDA 2MLFC 2ZREA 1QX5B 1G8PA 3GQBA 2G83A 2W6ID 3CNNA 3DPUA 5FPTA 5JEDA 1SXJB 4WIAA 2FJUB 2CNWA 3WNDA 4DC9A 4N0EA 2DCUA 3PATA 1GNPA 4NCNA 2EFGA 4QNMA 5A0FA 5AUOB 1JF0A 4D2IA 5D3MB 1COWD 4TTQA 2WWIA 4LYHA 1WF3A 5FOSA 5TB5A 1XJQA 2O8CB 2R6GA 2BBOA 2A5FA 5JEEA 1EXRA 1XMSA 2G1JA 2JLUA 3H4MA 1F55A 3I32A 4V02A 1QVRA 3TR0A 4E09A 3TIFA 4PC3A 3OIYA 1X3SA 2L50A 4LCBA 2XZLA 1TADA 3BUOB 4PE0A 4D81A 1QX7A 1H8EA 1YUTA 2IF0A 2IBMA 1KMHB 3SR0A 2XOKD 3B1ZA 1KDTA 2UZIR 1N3BA 1M45A 1LNZA 2FSGA 2F9LA 1TUEA 3PUZA 3B78A 3IPXA 1UHJA 1SVMA 2JU0A 1TUIA 3FB4A 1PLLA 4FI3C 2N46A 1J1EA 3O6BA 1AJEA 3K09A 2O8CA 4AWXA 3EG5A 1N5JA 2O8BA 1CKKA 4QBFA 1DAGA 1W4RA 3FS7A 2X8AA 3PEYA 3WXMA 4NYJR 5FPHA 2WV9A 4RZUA 1ZUZA 1A7JA 4QGGA 1BMFA 3P32A 3D6TB 3TVTA 3I5YA 3SC3A 3T06B 5KSOA 3LH5A 4Q1CA 1A82A 1E2KA 3WHKA 1PJRA 1RIFA 3SFVA 3BXZA 4A4BA 2FV8A 2EHBA 1MOZA 2FN4A 2GZHA 2QM7A 4TMWA 2AD1A 2IUSA 1Z83A 3ADKA 2RGNA 3ECCA 4PPNA 3OIUA 5SZJA 3BD9A 4DBLC 4IDPA 3KQHA 2GEUA 4V0MA 1YZLA 4KAXA 1MRNA 1RRGA 2IF2A 3U3RA 4C2TA 3MRSA 2ODBA 3U4QB 2EC6C 2LVJA 1GM5A 1IJFA 1GOTA 2CL0X 5IDVA 2ISDA 3RWOA 4Q1FA 3NVAA 4LYFA 2WCFA 4WW0A 3CRMA 1JR3E 3SEAA 4GUKA 2YZ2A 5J5CA 2F7SA 3P1JA 2LLSA 3I5IC 4LC1A 2OTGC 3NSIA 2P6NA 1NG9A 2ZI5A 3TK1A 4MZLA 3B7GA 3EK8A 5IBWA 3IBYA 3RRYA 4GFDA 3W8RA 4O3MA 3OFND 4P32A 3C1VA 5B58C 4C4PA 4IXNA 2ZYVX 3CZPA 5FUXA 4BRUA 3TNFA 2I18A 1XJCA 3W3AA 5TXGA 2G77B 3RSLA 1OOJA 1ZNWA 1S9HA 4DUGD 2KAXA 2VRWA 4US2R 1OH6A 2J41A 4H9GA 2R62A 1OKKD 3UIEA 1VIYA 1LFDB 5FOVA 3GOFA 3WYAA 1RPZA 1IN4A 1KKMA 1I2MA 2RCNA 1SHZA 4JYCA 4NDCA 2W2VA 4QJ5A 5CLLA 4B3DA 5EE3A 4D4JA 4Q9LA 1KQVA 2BL0B 4GRAA 1BMOA 4JS0A 2O60A 3W8NA 1NCZA 4PQFA 1NX0A 4CPVA
chains in the Genus database with same CATH superfamily
2H1HA 4GX0A 2J7PA 2VSNA 1YUUA 3E61A 4W1RA 4LX8A 4QDOA 1TZCA 4BB6A 4E46A 3J7AC 5MF6A 4P08A 1ES9A 4HRAA 3KO0A 3BXXA 4OI0A 1SWWA 4M89A 4DQDA 3B20A 5DBIA 1D2EA 3G17A 2QD3A 2IKSA 2MINB 2VXOA 4KWTA 4B8YA 4DMGA 1K6XA 2Q1YA 2HCBA 1TUZA 4ICBA 1QSGA 1JJ7A 1Q21A 4KN9S 2GJ8A 1SQFA 4LRQA 4TTIA 4CM8A 1FSGA 2ZJ3A 4YJFA 3TIVA 3AEZA 3VPGA 1F6BA 1PUXA 1ZMBA 4J07A 1Q20A 4RFVA 3T95A 3QHAA 5B57C 2DR2A 1SCJA 4JBNA 1TNWA 4Y1RB 4F97A 3WYBA 5ENZA 4LHEA 2WTMA 4PC6A 4YRIA 2CL5A 4MLWA 4KQIA 2LCIA 2V3VA 5E4YA 2QD1A 4TTRA 2PGOA 2AK3A 2BCEA 3T7TA 4BJ1A 4AJJA 5JASA 3ZJTA 3A6EA 4OKIA 3U1BA 3I01M 1GZVA 1RWPA 5AJWA 4ON9A 3CQ9A 3KX2A 4DSAA 4DA6A 3NC4A 4UARA 1PJ8A 3BGWA 3W2TA 3U3JA 1YV9A 2XCRB 1I2AA 1DXHA 1YR6A 5CLQA 2ACEA 5ULLA 3ZXIA 3HYCA 1DRVA 1Z7BA 1V9CA 2ZR9A 3WWEA 4NBSA 5J4HA 3TLKA 3UB3A 3C5VA 5FUBA 1XQXA 2AOXA 1O57A 1XMPA 2W2TA 2ESRA 3A3YA 3NR2A 4R0MA 1R4NB 4A0RA 2TRSB 3WL6A 3VRRA 2FH5B 1CS0A 2CLHB 4DWVA 4WQ2A 2VH2A 3EZXA 3KUCA 4NESA 3VR4D 4GOKA 3C7KA 2O57A 2P5YA 4TLDA 1M39A 3ZY2A 1N5KA 4WOBA 4GPLB 1JTEA 1NY5A 1T4DA 1T3GA 2HLNA 5EIWA 3VU9B 2H7VA 4MR9B 1H9CA 2ZPTX 3I39X 4QAJA 1PQWA 1WVIA 5AD1A 5EZYA 4PC2A 2WJYA 1T43A 4CF6A 4ZGGA 4R0VA 1TKBA 5FBWB 1VG9B 1KP3A 2WU8A 3OG9A 4MXDA 3NYWA 4YRPA 5LQSA 2A9RA 1T9ZA 2VPZA 4FYKA 4E22A 4P5EA 5TT1A 3SXUA 1CK4A 1W5BA 4QYSA 4X44A 4FDAA 1J7RA 5F9MA 4MV6A 4G5GA 3AHGA 3D6AA 5HIJA 5AM2A 4D3YA 2XECA 3FCSB 5DI9A 1QIVA 1Z62A 4BX9A 4DA0A 4C3OB 5KX5B 4F91B 2W2QA 3UWDA 4MZDA 5LQAA 3T5TA 4BO6A 4DDMA 1NN1A 1JFLA 2PPLA 3CZ4A 4X6XA 1NHWA 1W94A 3RSQA 3V00A 3LX6A 4YDSA 4CEJA 1U28A 2LE0A 2XXJA 4R1LA 1N1DA 4YQFA 1S7GA 4BYMA 4R8SA 5LQKA 2I55A 4FYWA 1NW9B 3CIFA 4HCJA 3ZQ6A 4TKZA 4YUVA 1LSOA 1TFRA 1OFGA 1PLKA 5DYNA 2XCUA 2WLTA 4BEJA 4EJSC 3F46A 4OJKA 2RGBA 3P4XA 4KUGA 2XB4A 3IUJA 3NSOA 2YXBA 2BN4A 4C76A 5EZYF 5IDWA 3WL5A 4YT5A 3HKCA 1RLOA 1GTZA 2VJCA 4FPXA 2WHRA 1KGSA 1GGMA 3B2EA 2GBCA 3D5QA 4TWIA 5GGYA 5BVGA 2XYGA 4CFZA 3IRUA 3M49A 3OZWA 4MUIA 5E0KB 2ZBEA 2CJWB 5TSDA 3ZHUA 3SQXA 4NYIR 2BEVA 4PLFA 2ZPAA 4M38A 4CEJB 4J1SA 4GYWA 3OICA 2EWMA 4X1IA 1IXSB 1NW6A 2ZQ5A 4Y9TA 3LOQA 4HFJA 1N2CA 4TSKA 4WXHA 2H61C 3KYBA 3TRDA 3WLOA 5BXYA 1E2BA 5JCXA 2B1IA 3QLVA 2HETA 1G20A 4FE7A 1V16B 2OV8A 4FOPA 1JR3A 3KQNA 2JH8A 4DC1A 2Q21A 2ERBA 1WSAA 2G76A 3GRFA 4QDTA 2H9IA 2WPDD 3HHEA 5CA0B 3H1EA 3OZXA 3T52A 2VDPB 4AYTA 4IDEA 3KLNA 4RBNA 3FF1A 5AJUA 4QJ5B 2PRIA 4BBPA 1R6AA 5FI3A 3WIUA 1ZBDA 4IXWA 2XOXA 5KINB 1JZTA 2BGTA 4X7MA 3EFBA 4C78A 1N5MA 4JI5B 3OX5A 4EELA 5BV1A 2YHSA 3R77A 4AZ0B 4LYGA 3C4VA 4CMEA 1CLBA 3H3FA 3GFBA 1PTJA 1C1DB 3KHSA 4Q3AA 3RAJA 2HOQA 5EFZA 1EDBA 2J0VA 3I09A 1W5FA 4PGFA 3RRNA 4CIAA 1KTIA 4LQ4A 621PA 4TKUB 3PGKA 5B3AA 2VNIA 4FC7A 5GV7A 3TBFA 2IE8A 5BRAA 4CM9D 2HI0A 1LBEA 1I7PA 1E0SA 3BXFA 4K28A 3THRA 3ZLVA 4DLNA 3IPAA 3Q12A 3KSAC 1PLJA 1XT6A 1FI5A 3KDPA 2YC2C 2JLXA 4JXXA 1P74A 1YX8A 1TYCA 1N0YA 1Y7LA 2OFPA 2RI0A 3OPVA 4KLNA 3SN6A 4DLTA 4FBGA 4EVQA 3MGCA 5IH7A 4DXAA 2IS1A 1LLFA 1MT3A 1X7GA 1JALA 1Y4DE 1GPH1 4IOKA 2NLNA 1HH4A 3T94A 1II8A 1PSZA 3OCYA 2XNKA 4JFRA 1T0PA 1LBTA 2AN1A 2VWPA 4MI1A 2Z6AA 1WNFA 5GGXA 1QB7A 3F6PA 4HZGA 2BI4A 4WOKA 2PASA 2ZCJA 4GQBA 3LLEA 1USKA 4BUCA 1QV0A 3RT1A 4BCDA 5FUVA 1J7JA 1DTWB 3ZIDA 4QTXA 5CFLA 5AW2A 2IGTA 4WSOA 3FSEA 3RS2A 4BY4A 4EKYA 1ZSVA 3G2PA 4EMSA 3EIHA 2NU6A 3EIXA 3FM9A 4R8RA 1FUUA 1XTTA 3E8SA 3H5NA 3A7EA 1HZZC 2A0XA 3OZDA 4MITA 4B6OA 2H61A 1NP6A 3AHHA 1NMZA 3N8HA 2ZR8A 1SR6B 1ICEA 1WX1A 1IZYA 3IEUA 5BN4B 1N2JA 3TLXA 4EGSA 4XSVA 4YT8A 2Q3BA 6LDHA 5KJ6A 2IBTA 2FSIA 1J21A 1TO1E 3CR4X 3P0FA 2PJRA 1RHRA 5L7YA 4UZFA 1ADJA 1U7TA 4DIFA 3LK7A 1VYTA 2J87A 4EH1A 4J2OA 1BEUB 4KRGA 1XZKA 4DCCA 1CUXA 1R16A 1LC0A 5EZYB 5AM5A 3BA6A 4I1IA 2GK3A 1L5LA 3WIEA 3UXMA 3TLAA 3PKJA 2AI1A 1ZAKA 2DHEA 2ZTLA 3NOXA 3VU1A 4D9CA 4CMEC 3KB8A 3YASA 4CF5A 5ES3A 3IV6A 2ZWPA 1U4SA 1UJCA 5DHAA 1SCIA 2XMBA 1WMAA 3M33A 3G13A 5TMDA 5J47A 2R6AA 3CH7A 3LY8A 2VF7A 2YJTD 2IKQA 5D7BA 3EZFA 2NZJA 3DZGA 2LC5A 3UMSA 2CT9A 5DTQA 5A2QA 3DKIA 2X14A 1YS9A 2BCJQ 4AJ1A 1ULTA 4JI3B 3SKVA 5D5HA 1S8NA 1NFQA 1O96A 3HJRA 3KHKA 4ZTZB 1Z18A 1SWVA 2VZ0A 3SSOA 4C4TA 1M2NA 4Y6SA 4PT1A 5JXHA 4UDOA 1QV7A 4Y2QA 5D69A 4LOLA 3O2QB 1EX9A 4NE7A 4B46A 4RC9A 3D78A 3BF8A 1WY7A 2G9BA 3LC0A 2NTNA 2VAVA 3EE6A 4L15A 4YJ2F 5EMLA 1D9XA 3HYNA 3VGJA 2BC9A 4C4RA 1ENYA 4HYYA 4H1TA 1PFGA 4JIMA 4RTLA 5JNVA 5LYJB 4QUHA 4O8CA 1U3CA 3M3PA 4XYBA 5C1OA 4JCOA 3T3OA 2CMDA 4TWAA 2EZ4A 4IIXA 4XFKA 4Y6PA 3H42B 3PDJA 3ROKA 4DM7A 1OWNA 4KQ6A 2YCLA 4PRKA 5LJIA 4DIDA 4KR2A 2A9KA 4Y3UA 1DJXA 3UMYA 3FLAA 4YRAA 4QFCA 2JFZA 3NM5A 4YALA 4DWJA 1KY2A 2KMLA 1AG9A 1I0ZA 3AESA 4IVRA 4R9VA 4E6EA 2B5OA 1KDVA 3TDNA 3RBVA 2ID8A 4AZWA 4DDUA 2IVZA 2GX6A 3E84A 3IV7A 4B4WA 5B3KA 1H5QA 4JUFA 1DLJA 2YMQA 4FILA 1HKUA 4LUCA 2G6TA 1XSEA 2BEUA 4ESEA 5A03A 1GPJA 3JWIA 3ABSB 3QFRA 3S55A 2BEKA 1YKGA 3H4VA 4K6OA 5JUWA 2BHSA 1XVVA 2FSVC 1N77A 4RPJA 4YVFA 5C53B 1OLUB 1E32A 4YB8A 5CT5A 1R0ZA 4BCCA 5JNWA 5FFFA 3HNRA 3O8LA 4MO9A 4UXIA 4X91A 4RM2A 4DIEA 4QYWA 1CP2A 1VBKA 2V6MA 1QFSA 3IUYA 1F0PA 4M1SA 3O2PA 2EJVA 2J7PD 3NHRA 3G9XA 2LHIA 3F4LA 4QPNA 1XTQA 3RU7A 5BMVB 2QTMA 2JARA 2M1UA 1Z4MA 2FQ1A 3GC6A 4OFZA 3MS2A 3RW9A 3QEMA 4BMVA 1X1AA 4FCCA 4FS3A 5ILGA 4LJ9A 4IXTA 5CA1F 1F14A 5LA6A 5AERA 3NLLA 2AFHE 3TQQA 3OX3A 3PSRA 5KJCA 1UWOA 4BL5A 1E0KA 2WJGA 3CPSA 1FDOA 3LWZA 3IESA 1EA5A 4GMFA 3PUHA 4OQMA 3K6SB 4BAUA 4C0WA 1F4VA 1ZN8A 1JAXA 2QTNA 3DZTA 3PEEA 4OHKA 4MAMA 3U0BA 3WL8A 1YR8A 4B9EA 4DG9A 2YVLA 2WM3A 5BV7A 2YVQA 5LQCA 2YUIA 1GEEA 3VYTB 3W1EA 3EMDA 1K27A 1T36A 2ZSIA 3SP1A 3HXLA 5B8IB 2DVMA 2EHJA 2QVGA 4M3NA 2Z6VA 1P9RA 1UFOA 3OFNA 1G0NA 3BQNB 4LX0A 2VSFA 2RMKA 3OX4A 4H4CA 1PS0A 4XM2A 1MJNA 5DT2A 3FBWA 5DX8A 1PT9A 1G8JA 4K05A 1XD9A 3CB4A 1D6JA 1GLVA 3DTYA 4QYIB 3T0FA 3VTFA 3PDIB 4JQYA 1I30A 3QW4B 4GXNA 4RV4A 4EJSB 1S4QA 1GQOA 1CY4A 1GVNB 3VZRA 4E2ZA 5TLSA 3Q8MA 1W0KA 4OB7A 1KJQA 1B1AA 3INNA 3SD7A 3TYXA 4ABYA 4HJRA 1E7MA 3LT0A 3NIWA 5IEBA 1R4MA 4CFRA 4N7JA 1PWEA 3OJEA 3OPNA 4FW8A 2V7WA 3BA1A 3MJ4A 3WE7A 1AN9A 2FUG1 2YYYA 1T9AA 4MS4B 4WZAE 3ND8A 4AJOA 1MXFA 1Q11A 2FPIB 2ZB4A 5FHRA 4YMHA 2BL0C 2OCKA 3CGGA 1E9FA 2QYHA 3LQ4A 2XOEA 2K2FA 2Y1NA 4LIPD 1IM5A 3DD4A 2H2DA 3QE4A 1T0JB 4XIIA 1W19A 4BRZA 1ZM3A 2XUFA 4P9NA 4REQA 3PYLA 1U3FA 1ONOA 2ZVDA 1W5AA 2ZCVA 3DLIA 3K7EA 1Q0ZA 4LZNA 3C24A 4PR0A 4RESA 4JLSA 4X41A 4WBXC 4R1MA 3LA8A 1T3HA 4LYJA 1BIFA 4MICA 1S8OA 3OQBA 4JD9A 4L4RA 3OF2A 5HBGA 1TMGE 3T99A 1G55A 1T0BA 3A6FA 3GK3A 5E2IA 4EFDA 5C8YB 5AVUA 4DV3B 2P3LA 2O2HA 5HR5A 3NGLA 2O3RA 1RQNA 4JX9A 3VSBA 3AL2A 3AY7A 4Q6BA 1LPSA 5FPQA 3H2YA 4D4LA 1A8HA 4OM8A 3A1WA 3ADPA 3DXXA 3E6AA 4JXZA 1X1SA 1OTHA 3H2ZA 1JSLA 1KAOA 1PNOA 4J3JA 4L22A 4BP9A 3V1LA 2C7RA 1I80A 1U2EA 3GCGA 3E53A 3PL5A 3E0XA 3KOZA 1JJVA 4LYAA 3KWJA 4AKSA 3A9RA 3Q7RA 3K6JA 5DLYA 3AVUA 2C83A 4DBLE 1G5TA 4IEEA 2F3ZA 3VNRA 4LRTB 1J5XA 3ZNIA 3BE5A 1QO0A 3ONNA 5CG1A 4FFRA 3ESDA 1XHFA 3M6LA 3NMUF 1XTVA 1O9BA 4Z8XA 3I0MA 3TR5A 1R6DA 3V8RA 3BXGA 4B6JA 3IPCA 4D3SA 4LFAB 4IR7A 2FW9A 2R11A 2WCEA 2XE8A 4LDZA 4HFNA 4CFQA 3ZV6A 4HDNB 2NYUA 2JRCA 1Z2NX 2OS8B 3PI6A 2HAEA 1XROA 3F9RA 2P91A 4M7WA 3ASYA 3PC6A 5EMNA 1CJTC 5GQQC 1FZQA 3H2KA 1CT9A 4QPDA 4RKEA 1HNXB 4HQ6A 2P1ZA 3CVJA 4B3SB 1OB2A 2XCIA 2C96A 4DCNA 3KVYA 2GZRA 4KX5A 4CIYA 1E2PA 1CMGA 3QELB 2FMKA 3PJRA 1JDUA 1E1DA 4WV3A 5AT1A 5H5JA 4PZUA 1HM5A 4J1TC 4EHIA 1RXEA 2EJWA 2QSZA 4XYEA 5AYVA 1C0PA 4P86A 3ABQB 3QPBA 1BE6A 4TT8A 1VJCA 3V7FA 3ED5A 3KLBA 3OOHA 1HGXA 4UUOA 1E64A 3W34A 1QQTA 3W6NA 5AP9A 2HYIC 1XDSA 4QLAA 1I2DA 1C3VA 4J3FA 4GNKB 2EHDA 4MPTA 3R5XA 1M73E 5F23A 1NMQA 1BWRA 2VKTA 4K9LA 3B6ZA 3S3TA 4Y9SA 2P2GA 5C3UA 4XCXA 5KWIA 5CYGA 1L1QA 3KAQA 3QMEA 4PNEA 4J4BA 4WJZA 4XWGA 1M8GA 1OMVA 3WMEA 2VHJA 1HYHA 4WZAB 1U2GA 1E3SA 5JVDF 5I7AA 2NT4A 4X8MA 3ADCA 1R0RE 5BN1A 1ULZA 3HJCA 1CS4C 1Z5ZA 3HSYA 2B6HA 1LLDA 2G5GX 2PXCA 4CCYB 5C5EA 4LSGA 1IWOA 1U7XA 2RGNC 5BPFA 1VLQA 1BS2A 4I1OA 1VKJA 5B55A 1GR0A 2JI6A 1D2AA 2A3RA 3NIDB 2H5LA 2GNAA 3E1GA 3KBOA 4JV5B 2VYND 3MG9A 4IKPA 3W9UA 5BVHA 1BS1A 3EUFA 2Q5QA 1P4RA 1W96A 1LW7A 5LDGA 4TZ0A 1P5RA 2PEYA 4PZDA 3WGTA 1RTKA 3THYB 2ZK7A 3EW7A 1JHPA 1OC2A 4OHFA 2VBGA 4W5WA 1HQYE 1QFJA 4ZI7A 2OUKA 4RIHA 5CAEA 3UWOA 1QYXA 1G9SA 3FUTA 3HCEA 4YUWA 5K2MA 5JRJA 1MIHA 2GZAA 1XF9A 4I5EA 3WQRA 4DA8A 3BBLA 5IVPA 5JCPA 3IO5A 4DMMA 3DOOA 4LV8B 4HYQA 1G42A 1RXIA 1GHTA 3FSJX 3K2BA 5EXXA 4N40A 4YLYA 3A3OA 3B6XA 2RKOA 3IEKA 2QPOA 4M86A 3L3BA 2I66A 1RHUA 2OV2A 1PJQA 3ISVA 4JUDX 3PN7B 4TSRA 5KBYA 3OZAA 2ZJAA 4LBZA 5H3HA 4CEHB 1V4VA 5JQGB 3W5DA 5IS2A 1RI2A 2O8DA 2AZTA 2WNIA 3R5HA 2JFPA 4JLMA 4L57A 2WF7A 2A2ZA 4O33A 1UBTS 4GI1A 3FWNA 1KXZA 1A69A 3GF4A 1NLYA 3KZNA 4BNHA 3L77A 2DWUA 2GN4A 3ZLTA 4D9GA 5LPNA 2I4NA 2JIZA 2NO4A 3B8HA 4M21A 2BHNA 1OJLA 1X8JA 3OLWA 3LT2A 4P92A 3C7DB 4TN1A 4GGFC 2E4YA 2XA2A 3EBLA 3PJDA 4YLEA 3J80A 2W9XA 2JXCA 2I9KA 1OMDA 1QUFA 2H3EA 4PHNA 4E1AA 1U2GC 3VO2A 1T5IA 4URFA 2BJWA 3LAWA 1FYWA 4ZMSA 521PA 5TPWB 3KETA 1FRZA 3SZOA 3FI9A 2GRJA 4ZO6A 1QCDA 1YCHA 1P1HA 1YBHA 3IOEA 4M54A 3WB1A 4DRWA 1FC0A 1FTWA 1Q7CA 3UBMA 3RRZA 1DKLA 4ALIA 2Y5IA 2NO5A 3ZY6A 4KP7A 5TY0A 4UJ5A 1Z26A 4ZCIA 1JTVA 2NSYA 3SF8A 5G4KA 4U7DA 4AP6A 3NXAA 2ROQA 3FHLA 1WVMA 5DBFA 4ZJYA 2BRUA 2ZUEA 1IIOA 1N2XA 3A1DA 3SFZA 2RONA 3NS7A 4J91A 2OGWA 1MX5A 2F3YA 4YRRA 4MDEA 4CR6A 3FTEA 2I1QA 1G6Q1 1V1MB 3TS5C 3N8GA 5HOEA 2EWVA 4AF8A 3L6RA 4Z7NB 4DQLA 4KREA 1K97A 2WJAA 1O95D 1W6UA 3WB0A 1R0WA 3C16C 3OE7D 4MYTA 4C04A 1WP9A 4WKCA 1O0SA 5KWVA 2O7NA 1EVKA 1U9YA 3R2JA 1QC5A 4R41A 3E8XA 4B6RA 4K6CA 2AA3A 1EP3B 1P2SA 3CY6A 3NHAA 3HYSA 1CYEA 3SZUA 3VRPA 4IIFA 2W37A 4TOIA 3L8EA 5C4GB 3VUEA 3KJGA 1DL5A 1FFEA 1PR2A 3I9LA 5EP1A 3TSOA 2I3BA 5JBNA 1DJGA 4KCGA 4NJOA 1E2DA 3V8EA 4IJ6A 1VDZA 4DV4B 1ZQ9A 3R5KA 4IIYA 1SUFA 5BOSB 1RZRD 1JU9A 4JI7B 2W11A 4LV5B 1UDXA 2C2XA 2FN9A 1LU9A 4M0MA 1G5PA 2V45A 2X86A 3HP7A 1E6KA 3SX4A 5KQSA 4YRZA 2CDAA 4NX2A 5JYEA 1OOHA 4UJ3A 3VNVA 1P3JA 2FJPA 4GECA 4R69A 3T38A 1X7DA 2C98A 2PJUA 5JS7A 4GGFA 1B8CA 2OXEA 2P77A 2BFMA 1UWCA 1OZSA 1QZTA 3KLPX 3TCXB 4GF5A 4QE3A 3JAWA 4Q1DA 2B1RA 2GN8A 3I6ZA 2X0KA 3C1TA 2QW0X 4Z2AA 2ODNA 1RT9A 1TUGA 1QOPB 4WFKA 5KUTA 4PIPA 2FX2A 4L9AA 1ST3A 4ZV9A 1P81A 3PG5A 2XW6A 1SA0A 3H65A 1CNFA 1M6NA 4G01B 4AQIA 4W5JA 4X1YA 5FWXA 3WHIA 4RXMA 3IT2A 4A8JC 3A2MA 3WGOA 1L7NA 1N6KA 4GGPA 4DCMA 1RW4A 4DR3B 2OZLA 5EOVA 4XQ9A 2AXNA 2YZMA 2YN4A 5EC8A 3PGVA 3AFOA 4HUQB 1V5WA 4EHNA 3T34A 3WKCA 4LJ6A 4TKVB 1K2VN 3QPVA 2FPIA 3BWCA 4KE7A 4FFOA 2C5SA 4W1PA 1CF9A 1S9DA 1ENPA 1SY7A 4MK4A 2ERXA 3KKOA 5JZVA 2P8SA 3SDSA 4II3A 1NCYA 3COZA 4UTZA 3QNMA 1WB5A 2VG8A 1KRWA 2XCQA 2BCXA 2PUHA 4ANFA 2XRFA 2FFAA 4QUDA 1QIJA 4I5KA 1OZGA 1J25A 2FLVA 1JG7A 2ZRGA 3P9CA 1JDVA 2FJ0A 4I4CA 1X1QA 2G5CA 1L5RA 4BJ5A 3W3AH 5THQA 1ZICA 4ZDJA 2I2WA 4GPZA 2FCEA 2J48A 5CEEA 1AKRA 4CL0A 4O4JF 3PFWO 2PT7A 2WQ7A 4LWOA 2DPYA 1RTTA 2VQFB 4DS7A 1GNLA 4HQ0A 4NATA 3HL4A 4TMTA 3ESCA 5ALEA 5E95A 5JDIC 1MAVA 3L4LA 1NKTA 3H1FA 3AILA 3CLSC 3L7MA 2EOAA 3CXRA 4BX3A 4JK3A 1XVJA 2IIBA 2BT4A 2YXEA 3CV3A 2M9MA 3S7ZA 3N07A 1B8RA 5M34A 2W2NA 1I01A 3LT1A 3IXMA 5IJXA 4D4GA 3OURA 1FXUA 3FUXA 3S2GA 1KWKA 3OB1B 3CUEF 3Q98A 1Y1AA 1K2HA 5HS6A 3KKQA 1DFHA 3RJZA 4NWIA 1NJGA 3VTKA 5J4YA 3AVYA 1M1XB 1OAKA 1L4MA 2GN0A 2VYFA 3LL4A 4ES6A 1OE9B 5AOVA 5HRCA 1UPTA 1KFUS 1MG0A 4HMOA 4HQKA 2ADFA 4AX4A 3FOFC 3CLSD 3ETEA 3GT3A 3Q3JB 2H8KA 4X8OA 3AM3A 5B4TA 4CQMB 2B2CA 2GI4A 2WR8A 4R1SA 4QOJA 5F7OA 1KJIA 5EIOA 4CLOA 3IAS6 3TUJC 4P82A 3S2IA 3QH4A 2RHMA 4BNWA 4ZT4A 2AR9A 2OGTA 3IE0A 2BUAA 3HO6A 3IBTA 3DZCA 3QK7A 1GL6A 2ZJFA 1KR2A 4QQKA 3RUHA 2G6BA 2REBA 3MXOA 3PXCX 4RKYA 2IWRA 4AM8A 1FOEB 2RC5A 1DAFA 1O94A 3TSCA 4IX9A 1GSAA 2ABWA 4XR9A 4BZQA 5B3JC 5K3SA 3I8OA 3BSSA 1GGWA 3HUTA 4Y2SA 1DQSA 3AVWA 1P0IA 4LMBA 4HWOA 2WCLA 2C94A 3RYIB 1UOOA 2QRHA 5ECYA 1VA5A 4I4TB 3IT0A 3TNYA 4GRDA 4DJTA 4EITA 3MT9A 1EFRD 1O94D 5LKAA 3ZJUA 2WP0A 3L1UA 5CXSA 3W5IA 3FB1A 2VZ9A 1PJAA 2N1BA 4L5JA 4P3OA 1Z63A 4FFNA 3F5FA 3FIJA 3P45A 4X85A 5BWBA 4C4AA 5FWNA 3KR0A 4OLFA 4RV5A 3U4QA 5FBKA 1HL3A 2ODPA 2XD9A 4IDNA 5FI0B 4Q4JA 1XKXA 3AAJA 1IFXA 2DPXA 5ALRA 2O05A 4KRFA 4G36A 3BYZA 4TMXA 5DTMA 1Z3IX 1ZX1A 2XI4A 4K9DA 3V1YA 1UT6A 1GRVA 2LV8A 3M81A 4HADA 2C5GA 4Q03A 4TXNA 3VX3A 1PT7A 1Z13A 1PL7A 1ACMA 1C1DA 2BKAA 4DLWA 3DVKA 3QITA 5E1BA 3U4IA 1WMEA 5L3QA 1G21B 2KPOA 2FG5A 4OK6A 4PE5B 2F6RA 1S1EA 2L69A 3ELDA 3HWRA 1VL1A 4FWIB 3HWSA 3ESXA 4LDNA