3LK1A

X-ray structure of bovine sc0322,ca(2+)-s100b
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
88
structure length
88
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title In vitro screening and structural characterization of inhibitors of the S100B-p53 interaction.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 30
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2010-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3lk1A00
1DJIA 4U8DA 3CGAA 2LAPA 1DJZA 3AKAA 1W7IB 1UHNA 1GJYA 2M29A 4XYNA 1QS7A 5DKNA 1KQVA 2JULA 3SIAA 1CFPA 1PALA 3TUYB 2G9BA 3SIBA 1WRZA 2KQ6A 2JTTA 2JRFA 1BJFA 2ZNEA 1QX7A 3CR2A 2OS8B 1L2OB 2K7BA 1C07A 3EVRA 2GV5A 1BR4B 1RFJA 2SASA 2JNXA 1SR6B 3BUOB 4GGFA 3NSLA 2FCEA 3DVKA 1F71A 2K2FA 1LA3A 2KDHA 4GBAA 2LE9B 2P6BB 1A75B 1BOCA 4A4CA 2NZ0A 1NUBA 2AMIA 2Y1MA 1CM4A 1G33A 1PVBA 5I2LA 2PMYA 1QV0A 1MQ1A 1S1EA 1IWQA 2L4HA 4OCIA 2MJWB 1B47A 4USLA 1CLLA 1WDCC 1BT6A 2CT9A 4XJKB 4YGDB 1WLMA 3NSKA 1SCVA 3BUMB 4JWQA 2KNEA 4R1EA 5HKZA 1IQ3A 1MUXA 1RWYA 2JNFA 2JXCA 3SG3A 2EGDA 4NDBA 1JF0A 3BXKA 1DJWA 1OQPA 1N2DA 2WCFA 1SMGA 2I18A 3NSOA 2SCPA 3TDIA 2ZN9A 3DVMA 4HRHA 3VRRA 2MAZA 4UPGA 1QIWA 1XFWO 2LUXA 5AERA 2L2EA 2M97A 3EVVA 1SCMC 3ICBA 4PHMA 5DKQA 5KSZA 4AQJA 4E68A 1X02A 5G08A 2JC2A 1QJTA 4L9MA 1IH0A 1B9AA 2JU0A 3O4YA 5KU1A 4PDZA 1IJ6A 2M0RA 1S5GZ 2KAYA 2M3WA 2KYFA 1PK0D 2BBMA 2LHIA 3FWCA 2FCDA 2WCBA 4YRUA 2ZRSA 1QLKA 2F3YA 4ORCB 3AAJA 3PN7C 2IS9A 3CLNA 1RTP1 4C0JA 2M9GA 3PATA 2Q4UA 1EG3A 1NCXA 4DCKA 4MZJA 5HKYA 5AXIA 1VRKA 3AAKA 4YI8A 2KFGA 1JF2A 1WY9A 3TUYC 2KGBC 1V1GA 3M0WA 3HX4A 1J7OA 1AVSA 1UHJA 3JVTB 2LLUA 2WCEA 1A75A 1BG1A 2L5XB 1EG4A 1M31A 1Q80A 2OS8C 1OMDA 3BUWB 3GK1A 4MSPA 5ER5A 3DD4A 1NSHA 4A4BA 1KK7Z 1IGVA 1SR6C 1NIWA 2LLTA 2MLEC 1QX2A 1E8AA 2M7LA 2M1KB 1QLSA 4YBHB 2LMUA 1QVIY 1SK6D 3IF7A 4PHJA 1M45A 4PE0A 2Y5IA 3O2PA 1DT7B 1UUSA 2JT8A 1OSAA 2WNDA 2LUCA 2H2KA 5D7FA 2KBIA 1CM1A 2M1UA 1A2XA 3FIAA 4CFQA 1BMOA 2HF5A 1IKUA 1B8LA 2NCPA 3CR5X 4C0LA 1D1OA 2TN4A 2LVJA 2WOSA 1DF0B 3IQOA 1XK4C 1XA5A 2JZIA 4P5OE 1GGWA 3CTNA 2JXLA 2JQ6A 2E30A 3LCPC 1UWOA 1J1DA 4HREE 2PSRA 3VRNA 1PSBA 1GQMA 3JTDC 1OMRA 2CNPA 1OZSA 2BCBA 1Y0VH 3TS5B 1TTXA 3A4UB 2Y4QA 1KWOB 3C1VA 1SBJA 1YR5A 4I5JA 1QTXA 3BOWB 2WORA 1OZOA 4ZCUA 3WXAA 3GOFA 1YX8A 1CLBA 3I5IB 3WHUB 1YRTB 2Y1NA 5K89A 5J3XA 2L4IA 3VROA 1U5IB 1NP8A 1SPYA 4Q04A 1F55A 4MRXA 1LVCD 2LMVA 2KI4B 2KQYA 1J7QA 1QATA 1WRLA 2JTZA 1RROA 2KSPA 1ALWA 1OOJA 2K7CA 3HCMA 1JFKA 3FS7A 4WQ2A 3SG5A 1ZMZA 1F70A 1AHRA 2BCXA 4C0KA 1CDLA 3GK4X 4YGEB 2KFFA 2NXQA 1C7VA 5HYDA 4OV2A 1XFZO 2ZNDA 1YURA 2LCPA 2ZN8A 1RECA 3D0YA 1V1FA 5GQQC 1MXEA 1J7PA 4GGNA 1K9UA 2CXJA 1K96A 4GPLB 1CMFA 1BU3A 3O78A 4AOMA 3JVTC 1TNPA 3ZWHA 1CFFA 2KHNA 2ZFDA 3DF0A 2CBLA 4MZKA 4P2YB 3PFVA 3RLZA 3TDZA 1CTRA 1RK9A 1IRJA 3KEVA 2KAXA 3SG4A 1CFCA 3DVJA 1SL7A 2LP3A 1BR1B 1ZOTB 2BE4A 4PHKA 1NX1A 1TNQA 3EK8A 1NYAA 1MR8A 1B7TY 1J7RA 2OTGC 1K93D 4OR9B 1HQVA 2LNKA 2MLFC 5AANA 5TNCA 1RJVA 2V53A 3LL8B 2K7OA 4CIDA 1DJHA 5HKWA 1B7TZ 2LC5A 2EHBA 1W7JB 2L0PA 1K90D 2COLB 1DVIA 1QASA 2K2AA 3OP0A 1B8CA 5KTYA 3TZ1A 1SL8A 4OVNF 3VGOA 3VRQA 3PLFB 1H4BA 2BECA 3IQQA 2D8NA 1DGUA 1PULA 1R2UA 4QJ3B 3O6BA 1DJYA 4F0ZB 1YTZC 1CDNA 2CCMA 1F4QA 1XO5A 2PASA 3TS5C 3CZTX 1KWOC 1QIVA 4PALA 3EKHA 4HSZA 4MLWA 3K21A 3I5IC 2H61C 2O5GA 1Y1XA 1F4OA 1Y1AA 1CB1A 3D10A 1CLMA 1YUSA 2NCOA 1J1EA 2I2RE 4JPZB 1EH2A 1KFUS 1NWDA 1XFUO 1FI6A 2KI4C 2FOTA 5AFPA 1KCYA 2KBMA 4I5LB 4CLNA 1XYDA 4XJKA 2JPTA 1N0YA 1A03A 1DJGA 2OTGB 1LINA 1MHOA 2MRDA 3NSIA 1EL4A 1EJ3A 1XK4A 1TOPA 1QVIZ 4YGCB 3OX6A 1B8RA 1S36A 2BE6A 1DJXA 3OB2B 4MZLA 1K2HA 4NDCA 1KFXL 2QACA 2BL0C 4I5KA 1DMOA 4IL1A 1SW8A 4GAOA 1IG5A 4OKHA 4ZCVA 1AP4A 4CPVA 5B8IB 5AEQA 3LLEA 1JC2A 1A4PA 2PRUA 2LP2A 4YGAA 4PE7A 1HT9A 1FI5A 5JOLA 1SRAA 1KFUL 2MBXA 3I5GC 5CSNA 1PSRA 1M46A 4MN0A 3TDUA 1KK8B 3A8RA 1M39A 2LLSA 3CWGA 1PVAA 1M63B 1UHIA 2M8UA 4FTGA 3SG2A 2B1UA 1CKKA 1DGVA 5JJGA 3OX5A 2LV7A 1FBVA 1C7WA 1QV1A 4NQGA 4N1FA 2LVIA 5CSIA 5CSFA 3EVUA 1ZUZA 2KFHA 1NX0A 2JWWA 1CMGA 3QRXA 1SYMA 4ORAB 2KI6D 4WQ3A 1FF1A 1Y1UA 2JT0A 2KAVA 2R2IA 1N65A 4ICBA 4N5XA 5BPJA 2RGIA 5F6TA 2PALA 1NCZA 1S6CA 3I5HC 1NCYA 3GK2A 1JBAA 1YUUA 2OPOA 1K9PA 3E3RA 4HRGA 2Q91A 3VRPA 1CFDA 1OE9B 1YUTA 2FJUB 2EC6B 4FQOA 2HQ8A 1R6PA 2KOTA 3LK1A 1B4CA 2BL0B 2BKIB 2KI6C 3OB1B 1OMVA 1ZFSA 3OHMB 5I2QA 1UHKA 4TNCA 2F3ZA 1CDPA 1ODBA 1XFVO 2HQWA 4QJ5B 2F33A 2L50A 4GFTA 1SNLA 1TCOB 5D69A 2GGZA 1L7ZA 2QPTA 5HLOA 4BY5A 4D1EA 1F8HA 4M2QA 3I5GB 1AUIB 1KQMB 4DRWA 1TRFA 1B1GA 1MWNA 4BY4A 4M2PA 1YX7A 4GGFC 5IBWA 3CR4X 1K8UA 1A29A 1BODA 4MEWA 1AK8A 5DKRA 4GUKA 1G8IA 2HETA 2E6WA 3RM1A 1DF0A 4MRYA 4PE4A 3PSRA 3KO0A 1YRUB 4GNKB 1AJ4A 5CSJA 3ZNIA 1BLQA 3JTDB 4YGBB 4ORBB 2BKHB 1KSOA 1Y6WA 2F2OA 3I5FC 4WRIA 4PCWA 5CPVA 2KYCA 4DIRA 1UP5A 2VRGA 3SG7A 1SKTA 1F54A 3BQ3A 3I5HB 2A4JA 1H8BA 3BOWA 1J55A 3KHEA 2JOJA 1JUOA 1S6IA 2O60A 4ETOA 2L51A 3WNXB 2H61A 4QJ4B 2LHLA 1IQ5A 3KPXA 1S5GY 1UHHA 2LMTA 1U5IA 2BBNA 5FYXA 3PALA 1CDMA 4MBEA 1KK8C 1KFXS 4JQ0D 4CFRA 1KSMA 1S6JA 2KGRA 1SL9A 1XFYO 2M7NA 1ALVA 2NLNA 5PALA 2M49B 5I2OA 1MXLC 1JWDA 4DUQA 2LANA 1NX2A 1LXFC 2WC8A 3EK4A 2MHHA 1CNPA 1K95A 3CS1A 2K0JA 2LM5A 2MA2A 4M2OA 3SG6A 1AJ5A 1QX5B 1NX3A 1DTLA 2F8PA 4MVFA 1BF5A 3BUXB 1TCFA 4DS7A 4NDDA 3LK0A 1JFJA 2LVKA 5HLVA 5I8NA 1WRKA 1TNXA 1ZACA 4PE1A 3SJSA 2G2BA 1WDCB 1K9KA 1S3PA 3F45A 2JT3A 2DOQA 1KK7Y 1G4YR 2EC6C 3MSEB 1TNWA 3AKBA 3EKJA 1SY9A 3I5FB 1JSAA 1L2OC 1GGZA 2BCAA 2F2PA 2K8MB 1YVLA 3FWBA 1MF8B 3D0YB 3H4SE 3EK7A 1K94A 5ER4X 1LKJA 2PVBA 1XVJA 1SCMB 1LA0A 3NXAA 1YVHA 3DF0B 3KF9A 4PHNA 1FPWA 1S26D 3WHTB 2LVVA 1KQMC 1QXPA 1WLZA 1EXRA 2K61A 2GGMA 1NPQA 2I94A 2L98A 4YI9A 2AAOA 4I5NB 3DVEA 4AQIA 1FW4A 1XFXO 4N1GA 1UURA 2ISDA 2CTNA 2HPSA 2AUCA 1PRWA 2ZRTA 2ZKMX 2I7AA 3PN7B 1IJ5A 3PM8A 2K7DA 3BUNB 3BYAA 1TN4A 1TIZA
chains in the Genus database with same CATH superfamily
1DJIA 4U8DA 2FJYA 3CGAA 2LAPA 1DJZA 3AKAA 1W7IB 1UHNA 1GJYA 2M29A 4XYNA 1QS7A 5DKNA 1KQVA 2JULA 3SIAA 1CFPA 1PALA 3TUYB 2G9BA 3S0BA 1DELA 3SIBA 1XFRA 1WRZA 2KQ6A 2JTTA 2JRFA 1BJFA 2ZNEA 1QX7A 3CR2A 2OS8B 2QEVA 5D3OA 1L2OB 3S0EA 2K7BA 1C07A 3EVRA 2GV5A 1BR4B 1RFJA 2SASA 2GTEA 1SR6B 2JNXA 3BUOB 4GGFA 1C3YA 3NSLA 2FCEA 3DVKA 1F71A 2K2FA 3L4LA 1LA3A 2WCJA 2KDHA 3BFHA 4GBAA 2LE9B 2P6BB 1A75B 1ORGA 4FQTA 1BOCA 4A4CA 2NZ0A 3EG5B 1NUBA 2AMIA 3B88A 2Y1MA 1CM4A 1G33A 1PVBA 5I2LA 2PMYA 3V2LA 1QV0A 1MQ1A 1S1EA 1IWQA 2L4HA 4OCIA 2MJWB 1B47A 4USLA 1CLLA 1WDCC 1BT6A 2CT9A 3BJHA 4XJKB 4YGDB 1WLMA 3NSKA 1SCVA 3BUMB 4JWQA 2KNEA 4R1EA 5HKZA 1IQ3A 1MUXA 1RWYA 2JNFA 2JXCA 3DXLA 3SG3A 2EGDA 4NDBA 1JF0A 3BXKA 1DJWA 1OQPA 1N2DA 2WCFA 3FE8A 1SMGA 2I18A 3CZ0A 2SCPA 3NSOA 3TDIA 2ZN9A 3DVMA 4HRHA 3VRRA 2MAZA 4UPGA 1QIWA 3S0AA 1XFWO 2LUXA 5AERA 2L2EA 2M97A 3D76A 3EVVA 1SCMC 3ICBA 4PHMA 5DKQA 5KSZA 4AQJA 4E68A 1X02A 5G08A 2JC2A 1QJTA 4L9MA 1IH0A 1B9AA 2JU0A 3O4YA 5KU1A 4PDZA 1IJ6A 2M0RA 1S5GZ 2KAYA 2M3WA 2KYFA 1PK0D 2BBMA 2LHIA 3PM2A 4IJ7A 3FWCA 2FCDA 2WCBA 4YRUA 2ZRSA 1QLKA 2F3YA 4ORCB 3AAJA 5HL1A 3PN7C 2IS9A 2YGUA 3CLNA 1RTP1 4C0JA 2M9GA 3PATA 2Q4UA 1EG3A 1NCXA 4DCKA 4MZJA 5HKYA 5AXIA 1VRKA 3AAKA 1DEKA 4YI8A 2KFGA 1JF2A 1WY9A 2BAPA 3TUYC 2KGBC 1V1GA 3M0WA 1TUZA 3HX4A 1J7OA 1AVSA 1UHJA 3JVTB 2LLUA 2WCEA 2WCHA 1A75A 3DZTA 1BG1A 2L5XB 1EG4A 1M31A 1Q80A 2OS8C 1OMDA 3BUWB 3GK1A 4MSPA 5ER5A 2WC5A 1GM0A 3DD4A 3BFBA 3D74A 1NSHA 1TUJA 4A4BA 1KK7Z 1IGVA 1SR6C 1NIWA 1P28A 2BNXA 1QX2A 1E8AA 2LLTA 2MLEC 2M7LA 1C3ZA 2M1KB 1QLSA 4YBHB 2LMUA 4JD9A 1QVIY 1LS8A 1SK6D 3DYEA 3IF7A 4PHJA 1M45A 4PE0A 3R1VA 2Y5IA 3O2PA 1DT7B 1UUSA 2KLDA 2JT8A 1OSAA 2WNDA 4F7FA 2LUCA 2H2KA 5D7FA 2KBIA 3Q8IA 1CM1A 2M1UA 1A2XA 3FIAA 2L2CA 4CFQA 1BMOA 1W9ZA 2HF5A 1IKUA 1B8LA 2NCPA 3CR5X 4INWA 4C0LA 1D1OA 2TN4A 2LVJA 2WOSA 1DF0B 3IQOA 2K60A 1XK4C 1XA5A 2JZIA 4P5OE 4PT1A 1GGWA 3CTNA 2JXLA 2JQ6A 2E30A 3NGVA 3LCPC 1UWOA 1J1DA 4HREE 2PSRA 3VRNA 1PSBA 1GQMA 3JTDC 1OMRA 2CNPA 2QEOA 1OW4A 1OZSA 2BCBA 2WCKA 1Y0VH 4JKTA 3SS3A 3TS5B 1TTXA 3A4UB 2Y4QA 1KWOB 3C1VA 1SBJA 1YR5A 4I5JA 1QTXA 3BOWB 2WORA 1OZOA 4ZCUA 3WXAA 3GOFA 1YX8A 1CLBA 3I5IB 3WHUB 2PQLA 3S0DA 1YRTB 2Y1NA 5K89A 5J3XA 2L4IA 3VROA 1U5IB 1NP8A 1SPYA 4Q04A 3RZSA 1F55A 2KPHA 4MRXA 1LVCD 2LMVA 2KI4B 2KQYA 2P71A 3S0GA 1J7QA 1QATA 1WRLA 2JTZA 1RROA 1DC1A 2KSPA 1ALWA 1OOJA 2K7CA 3HCMA 1JFKA 3FS7A 4WQ2A 3SG5A 1ZMZA 1F70A 1AHRA 2BCXA 4C0KA 1CDLA 3GK4X 4YGEB 2KFFA 2NXQA 1C7VA 3BFAA 5HYDA 3UNWA 4OV2A 1XFZO 2ZNDA 1YURA 2LCPA 2ZN8A 1RECA 3D0YA 1V1FA 5GQQC 1MXEA 1J7PA 4GGNA 1K9UA 2CXJA 2JPOA 1K96A 4GPLB 1CMFA 1BU3A 3O78A 4AOMA 3JVTC 3B86A 3FE6A 1TNPA 3ZWHA 1CFFA 2KHNA 2ZFDA 3DF0A 2CBLA 4MZKA 4P2YB 3PFVA 3RLZA 3TDZA 1CTRA 1RK9A 1IRJA 3KEVA 2KAXA 3SG4A 1CFCA 3DVJA 1IIOA 1SL7A 2LP3A 1BR1B 1ZOTB 2BE4A 4PHKA 1NX1A 1TNQA 3EK8A 3R72A 1NYAA 1MR8A 5FI2A 3O4XA 1B7TY 1J7RA 2OTGC 3L47A 1K93D 3NHIA 4OR9B 1HQVA 2LNKA 2MLFC 5AANA 5TNCA 3UO9A 1RJVA 3CZ2A 2V53A 3LL8B 2K7OA 4CIDA 1DJHA 5HKWA 1B7TZ 2LC5A 2EHBA 1W7JB 2L0PA 1K90D 4INXA 2COLB 1DVIA 1QASA 1DQEA 2K2AA 3OP0A 1B8CA 5KTYA 3TZ1A 1SL8A 4OVNF 3VGOA 3VRQA 3PLFB 1H4BA 2BECA 3IQQA 2D8NA 1DGUA 1PULA 1R2UA 4QJ3B 3O6BA 1DJYA 4F0ZB 1YTZC 1CDNA 2CCMA 1F4QA 1XO5A 2PASA 3CZ1A 3OBVA 3TS5C 3CZTX 1KWOC 1QIVA 4PALA 3EKHA 4HSZA 4MLWA 3SS4A 3K21A 3D78A 3I5IC 3CABA 2H61C 2O5GA 1Y1XA 1F4OA 1Y1AA 1CB1A 3D10A 1CLMA 5FI7A 1YUSA 2NCOA 1J1EA 2I2RE 3B7AA 4JPZB 1EH2A 1KFUS 1NWDA 1XFUO 5DICA 2KI4C 2FOTA 5AFPA 1FI6A 1KCYA 2KBMA 4I5LB 4CLNA 1XYDA 1OOIX 2JPTA 4XJKA 1N0YA 1A03A 1DJGA 2OTGB 5EL2A 1LINA 1MHOA 2MRDA 3NSIA 1EL4A 1EJ3A 1XK4A 1TOPA 1QVIZ 4YGCB 3OX6A 1B8RA 1S36A 2BE6A 1DJXA 3B6XA 3OB2B 3K1EA 3R1PA 4MZLA 4NDCA 1KFXL 2QACA 2BL0C 1K2HA 4I5KA 1DMOA 4IL1A 1SW8A 4GAOA 1IG5A 4OKHA 4ZCVA 1AP4A 4CPVA 5B8IB 3B87A 5AEQA 3LLEA 1JC2A 1A4PA 2PRUA 2LP2A 4YGAA 4PE7A 1HT9A 1FI5A 4KYNA 5JOLA 2QEBA 1SRAA 1KFUL 2MBXA 3I5GC 5CSNA 1PSRA 1M46A 4MN0A 3TDUA 1KK8B 3A8RA 1M39A 2LLSA 3CWGA 1PVAA 1M63B 1UHIA 2M8UA 4FTGA 3SG2A 2B1UA 1CKKA 1DGVA 5JJGA 3OX5A 2LV7A 1FBVA 1C7WA 1QV1A 4NQGA 4N1FA 2LVIA 5CSIA 5CSFA 3EVUA 1ZUZA 2KFHA 1NX0A 3L4AA 2JWWA 1CMGA 3QRXA 1SYMA 4ORAB 2KI6D 4WQ3A 2WCLA 1FF1A 1Y1UA 2JT0A 2KAVA 2R2IA 1N65A 4ICBA 4N5XA 2PYQA 5BPJA 2RGIA 5F6TA 2PALA 1NCZA 1S6CA 3I5HC 1NCYA 3GK2A 1JBAA 1YUUA 2OPOA 1K9PA 3E3RA 4HRGA 2Q91A 3VRPA 1CFDA 1OE9B 1YUTA 2FJUB 2EC6B 2KLEA 4FQOA 2HQ8A 1R6PA 2KOTA 3LK1A 1B4CA 2BL0B 3PJIA 2BKIB 2KI6C 3OB1B 1OMVA 1ZFSA 3OHMB 5I2QA 1UHKA 4TNCA 3N7HA 2F3ZA 1CDPA 1ODBA 1XFVO 2HQWA 3D77A 2F33A 4QJ5B 1OOFA 2L50A 4GFTA 1SNLA 1TCOB 2ERBA 5D69A 2GGZA 1L7ZA 2QPTA 5HLOA 4BY5A 3R1OA 4D1EA 1F8HA 4M2QA 3I5GB 1AUIB 1KQMB 4DRWA 1TRFA 1B1GA 1MWNA 2L5YA 4BY4A 4M2PA 1YX7A 4GGFC 5IBWA 3CYZA 3CR4X 3FE9A 1K8UA 1A29A 2QDIA 1BODA 4MEWA 1AK8A 5DKRA 4GUKA 1G8IA 2HETA 2E6WA 3RM1A 1DF0A 4MRYA 4PE4A 3PSRA 3KO0A 1YRUB 4GNKB 1AJ4A 5I94A 5CSJA 3ZNIA 1BLQA 2H8VA 3JTDB 4ORBB 4YGBB 2BKHB 1KSOA 1Y6WA 2F2OA 3I5FC 4WRIA 4PCWA 5CPVA 2KYCA 4DIRA 1UP5A 2VRGA 3SG7A 1SKTA 1F54A 3BQ3A 4OZDA 3I5HB 2A4JA 1H8BA 3BOWA 1TWOA 1J55A 3KHEA 2JOJA 1JUOA 1S6IA 2O60A 4ETOA 2L51A 3WNXB 2H61A 4QJ4B 2LHLA 1IQ5A 3KPXA 1S5GY 2WCMA 3SS5A 1UHHA 2LMTA 1U5IA 2BBNA 5FYXA 3PALA 3CDNA 1CDMA 4MBEA 1KK8C 1KFXS 4JQ0D 4CFRA 1KSMA 1S6JA 5FI6A 1T14A 2KGRA 1SL9A 1XFYO 2M7NA 1ALVA 2NLNA 5PALA 2M49B 2P70A 5I2OA 1Z4HA 1MXLC 1JWDA 2WC6A 4DUQA 2LANA 1NX2A 1LXFC 2WC8A 3EK4A 2MHHA 1CNPA 1K95A 3CS1A 2K0JA 2LM5A 2MA2A 3OGNA 4M2OA 3SG6A 1AJ5A 1QX5B 1NX3A 1DTLA 2F8PA 3IVTA 4MVFA 1BF5A 3BUXB 1TCFA 4DS7A 4NDDA 3LK0A 3NHTA 1JFJA 2LVKA 5HLVA 5I8NA 1WRKA 1TNXA 1ZACA 3DY9A 4PE1A 3SJSA 2G2BA 1WDCB 1K9KA 1Z2CB 1S3PA 3F45A 2JT3A 2DOQA 1KK7Y 1G4YR 2EC6C 3MSEB 1TNWA 3QMEA 3AKBA 3EKJA 1SY9A 3I5FB 1JSAA 1L2OC 1GGZA 3D75A 2BCAA 2F2PA 2K8MB 1YVLA 3FWBA 1MF8B 2QEHA 3D0YB 3EK7A 3H4SE 1K94A 5ER4X 1LKJA 1SSEB 2PVBA 1XVJA 1SCMB 1LA0A 3NXAA 1YVHA 3DF0B 3VB1A 3KF9A 1OOGA 4PHNA 1FPWA 3D73A 1S26D 3WHTB 2LVVA 1KQMC 1QXPA 1WLZA 1EXRA 3S0FA 2K61A 2GGMA 1NPQA 2I94A 2L98A 4YI9A 2AAOA 4I5NB 3DVEA 4AQIA 1FW4A 1XFXO 4N1GA 1UURA 2ISDA 2CTNA 2HPSA 1OOHA 1PRWA 1QWVA 2AUCA 2I7AA 2ZRTA 2ZKMX 3PN7B 1IJ5A 3PM8A 2K7DA 3BUNB 3BYAA 1TN4A 1TIZA
chains in the Genus database with same CATH topology
1DJIA 4U8DA 3CGAA 2LAPA 1DJZA 3AKAA 1W7IB 1UHNA 1GJYA 2M29A 4XYNA 1QS7A 5DKNA 1KQVA 2JULA 3SIAA 1CFPA 1PALA 3TUYB 2G9BA 3SIBA 1WRZA 2KQ6A 2JTTA 2JRFA 1BJFA 2ZNEA 1QX7A 3CR2A 2OS8B 1L2OB 2K7BA 1C07A 3EVRA 2GV5A 1BR4B 1RFJA 2SASA 2JNXA 1SR6B 3BUOB 4GGFA 3NSLA 2FCEA 3DVKA 1F71A 2K2FA 1LA3A 2KDHA 4GBAA 2LE9B 2P6BB 1A75B 1BOCA 4A4CA 2NZ0A 1NUBA 2AMIA 2Y1MA 1CM4A 1G33A 1PVBA 5I2LA 2PMYA 1QV0A 1MQ1A 1S1EA 1IWQA 2L4HA 4OCIA 2MJWB 1B47A 4USLA 1CLLA 1WDCC 1BT6A 2CT9A 4XJKB 4YGDB 1WLMA 3NSKA 1SCVA 3BUMB 4JWQA 2KNEA 4R1EA 5HKZA 1IQ3A 1MUXA 1RWYA 2JNFA 2JXCA 3SG3A 2EGDA 4NDBA 1JF0A 3BXKA 1DJWA 1OQPA 1N2DA 2WCFA 1SMGA 2I18A 3NSOA 2SCPA 3TDIA 2ZN9A 3DVMA 4HRHA 3VRRA 2MAZA 4UPGA 1QIWA 1XFWO 2LUXA 5AERA 2L2EA 2M97A 3EVVA 1SCMC 3ICBA 4PHMA 5DKQA 5KSZA 4AQJA 4E68A 1X02A 5G08A 2JC2A 1QJTA 4L9MA 1IH0A 1B9AA 2JU0A 3O4YA 5KU1A 4PDZA 1IJ6A 2M0RA 1S5GZ 2KAYA 2M3WA 2KYFA 1PK0D 2BBMA 2LHIA 3FWCA 2FCDA 2WCBA 4YRUA 2ZRSA 1QLKA 2F3YA 4ORCB 3AAJA 3PN7C 2IS9A 3CLNA 1RTP1 4C0JA 2M9GA 3PATA 2Q4UA 1EG3A 1NCXA 4DCKA 4MZJA 5HKYA 5AXIA 1VRKA 3AAKA 4YI8A 2KFGA 1JF2A 1WY9A 3TUYC 2KGBC 1V1GA 3M0WA 3HX4A 1J7OA 1AVSA 1UHJA 3JVTB 2LLUA 2WCEA 1A75A 1BG1A 2L5XB 1EG4A 1M31A 1Q80A 2OS8C 1OMDA 3BUWB 3GK1A 4MSPA 5ER5A 3DD4A 1NSHA 4A4BA 1KK7Z 1IGVA 1SR6C 1NIWA 2LLTA 2MLEC 1QX2A 1E8AA 2M7LA 2M1KB 1QLSA 4YBHB 2LMUA 1QVIY 1SK6D 3IF7A 4PHJA 1M45A 4PE0A 2Y5IA 3O2PA 1DT7B 1UUSA 2JT8A 1OSAA 2WNDA 2LUCA 2H2KA 5D7FA 2KBIA 1CM1A 2M1UA 1A2XA 3FIAA 4CFQA 1BMOA 2HF5A 1IKUA 1B8LA 2NCPA 3CR5X 4C0LA 1D1OA 2TN4A 2LVJA 2WOSA 1DF0B 3IQOA 1XK4C 1XA5A 2JZIA 4P5OE 1GGWA 3CTNA 2JXLA 2JQ6A 2E30A 3LCPC 1UWOA 1J1DA 4HREE 2PSRA 3VRNA 1PSBA 1GQMA 3JTDC 1OMRA 2CNPA 1OZSA 2BCBA 1Y0VH 3TS5B 1TTXA 3A4UB 2Y4QA 1KWOB 3C1VA 1SBJA 1YR5A 4I5JA 1QTXA 3BOWB 2WORA 1OZOA 4ZCUA 3WXAA 3GOFA 1YX8A 1CLBA 3I5IB 3WHUB 1YRTB 2Y1NA 5K89A 5J3XA 2L4IA 3VROA 1U5IB 1NP8A 1SPYA 4Q04A 1F55A 4MRXA 1LVCD 2LMVA 2KI4B 2KQYA 1J7QA 1QATA 1WRLA 2JTZA 1RROA 2KSPA 1ALWA 1OOJA 2K7CA 3HCMA 1JFKA 3FS7A 4WQ2A 3SG5A 1ZMZA 1F70A 1AHRA 2BCXA 4C0KA 1CDLA 3GK4X 4YGEB 2KFFA 2NXQA 1C7VA 5HYDA 4OV2A 1XFZO 2ZNDA 1YURA 2LCPA 2ZN8A 1RECA 3D0YA 1V1FA 5GQQC 1MXEA 1J7PA 4GGNA 1K9UA 2CXJA 1K96A 4GPLB 1CMFA 1BU3A 3O78A 4AOMA 3JVTC 1TNPA 3ZWHA 1CFFA 2KHNA 2ZFDA 3DF0A 2CBLA 4MZKA 4P2YB 3PFVA 3RLZA 3TDZA 1CTRA 1RK9A 1IRJA 3KEVA 2KAXA 3SG4A 1CFCA 3DVJA 1SL7A 2LP3A 1BR1B 1ZOTB 2BE4A 4PHKA 1NX1A 1TNQA 3EK8A 1NYAA 1MR8A 1B7TY 1J7RA 2OTGC 1K93D 4OR9B 1HQVA 2LNKA 2MLFC 5AANA 5TNCA 1RJVA 2V53A 3LL8B 2K7OA 4CIDA 1DJHA 5HKWA 1B7TZ 2LC5A 2EHBA 1W7JB 2L0PA 1K90D 2COLB 1DVIA 1QASA 2K2AA 3OP0A 1B8CA 5KTYA 3TZ1A 1SL8A 4OVNF 3VGOA 3VRQA 3PLFB 1H4BA 2BECA 3IQQA 2D8NA 1DGUA 1PULA 1R2UA 4QJ3B 3O6BA 1DJYA 4F0ZB 1YTZC 1CDNA 2CCMA 1F4QA 1XO5A 2PASA 3TS5C 3CZTX 1KWOC 1QIVA 4PALA 3EKHA 4HSZA 4MLWA 3K21A 3I5IC 2H61C 2O5GA 1Y1XA 1F4OA 1Y1AA 1CB1A 3D10A 1CLMA 1YUSA 2NCOA 1J1EA 2I2RE 4JPZB 1EH2A 1KFUS 1NWDA 1XFUO 1FI6A 2KI4C 2FOTA 5AFPA 1KCYA 2KBMA 4I5LB 4CLNA 1XYDA 4XJKA 2JPTA 1N0YA 1A03A 1DJGA 2OTGB 1LINA 1MHOA 2MRDA 3NSIA 1EL4A 1EJ3A 1XK4A 1TOPA 1QVIZ 4YGCB 3OX6A 1B8RA 1S36A 2BE6A 1DJXA 3OB2B 4MZLA 1K2HA 4NDCA 1KFXL 2QACA 2BL0C 4I5KA 1DMOA 4IL1A 1SW8A 4GAOA 1IG5A 4OKHA 4ZCVA 1AP4A 4CPVA 5B8IB 5AEQA 3LLEA 1JC2A 1A4PA 2PRUA 2LP2A 4YGAA 4PE7A 1HT9A 1FI5A 5JOLA 1SRAA 1KFUL 2MBXA 3I5GC 5CSNA 1PSRA 1M46A 4MN0A 3TDUA 1KK8B 3A8RA 1M39A 2LLSA 3CWGA 1PVAA 1M63B 1UHIA 2M8UA 4FTGA 3SG2A 2B1UA 1CKKA 1DGVA 5JJGA 3OX5A 2LV7A 1FBVA 1C7WA 1QV1A 4NQGA 4N1FA 2LVIA 5CSIA 5CSFA 3EVUA 1ZUZA 2KFHA 1NX0A 2JWWA 1CMGA 3QRXA 1SYMA 4ORAB 2KI6D 4WQ3A 1FF1A 1Y1UA 2JT0A 2KAVA 2R2IA 1N65A 4ICBA 4N5XA 5BPJA 2RGIA 5F6TA 2PALA 1NCZA 1S6CA 3I5HC 1NCYA 3GK2A 1JBAA 1YUUA 2OPOA 1K9PA 3E3RA 4HRGA 2Q91A 3VRPA 1CFDA 1OE9B 1YUTA 2FJUB 2EC6B 4FQOA 2HQ8A 1R6PA 2KOTA 3LK1A 1B4CA 2BL0B 2BKIB 2KI6C 3OB1B 1OMVA 1ZFSA 3OHMB 5I2QA 1UHKA 4TNCA 2F3ZA 1CDPA 1ODBA 1XFVO 2HQWA 4QJ5B 2F33A 2L50A 4GFTA 1SNLA 1TCOB 5D69A 2GGZA 1L7ZA 2QPTA 5HLOA 4BY5A 4D1EA 1F8HA 4M2QA 3I5GB 1AUIB 1KQMB 4DRWA 1TRFA 1B1GA 1MWNA 4BY4A 4M2PA 1YX7A 4GGFC 5IBWA 3CR4X 1K8UA 1A29A 1BODA 4MEWA 1AK8A 5DKRA 4GUKA 1G8IA 2HETA 2E6WA 3RM1A 1DF0A 4MRYA 4PE4A 3PSRA 3KO0A 1YRUB 4GNKB 1AJ4A 5CSJA 3ZNIA 1BLQA 3JTDB 4YGBB 4ORBB 2BKHB 1KSOA 1Y6WA 2F2OA 3I5FC 4WRIA 4PCWA 5CPVA 2KYCA 4DIRA 1UP5A 2VRGA 3SG7A 1SKTA 1F54A 3BQ3A 3I5HB 2A4JA 1H8BA 3BOWA 1J55A 3KHEA 2JOJA 1JUOA 1S6IA 2O60A 4ETOA 2L51A 3WNXB 2H61A 4QJ4B 2LHLA 1IQ5A 3KPXA 1S5GY 1UHHA 2LMTA 1U5IA 2BBNA 5FYXA 3PALA 1CDMA 4MBEA 1KK8C 1KFXS 4JQ0D 4CFRA 1KSMA 1S6JA 2KGRA 1SL9A 1XFYO 2M7NA 1ALVA 2NLNA 5PALA 2M49B 5I2OA 1MXLC 1JWDA 4DUQA 2LANA 1NX2A 1LXFC 2WC8A 3EK4A 2MHHA 1CNPA 1K95A 3CS1A 2K0JA 2LM5A 2MA2A 4M2OA 3SG6A 1AJ5A 1QX5B 1NX3A 1DTLA 2F8PA 4MVFA 1BF5A 3BUXB 1TCFA 4DS7A 4NDDA 3LK0A 1JFJA 2LVKA 5HLVA 5I8NA 1WRKA 1TNXA 1ZACA 4PE1A 3SJSA 2G2BA 1WDCB 1K9KA 1S3PA 3F45A 2JT3A 2DOQA 1KK7Y 1G4YR 2EC6C 3MSEB 1TNWA 3AKBA 3EKJA 1SY9A 3I5FB 1JSAA 1L2OC 1GGZA 2BCAA 2F2PA 2K8MB 1YVLA 3FWBA 1MF8B 3D0YB 3H4SE 3EK7A 1K94A 5ER4X 1LKJA 2PVBA 1XVJA 1SCMB 1LA0A 3NXAA 1YVHA 3DF0B 3KF9A 4PHNA 1FPWA 1S26D 3WHTB 2LVVA 1KQMC 1QXPA 1WLZA 1EXRA 2K61A 2GGMA 1NPQA 2I94A 2L98A 4YI9A 2AAOA 4I5NB 3DVEA 4AQIA 1FW4A 1XFXO 4N1GA 1UURA 2ISDA 2CTNA 2HPSA 2AUCA 1PRWA 2ZRTA 2ZKMX 2I7AA 3PN7B 1IJ5A 3PM8A 2K7DA 3BUNB 3BYAA 1TN4A 1TIZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DJI A;  4U8D A;  3CGA A;  2LAP A;  1DJZ A;  3AKA A;  1W7I B;  1UHN A;  1GJY A;  2M29 A;  4XYN A;  1QS7 A;  5DKN A;  1KQV A;  2JUL A;  3SIA A;  1CFP A;  1PAL A;  3TUY B;  2G9B A;  3SIB A;  1WRZ A;  2KQ6 A;  2JTT A;  2JRF A;  1BJF A;  2ZNE A;  1QX7 A;  3CR2 A;  2OS8 B;  1L2O B;  2K7B A;  1C07 A;  3EVR A;  2GV5 A;  1BR4 B;  1RFJ A;  2SAS A;  2JNX A;  1SR6 B;  3BUO B;  4GGF A;  3NSL A;  2FCE A;  3DVK A;  1F71 A;  2K2F A;  1LA3 A;  2KDH A;  4GBA A;  2LE9 B;  2P6B B;  1A75 B;  1BOC A;  4A4C A;  2NZ0 A;  1NUB A;  2AMI A;  2Y1M A;  1CM4 A;  1G33 A;  1PVB A;  5I2L A;  2PMY A;  1QV0 A;  1MQ1 A;  1S1E A;  1IWQ A;  2L4H A;  4OCI A;  2MJW B;  1B47 A;  4USL A;  1CLL A;  1WDC C;  1BT6 A;  2CT9 A;  4XJK B;  4YGD B;  1WLM A;  3NSK A;  1SCV A;  3BUM B;  4JWQ A;  2KNE A;  4R1E A;  5HKZ A;  1IQ3 A;  1MUX A;  1RWY A;  2JNF A;  2JXC A;  3SG3 A;  2EGD A;  4NDB A;  1JF0 A;  3BXK A;  1DJW A;  1OQP A;  1N2D A;  2WCF A;  1SMG A;  2I18 A;  3NSO A;  2SCP A;  3TDI A;  2ZN9 A;  3DVM A;  4HRH A;  3VRR A;  2MAZ A;  4UPG A;  1QIW A;  1XFW O;  2LUX A;  5AER A;  2L2E A;  2M97 A;  3EVV A;  1SCM C;  3ICB A;  4PHM A;  5DKQ A;  5KSZ A;  4AQJ A;  4E68 A;  1X02 A;  5G08 A;  2JC2 A;  1QJT A;  4L9M A;  1IH0 A;  1B9A A;  2JU0 A;  3O4Y A;  5KU1 A;  4PDZ A;  1IJ6 A;  2M0R A;  1S5G Z;  2KAY A;  2M3W A;  2KYF A;  1PK0 D;  2BBM A;  2LHI A;  3FWC A;  2FCD A;  2WCB A;  4YRU A;  2ZRS A;  1QLK A;  2F3Y A;  4ORC B;  3AAJ A;  3PN7 C;  2IS9 A;  3CLN A;  1RTP 1;  4C0J A;  2M9G A;  3PAT A;  2Q4U A;  1EG3 A;  1NCX A;  4DCK A;  4MZJ A;  5HKY A;  5AXI A;  1VRK A;  3AAK A;  4YI8 A;  2KFG A;  1JF2 A;  1WY9 A;  3TUY C;  2KGB C;  1V1G A;  3M0W A;  3HX4 A;  1J7O A;  1AVS A;  1UHJ A;  3JVT B;  2LLU A;  2WCE A;  1A75 A;  1BG1 A;  2L5X B;  1EG4 A;  1M31 A;  1Q80 A;  2OS8 C;  1OMD A;  3BUW B;  3GK1 A;  4MSP A;  5ER5 A;  3DD4 A;  1NSH A;  4A4B A;  1KK7 Z;  1IGV A;  1SR6 C;  1NIW A;  2LLT A;  2MLE C;  1QX2 A;  1E8A A;  2M7L A;  2M1K B;  1QLS A;  4YBH B;  2LMU A;  1QVI Y;  1SK6 D;  3IF7 A;  4PHJ A;  1M45 A;  4PE0 A;  2Y5I A;  3O2P A;  1DT7 B;  1UUS A;  2JT8 A;  1OSA A;  2WND A;  2LUC A;  2H2K A;  5D7F A;  2KBI A;  1CM1 A;  2M1U A;  1A2X A;  3FIA A;  4CFQ A;  1BMO A;  2HF5 A;  1IKU A;  1B8L A;  2NCP A;  3CR5 X;  4C0L A;  1D1O A;  2TN4 A;  2LVJ A;  2WOS A;  1DF0 B;  3IQO A;  1XK4 C;  1XA5 A;  2JZI A;  4P5O E;  1GGW A;  3CTN A;  2JXL A;  2JQ6 A;  2E30 A;  3LCP C;  1UWO A;  1J1D A;  4HRE E;  2PSR A;  3VRN A;  1PSB A;  1GQM A;  3JTD C;  1OMR A;  2CNP A;  1OZS A;  2BCB A;  1Y0V H;  3TS5 B;  1TTX A;  3A4U B;  2Y4Q A;  1KWO B;  3C1V A;  1SBJ A;  1YR5 A;  4I5J A;  1QTX A;  3BOW B;  2WOR A;  1OZO A;  4ZCU A;  3WXA A;  3GOF A;  1YX8 A;  1CLB A;  3I5I B;  3WHU B;  1YRT B;  2Y1N A;  5K89 A;  5J3X A;  2L4I A;  3VRO A;  1U5I B;  1NP8 A;  1SPY A;  4Q04 A;  1F55 A;  4MRX A;  1LVC D;  2LMV A;  2KI4 B;  2KQY A;  1J7Q A;  1QAT A;  1WRL A;  2JTZ A;  1RRO A;  2KSP A;  1ALW A;  1OOJ A;  2K7C A;  3HCM A;  1JFK A;  3FS7 A;  4WQ2 A;  3SG5 A;  1ZMZ A;  1F70 A;  1AHR A;  2BCX A;  4C0K A;  1CDL A;  3GK4 X;  4YGE B;  2KFF A;  2NXQ A;  1C7V A;  5HYD A;  4OV2 A;  1XFZ O;  2ZND A;  1YUR A;  2LCP A;  2ZN8 A;  1REC A;  3D0Y A;  1V1F A;  5GQQ C;  1MXE A;  1J7P A;  4GGN A;  1K9U A;  2CXJ A;  1K96 A;  4GPL B;  1CMF A;  1BU3 A;  3O78 A;  4AOM A;  3JVT C;  1TNP A;  3ZWH A;  1CFF A;  2KHN A;  2ZFD A;  3DF0 A;  2CBL A;  4MZK A;  4P2Y B;  3PFV A;  3RLZ A;  3TDZ A;  1CTR A;  1RK9 A;  1IRJ A;  3KEV A;  2KAX A;  3SG4 A;  1CFC A;  3DVJ A;  1SL7 A;  2LP3 A;  1BR1 B;  1ZOT B;  2BE4 A;  4PHK A;  1NX1 A;  1TNQ A;  3EK8 A;  1NYA A;  1MR8 A;  1B7T Y;  1J7R A;  2OTG C;  1K93 D;  4OR9 B;  1HQV A;  2LNK A;  2MLF C;  5AAN A;  5TNC A;  1RJV A;  2V53 A;  3LL8 B;  2K7O A;  4CID A;  1DJH A;  5HKW A;  1B7T Z;  2LC5 A;  2EHB A;  1W7J B;  2L0P A;  1K90 D;  2COL B;  1DVI A;  1QAS A;  2K2A A;  3OP0 A;  1B8C A;  5KTY A;  3TZ1 A;  1SL8 A;  4OVN F;  3VGO A;  3VRQ A;  3PLF B;  1H4B A;  2BEC A;  3IQQ A;  2D8N A;  1DGU A;  1PUL A;  1R2U A;  4QJ3 B;  3O6B A;  1DJY A;  4F0Z B;  1YTZ C;  1CDN A;  2CCM A;  1F4Q A;  1XO5 A;  2PAS A;  3TS5 C;  3CZT X;  1KWO C;  1QIV A;  4PAL A;  3EKH A;  4HSZ A;  4MLW A;  3K21 A;  3I5I C;  2H61 C;  2O5G A;  1Y1X A;  1F4O A;  1Y1A A;  1CB1 A;  3D10 A;  1CLM A;  1YUS A;  2NCO A;  1J1E A;  2I2R E;  4JPZ B;  1EH2 A;  1KFU S;  1NWD A;  1XFU O;  1FI6 A;  2KI4 C;  2FOT A;  5AFP A;  1KCY A;  2KBM A;  4I5L B;  4CLN A;  1XYD A;  4XJK A;  2JPT A;  1N0Y A;  1A03 A;  1DJG A;  2OTG B;  1LIN A;  1MHO A;  2MRD A;  3NSI A;  1EL4 A;  1EJ3 A;  1XK4 A;  1TOP A;  1QVI Z;  4YGC B;  3OX6 A;  1B8R A;  1S36 A;  2BE6 A;  1DJX A;  3OB2 B;  4MZL A;  1K2H A;  4NDC A;  1KFX L;  2QAC A;  2BL0 C;  4I5K A;  1DMO A;  4IL1 A;  1SW8 A;  4GAO A;  1IG5 A;  4OKH A;  4ZCV A;  1AP4 A;  4CPV A;  5B8I B;  5AEQ A;  3LLE A;  1JC2 A;  1A4P A;  2PRU A;  2LP2 A;  4YGA A;  4PE7 A;  1HT9 A;  1FI5 A;  5JOL A;  1SRA A;  1KFU L;  2MBX A;  3I5G C;  5CSN A;  1PSR A;  1M46 A;  4MN0 A;  3TDU A;  1KK8 B;  3A8R A;  1M39 A;  2LLS A;  3CWG A;  1PVA A;  1M63 B;  1UHI A;  2M8U A;  4FTG A;  3SG2 A;  2B1U A;  1CKK A;  1DGV A;  5JJG A;  3OX5 A;  2LV7 A;  1FBV A;  1C7W A;  1QV1 A;  4NQG A;  4N1F A;  2LVI A;  5CSI A;  5CSF A;  3EVU A;  1ZUZ A;  2KFH A;  1NX0 A;  2JWW A;  1CMG A;  3QRX A;  1SYM A;  4ORA B;  2KI6 D;  4WQ3 A;  1FF1 A;  1Y1U A;  2JT0 A;  2KAV A;  2R2I A;  1N65 A;  4ICB A;  4N5X A;  5BPJ A;  2RGI A;  5F6T A;  2PAL A;  1NCZ A;  1S6C A;  3I5H C;  1NCY A;  3GK2 A;  1JBA A;  1YUU A;  2OPO A;  1K9P A;  3E3R A;  4HRG A;  2Q91 A;  3VRP A;  1CFD A;  1OE9 B;  1YUT A;  2FJU B;  2EC6 B;  4FQO A;  2HQ8 A;  1R6P A;  2KOT A;  3LK1 A;  1B4C A;  2BL0 B;  2BKI B;  2KI6 C;  3OB1 B;  1OMV A;  1ZFS A;  3OHM B;  5I2Q A;  1UHK A;  4TNC A;  2F3Z A;  1CDP A;  1ODB A;  1XFV O;  2HQW A;  4QJ5 B;  2F33 A;  2L50 A;  4GFT A;  1SNL A;  1TCO B;  5D69 A;  2GGZ A;  1L7Z A;  2QPT A;  5HLO A;  4BY5 A;  4D1E A;  1F8H A;  4M2Q A;  3I5G B;  1AUI B;  1KQM B;  4DRW A;  1TRF A;  1B1G A;  1MWN A;  4BY4 A;  4M2P A;  1YX7 A;  4GGF C;  5IBW A;  3CR4 X;  1K8U A;  1A29 A;  1BOD A;  4MEW A;  1AK8 A;  5DKR A;  4GUK A;  1G8I A;  2HET A;  2E6W A;  3RM1 A;  1DF0 A;  4MRY A;  4PE4 A;  3PSR A;  3KO0 A;  1YRU B;  4GNK B;  1AJ4 A;  5CSJ A;  3ZNI A;  1BLQ A;  3JTD B;  4YGB B;  4ORB B;  2BKH B;  1KSO A;  1Y6W A;  2F2O A;  3I5F C;  4WRI A;  4PCW A;  5CPV A;  2KYC A;  4DIR A;  1UP5 A;  2VRG A;  3SG7 A;  1SKT A;  1F54 A;  3BQ3 A;  3I5H B;  2A4J A;  1H8B A;  3BOW A;  1J55 A;  3KHE A;  2JOJ A;  1JUO A;  1S6I A;  2O60 A;  4ETO A;  2L51 A;  3WNX B;  2H61 A;  4QJ4 B;  2LHL A;  1IQ5 A;  3KPX A;  1S5G Y;  1UHH A;  2LMT A;  1U5I A;  2BBN A;  5FYX A;  3PAL A;  1CDM A;  4MBE A;  1KK8 C;  1KFX S;  4JQ0 D;  4CFR A;  1KSM A;  1S6J A;  2KGR A;  1SL9 A;  1XFY O;  2M7N A;  1ALV A;  2NLN A;  5PAL A;  2M49 B;  5I2O A;  1MXL C;  1JWD A;  4DUQ A;  2LAN A;  1NX2 A;  1LXF C;  2WC8 A;  3EK4 A;  2MHH A;  1CNP A;  1K95 A;  3CS1 A;  2K0J A;  2LM5 A;  2MA2 A;  4M2O A;  3SG6 A;  1AJ5 A;  1QX5 B;  1NX3 A;  1DTL A;  2F8P A;  4MVF A;  1BF5 A;  3BUX B;  1TCF A;  4DS7 A;  4NDD A;  3LK0 A;  1JFJ A;  2LVK A;  5HLV A;  5I8N A;  1WRK A;  1TNX A;  1ZAC A;  4PE1 A;  3SJS A;  2G2B A;  1WDC B;  1K9K A;  1S3P A;  3F45 A;  2JT3 A;  2DOQ A;  1KK7 Y;  1G4Y R;  2EC6 C;  3MSE B;  1TNW A;  3AKB A;  3EKJ A;  1SY9 A;  3I5F B;  1JSA A;  1L2O C;  1GGZ A;  2BCA A;  2F2P A;  2K8M B;  1YVL A;  3FWB A;  1MF8 B;  3D0Y B;  3H4S E;  3EK7 A;  1K94 A;  5ER4 X;  1LKJ A;  2PVB A;  1XVJ A;  1SCM B;  1LA0 A;  3NXA A;  1YVH A;  3DF0 B;  3KF9 A;  4PHN A;  1FPW A;  1S26 D;  3WHT B;  2LVV A;  1KQM C;  1QXP A;  1WLZ A;  1EXR A;  2K61 A;  2GGM A;  1NPQ A;  2I94 A;  2L98 A;  4YI9 A;  2AAO A;  4I5N B;  3DVE A;  4AQI A;  1FW4 A;  1XFX O;  4N1G A;  1UUR A;  2ISD A;  2CTN A;  2HPS A;  2AUC A;  1PRW A;  2ZRT A;  2ZKM X;  2I7A A;  3PN7 B;  1IJ5 A;  3PM8 A;  2K7D A;  3BUN B;  3BYA A;  1TN4 A;  1TIZ A; 
#chains in the Genus database with same CATH topology
 1DJI A;  4U8D A;  2FJY A;  3CGA A;  2LAP A;  1DJZ A;  3AKA A;  1W7I B;  1UHN A;  1GJY A;  2M29 A;  4XYN A;  1QS7 A;  5DKN A;  1KQV A;  2JUL A;  3SIA A;  1CFP A;  1PAL A;  3TUY B;  2G9B A;  3S0B A;  1DEL A;  3SIB A;  1XFR A;  1WRZ A;  2KQ6 A;  2JTT A;  2JRF A;  1BJF A;  2ZNE A;  1QX7 A;  3CR2 A;  2OS8 B;  2QEV A;  5D3O A;  1L2O B;  3S0E A;  2K7B A;  1C07 A;  3EVR A;  2GV5 A;  1BR4 B;  1RFJ A;  2SAS A;  2GTE A;  1SR6 B;  2JNX A;  3BUO B;  4GGF A;  1C3Y A;  3NSL A;  2FCE A;  3DVK A;  1F71 A;  2K2F A;  3L4L A;  1LA3 A;  2WCJ A;  2KDH A;  3BFH A;  4GBA A;  2LE9 B;  2P6B B;  1A75 B;  1ORG A;  4FQT A;  1BOC A;  4A4C A;  2NZ0 A;  3EG5 B;  1NUB A;  2AMI A;  3B88 A;  2Y1M A;  1CM4 A;  1G33 A;  1PVB A;  5I2L A;  2PMY A;  3V2L A;  1QV0 A;  1MQ1 A;  1S1E A;  1IWQ A;  2L4H A;  4OCI A;  2MJW B;  1B47 A;  4USL A;  1CLL A;  1WDC C;  1BT6 A;  2CT9 A;  3BJH A;  4XJK B;  4YGD B;  1WLM A;  3NSK A;  1SCV A;  3BUM B;  4JWQ A;  2KNE A;  4R1E A;  5HKZ A;  1IQ3 A;  1MUX A;  1RWY A;  2JNF A;  2JXC A;  3DXL A;  3SG3 A;  2EGD A;  4NDB A;  1JF0 A;  3BXK A;  1DJW A;  1OQP A;  1N2D A;  2WCF A;  3FE8 A;  1SMG A;  2I18 A;  3CZ0 A;  2SCP A;  3NSO A;  3TDI A;  2ZN9 A;  3DVM A;  4HRH A;  3VRR A;  2MAZ A;  4UPG A;  1QIW A;  3S0A A;  1XFW O;  2LUX A;  5AER A;  2L2E A;  2M97 A;  3D76 A;  3EVV A;  1SCM C;  3ICB A;  4PHM A;  5DKQ A;  5KSZ A;  4AQJ A;  4E68 A;  1X02 A;  5G08 A;  2JC2 A;  1QJT A;  4L9M A;  1IH0 A;  1B9A A;  2JU0 A;  3O4Y A;  5KU1 A;  4PDZ A;  1IJ6 A;  2M0R A;  1S5G Z;  2KAY A;  2M3W A;  2KYF A;  1PK0 D;  2BBM A;  2LHI A;  3PM2 A;  4IJ7 A;  3FWC A;  2FCD A;  2WCB A;  4YRU A;  2ZRS A;  1QLK A;  2F3Y A;  4ORC B;  3AAJ A;  5HL1 A;  3PN7 C;  2IS9 A;  2YGU A;  3CLN A;  1RTP 1;  4C0J A;  2M9G A;  3PAT A;  2Q4U A;  1EG3 A;  1NCX A;  4DCK A;  4MZJ A;  5HKY A;  5AXI A;  1VRK A;  3AAK A;  1DEK A;  4YI8 A;  2KFG A;  1JF2 A;  1WY9 A;  2BAP A;  3TUY C;  2KGB C;  1V1G A;  3M0W A;  1TUZ A;  3HX4 A;  1J7O A;  1AVS A;  1UHJ A;  3JVT B;  2LLU A;  2WCE A;  2WCH A;  1A75 A;  3DZT A;  1BG1 A;  2L5X B;  1EG4 A;  1M31 A;  1Q80 A;  2OS8 C;  1OMD A;  3BUW B;  3GK1 A;  4MSP A;  5ER5 A;  2WC5 A;  1GM0 A;  3DD4 A;  3BFB A;  3D74 A;  1NSH A;  1TUJ A;  4A4B A;  1KK7 Z;  1IGV A;  1SR6 C;  1NIW A;  1P28 A;  2BNX A;  1QX2 A;  1E8A A;  2LLT A;  2MLE C;  2M7L A;  1C3Z A;  2M1K B;  1QLS A;  4YBH B;  2LMU A;  4JD9 A;  1QVI Y;  1LS8 A;  1SK6 D;  3DYE A;  3IF7 A;  4PHJ A;  1M45 A;  4PE0 A;  3R1V A;  2Y5I A;  3O2P A;  1DT7 B;  1UUS A;  2KLD A;  2JT8 A;  1OSA A;  2WND A;  4F7F A;  2LUC A;  2H2K A;  5D7F A;  2KBI A;  3Q8I A;  1CM1 A;  2M1U A;  1A2X A;  3FIA A;  2L2C A;  4CFQ A;  1BMO A;  1W9Z A;  2HF5 A;  1IKU A;  1B8L A;  2NCP A;  3CR5 X;  4INW A;  4C0L A;  1D1O A;  2TN4 A;  2LVJ A;  2WOS A;  1DF0 B;  3IQO A;  2K60 A;  1XK4 C;  1XA5 A;  2JZI A;  4P5O E;  4PT1 A;  1GGW A;  3CTN A;  2JXL A;  2JQ6 A;  2E30 A;  3NGV A;  3LCP C;  1UWO A;  1J1D A;  4HRE E;  2PSR A;  3VRN A;  1PSB A;  1GQM A;  3JTD C;  1OMR A;  2CNP A;  2QEO A;  1OW4 A;  1OZS A;  2BCB A;  2WCK A;  1Y0V H;  4JKT A;  3SS3 A;  3TS5 B;  1TTX A;  3A4U B;  2Y4Q A;  1KWO B;  3C1V A;  1SBJ A;  1YR5 A;  4I5J A;  1QTX A;  3BOW B;  2WOR A;  1OZO A;  4ZCU A;  3WXA A;  3GOF A;  1YX8 A;  1CLB A;  3I5I B;  3WHU B;  2PQL A;  3S0D A;  1YRT B;  2Y1N A;  5K89 A;  5J3X A;  2L4I A;  3VRO A;  1U5I B;  1NP8 A;  1SPY A;  4Q04 A;  3RZS A;  1F55 A;  2KPH A;  4MRX A;  1LVC D;  2LMV A;  2KI4 B;  2KQY A;  2P71 A;  3S0G A;  1J7Q A;  1QAT A;  1WRL A;  2JTZ A;  1RRO A;  1DC1 A;  2KSP A;  1ALW A;  1OOJ A;  2K7C A;  3HCM A;  1JFK A;  3FS7 A;  4WQ2 A;  3SG5 A;  1ZMZ A;  1F70 A;  1AHR A;  2BCX A;  4C0K A;  1CDL A;  3GK4 X;  4YGE B;  2KFF A;  2NXQ A;  1C7V A;  3BFA A;  5HYD A;  3UNW A;  4OV2 A;  1XFZ O;  2ZND A;  1YUR A;  2LCP A;  2ZN8 A;  1REC A;  3D0Y A;  1V1F A;  5GQQ C;  1MXE A;  1J7P A;  4GGN A;  1K9U A;  2CXJ A;  2JPO A;  1K96 A;  4GPL B;  1CMF A;  1BU3 A;  3O78 A;  4AOM A;  3JVT C;  3B86 A;  3FE6 A;  1TNP A;  3ZWH A;  1CFF A;  2KHN A;  2ZFD A;  3DF0 A;  2CBL A;  4MZK A;  4P2Y B;  3PFV A;  3RLZ A;  3TDZ A;  1CTR A;  1RK9 A;  1IRJ A;  3KEV A;  2KAX A;  3SG4 A;  1CFC A;  3DVJ A;  1IIO A;  1SL7 A;  2LP3 A;  1BR1 B;  1ZOT B;  2BE4 A;  4PHK A;  1NX1 A;  1TNQ A;  3EK8 A;  3R72 A;  1NYA A;  1MR8 A;  5FI2 A;  3O4X A;  1B7T Y;  1J7R A;  2OTG C;  3L47 A;  1K93 D;  3NHI A;  4OR9 B;  1HQV A;  2LNK A;  2MLF C;  5AAN A;  5TNC A;  3UO9 A;  1RJV A;  3CZ2 A;  2V53 A;  3LL8 B;  2K7O A;  4CID A;  1DJH A;  5HKW A;  1B7T Z;  2LC5 A;  2EHB A;  1W7J B;  2L0P A;  1K90 D;  4INX A;  2COL B;  1DVI A;  1QAS A;  1DQE A;  2K2A A;  3OP0 A;  1B8C A;  5KTY A;  3TZ1 A;  1SL8 A;  4OVN F;  3VGO A;  3VRQ A;  3PLF B;  1H4B A;  2BEC A;  3IQQ A;  2D8N A;  1DGU A;  1PUL A;  1R2U A;  4QJ3 B;  3O6B A;  1DJY A;  4F0Z B;  1YTZ C;  1CDN A;  2CCM A;  1F4Q A;  1XO5 A;  2PAS A;  3CZ1 A;  3OBV A;  3TS5 C;  3CZT X;  1KWO C;  1QIV A;  4PAL A;  3EKH A;  4HSZ A;  4MLW A;  3SS4 A;  3K21 A;  3D78 A;  3I5I C;  3CAB A;  2H61 C;  2O5G A;  1Y1X A;  1F4O A;  1Y1A A;  1CB1 A;  3D10 A;  1CLM A;  5FI7 A;  1YUS A;  2NCO A;  1J1E A;  2I2R E;  3B7A A;  4JPZ B;  1EH2 A;  1KFU S;  1NWD A;  1XFU O;  5DIC A;  2KI4 C;  2FOT A;  5AFP A;  1FI6 A;  1KCY A;  2KBM A;  4I5L B;  4CLN A;  1XYD A;  1OOI X;  2JPT A;  4XJK A;  1N0Y A;  1A03 A;  1DJG A;  2OTG B;  5EL2 A;  1LIN A;  1MHO A;  2MRD A;  3NSI A;  1EL4 A;  1EJ3 A;  1XK4 A;  1TOP A;  1QVI Z;  4YGC B;  3OX6 A;  1B8R A;  1S36 A;  2BE6 A;  1DJX A;  3B6X A;  3OB2 B;  3K1E A;  3R1P A;  4MZL A;  4NDC A;  1KFX L;  2QAC A;  2BL0 C;  1K2H A;  4I5K A;  1DMO A;  4IL1 A;  1SW8 A;  4GAO A;  1IG5 A;  4OKH A;  4ZCV A;  1AP4 A;  4CPV A;  5B8I B;  3B87 A;  5AEQ A;  3LLE A;  1JC2 A;  1A4P A;  2PRU A;  2LP2 A;  4YGA A;  4PE7 A;  1HT9 A;  1FI5 A;  4KYN A;  5JOL A;  2QEB A;  1SRA A;  1KFU L;  2MBX A;  3I5G C;  5CSN A;  1PSR A;  1M46 A;  4MN0 A;  3TDU A;  1KK8 B;  3A8R A;  1M39 A;  2LLS A;  3CWG A;  1PVA A;  1M63 B;  1UHI A;  2M8U A;  4FTG A;  3SG2 A;  2B1U A;  1CKK A;  1DGV A;  5JJG A;  3OX5 A;  2LV7 A;  1FBV A;  1C7W A;  1QV1 A;  4NQG A;  4N1F A;  2LVI A;  5CSI A;  5CSF A;  3EVU A;  1ZUZ A;  2KFH A;  1NX0 A;  3L4A A;  2JWW A;  1CMG A;  3QRX A;  1SYM A;  4ORA B;  2KI6 D;  4WQ3 A;  2WCL A;  1FF1 A;  1Y1U A;  2JT0 A;  2KAV A;  2R2I A;  1N65 A;  4ICB A;  4N5X A;  2PYQ A;  5BPJ A;  2RGI A;  5F6T A;  2PAL A;  1NCZ A;  1S6C A;  3I5H C;  1NCY A;  3GK2 A;  1JBA A;  1YUU A;  2OPO A;  1K9P A;  3E3R A;  4HRG A;  2Q91 A;  3VRP A;  1CFD A;  1OE9 B;  1YUT A;  2FJU B;  2EC6 B;  2KLE A;  4FQO A;  2HQ8 A;  1R6P A;  2KOT A;  3LK1 A;  1B4C A;  2BL0 B;  3PJI A;  2BKI B;  2KI6 C;  3OB1 B;  1OMV A;  1ZFS A;  3OHM B;  5I2Q A;  1UHK A;  4TNC A;  3N7H A;  2F3Z A;  1CDP A;  1ODB A;  1XFV O;  2HQW A;  3D77 A;  2F33 A;  4QJ5 B;  1OOF A;  2L50 A;  4GFT A;  1SNL A;  1TCO B;  2ERB A;  5D69 A;  2GGZ A;  1L7Z A;  2QPT A;  5HLO A;  4BY5 A;  3R1O A;  4D1E A;  1F8H A;  4M2Q A;  3I5G B;  1AUI B;  1KQM B;  4DRW A;  1TRF A;  1B1G A;  1MWN A;  2L5Y A;  4BY4 A;  4M2P A;  1YX7 A;  4GGF C;  5IBW A;  3CYZ A;  3CR4 X;  3FE9 A;  1K8U A;  1A29 A;  2QDI A;  1BOD A;  4MEW A;  1AK8 A;  5DKR A;  4GUK A;  1G8I A;  2HET A;  2E6W A;  3RM1 A;  1DF0 A;  4MRY A;  4PE4 A;  3PSR A;  3KO0 A;  1YRU B;  4GNK B;  1AJ4 A;  5I94 A;  5CSJ A;  3ZNI A;  1BLQ A;  2H8V A;  3JTD B;  4ORB B;  4YGB B;  2BKH B;  1KSO A;  1Y6W A;  2F2O A;  3I5F C;  4WRI A;  4PCW A;  5CPV A;  2KYC A;  4DIR A;  1UP5 A;  2VRG A;  3SG7 A;  1SKT A;  1F54 A;  3BQ3 A;  4OZD A;  3I5H B;  2A4J A;  1H8B A;  3BOW A;  1TWO A;  1J55 A;  3KHE A;  2JOJ A;  1JUO A;  1S6I A;  2O60 A;  4ETO A;  2L51 A;  3WNX B;  2H61 A;  4QJ4 B;  2LHL A;  1IQ5 A;  3KPX A;  1S5G Y;  2WCM A;  3SS5 A;  1UHH A;  2LMT A;  1U5I A;  2BBN A;  5FYX A;  3PAL A;  3CDN A;  1CDM A;  4MBE A;  1KK8 C;  1KFX S;  4JQ0 D;  4CFR A;  1KSM A;  1S6J A;  5FI6 A;  1T14 A;  2KGR A;  1SL9 A;  1XFY O;  2M7N A;  1ALV A;  2NLN A;  5PAL A;  2M49 B;  2P70 A;  5I2O A;  1Z4H A;  1MXL C;  1JWD A;  2WC6 A;  4DUQ A;  2LAN A;  1NX2 A;  1LXF C;  2WC8 A;  3EK4 A;  2MHH A;  1CNP A;  1K95 A;  3CS1 A;  2K0J A;  2LM5 A;  2MA2 A;  3OGN A;  4M2O A;  3SG6 A;  1AJ5 A;  1QX5 B;  1NX3 A;  1DTL A;  2F8P A;  3IVT A;  4MVF A;  1BF5 A;  3BUX B;  1TCF A;  4DS7 A;  4NDD A;  3LK0 A;  3NHT A;  1JFJ A;  2LVK A;  5HLV A;  5I8N A;  1WRK A;  1TNX A;  1ZAC A;  3DY9 A;  4PE1 A;  3SJS A;  2G2B A;  1WDC B;  1K9K A;  1Z2C B;  1S3P A;  3F45 A;  2JT3 A;  2DOQ A;  1KK7 Y;  1G4Y R;  2EC6 C;  3MSE B;  1TNW A;  3QME A;  3AKB A;  3EKJ A;  1SY9 A;  3I5F B;  1JSA A;  1L2O C;  1GGZ A;  3D75 A;  2BCA A;  2F2P A;  2K8M B;  1YVL A;  3FWB A;  1MF8 B;  2QEH A;  3D0Y B;  3EK7 A;  3H4S E;  1K94 A;  5ER4 X;  1LKJ A;  1SSE B;  2PVB A;  1XVJ A;  1SCM B;  1LA0 A;  3NXA A;  1YVH A;  3DF0 B;  3VB1 A;  3KF9 A;  1OOG A;  4PHN A;  1FPW A;  3D73 A;  1S26 D;  3WHT B;  2LVV A;  1KQM C;  1QXP A;  1WLZ A;  1EXR A;  3S0F A;  2K61 A;  2GGM A;  1NPQ A;  2I94 A;  2L98 A;  4YI9 A;  2AAO A;  4I5N B;  3DVE A;  4AQI A;  1FW4 A;  1XFX O;  4N1G A;  1UUR A;  2ISD A;  2CTN A;  2HPS A;  1OOH A;  1PRW A;  1QWV A;  2AUC A;  2I7A A;  2ZRT A;  2ZKM X;  3PN7 B;  1IJ5 A;  3PM8 A;  2K7D A;  3BUN B;  3BYA A;  1TN4 A;  1TIZ A; 
#chains in the Genus database with same CATH homology
 1DJI A;  4U8D A;  3CGA A;  2LAP A;  1DJZ A;  3AKA A;  1W7I B;  1UHN A;  1GJY A;  2M29 A;  4XYN A;  1QS7 A;  5DKN A;  1KQV A;  2JUL A;  3SIA A;  1CFP A;  1PAL A;  3TUY B;  2G9B A;  3SIB A;  1WRZ A;  2KQ6 A;  2JTT A;  2JRF A;  1BJF A;  2ZNE A;  1QX7 A;  3CR2 A;  2OS8 B;  1L2O B;  2K7B A;  1C07 A;  3EVR A;  2GV5 A;  1BR4 B;  1RFJ A;  2SAS A;  2JNX A;  1SR6 B;  3BUO B;  4GGF A;  3NSL A;  2FCE A;  3DVK A;  1F71 A;  2K2F A;  1LA3 A;  2KDH A;  4GBA A;  2LE9 B;  2P6B B;  1A75 B;  1BOC A;  4A4C A;  2NZ0 A;  1NUB A;  2AMI A;  2Y1M A;  1CM4 A;  1G33 A;  1PVB A;  5I2L A;  2PMY A;  1QV0 A;  1MQ1 A;  1S1E A;  1IWQ A;  2L4H A;  4OCI A;  2MJW B;  1B47 A;  4USL A;  1CLL A;  1WDC C;  1BT6 A;  2CT9 A;  4XJK B;  4YGD B;  1WLM A;  3NSK A;  1SCV A;  3BUM B;  4JWQ A;  2KNE A;  4R1E A;  5HKZ A;  1IQ3 A;  1MUX A;  1RWY A;  2JNF A;  2JXC A;  3SG3 A;  2EGD A;  4NDB A;  1JF0 A;  3BXK A;  1DJW A;  1OQP A;  1N2D A;  2WCF A;  1SMG A;  2I18 A;  3NSO A;  2SCP A;  3TDI A;  2ZN9 A;  3DVM A;  4HRH A;  3VRR A;  2MAZ A;  4UPG A;  1QIW A;  1XFW O;  2LUX A;  5AER A;  2L2E A;  2M97 A;  3EVV A;  1SCM C;  3ICB A;  4PHM A;  5DKQ A;  5KSZ A;  4AQJ A;  4E68 A;  1X02 A;  5G08 A;  2JC2 A;  1QJT A;  4L9M A;  1IH0 A;  1B9A A;  2JU0 A;  3O4Y A;  5KU1 A;  4PDZ A;  1IJ6 A;  2M0R A;  1S5G Z;  2KAY A;  2M3W A;  2KYF A;  1PK0 D;  2BBM A;  2LHI A;  3FWC A;  2FCD A;  2WCB A;  4YRU A;  2ZRS A;  1QLK A;  2F3Y A;  4ORC B;  3AAJ A;  3PN7 C;  2IS9 A;  3CLN A;  1RTP 1;  4C0J A;  2M9G A;  3PAT A;  2Q4U A;  1EG3 A;  1NCX A;  4DCK A;  4MZJ A;  5HKY A;  5AXI A;  1VRK A;  3AAK A;  4YI8 A;  2KFG A;  1JF2 A;  1WY9 A;  3TUY C;  2KGB C;  1V1G A;  3M0W A;  3HX4 A;  1J7O A;  1AVS A;  1UHJ A;  3JVT B;  2LLU A;  2WCE A;  1A75 A;  1BG1 A;  2L5X B;  1EG4 A;  1M31 A;  1Q80 A;  2OS8 C;  1OMD A;  3BUW B;  3GK1 A;  4MSP A;  5ER5 A;  3DD4 A;  1NSH A;  4A4B A;  1KK7 Z;  1IGV A;  1SR6 C;  1NIW A;  2LLT A;  2MLE C;  1QX2 A;  1E8A A;  2M7L A;  2M1K B;  1QLS A;  4YBH B;  2LMU A;  1QVI Y;  1SK6 D;  3IF7 A;  4PHJ A;  1M45 A;  4PE0 A;  2Y5I A;  3O2P A;  1DT7 B;  1UUS A;  2JT8 A;  1OSA A;  2WND A;  2LUC A;  2H2K A;  5D7F A;  2KBI A;  1CM1 A;  2M1U A;  1A2X A;  3FIA A;  4CFQ A;  1BMO A;  2HF5 A;  1IKU A;  1B8L A;  2NCP A;  3CR5 X;  4C0L A;  1D1O A;  2TN4 A;  2LVJ A;  2WOS A;  1DF0 B;  3IQO A;  1XK4 C;  1XA5 A;  2JZI A;  4P5O E;  1GGW A;  3CTN A;  2JXL A;  2JQ6 A;  2E30 A;  3LCP C;  1UWO A;  1J1D A;  4HRE E;  2PSR A;  3VRN A;  1PSB A;  1GQM A;  3JTD C;  1OMR A;  2CNP A;  1OZS A;  2BCB A;  1Y0V H;  3TS5 B;  1TTX A;  3A4U B;  2Y4Q A;  1KWO B;  3C1V A;  1SBJ A;  1YR5 A;  4I5J A;  1QTX A;  3BOW B;  2WOR A;  1OZO A;  4ZCU A;  3WXA A;  3GOF A;  1YX8 A;  1CLB A;  3I5I B;  3WHU B;  1YRT B;  2Y1N A;  5K89 A;  5J3X A;  2L4I A;  3VRO A;  1U5I B;  1NP8 A;  1SPY A;  4Q04 A;  1F55 A;  4MRX A;  1LVC D;  2LMV A;  2KI4 B;  2KQY A;  1J7Q A;  1QAT A;  1WRL A;  2JTZ A;  1RRO A;  2KSP A;  1ALW A;  1OOJ A;  2K7C A;  3HCM A;  1JFK A;  3FS7 A;  4WQ2 A;  3SG5 A;  1ZMZ A;  1F70 A;  1AHR A;  2BCX A;  4C0K A;  1CDL A;  3GK4 X;  4YGE B;  2KFF A;  2NXQ A;  1C7V A;  5HYD A;  4OV2 A;  1XFZ O;  2ZND A;  1YUR A;  2LCP A;  2ZN8 A;  1REC A;  3D0Y A;  1V1F A;  5GQQ C;  1MXE A;  1J7P A;  4GGN A;  1K9U A;  2CXJ A;  1K96 A;  4GPL B;  1CMF A;  1BU3 A;  3O78 A;  4AOM A;  3JVT C;  1TNP A;  3ZWH A;  1CFF A;  2KHN A;  2ZFD A;  3DF0 A;  2CBL A;  4MZK A;  4P2Y B;  3PFV A;  3RLZ A;  3TDZ A;  1CTR A;  1RK9 A;  1IRJ A;  3KEV A;  2KAX A;  3SG4 A;  1CFC A;  3DVJ A;  1SL7 A;  2LP3 A;  1BR1 B;  1ZOT B;  2BE4 A;  4PHK A;  1NX1 A;  1TNQ A;  3EK8 A;  1NYA A;  1MR8 A;  1B7T Y;  1J7R A;  2OTG C;  1K93 D;  4OR9 B;  1HQV A;  2LNK A;  2MLF C;  5AAN A;  5TNC A;  1RJV A;  2V53 A;  3LL8 B;  2K7O A;  4CID A;  1DJH A;  5HKW A;  1B7T Z;  2LC5 A;  2EHB A;  1W7J B;  2L0P A;  1K90 D;  2COL B;  1DVI A;  1QAS A;  2K2A A;  3OP0 A;  1B8C A;  5KTY A;  3TZ1 A;  1SL8 A;  4OVN F;  3VGO A;  3VRQ A;  3PLF B;  1H4B A;  2BEC A;  3IQQ A;  2D8N A;  1DGU A;  1PUL A;  1R2U A;  4QJ3 B;  3O6B A;  1DJY A;  4F0Z B;  1YTZ C;  1CDN A;  2CCM A;  1F4Q A;  1XO5 A;  2PAS A;  3TS5 C;  3CZT X;  1KWO C;  1QIV A;  4PAL A;  3EKH A;  4HSZ A;  4MLW A;  3K21 A;  3I5I C;  2H61 C;  2O5G A;  1Y1X A;  1F4O A;  1Y1A A;  1CB1 A;  3D10 A;  1CLM A;  1YUS A;  2NCO A;  1J1E A;  2I2R E;  4JPZ B;  1EH2 A;  1KFU S;  1NWD A;  1XFU O;  1FI6 A;  2KI4 C;  2FOT A;  5AFP A;  1KCY A;  2KBM A;  4I5L B;  4CLN A;  1XYD A;  4XJK A;  2JPT A;  1N0Y A;  1A03 A;  1DJG A;  2OTG B;  1LIN A;  1MHO A;  2MRD A;  3NSI A;  1EL4 A;  1EJ3 A;  1XK4 A;  1TOP A;  1QVI Z;  4YGC B;  3OX6 A;  1B8R A;  1S36 A;  2BE6 A;  1DJX A;  3OB2 B;  4MZL A;  1K2H A;  4NDC A;  1KFX L;  2QAC A;  2BL0 C;  4I5K A;  1DMO A;  4IL1 A;  1SW8 A;  4GAO A;  1IG5 A;  4OKH A;  4ZCV A;  1AP4 A;  4CPV A;  5B8I B;  5AEQ A;  3LLE A;  1JC2 A;  1A4P A;  2PRU A;  2LP2 A;  4YGA A;  4PE7 A;  1HT9 A;  1FI5 A;  5JOL A;  1SRA A;  1KFU L;  2MBX A;  3I5G C;  5CSN A;  1PSR A;  1M46 A;  4MN0 A;  3TDU A;  1KK8 B;  3A8R A;  1M39 A;  2LLS A;  3CWG A;  1PVA A;  1M63 B;  1UHI A;  2M8U A;  4FTG A;  3SG2 A;  2B1U A;  1CKK A;  1DGV A;  5JJG A;  3OX5 A;  2LV7 A;  1FBV A;  1C7W A;  1QV1 A;  4NQG A;  4N1F A;  2LVI A;  5CSI A;  5CSF A;  3EVU A;  1ZUZ A;  2KFH A;  1NX0 A;  2JWW A;  1CMG A;  3QRX A;  1SYM A;  4ORA B;  2KI6 D;  4WQ3 A;  1FF1 A;  1Y1U A;  2JT0 A;  2KAV A;  2R2I A;  1N65 A;  4ICB A;  4N5X A;  5BPJ A;  2RGI A;  5F6T A;  2PAL A;  1NCZ A;  1S6C A;  3I5H C;  1NCY A;  3GK2 A;  1JBA A;  1YUU A;  2OPO A;  1K9P A;  3E3R A;  4HRG A;  2Q91 A;  3VRP A;  1CFD A;  1OE9 B;  1YUT A;  2FJU B;  2EC6 B;  4FQO A;  2HQ8 A;  1R6P A;  2KOT A;  3LK1 A;  1B4C A;  2BL0 B;  2BKI B;  2KI6 C;  3OB1 B;  1OMV A;  1ZFS A;  3OHM B;  5I2Q A;  1UHK A;  4TNC A;  2F3Z A;  1CDP A;  1ODB A;  1XFV O;  2HQW A;  4QJ5 B;  2F33 A;  2L50 A;  4GFT A;  1SNL A;  1TCO B;  5D69 A;  2GGZ A;  1L7Z A;  2QPT A;  5HLO A;  4BY5 A;  4D1E A;  1F8H A;  4M2Q A;  3I5G B;  1AUI B;  1KQM B;  4DRW A;  1TRF A;  1B1G A;  1MWN A;  4BY4 A;  4M2P A;  1YX7 A;  4GGF C;  5IBW A;  3CR4 X;  1K8U A;  1A29 A;  1BOD A;  4MEW A;  1AK8 A;  5DKR A;  4GUK A;  1G8I A;  2HET A;  2E6W A;  3RM1 A;  1DF0 A;  4MRY A;  4PE4 A;  3PSR A;  3KO0 A;  1YRU B;  4GNK B;  1AJ4 A;  5CSJ A;  3ZNI A;  1BLQ A;  3JTD B;  4YGB B;  4ORB B;  2BKH B;  1KSO A;  1Y6W A;  2F2O A;  3I5F C;  4WRI A;  4PCW A;  5CPV A;  2KYC A;  4DIR A;  1UP5 A;  2VRG A;  3SG7 A;  1SKT A;  1F54 A;  3BQ3 A;  3I5H B;  2A4J A;  1H8B A;  3BOW A;  1J55 A;  3KHE A;  2JOJ A;  1JUO A;  1S6I A;  2O60 A;  4ETO A;  2L51 A;  3WNX B;  2H61 A;  4QJ4 B;  2LHL A;  1IQ5 A;  3KPX A;  1S5G Y;  1UHH A;  2LMT A;  1U5I A;  2BBN A;  5FYX A;  3PAL A;  1CDM A;  4MBE A;  1KK8 C;  1KFX S;  4JQ0 D;  4CFR A;  1KSM A;  1S6J A;  2KGR A;  1SL9 A;  1XFY O;  2M7N A;  1ALV A;  2NLN A;  5PAL A;  2M49 B;  5I2O A;  1MXL C;  1JWD A;  4DUQ A;  2LAN A;  1NX2 A;  1LXF C;  2WC8 A;  3EK4 A;  2MHH A;  1CNP A;  1K95 A;  3CS1 A;  2K0J A;  2LM5 A;  2MA2 A;  4M2O A;  3SG6 A;  1AJ5 A;  1QX5 B;  1NX3 A;  1DTL A;  2F8P A;  4MVF A;  1BF5 A;  3BUX B;  1TCF A;  4DS7 A;  4NDD A;  3LK0 A;  1JFJ A;  2LVK A;  5HLV A;  5I8N A;  1WRK A;  1TNX A;  1ZAC A;  4PE1 A;  3SJS A;  2G2B A;  1WDC B;  1K9K A;  1S3P A;  3F45 A;  2JT3 A;  2DOQ A;  1KK7 Y;  1G4Y R;  2EC6 C;  3MSE B;  1TNW A;  3AKB A;  3EKJ A;  1SY9 A;  3I5F B;  1JSA A;  1L2O C;  1GGZ A;  2BCA A;  2F2P A;  2K8M B;  1YVL A;  3FWB A;  1MF8 B;  3D0Y B;  3H4S E;  3EK7 A;  1K94 A;  5ER4 X;  1LKJ A;  2PVB A;  1XVJ A;  1SCM B;  1LA0 A;  3NXA A;  1YVH A;  3DF0 B;  3KF9 A;  4PHN A;  1FPW A;  1S26 D;  3WHT B;  2LVV A;  1KQM C;  1QXP A;  1WLZ A;  1EXR A;  2K61 A;  2GGM A;  1NPQ A;  2I94 A;  2L98 A;  4YI9 A;  2AAO A;  4I5N B;  3DVE A;  4AQI A;  1FW4 A;  1XFX O;  4N1G A;  1UUR A;  2ISD A;  2CTN A;  2HPS A;  2AUC A;  1PRW A;  2ZRT A;  2ZKM X;  2I7A A;  3PN7 B;  1IJ5 A;  3PM8 A;  2K7D A;  3BUN B;  3BYA A;  1TN4 A;  1TIZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...