3LK1A

X-ray structure of bovine sc0322,ca(2+)-s100b
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
88
structure length
88
Chain Sequence
b'MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title In vitro screening and structural characterization of inhibitors of the S100B-p53 interaction.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 30
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2010-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3lk1A00
5D7FA 1CM4A 1NX1A 2L2EA 4Q04A 1TN4A 2K8MB 3MSEB 1BT6A 1SMGA 1XFXO 2O5GA 5ER5A 4CFRA 1SR6B 2I18A 3OHMB 4ORAB 1GJYA 3I5HC 1ALVA 2KAXA 1UHIA 1QLKA 2L51A 2KI4B 1B1GA 1SW8A 2JT0A 1DGUA 4F0ZB 2KFGA 1FPWA 1LINA 3BYAA 1KFUL 1DJYA 5HLVA 1A75B 1PALA 2MAZA 1IGVA 1N0YA 3I5IC 4OVNF 1OOJA 2F3ZA 2E6WA 2KI6D 2ZNEA 1KK8B 3DF0B 1OE9B 3SG7A 5AEQA 1KFUS 2K7BA 4PHNA 3GK2A 1M31A 1ZFSA 1L2OB 2QPTA 1YX7A 4MZJA 1LVCD 1M45A 1DJZA 2AAOA 4XYNA 1UUSA 1BMOA 1RK9A 1S26D 2FOTA 3ZNIA 2LP3A 3PN7B 1FF1A 3TS5C 1YUTA 1JFKA 1OZSA 5HLOA 2K61A 3RM1A 4DRWA 4PDZA 1J7OA 2BCXA 3SIBA 1A75A 2LV7A 2M8UA 1ZACA 1B8RA 2EC6B 1B7TZ 4HRHA 1MF8B 1NX3A 2BL0B 1WLZA 5DKNA 3NXAA 2Q91A 2KFHA 2Y1NA 1AJ4A 1G4YR 1EJ3A 3DF0A 1RWYA 3VROA 1XK4C 3DVKA 1SL9A 4GUKA 1J1DA 3SIAA 3BQ3A 4DIRA 1KCYA 3O78A 2KQ6A 1MQ1A 2L0PA 3JTDC 4I5KA 2MBXA 5JOLA 2WORA 4MLWA 1V1FA 3TUYC 1MHOA 1WDCC 4MZLA 2LLTA 4GNKB 2K0JA 2Y4QA 4PE1A 1B9AA 5PALA 4E68A 1TIZA 5ER4X 3I5GB 2PASA 1QLSA 1K9PA 1KWOC 2LAPA 2JXLA 1BODA 1ODBA 1YURA 3KO0A 1DF0B 3SG2A 4MSPA 2LMVA 1JSAA 2K2AA 1QATA 2OS8B 2MHHA 1KQMC 3SJSA 4OCIA 2K2FA 1YTZC 4YI8A 1DJHA 3EK8A 1NIWA 2KBIA 1ZMZA 2L98A 4GGFA 1ZOTB 2EHBA 2F2PA 1XO5A 2M29A 3BUWB 1DTLA 1S6JA 2LHIA 1OMVA 1DVIA 4GPLB 1JBAA 2V53A 1SK6D 1TNXA 2O60A 1SL8A 1M46A 2Y1MA 1OQPA 3IQOA 4DS7A 1XYDA 3C1VA 1J7RA 4UPGA 3PSRA 1CFDA 2JPTA 3FIAA 1CDNA 2K7OA 4TNCA 1F71A 1B7TY 1SNLA 1DF0A 1PVBA 1CLBA 3HCMA 5CSJA 2CNPA 2BBNA 3JVTC 3RLZA 3BUXB 2JWWA 3CR2A 1FBVA 3D10A 1NSHA 1MXEA 4WQ3A 3KF9A 3TDIA 3O2PA 1IRJA 2BECA 1JF2A 1IG5A 2JTZA 4WRIA 1K95A 1RECA 1Y0VH 3IF7A 1TNPA 3H4SE 3TDZA 2Y5IA 1B8LA 1DJIA 1S3PA 1G33A 3PM8A 1YX8A 3VRQA 4NDBA 1TOPA 3DD4A 5J3XA 1K93D 1SY9A 1NCYA 5CSFA 4GAOA 4OV2A 2FCDA 3D0YB 1B4CA 1FI6A 3WNXB 1QXPA 4P5OE 3I5FB 4MZKA 2L5XB 2PMYA 2KHNA 3NSOA 2M7NA 2WC8A 4YGCB 1PSBA 1K9KA 1X02A 2E30A 1SL7A 4MBEA 1AK8A 1EXRA 1BOCA 5FYXA 1N65A 3CGAA 3BUMB 5K89A 4AQIA 1RFJA 1UHKA 1RROA 5DKQA 1YUSA 1DJXA 1TNQA 3BUNB 2HQWA 2F33A 2JULA 2LVIA 1DJGA 4YGDB 1CKKA 1S36A 4NDDA 1F55A 4MN0A 1HT9A 5B8IB 3D0YA 1XVJA 2Q4UA 4A4CA 2CBLA 3CZTX 1UHNA 1PRWA 4XJKB 1R2UA 4QJ3B 2L4IA 1A2XA 1IWQA 2LP2A 3NSKA 3EVRA 3TDUA 2BE6A 2JOJA 3GOFA 2M49B 1MUXA 1JFJA 2H61C 4BY5A 4AQJA 1YVHA 3CS1A 4GGNA 1KQVA 1YVLA 1BR1B 1Y1AA 2KSPA 1W7JB 1CM1A 5HKYA 1SCMC 1NPQA 2OTGC 5KTYA 1UHHA 1BG1A 4D1EA 1AVSA 3KEVA 2JXCA 4HSZA 3ZWHA 4YBHB 1BF5A 1QX7A 1LA0A 3HX4A 2JRFA 1UP5A 2MLFC 2TN4A 2PVBA 4PHKA 1CLLA 2P6BB 5I2QA 4XJKA 1RTP1 2JC2A 2WCEA 2KGBC 3WHUB 2B1UA 2GV5A 2PRUA 2WOSA 1FI5A 2LUXA 5HKWA 1NX0A 1Q80A 5KSZA 1WY9A 2LMTA 1V1GA 1NX2A 1YRTB 2ISDA 3WHTB 4OKHA 3M0WA 2NXQA 3LL8B 3PALA 2NCOA 5JJGA 1IQ3A 1SR6C 2CT9A 2KDHA 1SBJA 5CSIA 3GK1A 1J7PA 1LKJA 3PATA 2KI4C 3F45A 4MRXA 2A4JA 1QIVA 1K90D 4GFTA 4M2PA 2KAVA 2WCBA 3ICBA 2G9BA 1S6IA 5I2LA 2KI6C 3OP0A 2F8PA 2M97A 2FCEA 2KQYA 1SPYA 2KYCA 1IJ5A 1KK8C 1RJVA 3E3RA 2MRDA 2HETA 1XFWO 3DVEA 4NDCA 4CFQA 4YGEB 1TTXA 1KK7Y 1L2OC 1KSMA 4HREE 1XFZO 4I5JA 3I5HB 1WRZA 3VRPA 4C0KA 1A29A 1GGZA 3PN7C 3VGOA 4YGBB 4N1GA 1HQVA 3AAJA 1Y6WA 2LHLA 4P2YB 2HPSA 1L7ZA 3CLNA 2L4HA 3I5IB 1M63B 1K94A 1NWDA 1QJTA 4ICBA 2EC6C 3AKAA 1IQ5A 5AFPA 1QV1A 2BL0C 1YUUA 3AKBA 3EVUA 4JPZB 5CPVA 2ZNDA 2M3WA 1NCXA 4N1FA 3EK7A 1QX5B 1DMOA 2ZKMX 1XA5A 2NLNA 4HRGA 1PVAA 3GK4X 4DUQA 2WCFA 4NQGA 3SG4A 4C0JA 3TS5B 2SASA 2ZRSA 3CWGA 4MVFA 2I2RE 5TNCA 4GGFC 4PHMA 1QIWA 1F54A 1M39A 1AP4A 2R2IA 1TRFA 2LCPA 2MA2A 4DCKA 1CDLA 2LNKA 5I2OA 2JU0A 1CTRA 3EK4A 2HF5A 4ORBB 1UURA 2KNEA 2G2BA 2M7LA 1S1EA 1CDMA 1CFCA 3VRNA 3I5GC 4C0LA 3NSIA 2QACA 4QJ5B 3CR4X 4WQ2A 4PE7A 4CIDA 3QRXA 2BKIB 2LLUA 1F4QA 1C7WA 1YR5A 2I7AA 1H4BA 2WNDA 4R1EA 1JF0A 2OS8C 3JTDB 3LCPC 3VRRA 1CMFA 1S5GY 3WXAA 1TNWA 2LANA 3OB2B 2LLSA 4YI9A 2H61A 4GBAA 3K21A 2ZRTA 1QVIZ 3TUYB 1MR8A 4N5XA 4PE4A 1WDCB 1SYMA 1B47A 2JZIA 2LM5A 2LVKA 4YRUA 4PALA 3SG6A 1UHJA 3SG5A 1AUIB 3CR5X 1WRLA 1WRKA 5GQQC 1BU3A 1EG4A 2BCAA 3IQQA 1DGVA 3OX5A 1AJ5A 1KWOB 3SG3A 5AERA 3PFVA 1XK4A 1KK7Z 2COLB 4ZCVA 3LLEA 1GGWA 1C7VA 3O6BA 1BR4B 1KQMB 2AUCA 2JQ6A 2ZN8A 2KFFA 4QJ4B 4PCWA 1SRAA 2PSRA 1LA3A 2IS9A 1LXFC 4M2OA 1DJWA 1AHRA 1QX2A 2AMIA 4JQ0D 2NZ0A 2PALA 1QASA 2M1KB 1K8UA 3A4UB 1FW4A 4PE0A 1Y1UA 1N2DA 1IH0A 1J55A 3EKJA 2LVJA 1CFFA 3FWCA 1SKTA 1G8IA 2M9GA 4ZCUA 4PHJA 5IBWA 1C07A 1B8CA 1YRUB 1BJFA 1QTXA 1CDPA 1EL4A 2LUCA 1GQMA 3FS7A 1DT7B 1EG3A 3FWBA 1UWOA 4JWQA 1XFYO 5DKRA 3JVTB 2L50A 2M1UA 1CFPA 1JC2A 1K9UA 3BUOB 2FJUB 2K7DA 2K7CA 3I5FC 4CLNA 3OX6A 2JNFA 2LC5A 1TCOB 5CSNA 5D69A 1NUBA 2KGRA 2VRGA 2BKHB 1CLMA 2ZFDA 1F70A 2KOTA 5I8NA 1OMRA 1CMGA 3LK1A 1QVIY 2SCPA 2JT3A 3TZ1A 2BBMA 1E8AA 2H2KA 1PK0D 1PSRA 1U5IB 5G08A 4MEWA 2KAYA 1S5GZ 3BOWB 1OMDA 4YGAA 1VRKA 2GGMA 4OR9B 2HQ8A 4I5LB 3KHEA 1KFXL 1TCFA 1K96A 2GGZA 2MJWB 2ZN9A 3DVJA 1JWDA 4MRYA 3LK0A 1NCZA 1A4PA 1QS7A 1XFVO 2BE4A 1BLQA 2NCPA 4CPVA 1CB1A 1KSOA 2KBMA 4A4BA 1CNPA 1MXLC 2MLEC 1KFXS 1A03A 5F6TA 4USLA 2OPOA 4ORCB 1XFUO 1F8HA 1U5IA 2D8NA 2CTNA 3BOWA 3CTNA 2JT8A 2I94A 2EGDA 1S6CA 1MWNA 2F3YA 1OSAA 1QV0A 1SCVA 2LVVA 3EKHA 1H8BA 3PLFB 3OB1B 3BXKA 4FQOA 2CCMA 2BCBA 5AXIA 2DOQA 2F2OA 2RGIA 1WLMA 1NP8A 1PULA 1IKUA 1W7IB 3A8RA 4IL1A 1K2HA 1D1OA 4M2QA 1IJ6A 4FTGA 4U8DA 1NYAA 1OZOA 2JTTA 1R6PA 2LE9B 1SCMB 1ALWA 1ZUZA 2OTGB 2CXJA 5KU1A 4L9MA 2KYFA 3KPXA 4BY4A 5BPJA 4ETOA 3EVVA 3NSLA 1Y1XA 1J1EA 3AAKA 5HKZA 1JUOA 4AOMA 3DVMA 3O4YA 1J7QA 2LMUA 2M0RA 5HYDA 2JNXA 1F4OA 1EH2A 5AANA 4I5NB
chains in the Genus database with same CATH superfamily
5D7FA 1CM4A 1NX1A 3UO9A 2L2EA 4Q04A 1TN4A 2K8MB 3R1VA 3MSEB 1BT6A 1SMGA 1XFXO 2O5GA 5ER5A 4CFRA 1SR6B 2WCKA 2I18A 3DYEA 3OHMB 4ORAB 1GJYA 3I5HC 1ALVA 2KAXA 1UHIA 1QLKA 2L51A 2KI4B 1B1GA 1SW8A 2JT0A 1DGUA 4F0ZB 2KFGA 1FPWA 1LINA 3BYAA 1KFUL 1DJYA 5HLVA 1A75B 1PALA 2MAZA 1IGVA 1N0YA 1Z4HA 3I5IC 1T14A 4OVNF 1OOJA 2F3ZA 2E6WA 2KI6D 2ZNEA 1KK8B 3DF0B 1OE9B 3SG7A 5AEQA 1KFUS 2K7BA 4PHNA 3GK2A 1M31A 1ZFSA 1L2OB 2QPTA 1YX7A 4MZJA 3RZSA 1LVCD 1M45A 1DJZA 2AAOA 4XYNA 1UUSA 1BMOA 1RK9A 1S26D 2FOTA 3ZNIA 2LP3A 3EG5B 3PN7B 1FF1A 3TS5C 3S0EA 1YUTA 1JFKA 1OZSA 5HLOA 2K61A 3RM1A 4DRWA 4PDZA 1GM0A 1J7OA 2BCXA 3SIBA 1A75A 2LV7A 2M8UA 1ZACA 1B8RA 2EC6B 1B7TZ 4HRHA 1MF8B 1NX3A 2BL0B 1WLZA 5DKNA 3NXAA 3CZ2A 2Q91A 2KFHA 2Y1NA 5FI7A 1AJ4A 1G4YR 1EJ3A 3DF0A 1ORGA 1RWYA 3K1EA 3R1OA 1XK4C 3DVKA 1SL9A 4GUKA 4INWA 1J1DA 3SIAA 3BQ3A 4DIRA 1KCYA 3O78A 3DXLA 2KQ6A 2WCMA 1MQ1A 2L0PA 3JTDC 4I5KA 2WCHA 2MBXA 3B6XA 1TWOA 5JOLA 2WORA 4MLWA 1V1FA 3TUYC 1MHOA 1WDCC 4MZLA 2LLTA 3DZTA 4GNKB 2K0JA 2ERBA 2Y4QA 3D78A 4PE1A 1B9AA 2QDIA 5PALA 4E68A 1TIZA 5ER4X 3NHTA 3I5GB 2PASA 3R72A 1QLSA 1K9PA 1KWOC 2LAPA 2JXLA 1BODA 2BNXA 1ODBA 3D77A 1YURA 2WCLA 3KO0A 1DF0B 3PM2A 3SG2A 4MSPA 2LMVA 1JSAA 2K2AA 1QATA 2OS8B 2MHHA 1KQMC 2FJYA 3SJSA 4OCIA 2K2FA 1YTZC 4YI8A 1DJHA 3EK8A 1NIWA 2KBIA 1ZMZA 2L98A 3FE9A 4GGFA 1ZOTB 2EHBA 2F2PA 1XO5A 2M29A 3BUWB 1DTLA 1S6JA 2LHIA 1OMVA 3SS4A 1DVIA 4GPLB 1JBAA 3B87A 2V53A 1SK6D 1TNXA 2O60A 1SL8A 1M46A 2Y1MA 1OQPA 3IQOA 4DS7A 1XYDA 5DICA 3C1VA 1J7RA 4UPGA 3PSRA 1CFDA 2JPTA 5FI6A 3L47A 3SS5A 3FIAA 1CDNA 2K7OA 4TNCA 1F71A 1B7TY 1SNLA 1DF0A 1PVBA 1CLBA 3HCMA 5CSJA 2CNPA 2BBNA 3OGNA 1XFRA 1C3YA 3JVTC 3RLZA 3BUXB 1DELA 2JWWA 1FBVA 3CR2A 3V2LA 2QEOA 3D10A 1NSHA 1MXEA 4WQ3A 3KF9A 3TDIA 3O2PA 1IRJA 2BECA 1JF2A 1IG5A 2JTZA 4WRIA 1K95A 1RECA 1Y0VH 3IF7A 1TNPA 3H4SE 3TDZA 2Y5IA 1B8LA 1DJIA 1S3PA 1G33A 1OOIX 3NGVA 3PM8A 1YX8A 3VRQA 4NDBA 1SSEB 1TOPA 3DD4A 3FE6A 5J3XA 3S0GA 1K93D 1SY9A 1NCYA 5CSFA 4GAOA 1TUJA 4OV2A 2FCDA 3D0YB 1B4CA 1FI6A 3WNXB 1QXPA 4P5OE 4JD9A 3I5FB 4MZKA 2L5XB 2PMYA 2KHNA 3NSOA 2M7NA 2WC8A 3PJIA 4YGCB 1PSBA 1K9KA 1X02A 2E30A 1SL7A 4MBEA 1AK8A 1EXRA 1BOCA 5FYXA 1N65A 3CGAA 3BUMB 5K89A 4AQIA 1RFJA 1UHKA 1RROA 5DKQA 1YUSA 1DJXA 1TNQA 3BUNB 2HQWA 2F33A 2JULA 2LVIA 1OOGA 1DJGA 2KLEA 3QMEA 4YGDB 1S36A 3L4AA 4NDDA 1CKKA 1F55A 4MN0A 1HT9A 5B8IB 3D0YA 1XVJA 2Q4UA 2PQLA 4A4CA 2CBLA 3CZTX 1UHNA 1PRWA 1LS8A 4JKTA 1R2UA 4QJ3B 2L4IA 1A2XA 1IWQA 2LP2A 3NSKA 3EVRA 4XJKB 3TDUA 3VROA 2BE6A 2JOJA 3GOFA 2M49B 1MUXA 1JFJA 2H61C 4BY5A 4AQJA 1YVHA 3CS1A 2KPHA 4GGNA 1KQVA 1YVLA 1BR1B 1Y1AA 2KSPA 1W7JB 1CM1A 5HKYA 1SCMC 1NPQA 2OTGC 2K60A 4F7FA 5KTYA 1UHHA 1BG1A 2GTEA 4D1EA 1AVSA 3KEVA 2JXCA 4HSZA 3ZWHA 4YBHB 5I94A 1QX7A 1BF5A 1LA0A 3HX4A 2JRFA 1UP5A 2MLFC 2TN4A 2PVBA 2PYQA 1CLLA 2P6BB 4PHKA 5EL2A 5I2QA 4XJKA 1RTP1 2JC2A 2WCEA 2KGBC 3WHUB 2B1UA 2GV5A 2PRUA 2WOSA 1FI5A 2LUXA 5HKWA 1NX0A 1Q80A 5KSZA 1WY9A 2LMTA 1V1GA 1NX2A 1YRTB 2ISDA 3WHTB 4OKHA 3B88A 3M0WA 2NXQA 3VB1A 3LL8B 3PALA 2NCOA 5JJGA 1IQ3A 1SR6C 2CT9A 1OOHA 2KDHA 1SBJA 5CSIA 3GK1A 1J7PA 1LKJA 3PATA 2KI4C 3F45A 4MRXA 2A4JA 1QIVA 1K90D 4GFTA 4M2PA 2KAVA 2WCBA 3ICBA 2G9BA 1S6IA 5I2LA 2KI6C 3OP0A 1P28A 4PT1A 2F8PA 5D3OA 2M97A 2QEHA 2FCEA 2KQYA 1SPYA 2KYCA 1IJ5A 1KK8C 1RJVA 3E3RA 2MRDA 2HETA 4OZDA 1XFWO 3DVEA 4NDCA 4CFQA 4KYNA 4YGEB 1TTXA 1KK7Y 1L2OC 1KSMA 4HREE 1XFZO 2H8VA 4I5JA 3I5HB 1WRZA 3VRPA 4FQTA 4C0KA 1A29A 1GGZA 3PN7C 3VGOA 4YGBB 4N1GA 1HQVA 3AAJA 1Y6WA 2LHLA 4P2YB 2HPSA 3SS3A 1L7ZA 3CLNA 2L4HA 3I5IB 1M63B 1K94A 1NWDA 1QJTA 4ICBA 2EC6C 3AKAA 3BFBA 1IQ5A 5AFPA 1QV1A 2BL0C 1YUUA 3AKBA 3EVUA 3N7HA 4JPZB 5CPVA 2ZNDA 2M3WA 1NCXA 4N1FA 3EK7A 1QX5B 1DMOA 2ZKMX 1XA5A 2NLNA 4HRGA 1PVAA 3GK4X 4DUQA 2WCFA 4NQGA 3SG4A 4C0JA 3TS5B 2KLDA 2SASA 2ZRSA 1IIOA 3CWGA 4MVFA 2I2RE 2YGUA 4INXA 5TNCA 4GGFC 4PHMA 1QIWA 2WC6A 1M39A 1AP4A 1F54A 2R2IA 1TRFA 2LCPA 2MA2A 4DCKA 1CDLA 2LNKA 5HL1A 5I2OA 2JU0A 1CTRA 3EK4A 3NHIA 3OBVA 2HF5A 4ORBB 1UURA 2KNEA 2G2BA 2M7LA 1S1EA 1CDMA 2WC5A 1CFCA 3VRNA 3I5GC 4C0LA 3NSIA 2QACA 1DQEA 4QJ5B 3CR4X 4WQ2A 4PE7A 4CIDA 3QRXA 2BKIB 2LLUA 1F4QA 1C7WA 1YR5A 2I7AA 1DC1A 1H4BA 2WNDA 4R1EA 1JF0A 2OS8C 3JTDB 3LCPC 3VRRA 1CMFA 1S5GY 3WXAA 1TNWA 2LANA 3OB2B 2LLSA 4YI9A 3S0BA 2H61A 2QEVA 4GBAA 3K21A 2ZRTA 1QVIZ 3TUYB 1MR8A 3D74A 4N5XA 4PE4A 1WDCB 1SYMA 1B47A 2JZIA 2LM5A 2LVKA 4YRUA 4PALA 3SG6A 3B86A 3DY9A 1UHJA 1C3ZA 1AUIB 3SG5A 3CR5X 1WRLA 1WRKA 3R1PA 5GQQC 1BU3A 1EG4A 2BCAA 3IQQA 1DGVA 3OX5A 3S0FA 1AJ5A 1KWOB 3SG3A 5AERA 3PFVA 1XK4A 3S0DA 1KK7Z 2COLB 4ZCVA 3LLEA 1GGWA 1C7VA 3O6BA 1BR4B 1KQMB 2AUCA 2JQ6A 2ZN8A 2KFFA 4QJ4B 4PCWA 1SRAA 2PSRA 1LA3A 2IS9A 1LXFC 3BFHA 4M2OA 1DJWA 1AHRA 1QX2A 2AMIA 4JQ0D 2NZ0A 2PALA 1QASA 2M1KB 1K8UA 3A4UB 1FW4A 4PE0A 1Y1UA 3Q8IA 4CLNA 1N2DA 1IH0A 1J55A 3EKJA 2LVJA 1CFFA 3FWCA 1SKTA 2L5YA 1G8IA 2M9GA 3CABA 4ZCUA 4PHJA 5IBWA 1C07A 1B8CA 1YRUB 3O4XA 1BJFA 1QTXA 1CDPA 1EL4A 2LUCA 1GQMA 3FS7A 1DT7B 1EG3A 3FWBA 1UWOA 3BFAA 1XFYO 4JWQA 2L2CA 3JVTB 5DKRA 2L50A 2M1UA 3FE8A 1CFPA 1JC2A 1K9UA 3BUOB 3UNWA 2FJUB 2K7DA 2K7CA 2QEBA 3I5FC 3OX6A 2JNFA 2LC5A 1TCOB 1OW4A 5CSNA 5D69A 1NUBA 1QWVA 1Z2CB 2KGRA 2VRGA 2BKHB 1CLMA 2ZFDA 1F70A 2KOTA 5I8NA 1OMRA 1CMGA 3LK1A 1QVIY 2SCPA 2JT3A 3TZ1A 2BBMA 1E8AA 2H2KA 1PK0D 2P71A 1PSRA 1U5IB 5G08A 4MEWA 2KAYA 1S5GZ 3BOWB 1OMDA 4YGAA 1VRKA 2GGMA 4OR9B 2HQ8A 1W9ZA 2BAPA 4I5LB 3KHEA 1KFXL 1TCFA 3S0AA 1K96A 2GGZA 2MJWB 2ZN9A 3DVJA 1JWDA 4MRYA 3LK0A 1NCZA 1A4PA 1QS7A 1XFVO 2BE4A 5FI2A 1BLQA 3D76A 2NCPA 4CPVA 1CB1A 1KSOA 2KBMA 4A4BA 1CNPA 1MXLC 2MLEC 1DEKA 3CZ0A 1KFXS 1A03A 5F6TA 4USLA 2OPOA 4ORCB 1XFUO 3D73A 1F8HA 1U5IA 2D8NA 2CTNA 3BOWA 3CTNA 2JT8A 3CDNA 2I94A 2EGDA 1S6CA 3B7AA 1MWNA 2F3YA 1OSAA 1QV0A 1SCVA 2LVVA 3EKHA 1H8BA 3PLFB 3OB1B 3BXKA 4FQOA 2CCMA 2BCBA 3L4LA 5AXIA 2DOQA 2F2OA 2P70A 2RGIA 4IJ7A 2JPOA 1WLMA 1NP8A 1PULA 1IKUA 1W7IB 3A8RA 4IL1A 1K2HA 1D1OA 4M2QA 1IJ6A 4FTGA 4U8DA 1NYAA 1OZOA 2JTTA 1R6PA 2LE9B 3IVTA 1SCMB 1ALWA 1ZUZA 2OTGB 2CXJA 5KU1A 4L9MA 2KYFA 1OOFA 3KPXA 4BY4A 5BPJA 4ETOA 1TUZA 3EVVA 3NSLA 3D75A 3CZ1A 1Y1XA 1J1EA 3AAKA 5HKZA 1JUOA 4AOMA 3BJHA 3DVMA 3O4YA 1J7QA 2LMUA 2M0RA 5HYDA 3CYZA 2JNXA 1F4OA 1EH2A 2WCJA 5AANA 4I5NB
chains in the Genus database with same CATH topology
5D7FA 1CM4A 1NX1A 2L2EA 4Q04A 1TN4A 2K8MB 3MSEB 1BT6A 1SMGA 1XFXO 2O5GA 5ER5A 4CFRA 1SR6B 2I18A 3OHMB 4ORAB 1GJYA 3I5HC 1ALVA 2KAXA 1UHIA 1QLKA 2L51A 2KI4B 1B1GA 1SW8A 2JT0A 1DGUA 4F0ZB 2KFGA 1FPWA 1LINA 3BYAA 1KFUL 1DJYA 5HLVA 1A75B 1PALA 2MAZA 1IGVA 1N0YA 3I5IC 4OVNF 1OOJA 2F3ZA 2E6WA 2KI6D 2ZNEA 1KK8B 3DF0B 1OE9B 3SG7A 5AEQA 1KFUS 2K7BA 4PHNA 3GK2A 1M31A 1ZFSA 1L2OB 2QPTA 1YX7A 4MZJA 1LVCD 1M45A 1DJZA 2AAOA 4XYNA 1UUSA 1BMOA 1RK9A 1S26D 2FOTA 3ZNIA 2LP3A 3PN7B 1FF1A 3TS5C 1YUTA 1JFKA 1OZSA 5HLOA 2K61A 3RM1A 4DRWA 4PDZA 1J7OA 2BCXA 3SIBA 1A75A 2LV7A 2M8UA 1ZACA 1B8RA 2EC6B 1B7TZ 4HRHA 1MF8B 1NX3A 2BL0B 1WLZA 5DKNA 3NXAA 2Q91A 2KFHA 2Y1NA 1AJ4A 1G4YR 1EJ3A 3DF0A 1RWYA 3VROA 1XK4C 3DVKA 1SL9A 4GUKA 1J1DA 3SIAA 3BQ3A 4DIRA 1KCYA 3O78A 2KQ6A 1MQ1A 2L0PA 3JTDC 4I5KA 2MBXA 5JOLA 2WORA 4MLWA 1V1FA 3TUYC 1MHOA 1WDCC 4MZLA 2LLTA 4GNKB 2K0JA 2Y4QA 4PE1A 1B9AA 5PALA 4E68A 1TIZA 5ER4X 3I5GB 2PASA 1QLSA 1K9PA 1KWOC 2LAPA 2JXLA 1BODA 1ODBA 1YURA 3KO0A 1DF0B 3SG2A 4MSPA 2LMVA 1JSAA 2K2AA 1QATA 2OS8B 2MHHA 1KQMC 3SJSA 4OCIA 2K2FA 1YTZC 4YI8A 1DJHA 3EK8A 1NIWA 2KBIA 1ZMZA 2L98A 4GGFA 1ZOTB 2EHBA 2F2PA 1XO5A 2M29A 3BUWB 1DTLA 1S6JA 2LHIA 1OMVA 1DVIA 4GPLB 1JBAA 2V53A 1SK6D 1TNXA 2O60A 1SL8A 1M46A 2Y1MA 1OQPA 3IQOA 4DS7A 1XYDA 3C1VA 1J7RA 4UPGA 3PSRA 1CFDA 2JPTA 3FIAA 1CDNA 2K7OA 4TNCA 1F71A 1B7TY 1SNLA 1DF0A 1PVBA 1CLBA 3HCMA 5CSJA 2CNPA 2BBNA 3JVTC 3RLZA 3BUXB 2JWWA 3CR2A 1FBVA 3D10A 1NSHA 1MXEA 4WQ3A 3KF9A 3TDIA 3O2PA 1IRJA 2BECA 1JF2A 1IG5A 2JTZA 4WRIA 1K95A 1RECA 1Y0VH 3IF7A 1TNPA 3H4SE 3TDZA 2Y5IA 1B8LA 1DJIA 1S3PA 1G33A 3PM8A 1YX8A 3VRQA 4NDBA 1TOPA 3DD4A 5J3XA 1K93D 1SY9A 1NCYA 5CSFA 4GAOA 4OV2A 2FCDA 3D0YB 1B4CA 1FI6A 3WNXB 1QXPA 4P5OE 3I5FB 4MZKA 2L5XB 2PMYA 2KHNA 3NSOA 2M7NA 2WC8A 4YGCB 1PSBA 1K9KA 1X02A 2E30A 1SL7A 4MBEA 1AK8A 1EXRA 1BOCA 5FYXA 1N65A 3CGAA 3BUMB 5K89A 4AQIA 1RFJA 1UHKA 1RROA 5DKQA 1YUSA 1DJXA 1TNQA 3BUNB 2HQWA 2F33A 2JULA 2LVIA 1DJGA 4YGDB 1CKKA 1S36A 4NDDA 1F55A 4MN0A 1HT9A 5B8IB 3D0YA 1XVJA 2Q4UA 4A4CA 2CBLA 3CZTX 1UHNA 1PRWA 4XJKB 1R2UA 4QJ3B 2L4IA 1A2XA 1IWQA 2LP2A 3NSKA 3EVRA 3TDUA 2BE6A 2JOJA 3GOFA 2M49B 1MUXA 1JFJA 2H61C 4BY5A 4AQJA 1YVHA 3CS1A 4GGNA 1KQVA 1YVLA 1BR1B 1Y1AA 2KSPA 1W7JB 1CM1A 5HKYA 1SCMC 1NPQA 2OTGC 5KTYA 1UHHA 1BG1A 4D1EA 1AVSA 3KEVA 2JXCA 4HSZA 3ZWHA 4YBHB 1BF5A 1QX7A 1LA0A 3HX4A 2JRFA 1UP5A 2MLFC 2TN4A 2PVBA 4PHKA 1CLLA 2P6BB 5I2QA 4XJKA 1RTP1 2JC2A 2WCEA 2KGBC 3WHUB 2B1UA 2GV5A 2PRUA 2WOSA 1FI5A 2LUXA 5HKWA 1NX0A 1Q80A 5KSZA 1WY9A 2LMTA 1V1GA 1NX2A 1YRTB 2ISDA 3WHTB 4OKHA 3M0WA 2NXQA 3LL8B 3PALA 2NCOA 5JJGA 1IQ3A 1SR6C 2CT9A 2KDHA 1SBJA 5CSIA 3GK1A 1J7PA 1LKJA 3PATA 2KI4C 3F45A 4MRXA 2A4JA 1QIVA 1K90D 4GFTA 4M2PA 2KAVA 2WCBA 3ICBA 2G9BA 1S6IA 5I2LA 2KI6C 3OP0A 2F8PA 2M97A 2FCEA 2KQYA 1SPYA 2KYCA 1IJ5A 1KK8C 1RJVA 3E3RA 2MRDA 2HETA 1XFWO 3DVEA 4NDCA 4CFQA 4YGEB 1TTXA 1KK7Y 1L2OC 1KSMA 4HREE 1XFZO 4I5JA 3I5HB 1WRZA 3VRPA 4C0KA 1A29A 1GGZA 3PN7C 3VGOA 4YGBB 4N1GA 1HQVA 3AAJA 1Y6WA 2LHLA 4P2YB 2HPSA 1L7ZA 3CLNA 2L4HA 3I5IB 1M63B 1K94A 1NWDA 1QJTA 4ICBA 2EC6C 3AKAA 1IQ5A 5AFPA 1QV1A 2BL0C 1YUUA 3AKBA 3EVUA 4JPZB 5CPVA 2ZNDA 2M3WA 1NCXA 4N1FA 3EK7A 1QX5B 1DMOA 2ZKMX 1XA5A 2NLNA 4HRGA 1PVAA 3GK4X 4DUQA 2WCFA 4NQGA 3SG4A 4C0JA 3TS5B 2SASA 2ZRSA 3CWGA 4MVFA 2I2RE 5TNCA 4GGFC 4PHMA 1QIWA 1F54A 1M39A 1AP4A 2R2IA 1TRFA 2LCPA 2MA2A 4DCKA 1CDLA 2LNKA 5I2OA 2JU0A 1CTRA 3EK4A 2HF5A 4ORBB 1UURA 2KNEA 2G2BA 2M7LA 1S1EA 1CDMA 1CFCA 3VRNA 3I5GC 4C0LA 3NSIA 2QACA 4QJ5B 3CR4X 4WQ2A 4PE7A 4CIDA 3QRXA 2BKIB 2LLUA 1F4QA 1C7WA 1YR5A 2I7AA 1H4BA 2WNDA 4R1EA 1JF0A 2OS8C 3JTDB 3LCPC 3VRRA 1CMFA 1S5GY 3WXAA 1TNWA 2LANA 3OB2B 2LLSA 4YI9A 2H61A 4GBAA 3K21A 2ZRTA 1QVIZ 3TUYB 1MR8A 4N5XA 4PE4A 1WDCB 1SYMA 1B47A 2JZIA 2LM5A 2LVKA 4YRUA 4PALA 3SG6A 1UHJA 3SG5A 1AUIB 3CR5X 1WRLA 1WRKA 5GQQC 1BU3A 1EG4A 2BCAA 3IQQA 1DGVA 3OX5A 1AJ5A 1KWOB 3SG3A 5AERA 3PFVA 1XK4A 1KK7Z 2COLB 4ZCVA 3LLEA 1GGWA 1C7VA 3O6BA 1BR4B 1KQMB 2AUCA 2JQ6A 2ZN8A 2KFFA 4QJ4B 4PCWA 1SRAA 2PSRA 1LA3A 2IS9A 1LXFC 4M2OA 1DJWA 1AHRA 1QX2A 2AMIA 4JQ0D 2NZ0A 2PALA 1QASA 2M1KB 1K8UA 3A4UB 1FW4A 4PE0A 1Y1UA 1N2DA 1IH0A 1J55A 3EKJA 2LVJA 1CFFA 3FWCA 1SKTA 1G8IA 2M9GA 4ZCUA 4PHJA 5IBWA 1C07A 1B8CA 1YRUB 1BJFA 1QTXA 1CDPA 1EL4A 2LUCA 1GQMA 3FS7A 1DT7B 1EG3A 3FWBA 1UWOA 4JWQA 1XFYO 5DKRA 3JVTB 2L50A 2M1UA 1CFPA 1JC2A 1K9UA 3BUOB 2FJUB 2K7DA 2K7CA 3I5FC 4CLNA 3OX6A 2JNFA 2LC5A 1TCOB 5CSNA 5D69A 1NUBA 2KGRA 2VRGA 2BKHB 1CLMA 2ZFDA 1F70A 2KOTA 5I8NA 1OMRA 1CMGA 3LK1A 1QVIY 2SCPA 2JT3A 3TZ1A 2BBMA 1E8AA 2H2KA 1PK0D 1PSRA 1U5IB 5G08A 4MEWA 2KAYA 1S5GZ 3BOWB 1OMDA 4YGAA 1VRKA 2GGMA 4OR9B 2HQ8A 4I5LB 3KHEA 1KFXL 1TCFA 1K96A 2GGZA 2MJWB 2ZN9A 3DVJA 1JWDA 4MRYA 3LK0A 1NCZA 1A4PA 1QS7A 1XFVO 2BE4A 1BLQA 2NCPA 4CPVA 1CB1A 1KSOA 2KBMA 4A4BA 1CNPA 1MXLC 2MLEC 1KFXS 1A03A 5F6TA 4USLA 2OPOA 4ORCB 1XFUO 1F8HA 1U5IA 2D8NA 2CTNA 3BOWA 3CTNA 2JT8A 2I94A 2EGDA 1S6CA 1MWNA 2F3YA 1OSAA 1QV0A 1SCVA 2LVVA 3EKHA 1H8BA 3PLFB 3OB1B 3BXKA 4FQOA 2CCMA 2BCBA 5AXIA 2DOQA 2F2OA 2RGIA 1WLMA 1NP8A 1PULA 1IKUA 1W7IB 3A8RA 4IL1A 1K2HA 1D1OA 4M2QA 1IJ6A 4FTGA 4U8DA 1NYAA 1OZOA 2JTTA 1R6PA 2LE9B 1SCMB 1ALWA 1ZUZA 2OTGB 2CXJA 5KU1A 4L9MA 2KYFA 3KPXA 4BY4A 5BPJA 4ETOA 3EVVA 3NSLA 1Y1XA 1J1EA 3AAKA 5HKZA 1JUOA 4AOMA 3DVMA 3O4YA 1J7QA 2LMUA 2M0RA 5HYDA 2JNXA 1F4OA 1EH2A 5AANA 4I5NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D7F A;  1CM4 A;  1NX1 A;  2L2E A;  4Q04 A;  1TN4 A;  2K8M B;  3MSE B;  1BT6 A;  1SMG A;  1XFX O;  2O5G A;  5ER5 A;  4CFR A;  1SR6 B;  2I18 A;  3OHM B;  4ORA B;  1GJY A;  3I5H C;  1ALV A;  2KAX A;  1UHI A;  1QLK A;  2L51 A;  2KI4 B;  1B1G A;  1SW8 A;  2JT0 A;  1DGU A;  4F0Z B;  2KFG A;  1FPW A;  1LIN A;  3BYA A;  1KFU L;  1DJY A;  5HLV A;  1A75 B;  1PAL A;  2MAZ A;  1IGV A;  1N0Y A;  3I5I C;  4OVN F;  1OOJ A;  2F3Z A;  2E6W A;  2KI6 D;  2ZNE A;  1KK8 B;  3DF0 B;  1OE9 B;  3SG7 A;  5AEQ A;  1KFU S;  2K7B A;  4PHN A;  3GK2 A;  1M31 A;  1ZFS A;  1L2O B;  2QPT A;  1YX7 A;  4MZJ A;  1LVC D;  1M45 A;  1DJZ A;  2AAO A;  4XYN A;  1UUS A;  1BMO A;  1RK9 A;  1S26 D;  2FOT A;  3ZNI A;  2LP3 A;  3PN7 B;  1FF1 A;  3TS5 C;  1YUT A;  1JFK A;  1OZS A;  5HLO A;  2K61 A;  3RM1 A;  4DRW A;  4PDZ A;  1J7O A;  2BCX A;  3SIB A;  1A75 A;  2LV7 A;  2M8U A;  1ZAC A;  1B8R A;  2EC6 B;  1B7T Z;  4HRH A;  1MF8 B;  1NX3 A;  2BL0 B;  1WLZ A;  5DKN A;  3NXA A;  2Q91 A;  2KFH A;  2Y1N A;  1AJ4 A;  1G4Y R;  1EJ3 A;  3DF0 A;  1RWY A;  3VRO A;  1XK4 C;  3DVK A;  1SL9 A;  4GUK A;  1J1D A;  3SIA A;  3BQ3 A;  4DIR A;  1KCY A;  3O78 A;  2KQ6 A;  1MQ1 A;  2L0P A;  3JTD C;  4I5K A;  2MBX A;  5JOL A;  2WOR A;  4MLW A;  1V1F A;  3TUY C;  1MHO A;  1WDC C;  4MZL A;  2LLT A;  4GNK B;  2K0J A;  2Y4Q A;  4PE1 A;  1B9A A;  5PAL A;  4E68 A;  1TIZ A;  5ER4 X;  3I5G B;  2PAS A;  1QLS A;  1K9P A;  1KWO C;  2LAP A;  2JXL A;  1BOD A;  1ODB A;  1YUR A;  3KO0 A;  1DF0 B;  3SG2 A;  4MSP A;  2LMV A;  1JSA A;  2K2A A;  1QAT A;  2OS8 B;  2MHH A;  1KQM C;  3SJS A;  4OCI A;  2K2F A;  1YTZ C;  4YI8 A;  1DJH A;  3EK8 A;  1NIW A;  2KBI A;  1ZMZ A;  2L98 A;  4GGF A;  1ZOT B;  2EHB A;  2F2P A;  1XO5 A;  2M29 A;  3BUW B;  1DTL A;  1S6J A;  2LHI A;  1OMV A;  1DVI A;  4GPL B;  1JBA A;  2V53 A;  1SK6 D;  1TNX A;  2O60 A;  1SL8 A;  1M46 A;  2Y1M A;  1OQP A;  3IQO A;  4DS7 A;  1XYD A;  3C1V A;  1J7R A;  4UPG A;  3PSR A;  1CFD A;  2JPT A;  3FIA A;  1CDN A;  2K7O A;  4TNC A;  1F71 A;  1B7T Y;  1SNL A;  1DF0 A;  1PVB A;  1CLB A;  3HCM A;  5CSJ A;  2CNP A;  2BBN A;  3JVT C;  3RLZ A;  3BUX B;  2JWW A;  3CR2 A;  1FBV A;  3D10 A;  1NSH A;  1MXE A;  4WQ3 A;  3KF9 A;  3TDI A;  3O2P A;  1IRJ A;  2BEC A;  1JF2 A;  1IG5 A;  2JTZ A;  4WRI A;  1K95 A;  1REC A;  1Y0V H;  3IF7 A;  1TNP A;  3H4S E;  3TDZ A;  2Y5I A;  1B8L A;  1DJI A;  1S3P A;  1G33 A;  3PM8 A;  1YX8 A;  3VRQ A;  4NDB A;  1TOP A;  3DD4 A;  5J3X A;  1K93 D;  1SY9 A;  1NCY A;  5CSF A;  4GAO A;  4OV2 A;  2FCD A;  3D0Y B;  1B4C A;  1FI6 A;  3WNX B;  1QXP A;  4P5O E;  3I5F B;  4MZK A;  2L5X B;  2PMY A;  2KHN A;  3NSO A;  2M7N A;  2WC8 A;  4YGC B;  1PSB A;  1K9K A;  1X02 A;  2E30 A;  1SL7 A;  4MBE A;  1AK8 A;  1EXR A;  1BOC A;  5FYX A;  1N65 A;  3CGA A;  3BUM B;  5K89 A;  4AQI A;  1RFJ A;  1UHK A;  1RRO A;  5DKQ A;  1YUS A;  1DJX A;  1TNQ A;  3BUN B;  2HQW A;  2F33 A;  2JUL A;  2LVI A;  1DJG A;  4YGD B;  1CKK A;  1S36 A;  4NDD A;  1F55 A;  4MN0 A;  1HT9 A;  5B8I B;  3D0Y A;  1XVJ A;  2Q4U A;  4A4C A;  2CBL A;  3CZT X;  1UHN A;  1PRW A;  4XJK B;  1R2U A;  4QJ3 B;  2L4I A;  1A2X A;  1IWQ A;  2LP2 A;  3NSK A;  3EVR A;  3TDU A;  2BE6 A;  2JOJ A;  3GOF A;  2M49 B;  1MUX A;  1JFJ A;  2H61 C;  4BY5 A;  4AQJ A;  1YVH A;  3CS1 A;  4GGN A;  1KQV A;  1YVL A;  1BR1 B;  1Y1A A;  2KSP A;  1W7J B;  1CM1 A;  5HKY A;  1SCM C;  1NPQ A;  2OTG C;  5KTY A;  1UHH A;  1BG1 A;  4D1E A;  1AVS A;  3KEV A;  2JXC A;  4HSZ A;  3ZWH A;  4YBH B;  1BF5 A;  1QX7 A;  1LA0 A;  3HX4 A;  2JRF A;  1UP5 A;  2MLF C;  2TN4 A;  2PVB A;  4PHK A;  1CLL A;  2P6B B;  5I2Q A;  4XJK A;  1RTP 1;  2JC2 A;  2WCE A;  2KGB C;  3WHU B;  2B1U A;  2GV5 A;  2PRU A;  2WOS A;  1FI5 A;  2LUX A;  5HKW A;  1NX0 A;  1Q80 A;  5KSZ A;  1WY9 A;  2LMT A;  1V1G A;  1NX2 A;  1YRT B;  2ISD A;  3WHT B;  4OKH A;  3M0W A;  2NXQ A;  3LL8 B;  3PAL A;  2NCO A;  5JJG A;  1IQ3 A;  1SR6 C;  2CT9 A;  2KDH A;  1SBJ A;  5CSI A;  3GK1 A;  1J7P A;  1LKJ A;  3PAT A;  2KI4 C;  3F45 A;  4MRX A;  2A4J A;  1QIV A;  1K90 D;  4GFT A;  4M2P A;  2KAV A;  2WCB A;  3ICB A;  2G9B A;  1S6I A;  5I2L A;  2KI6 C;  3OP0 A;  2F8P A;  2M97 A;  2FCE A;  2KQY A;  1SPY A;  2KYC A;  1IJ5 A;  1KK8 C;  1RJV A;  3E3R A;  2MRD A;  2HET A;  1XFW O;  3DVE A;  4NDC A;  4CFQ A;  4YGE B;  1TTX A;  1KK7 Y;  1L2O C;  1KSM A;  4HRE E;  1XFZ O;  4I5J A;  3I5H B;  1WRZ A;  3VRP A;  4C0K A;  1A29 A;  1GGZ A;  3PN7 C;  3VGO A;  4YGB B;  4N1G A;  1HQV A;  3AAJ A;  1Y6W A;  2LHL A;  4P2Y B;  2HPS A;  1L7Z A;  3CLN A;  2L4H A;  3I5I B;  1M63 B;  1K94 A;  1NWD A;  1QJT A;  4ICB A;  2EC6 C;  3AKA A;  1IQ5 A;  5AFP A;  1QV1 A;  2BL0 C;  1YUU A;  3AKB A;  3EVU A;  4JPZ B;  5CPV A;  2ZND A;  2M3W A;  1NCX A;  4N1F A;  3EK7 A;  1QX5 B;  1DMO A;  2ZKM X;  1XA5 A;  2NLN A;  4HRG A;  1PVA A;  3GK4 X;  4DUQ A;  2WCF A;  4NQG A;  3SG4 A;  4C0J A;  3TS5 B;  2SAS A;  2ZRS A;  3CWG A;  4MVF A;  2I2R E;  5TNC A;  4GGF C;  4PHM A;  1QIW A;  1F54 A;  1M39 A;  1AP4 A;  2R2I A;  1TRF A;  2LCP A;  2MA2 A;  4DCK A;  1CDL A;  2LNK A;  5I2O A;  2JU0 A;  1CTR A;  3EK4 A;  2HF5 A;  4ORB B;  1UUR A;  2KNE A;  2G2B A;  2M7L A;  1S1E A;  1CDM A;  1CFC A;  3VRN A;  3I5G C;  4C0L A;  3NSI A;  2QAC A;  4QJ5 B;  3CR4 X;  4WQ2 A;  4PE7 A;  4CID A;  3QRX A;  2BKI B;  2LLU A;  1F4Q A;  1C7W A;  1YR5 A;  2I7A A;  1H4B A;  2WND A;  4R1E A;  1JF0 A;  2OS8 C;  3JTD B;  3LCP C;  3VRR A;  1CMF A;  1S5G Y;  3WXA A;  1TNW A;  2LAN A;  3OB2 B;  2LLS A;  4YI9 A;  2H61 A;  4GBA A;  3K21 A;  2ZRT A;  1QVI Z;  3TUY B;  1MR8 A;  4N5X A;  4PE4 A;  1WDC B;  1SYM A;  1B47 A;  2JZI A;  2LM5 A;  2LVK A;  4YRU A;  4PAL A;  3SG6 A;  1UHJ A;  3SG5 A;  1AUI B;  3CR5 X;  1WRL A;  1WRK A;  5GQQ C;  1BU3 A;  1EG4 A;  2BCA A;  3IQQ A;  1DGV A;  3OX5 A;  1AJ5 A;  1KWO B;  3SG3 A;  5AER A;  3PFV A;  1XK4 A;  1KK7 Z;  2COL B;  4ZCV A;  3LLE A;  1GGW A;  1C7V A;  3O6B A;  1BR4 B;  1KQM B;  2AUC A;  2JQ6 A;  2ZN8 A;  2KFF A;  4QJ4 B;  4PCW A;  1SRA A;  2PSR A;  1LA3 A;  2IS9 A;  1LXF C;  4M2O A;  1DJW A;  1AHR A;  1QX2 A;  2AMI A;  4JQ0 D;  2NZ0 A;  2PAL A;  1QAS A;  2M1K B;  1K8U A;  3A4U B;  1FW4 A;  4PE0 A;  1Y1U A;  1N2D A;  1IH0 A;  1J55 A;  3EKJ A;  2LVJ A;  1CFF A;  3FWC A;  1SKT A;  1G8I A;  2M9G A;  4ZCU A;  4PHJ A;  5IBW A;  1C07 A;  1B8C A;  1YRU B;  1BJF A;  1QTX A;  1CDP A;  1EL4 A;  2LUC A;  1GQM A;  3FS7 A;  1DT7 B;  1EG3 A;  3FWB A;  1UWO A;  4JWQ A;  1XFY O;  5DKR A;  3JVT B;  2L50 A;  2M1U A;  1CFP A;  1JC2 A;  1K9U A;  3BUO B;  2FJU B;  2K7D A;  2K7C A;  3I5F C;  4CLN A;  3OX6 A;  2JNF A;  2LC5 A;  1TCO B;  5CSN A;  5D69 A;  1NUB A;  2KGR A;  2VRG A;  2BKH B;  1CLM A;  2ZFD A;  1F70 A;  2KOT A;  5I8N A;  1OMR A;  1CMG A;  3LK1 A;  1QVI Y;  2SCP A;  2JT3 A;  3TZ1 A;  2BBM A;  1E8A A;  2H2K A;  1PK0 D;  1PSR A;  1U5I B;  5G08 A;  4MEW A;  2KAY A;  1S5G Z;  3BOW B;  1OMD A;  4YGA A;  1VRK A;  2GGM A;  4OR9 B;  2HQ8 A;  4I5L B;  3KHE A;  1KFX L;  1TCF A;  1K96 A;  2GGZ A;  2MJW B;  2ZN9 A;  3DVJ A;  1JWD A;  4MRY A;  3LK0 A;  1NCZ A;  1A4P A;  1QS7 A;  1XFV O;  2BE4 A;  1BLQ A;  2NCP A;  4CPV A;  1CB1 A;  1KSO A;  2KBM A;  4A4B A;  1CNP A;  1MXL C;  2MLE C;  1KFX S;  1A03 A;  5F6T A;  4USL A;  2OPO A;  4ORC B;  1XFU O;  1F8H A;  1U5I A;  2D8N A;  2CTN A;  3BOW A;  3CTN A;  2JT8 A;  2I94 A;  2EGD A;  1S6C A;  1MWN A;  2F3Y A;  1OSA A;  1QV0 A;  1SCV A;  2LVV A;  3EKH A;  1H8B A;  3PLF B;  3OB1 B;  3BXK A;  4FQO A;  2CCM A;  2BCB A;  5AXI A;  2DOQ A;  2F2O A;  2RGI A;  1WLM A;  1NP8 A;  1PUL A;  1IKU A;  1W7I B;  3A8R A;  4IL1 A;  1K2H A;  1D1O A;  4M2Q A;  1IJ6 A;  4FTG A;  4U8D A;  1NYA A;  1OZO A;  2JTT A;  1R6P A;  2LE9 B;  1SCM B;  1ALW A;  1ZUZ A;  2OTG B;  2CXJ A;  5KU1 A;  4L9M A;  2KYF A;  3KPX A;  4BY4 A;  5BPJ A;  4ETO A;  3EVV A;  3NSL A;  1Y1X A;  1J1E A;  3AAK A;  5HKZ A;  1JUO A;  4AOM A;  3DVM A;  3O4Y A;  1J7Q A;  2LMU A;  2M0R A;  5HYD A;  2JNX A;  1F4O A;  1EH2 A;  5AAN A;  4I5N B; 
#chains in the Genus database with same CATH topology
 5D7F A;  1CM4 A;  1NX1 A;  3UO9 A;  2L2E A;  4Q04 A;  1TN4 A;  2K8M B;  3R1V A;  3MSE B;  1BT6 A;  1SMG A;  1XFX O;  2O5G A;  5ER5 A;  4CFR A;  1SR6 B;  2WCK A;  2I18 A;  3DYE A;  3OHM B;  4ORA B;  1GJY A;  3I5H C;  1ALV A;  2KAX A;  1UHI A;  1QLK A;  2L51 A;  2KI4 B;  1B1G A;  1SW8 A;  2JT0 A;  1DGU A;  4F0Z B;  2KFG A;  1FPW A;  1LIN A;  3BYA A;  1KFU L;  1DJY A;  5HLV A;  1A75 B;  1PAL A;  2MAZ A;  1IGV A;  1N0Y A;  1Z4H A;  3I5I C;  1T14 A;  4OVN F;  1OOJ A;  2F3Z A;  2E6W A;  2KI6 D;  2ZNE A;  1KK8 B;  3DF0 B;  1OE9 B;  3SG7 A;  5AEQ A;  1KFU S;  2K7B A;  4PHN A;  3GK2 A;  1M31 A;  1ZFS A;  1L2O B;  2QPT A;  1YX7 A;  4MZJ A;  3RZS A;  1LVC D;  1M45 A;  1DJZ A;  2AAO A;  4XYN A;  1UUS A;  1BMO A;  1RK9 A;  1S26 D;  2FOT A;  3ZNI A;  2LP3 A;  3EG5 B;  3PN7 B;  1FF1 A;  3TS5 C;  3S0E A;  1YUT A;  1JFK A;  1OZS A;  5HLO A;  2K61 A;  3RM1 A;  4DRW A;  4PDZ A;  1GM0 A;  1J7O A;  2BCX A;  3SIB A;  1A75 A;  2LV7 A;  2M8U A;  1ZAC A;  1B8R A;  2EC6 B;  1B7T Z;  4HRH A;  1MF8 B;  1NX3 A;  2BL0 B;  1WLZ A;  5DKN A;  3NXA A;  3CZ2 A;  2Q91 A;  2KFH A;  2Y1N A;  5FI7 A;  1AJ4 A;  1G4Y R;  1EJ3 A;  3DF0 A;  1ORG A;  1RWY A;  3K1E A;  3R1O A;  1XK4 C;  3DVK A;  1SL9 A;  4GUK A;  4INW A;  1J1D A;  3SIA A;  3BQ3 A;  4DIR A;  1KCY A;  3O78 A;  3DXL A;  2KQ6 A;  2WCM A;  1MQ1 A;  2L0P A;  3JTD C;  4I5K A;  2WCH A;  2MBX A;  3B6X A;  1TWO A;  5JOL A;  2WOR A;  4MLW A;  1V1F A;  3TUY C;  1MHO A;  1WDC C;  4MZL A;  2LLT A;  3DZT A;  4GNK B;  2K0J A;  2ERB A;  2Y4Q A;  3D78 A;  4PE1 A;  1B9A A;  2QDI A;  5PAL A;  4E68 A;  1TIZ A;  5ER4 X;  3NHT A;  3I5G B;  2PAS A;  3R72 A;  1QLS A;  1K9P A;  1KWO C;  2LAP A;  2JXL A;  1BOD A;  2BNX A;  1ODB A;  3D77 A;  1YUR A;  2WCL A;  3KO0 A;  1DF0 B;  3PM2 A;  3SG2 A;  4MSP A;  2LMV A;  1JSA A;  2K2A A;  1QAT A;  2OS8 B;  2MHH A;  1KQM C;  2FJY A;  3SJS A;  4OCI A;  2K2F A;  1YTZ C;  4YI8 A;  1DJH A;  3EK8 A;  1NIW A;  2KBI A;  1ZMZ A;  2L98 A;  3FE9 A;  4GGF A;  1ZOT B;  2EHB A;  2F2P A;  1XO5 A;  2M29 A;  3BUW B;  1DTL A;  1S6J A;  2LHI A;  1OMV A;  3SS4 A;  1DVI A;  4GPL B;  1JBA A;  3B87 A;  2V53 A;  1SK6 D;  1TNX A;  2O60 A;  1SL8 A;  1M46 A;  2Y1M A;  1OQP A;  3IQO A;  4DS7 A;  1XYD A;  5DIC A;  3C1V A;  1J7R A;  4UPG A;  3PSR A;  1CFD A;  2JPT A;  5FI6 A;  3L47 A;  3SS5 A;  3FIA A;  1CDN A;  2K7O A;  4TNC A;  1F71 A;  1B7T Y;  1SNL A;  1DF0 A;  1PVB A;  1CLB A;  3HCM A;  5CSJ A;  2CNP A;  2BBN A;  3OGN A;  1XFR A;  1C3Y A;  3JVT C;  3RLZ A;  3BUX B;  1DEL A;  2JWW A;  1FBV A;  3CR2 A;  3V2L A;  2QEO A;  3D10 A;  1NSH A;  1MXE A;  4WQ3 A;  3KF9 A;  3TDI A;  3O2P A;  1IRJ A;  2BEC A;  1JF2 A;  1IG5 A;  2JTZ A;  4WRI A;  1K95 A;  1REC A;  1Y0V H;  3IF7 A;  1TNP A;  3H4S E;  3TDZ A;  2Y5I A;  1B8L A;  1DJI A;  1S3P A;  1G33 A;  1OOI X;  3NGV A;  3PM8 A;  1YX8 A;  3VRQ A;  4NDB A;  1SSE B;  1TOP A;  3DD4 A;  3FE6 A;  5J3X A;  3S0G A;  1K93 D;  1SY9 A;  1NCY A;  5CSF A;  4GAO A;  1TUJ A;  4OV2 A;  2FCD A;  3D0Y B;  1B4C A;  1FI6 A;  3WNX B;  1QXP A;  4P5O E;  4JD9 A;  3I5F B;  4MZK A;  2L5X B;  2PMY A;  2KHN A;  3NSO A;  2M7N A;  2WC8 A;  3PJI A;  4YGC B;  1PSB A;  1K9K A;  1X02 A;  2E30 A;  1SL7 A;  4MBE A;  1AK8 A;  1EXR A;  1BOC A;  5FYX A;  1N65 A;  3CGA A;  3BUM B;  5K89 A;  4AQI A;  1RFJ A;  1UHK A;  1RRO A;  5DKQ A;  1YUS A;  1DJX A;  1TNQ A;  3BUN B;  2HQW A;  2F33 A;  2JUL A;  2LVI A;  1OOG A;  1DJG A;  2KLE A;  3QME A;  4YGD B;  1S36 A;  3L4A A;  4NDD A;  1CKK A;  1F55 A;  4MN0 A;  1HT9 A;  5B8I B;  3D0Y A;  1XVJ A;  2Q4U A;  2PQL A;  4A4C A;  2CBL A;  3CZT X;  1UHN A;  1PRW A;  1LS8 A;  4JKT A;  1R2U A;  4QJ3 B;  2L4I A;  1A2X A;  1IWQ A;  2LP2 A;  3NSK A;  3EVR A;  4XJK B;  3TDU A;  3VRO A;  2BE6 A;  2JOJ A;  3GOF A;  2M49 B;  1MUX A;  1JFJ A;  2H61 C;  4BY5 A;  4AQJ A;  1YVH A;  3CS1 A;  2KPH A;  4GGN A;  1KQV A;  1YVL A;  1BR1 B;  1Y1A A;  2KSP A;  1W7J B;  1CM1 A;  5HKY A;  1SCM C;  1NPQ A;  2OTG C;  2K60 A;  4F7F A;  5KTY A;  1UHH A;  1BG1 A;  2GTE A;  4D1E A;  1AVS A;  3KEV A;  2JXC A;  4HSZ A;  3ZWH A;  4YBH B;  5I94 A;  1QX7 A;  1BF5 A;  1LA0 A;  3HX4 A;  2JRF A;  1UP5 A;  2MLF C;  2TN4 A;  2PVB A;  2PYQ A;  1CLL A;  2P6B B;  4PHK A;  5EL2 A;  5I2Q A;  4XJK A;  1RTP 1;  2JC2 A;  2WCE A;  2KGB C;  3WHU B;  2B1U A;  2GV5 A;  2PRU A;  2WOS A;  1FI5 A;  2LUX A;  5HKW A;  1NX0 A;  1Q80 A;  5KSZ A;  1WY9 A;  2LMT A;  1V1G A;  1NX2 A;  1YRT B;  2ISD A;  3WHT B;  4OKH A;  3B88 A;  3M0W A;  2NXQ A;  3VB1 A;  3LL8 B;  3PAL A;  2NCO A;  5JJG A;  1IQ3 A;  1SR6 C;  2CT9 A;  1OOH A;  2KDH A;  1SBJ A;  5CSI A;  3GK1 A;  1J7P A;  1LKJ A;  3PAT A;  2KI4 C;  3F45 A;  4MRX A;  2A4J A;  1QIV A;  1K90 D;  4GFT A;  4M2P A;  2KAV A;  2WCB A;  3ICB A;  2G9B A;  1S6I A;  5I2L A;  2KI6 C;  3OP0 A;  1P28 A;  4PT1 A;  2F8P A;  5D3O A;  2M97 A;  2QEH A;  2FCE A;  2KQY A;  1SPY A;  2KYC A;  1IJ5 A;  1KK8 C;  1RJV A;  3E3R A;  2MRD A;  2HET A;  4OZD A;  1XFW O;  3DVE A;  4NDC A;  4CFQ A;  4KYN A;  4YGE B;  1TTX A;  1KK7 Y;  1L2O C;  1KSM A;  4HRE E;  1XFZ O;  2H8V A;  4I5J A;  3I5H B;  1WRZ A;  3VRP A;  4FQT A;  4C0K A;  1A29 A;  1GGZ A;  3PN7 C;  3VGO A;  4YGB B;  4N1G A;  1HQV A;  3AAJ A;  1Y6W A;  2LHL A;  4P2Y B;  2HPS A;  3SS3 A;  1L7Z A;  3CLN A;  2L4H A;  3I5I B;  1M63 B;  1K94 A;  1NWD A;  1QJT A;  4ICB A;  2EC6 C;  3AKA A;  3BFB A;  1IQ5 A;  5AFP A;  1QV1 A;  2BL0 C;  1YUU A;  3AKB A;  3EVU A;  3N7H A;  4JPZ B;  5CPV A;  2ZND A;  2M3W A;  1NCX A;  4N1F A;  3EK7 A;  1QX5 B;  1DMO A;  2ZKM X;  1XA5 A;  2NLN A;  4HRG A;  1PVA A;  3GK4 X;  4DUQ A;  2WCF A;  4NQG A;  3SG4 A;  4C0J A;  3TS5 B;  2KLD A;  2SAS A;  2ZRS A;  1IIO A;  3CWG A;  4MVF A;  2I2R E;  2YGU A;  4INX A;  5TNC A;  4GGF C;  4PHM A;  1QIW A;  2WC6 A;  1M39 A;  1AP4 A;  1F54 A;  2R2I A;  1TRF A;  2LCP A;  2MA2 A;  4DCK A;  1CDL A;  2LNK A;  5HL1 A;  5I2O A;  2JU0 A;  1CTR A;  3EK4 A;  3NHI A;  3OBV A;  2HF5 A;  4ORB B;  1UUR A;  2KNE A;  2G2B A;  2M7L A;  1S1E A;  1CDM A;  2WC5 A;  1CFC A;  3VRN A;  3I5G C;  4C0L A;  3NSI A;  2QAC A;  1DQE A;  4QJ5 B;  3CR4 X;  4WQ2 A;  4PE7 A;  4CID A;  3QRX A;  2BKI B;  2LLU A;  1F4Q A;  1C7W A;  1YR5 A;  2I7A A;  1DC1 A;  1H4B A;  2WND A;  4R1E A;  1JF0 A;  2OS8 C;  3JTD B;  3LCP C;  3VRR A;  1CMF A;  1S5G Y;  3WXA A;  1TNW A;  2LAN A;  3OB2 B;  2LLS A;  4YI9 A;  3S0B A;  2H61 A;  2QEV A;  4GBA A;  3K21 A;  2ZRT A;  1QVI Z;  3TUY B;  1MR8 A;  3D74 A;  4N5X A;  4PE4 A;  1WDC B;  1SYM A;  1B47 A;  2JZI A;  2LM5 A;  2LVK A;  4YRU A;  4PAL A;  3SG6 A;  3B86 A;  3DY9 A;  1UHJ A;  1C3Z A;  1AUI B;  3SG5 A;  3CR5 X;  1WRL A;  1WRK A;  3R1P A;  5GQQ C;  1BU3 A;  1EG4 A;  2BCA A;  3IQQ A;  1DGV A;  3OX5 A;  3S0F A;  1AJ5 A;  1KWO B;  3SG3 A;  5AER A;  3PFV A;  1XK4 A;  3S0D A;  1KK7 Z;  2COL B;  4ZCV A;  3LLE A;  1GGW A;  1C7V A;  3O6B A;  1BR4 B;  1KQM B;  2AUC A;  2JQ6 A;  2ZN8 A;  2KFF A;  4QJ4 B;  4PCW A;  1SRA A;  2PSR A;  1LA3 A;  2IS9 A;  1LXF C;  3BFH A;  4M2O A;  1DJW A;  1AHR A;  1QX2 A;  2AMI A;  4JQ0 D;  2NZ0 A;  2PAL A;  1QAS A;  2M1K B;  1K8U A;  3A4U B;  1FW4 A;  4PE0 A;  1Y1U A;  3Q8I A;  4CLN A;  1N2D A;  1IH0 A;  1J55 A;  3EKJ A;  2LVJ A;  1CFF A;  3FWC A;  1SKT A;  2L5Y A;  1G8I A;  2M9G A;  3CAB A;  4ZCU A;  4PHJ A;  5IBW A;  1C07 A;  1B8C A;  1YRU B;  3O4X A;  1BJF A;  1QTX A;  1CDP A;  1EL4 A;  2LUC A;  1GQM A;  3FS7 A;  1DT7 B;  1EG3 A;  3FWB A;  1UWO A;  3BFA A;  1XFY O;  4JWQ A;  2L2C A;  3JVT B;  5DKR A;  2L50 A;  2M1U A;  3FE8 A;  1CFP A;  1JC2 A;  1K9U A;  3BUO B;  3UNW A;  2FJU B;  2K7D A;  2K7C A;  2QEB A;  3I5F C;  3OX6 A;  2JNF A;  2LC5 A;  1TCO B;  1OW4 A;  5CSN A;  5D69 A;  1NUB A;  1QWV A;  1Z2C B;  2KGR A;  2VRG A;  2BKH B;  1CLM A;  2ZFD A;  1F70 A;  2KOT A;  5I8N A;  1OMR A;  1CMG A;  3LK1 A;  1QVI Y;  2SCP A;  2JT3 A;  3TZ1 A;  2BBM A;  1E8A A;  2H2K A;  1PK0 D;  2P71 A;  1PSR A;  1U5I B;  5G08 A;  4MEW A;  2KAY A;  1S5G Z;  3BOW B;  1OMD A;  4YGA A;  1VRK A;  2GGM A;  4OR9 B;  2HQ8 A;  1W9Z A;  2BAP A;  4I5L B;  3KHE A;  1KFX L;  1TCF A;  3S0A A;  1K96 A;  2GGZ A;  2MJW B;  2ZN9 A;  3DVJ A;  1JWD A;  4MRY A;  3LK0 A;  1NCZ A;  1A4P A;  1QS7 A;  1XFV O;  2BE4 A;  5FI2 A;  1BLQ A;  3D76 A;  2NCP A;  4CPV A;  1CB1 A;  1KSO A;  2KBM A;  4A4B A;  1CNP A;  1MXL C;  2MLE C;  1DEK A;  3CZ0 A;  1KFX S;  1A03 A;  5F6T A;  4USL A;  2OPO A;  4ORC B;  1XFU O;  3D73 A;  1F8H A;  1U5I A;  2D8N A;  2CTN A;  3BOW A;  3CTN A;  2JT8 A;  3CDN A;  2I94 A;  2EGD A;  1S6C A;  3B7A A;  1MWN A;  2F3Y A;  1OSA A;  1QV0 A;  1SCV A;  2LVV A;  3EKH A;  1H8B A;  3PLF B;  3OB1 B;  3BXK A;  4FQO A;  2CCM A;  2BCB A;  3L4L A;  5AXI A;  2DOQ A;  2F2O A;  2P70 A;  2RGI A;  4IJ7 A;  2JPO A;  1WLM A;  1NP8 A;  1PUL A;  1IKU A;  1W7I B;  3A8R A;  4IL1 A;  1K2H A;  1D1O A;  4M2Q A;  1IJ6 A;  4FTG A;  4U8D A;  1NYA A;  1OZO A;  2JTT A;  1R6P A;  2LE9 B;  3IVT A;  1SCM B;  1ALW A;  1ZUZ A;  2OTG B;  2CXJ A;  5KU1 A;  4L9M A;  2KYF A;  1OOF A;  3KPX A;  4BY4 A;  5BPJ A;  4ETO A;  1TUZ A;  3EVV A;  3NSL A;  3D75 A;  3CZ1 A;  1Y1X A;  1J1E A;  3AAK A;  5HKZ A;  1JUO A;  4AOM A;  3BJH A;  3DVM A;  3O4Y A;  1J7Q A;  2LMU A;  2M0R A;  5HYD A;  3CYZ A;  2JNX A;  1F4O A;  1EH2 A;  2WCJ A;  5AAN A;  4I5N B; 
#chains in the Genus database with same CATH homology
 5D7F A;  1CM4 A;  1NX1 A;  2L2E A;  4Q04 A;  1TN4 A;  2K8M B;  3MSE B;  1BT6 A;  1SMG A;  1XFX O;  2O5G A;  5ER5 A;  4CFR A;  1SR6 B;  2I18 A;  3OHM B;  4ORA B;  1GJY A;  3I5H C;  1ALV A;  2KAX A;  1UHI A;  1QLK A;  2L51 A;  2KI4 B;  1B1G A;  1SW8 A;  2JT0 A;  1DGU A;  4F0Z B;  2KFG A;  1FPW A;  1LIN A;  3BYA A;  1KFU L;  1DJY A;  5HLV A;  1A75 B;  1PAL A;  2MAZ A;  1IGV A;  1N0Y A;  3I5I C;  4OVN F;  1OOJ A;  2F3Z A;  2E6W A;  2KI6 D;  2ZNE A;  1KK8 B;  3DF0 B;  1OE9 B;  3SG7 A;  5AEQ A;  1KFU S;  2K7B A;  4PHN A;  3GK2 A;  1M31 A;  1ZFS A;  1L2O B;  2QPT A;  1YX7 A;  4MZJ A;  1LVC D;  1M45 A;  1DJZ A;  2AAO A;  4XYN A;  1UUS A;  1BMO A;  1RK9 A;  1S26 D;  2FOT A;  3ZNI A;  2LP3 A;  3PN7 B;  1FF1 A;  3TS5 C;  1YUT A;  1JFK A;  1OZS A;  5HLO A;  2K61 A;  3RM1 A;  4DRW A;  4PDZ A;  1J7O A;  2BCX A;  3SIB A;  1A75 A;  2LV7 A;  2M8U A;  1ZAC A;  1B8R A;  2EC6 B;  1B7T Z;  4HRH A;  1MF8 B;  1NX3 A;  2BL0 B;  1WLZ A;  5DKN A;  3NXA A;  2Q91 A;  2KFH A;  2Y1N A;  1AJ4 A;  1G4Y R;  1EJ3 A;  3DF0 A;  1RWY A;  3VRO A;  1XK4 C;  3DVK A;  1SL9 A;  4GUK A;  1J1D A;  3SIA A;  3BQ3 A;  4DIR A;  1KCY A;  3O78 A;  2KQ6 A;  1MQ1 A;  2L0P A;  3JTD C;  4I5K A;  2MBX A;  5JOL A;  2WOR A;  4MLW A;  1V1F A;  3TUY C;  1MHO A;  1WDC C;  4MZL A;  2LLT A;  4GNK B;  2K0J A;  2Y4Q A;  4PE1 A;  1B9A A;  5PAL A;  4E68 A;  1TIZ A;  5ER4 X;  3I5G B;  2PAS A;  1QLS A;  1K9P A;  1KWO C;  2LAP A;  2JXL A;  1BOD A;  1ODB A;  1YUR A;  3KO0 A;  1DF0 B;  3SG2 A;  4MSP A;  2LMV A;  1JSA A;  2K2A A;  1QAT A;  2OS8 B;  2MHH A;  1KQM C;  3SJS A;  4OCI A;  2K2F A;  1YTZ C;  4YI8 A;  1DJH A;  3EK8 A;  1NIW A;  2KBI A;  1ZMZ A;  2L98 A;  4GGF A;  1ZOT B;  2EHB A;  2F2P A;  1XO5 A;  2M29 A;  3BUW B;  1DTL A;  1S6J A;  2LHI A;  1OMV A;  1DVI A;  4GPL B;  1JBA A;  2V53 A;  1SK6 D;  1TNX A;  2O60 A;  1SL8 A;  1M46 A;  2Y1M A;  1OQP A;  3IQO A;  4DS7 A;  1XYD A;  3C1V A;  1J7R A;  4UPG A;  3PSR A;  1CFD A;  2JPT A;  3FIA A;  1CDN A;  2K7O A;  4TNC A;  1F71 A;  1B7T Y;  1SNL A;  1DF0 A;  1PVB A;  1CLB A;  3HCM A;  5CSJ A;  2CNP A;  2BBN A;  3JVT C;  3RLZ A;  3BUX B;  2JWW A;  3CR2 A;  1FBV A;  3D10 A;  1NSH A;  1MXE A;  4WQ3 A;  3KF9 A;  3TDI A;  3O2P A;  1IRJ A;  2BEC A;  1JF2 A;  1IG5 A;  2JTZ A;  4WRI A;  1K95 A;  1REC A;  1Y0V H;  3IF7 A;  1TNP A;  3H4S E;  3TDZ A;  2Y5I A;  1B8L A;  1DJI A;  1S3P A;  1G33 A;  3PM8 A;  1YX8 A;  3VRQ A;  4NDB A;  1TOP A;  3DD4 A;  5J3X A;  1K93 D;  1SY9 A;  1NCY A;  5CSF A;  4GAO A;  4OV2 A;  2FCD A;  3D0Y B;  1B4C A;  1FI6 A;  3WNX B;  1QXP A;  4P5O E;  3I5F B;  4MZK A;  2L5X B;  2PMY A;  2KHN A;  3NSO A;  2M7N A;  2WC8 A;  4YGC B;  1PSB A;  1K9K A;  1X02 A;  2E30 A;  1SL7 A;  4MBE A;  1AK8 A;  1EXR A;  1BOC A;  5FYX A;  1N65 A;  3CGA A;  3BUM B;  5K89 A;  4AQI A;  1RFJ A;  1UHK A;  1RRO A;  5DKQ A;  1YUS A;  1DJX A;  1TNQ A;  3BUN B;  2HQW A;  2F33 A;  2JUL A;  2LVI A;  1DJG A;  4YGD B;  1CKK A;  1S36 A;  4NDD A;  1F55 A;  4MN0 A;  1HT9 A;  5B8I B;  3D0Y A;  1XVJ A;  2Q4U A;  4A4C A;  2CBL A;  3CZT X;  1UHN A;  1PRW A;  4XJK B;  1R2U A;  4QJ3 B;  2L4I A;  1A2X A;  1IWQ A;  2LP2 A;  3NSK A;  3EVR A;  3TDU A;  2BE6 A;  2JOJ A;  3GOF A;  2M49 B;  1MUX A;  1JFJ A;  2H61 C;  4BY5 A;  4AQJ A;  1YVH A;  3CS1 A;  4GGN A;  1KQV A;  1YVL A;  1BR1 B;  1Y1A A;  2KSP A;  1W7J B;  1CM1 A;  5HKY A;  1SCM C;  1NPQ A;  2OTG C;  5KTY A;  1UHH A;  1BG1 A;  4D1E A;  1AVS A;  3KEV A;  2JXC A;  4HSZ A;  3ZWH A;  4YBH B;  1BF5 A;  1QX7 A;  1LA0 A;  3HX4 A;  2JRF A;  1UP5 A;  2MLF C;  2TN4 A;  2PVB A;  4PHK A;  1CLL A;  2P6B B;  5I2Q A;  4XJK A;  1RTP 1;  2JC2 A;  2WCE A;  2KGB C;  3WHU B;  2B1U A;  2GV5 A;  2PRU A;  2WOS A;  1FI5 A;  2LUX A;  5HKW A;  1NX0 A;  1Q80 A;  5KSZ A;  1WY9 A;  2LMT A;  1V1G A;  1NX2 A;  1YRT B;  2ISD A;  3WHT B;  4OKH A;  3M0W A;  2NXQ A;  3LL8 B;  3PAL A;  2NCO A;  5JJG A;  1IQ3 A;  1SR6 C;  2CT9 A;  2KDH A;  1SBJ A;  5CSI A;  3GK1 A;  1J7P A;  1LKJ A;  3PAT A;  2KI4 C;  3F45 A;  4MRX A;  2A4J A;  1QIV A;  1K90 D;  4GFT A;  4M2P A;  2KAV A;  2WCB A;  3ICB A;  2G9B A;  1S6I A;  5I2L A;  2KI6 C;  3OP0 A;  2F8P A;  2M97 A;  2FCE A;  2KQY A;  1SPY A;  2KYC A;  1IJ5 A;  1KK8 C;  1RJV A;  3E3R A;  2MRD A;  2HET A;  1XFW O;  3DVE A;  4NDC A;  4CFQ A;  4YGE B;  1TTX A;  1KK7 Y;  1L2O C;  1KSM A;  4HRE E;  1XFZ O;  4I5J A;  3I5H B;  1WRZ A;  3VRP A;  4C0K A;  1A29 A;  1GGZ A;  3PN7 C;  3VGO A;  4YGB B;  4N1G A;  1HQV A;  3AAJ A;  1Y6W A;  2LHL A;  4P2Y B;  2HPS A;  1L7Z A;  3CLN A;  2L4H A;  3I5I B;  1M63 B;  1K94 A;  1NWD A;  1QJT A;  4ICB A;  2EC6 C;  3AKA A;  1IQ5 A;  5AFP A;  1QV1 A;  2BL0 C;  1YUU A;  3AKB A;  3EVU A;  4JPZ B;  5CPV A;  2ZND A;  2M3W A;  1NCX A;  4N1F A;  3EK7 A;  1QX5 B;  1DMO A;  2ZKM X;  1XA5 A;  2NLN A;  4HRG A;  1PVA A;  3GK4 X;  4DUQ A;  2WCF A;  4NQG A;  3SG4 A;  4C0J A;  3TS5 B;  2SAS A;  2ZRS A;  3CWG A;  4MVF A;  2I2R E;  5TNC A;  4GGF C;  4PHM A;  1QIW A;  1F54 A;  1M39 A;  1AP4 A;  2R2I A;  1TRF A;  2LCP A;  2MA2 A;  4DCK A;  1CDL A;  2LNK A;  5I2O A;  2JU0 A;  1CTR A;  3EK4 A;  2HF5 A;  4ORB B;  1UUR A;  2KNE A;  2G2B A;  2M7L A;  1S1E A;  1CDM A;  1CFC A;  3VRN A;  3I5G C;  4C0L A;  3NSI A;  2QAC A;  4QJ5 B;  3CR4 X;  4WQ2 A;  4PE7 A;  4CID A;  3QRX A;  2BKI B;  2LLU A;  1F4Q A;  1C7W A;  1YR5 A;  2I7A A;  1H4B A;  2WND A;  4R1E A;  1JF0 A;  2OS8 C;  3JTD B;  3LCP C;  3VRR A;  1CMF A;  1S5G Y;  3WXA A;  1TNW A;  2LAN A;  3OB2 B;  2LLS A;  4YI9 A;  2H61 A;  4GBA A;  3K21 A;  2ZRT A;  1QVI Z;  3TUY B;  1MR8 A;  4N5X A;  4PE4 A;  1WDC B;  1SYM A;  1B47 A;  2JZI A;  2LM5 A;  2LVK A;  4YRU A;  4PAL A;  3SG6 A;  1UHJ A;  3SG5 A;  1AUI B;  3CR5 X;  1WRL A;  1WRK A;  5GQQ C;  1BU3 A;  1EG4 A;  2BCA A;  3IQQ A;  1DGV A;  3OX5 A;  1AJ5 A;  1KWO B;  3SG3 A;  5AER A;  3PFV A;  1XK4 A;  1KK7 Z;  2COL B;  4ZCV A;  3LLE A;  1GGW A;  1C7V A;  3O6B A;  1BR4 B;  1KQM B;  2AUC A;  2JQ6 A;  2ZN8 A;  2KFF A;  4QJ4 B;  4PCW A;  1SRA A;  2PSR A;  1LA3 A;  2IS9 A;  1LXF C;  4M2O A;  1DJW A;  1AHR A;  1QX2 A;  2AMI A;  4JQ0 D;  2NZ0 A;  2PAL A;  1QAS A;  2M1K B;  1K8U A;  3A4U B;  1FW4 A;  4PE0 A;  1Y1U A;  1N2D A;  1IH0 A;  1J55 A;  3EKJ A;  2LVJ A;  1CFF A;  3FWC A;  1SKT A;  1G8I A;  2M9G A;  4ZCU A;  4PHJ A;  5IBW A;  1C07 A;  1B8C A;  1YRU B;  1BJF A;  1QTX A;  1CDP A;  1EL4 A;  2LUC A;  1GQM A;  3FS7 A;  1DT7 B;  1EG3 A;  3FWB A;  1UWO A;  4JWQ A;  1XFY O;  5DKR A;  3JVT B;  2L50 A;  2M1U A;  1CFP A;  1JC2 A;  1K9U A;  3BUO B;  2FJU B;  2K7D A;  2K7C A;  3I5F C;  4CLN A;  3OX6 A;  2JNF A;  2LC5 A;  1TCO B;  5CSN A;  5D69 A;  1NUB A;  2KGR A;  2VRG A;  2BKH B;  1CLM A;  2ZFD A;  1F70 A;  2KOT A;  5I8N A;  1OMR A;  1CMG A;  3LK1 A;  1QVI Y;  2SCP A;  2JT3 A;  3TZ1 A;  2BBM A;  1E8A A;  2H2K A;  1PK0 D;  1PSR A;  1U5I B;  5G08 A;  4MEW A;  2KAY A;  1S5G Z;  3BOW B;  1OMD A;  4YGA A;  1VRK A;  2GGM A;  4OR9 B;  2HQ8 A;  4I5L B;  3KHE A;  1KFX L;  1TCF A;  1K96 A;  2GGZ A;  2MJW B;  2ZN9 A;  3DVJ A;  1JWD A;  4MRY A;  3LK0 A;  1NCZ A;  1A4P A;  1QS7 A;  1XFV O;  2BE4 A;  1BLQ A;  2NCP A;  4CPV A;  1CB1 A;  1KSO A;  2KBM A;  4A4B A;  1CNP A;  1MXL C;  2MLE C;  1KFX S;  1A03 A;  5F6T A;  4USL A;  2OPO A;  4ORC B;  1XFU O;  1F8H A;  1U5I A;  2D8N A;  2CTN A;  3BOW A;  3CTN A;  2JT8 A;  2I94 A;  2EGD A;  1S6C A;  1MWN A;  2F3Y A;  1OSA A;  1QV0 A;  1SCV A;  2LVV A;  3EKH A;  1H8B A;  3PLF B;  3OB1 B;  3BXK A;  4FQO A;  2CCM A;  2BCB A;  5AXI A;  2DOQ A;  2F2O A;  2RGI A;  1WLM A;  1NP8 A;  1PUL A;  1IKU A;  1W7I B;  3A8R A;  4IL1 A;  1K2H A;  1D1O A;  4M2Q A;  1IJ6 A;  4FTG A;  4U8D A;  1NYA A;  1OZO A;  2JTT A;  1R6P A;  2LE9 B;  1SCM B;  1ALW A;  1ZUZ A;  2OTG B;  2CXJ A;  5KU1 A;  4L9M A;  2KYF A;  3KPX A;  4BY4 A;  5BPJ A;  4ETO A;  3EVV A;  3NSL A;  1Y1X A;  1J1E A;  3AAK A;  5HKZ A;  1JUO A;  4AOM A;  3DVM A;  3O4Y A;  1J7Q A;  2LMU A;  2M0R A;  5HYD A;  2JNX A;  1F4O A;  1EH2 A;  5AAN A;  4I5N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...