3LK1A

X-ray structure of bovine sc0322,ca(2+)-s100b
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
88
structure length
88
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In vitro screening and structural characterization of inhibitors of the S100B-p53 interaction.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
molecule keywords Protein S100-B
total genus 30
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2010-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3lk1A00
1B7TZ 1DMOA 1YTZC 2Q91A 1BLQA 2NLNA 3D10A 4OR9B 1RECA 2LLTA 4NDDA 2ZNEA 1X02A 1NX2A 1RJVA 1AJ4A 3DD4A 5FYXA 1KK7Z 3I5FB 1DJXA 3EK4A 5I2QA 1Y6WA 1NWDA 3TDUA 1S6CA 4YGAA 2BL0B 1K2HA 1EG4A 1SNLA 3JTDC 2M9GA 1B8CA 3TS5C 1OOJA 1B9AA 3DVMA 1OMVA 2L98A 4R1EA 1NCXA 4MN0A 1K93D 1WY9A 2JWWA 2BCBA 1A75B 2A4JA 1S6IA 2AMIA 2LLSA 1GJYA 1OMRA 1RROA 1YR5A 1RK9A 2K61A 2M8UA 1GGWA 3I5IB 2DOQA 3KF9A 4DRWA 1K95A 1J7PA 5HYDA 1TRFA 2LP2A 3NSLA 1NSHA 3I5GB 1DVIA 1YVHA 2K8MB 2NCPA 3EVUA 4YGEB 4M2QA 2CNPA 3VRPA 2KYFA 2O60A 3GOFA 1ALWA 3LK1A 1N0YA 2L51A 2Y5IA 1OMDA 2E6WA 2KFGA 3VRRA 2WCFA 2PSRA 1A75A 3CTNA 4MZLA 3CR4X 3VRQA 3HX4A 2O5GA 4AQJA 5D7FA 4GUKA 2MAZA 5HKZA 2BE6A 3TS5B 2LCPA 1QX5B 4C0KA 2OPOA 1CM4A 4I5NB 1BJFA 1TTXA 5ER4X 1YUSA 5I2OA 1IQ3A 1KFUL 1YURA 2GV5A 4FTGA 4MRYA 4QJ3B 1TCOB 2WCBA 3BYAA 3DVEA 2MBXA 4CFQA 1WLZA 1J7RA 1CFPA 1CFDA 1NCYA 1QIWA 3LL8B 1WRLA 4CPVA 1IG5A 4MEWA 1J1DA 1R2UA 4GGNA 1YUUA 2KAVA 2HETA 4ZCUA 1F71A 2WNDA 2BKIB 3ICBA 4USLA 2LMTA 3NSKA 1FW4A 1XFXO 2COLB 2LE9B 4DIRA 1UHNA 1K9PA 2FCEA 5CSNA 1BT6A 1K94A 2CBLA 2H2KA 5CSIA 2V53A 1PVAA 1SCVA 1NX3A 2SCPA 3PM8A 5I2LA 2M3WA 3OB1B 1CMGA 1QVIZ 4IL1A 1BR4B 2KGRA 2LM5A 1S26D 2PALA 4JPZB 4E68A 1IQ5A 2NCOA 4U8DA 1PSRA 4QJ5B 2KBIA 4AOMA 1CLBA 1A2XA 1S6JA 4DUQA 2JT3A 2WC8A 3O2PA 2Y4QA 3BUNB 1J1EA 1JF2A 3O6BA 1L2OB 2Q4UA 1N2DA 1QXPA 2LANA 1EXRA 1OE9B 4HRHA 1K9UA 1SL7A 2BCXA 5JOLA 3WHUB 1SBJA 3EK7A 2KI4C 1CDLA 2KAYA 1EJ3A 5BPJA 3OX5A 1J7OA 1SCMC 1BR1B 3CR2A 1EH2A 2K7CA 5AFPA 1IJ6A 4AQIA 1TIZA 2HQ8A 4L9MA 1CTRA 5D69A 1HQVA 1KFXS 1KK8B 1CDPA 2JTZA 2KNEA 3VGOA 1CLMA 3WHTB 2KHNA 2LC5A 2ZN9A 4HSZA 1KSMA 3I5HC 4WQ2A 3RM1A 1LXFC 1Y0VH 2HPSA 4YGBB 5KU1A 4ORCB 1PALA 3OX6A 3PN7C 1S5GZ 1C07A 4OCIA 1TNQA 3F45A 4P5OE 2M97A 3E3RA 2WCEA 1D1OA 2NXQA 4OVNF 2WORA 4PDZA 1BOCA 1F4QA 1QJTA 2JC2A 3SIBA 2KYCA 1S36A 1OSAA 1RWYA 3MSEB 4TNCA 2KI4B 2KSPA 5DKQA 2LMUA 4PCWA 2FCDA 2MHHA 1BF5A 3SG4A 1CDNA 1DGVA 1IGVA 3TZ1A 1UHKA 2MRDA 4YI8A 1FI5A 2LVVA 1BU3A 1S1EA 4A4CA 1CDMA 2LLUA 1GGZA 1RTP1 2BKHB 3I5FC 1C7WA 3JTDB 4XYNA 1IKUA 1M39A 3GK2A 1KQVA 4PE4A 1NCZA 4CLNA 1PK0D 2M0RA 1A03A 2KQ6A 1UHJA 2LVIA 2VRGA 5ER5A 2JZIA 1CFCA 1DF0A 4WRIA 4MZJA 3BUOB 4GFTA 1SY9A 4XJKB 3EVVA 1W7JB 1UWOA 2ZN8A 4BY5A 3I5HB 4N1FA 4PHNA 2F33A 1UP5A 1K90D 2LHLA 1XFZO 2D8NA 1WLMA 2MJWB 3PLFB 2Y1MA 2BCAA 2OTGC 1G33A 3GK4X 1SCMB 1QX7A 1FI6A 2LNKA 3AKAA 3FIAA 1F55A 1H8BA 1IJ5A 2G2BA 1PULA 2LVKA 4I5JA 1J55A 3H4SE 2JULA 1YUTA 4QJ4B 1IH0A 1DTLA 2JOJA 3JVTB 1B8LA 1L2OC 3D0YB 2FJUB 1QV1A 1AHRA 3CZTX 3LLEA 4M2PA 1M63B 1XYDA 4NDCA 1KFXL 2H61C 2CCMA 3O78A 3CS1A 4JQ0D 1QTXA 3BXKA 4GBAA 2PMYA 2KI6C 1UUSA 2B1UA 1Y1UA 2GGZA 3C1VA 3TDIA 1LKJA 1DJWA 2KQYA 3AKBA 3PALA 2LHIA 1YRTB 1L7ZA 4A4BA 2KI6D 2FOTA 2LUXA 1JSAA 1SPYA 1Y1XA 5CSJA 2MLEC 1CLLA 1XFVO 1NUBA 4PALA 1U5IB 1ZACA 2NZ0A 1CFFA 2LV7A 3PSRA 3LCPC 2KDHA 2LMVA 3DF0A 4P2YB 1TNXA 1JUOA 3I5GC 1XK4C 1DJZA 2L0PA 1MWNA 1DT7B 1RFJA 1XFWO 1YX7A 4MLWA 1YVLA 3BUMB 2JU0A 1QATA 1KWOC 2LVJA 1UHIA 3TUYB 2KFHA 1AVSA 4UPGA 1SR6B 2CTNA 1E8AA 1NP8A 2E30A 1B47A 1B8RA 3BOWB 5TNCA 1A29A 1MXLC 3BOWA 4C0LA 1K96A 2QACA 1SMGA 1DJYA 1CNPA 3BQ3A 1PSBA 1SR6C 2BL0C 5KTYA 2ZRSA 3ZWHA 1KWOB 5DKRA 1JF0A 1F4OA 1V1GA 4ETOA 2CT9A 1XA5A 4HREE 4MRXA 1BG1A 1JBAA 1QIVA 1M46A 3JVTC 2KBMA 2CXJA 2PVBA 1CB1A 3DF0B 1NIWA 4HRGA 3FS7A 3OB2B 1ALVA 5J3XA 1PVBA 1OQPA 1QVIY 1U5IA 3K21A 2ISDA 4MVFA 2F3YA 1XFUO 1OZOA 2JNFA 4FQOA 1XO5A 5K89A 5KSZA 1JWDA 2I7AA 5IBWA 2PASA 1B7TY 1MXEA 1R6PA 2F2PA 2K0JA 2ZKMX 2L2EA 5DKNA 3LK0A 1LA3A 5GQQC 2LP3A 2Y1NA 3SG5A 1MQ1A 1TNWA 1YRUB 3PFVA 1B1GA 5G08A 3EK8A 4ZCVA 2F3ZA 2AUCA 3IF7A 4GNKB 1CKKA 2KGBC 4NDBA 2JTTA 3BUXB 1QLKA 2ZRTA 3CR5X 4GAOA 1HT9A 1TCFA 3SIAA 1IRJA 4CFRA 2F8PA 3SG7A 4DCKA 4ORAB 3D0YA 4N1GA 1UHHA 2M7NA 1DJGA 1NYAA 3WXAA 1QLSA 1FF1A 3RLZA 1Y1AA 1SYMA 2LAPA 4YBHB 3QRXA 1KFUS 1QX2A 1NPQA 2RGIA 2ZFDA 3SG3A 4GGFC 4JWQA 1J7QA 1F70A 5HLVA 4PHMA 2HF5A 5B8IB 1CMFA 4F0ZB 3CWGA 2EHBA 1AJ5A 5CSFA 4D1EA 1JC2A 1LA0A 5HKYA 4YGCB 1ZOTB 5JJGA 3OHMB 2MLFC 1TOPA 1BMOA 1GQMA 2KAXA 3O4YA 4PE1A 5AERA 1KSOA 1M31A 3SG2A 1N65A 1S5GY 3M0WA 4I5LB 1JFJA 2QPTA 4XJKA 1DF0B 3KHEA 2JXCA 1ZMZA 1B4CA 1MUXA 3CLNA 3VRNA 1MHOA 3DVKA 1BODA 1KK8C 1M45A 1V1FA 2KFFA 4C0JA 1K8UA 1MF8B 1K9KA 2L4IA 1SL9A 1QV0A 4YRUA 1AUIB 2BBNA 5CPVA 1F8HA 1EL4A 3DVJA 4ORBB 2TN4A 2L5XB 1LVCD 2M1UA 1SKTA 3AAKA 3IQQA 5AANA 3OP0A 4CIDA 2EC6C 2P6BB 4MSPA 4MZKA 2K2FA 2BBMA 2R2IA 3TUYC 4I5KA 1SL8A 2L4HA 2M1KB 5F6TA 3FWBA 4DS7A 1WDCB 4NQGA 4PE7A 5AXIA 4N5XA 1EG3A 1SK6D 1WRKA 3EKJA 3CGAA 1G4YR 1CM1A 1AK8A 4GPLB 2I94A 2JNXA 1KQMC 3BUWB 2F2OA 1ZFSA 2LUCA 2HQWA 1FPWA 1A4PA 3SJSA 1XK4A 1AP4A 2JQ6A 3SG6A 2K7BA 2SASA 2WOSA 2K7OA 4GGFA 1G8IA 1WRZA 5I8NA 5HKWA 3KEVA 1UURA 1KQMB 2BE4A 4PE0A 4YI9A 1NX1A 4OKHA 2M49B 2BECA 1QS7A 2ZNDA 1WDCC 3AAJA 1FBVA 2JRFA 2KOTA 2JT8A 2L50A 2MA2A 1DJIA 2EC6B 1ZUZA 2K7DA 1JFKA 1MR8A 4PHJA 1TNPA 3KPXA 4M2OA 5AEQA 1IWQA 4ICBA 1OZSA 1F54A 3NSOA 1LINA 3EKHA 1C7VA 3FWCA 4PHKA 3EVRA 4WQ3A 2JPTA 1NX0A 1Q80A 2GGMA 2PRUA 2H61A 3HCMA 3IQOA 3NXAA 3VROA 2AAOA 3WNXB 2JT0A 1DGUA 5PALA 4YGDB 4MBEA 1H4BA 2OS8C 1SRAA 4Q04A 1ODBA 2I2RE 2JXLA 3ZNIA 3TDZA 1W7IB 1PRWA 1XVJA 2I18A 2M29A 2M7LA 1VRKA 2K2AA 3I5IC 1TN4A 3A4UB 1DJHA 1YX8A 2G9BA 1S3PA 1KK7Y 1SW8A 2OTGB 3A8RA 4OV2A 3GK1A 2IS9A 4BY4A 5HLOA 3NSIA 3PATA 1KCYA 3KO0A 3PN7B 2EGDA 1XFYO 2OS8B 1QASA
chains in the Genus database with same CATH superfamily
1B7TZ 1DMOA 1YTZC 2Q91A 1BLQA 2NLNA 3D10A 4OR9B 2KLDA 1RECA 2LLTA 4NDDA 2ZNEA 1X02A 4JD9A 1NX2A 1RJVA 1AJ4A 3DD4A 5FYXA 1KK7Z 3I5FB 1DJXA 3EK4A 5I2QA 1Y6WA 1NWDA 3TDUA 1S6CA 4YGAA 2BL0B 1K2HA 1EG4A 1SNLA 3JTDC 3FE8A 2M9GA 1B8CA 3RZSA 3TS5C 1OOJA 1B9AA 3DVMA 1OMVA 2L98A 2WC6A 4R1EA 1NCXA 4MN0A 1K93D 1WY9A 2JWWA 3S0EA 2BCBA 1A75B 2A4JA 1S6IA 2AMIA 2LLSA 2P71A 1GJYA 1OMRA 1RROA 1YR5A 1RK9A 5FI6A 2K61A 2M8UA 1GGWA 3I5IB 3S0DA 2DOQA 2PYQA 3KF9A 4DRWA 1K95A 1J7PA 5HYDA 3PJIA 1TRFA 3BFAA 1DQEA 2LP2A 3NSLA 1NSHA 3I5GB 1DVIA 1XFRA 1YVHA 2K8MB 3R1VA 2NCPA 3EVUA 1OOHA 1DEKA 2ERBA 2WCMA 4YGEB 4M2QA 5EL2A 2CNPA 3VRPA 2KYFA 2O60A 3GOFA 1ALWA 3LK1A 1N0YA 2L51A 2Y5IA 1OMDA 2E6WA 2KFGA 3VRRA 2WCFA 2PSRA 1A75A 3CTNA 4MZLA 3CR4X 3VRQA 1C3ZA 3HX4A 2O5GA 4AQJA 5D7FA 4GUKA 2MAZA 5HKZA 2BE6A 3TS5B 2LCPA 1QX5B 4C0KA 2OPOA 1CM4A 4I5NB 1BJFA 1TTXA 5ER4X 1YUSA 5I2OA 1IQ3A 1KFUL 1YURA 2GV5A 2QEBA 4FTGA 4MRYA 4QJ3B 1TCOB 2WCBA 3BYAA 3DVEA 3B86A 2MBXA 4CFQA 1WLZA 1J7RA 1CFPA 1CFDA 1NCYA 1QIWA 3LL8B 1WRLA 4CPVA 1IG5A 4MEWA 1J1DA 1R2UA 4GGNA 1YUUA 2KAVA 2HETA 4ZCUA 1F71A 2WNDA 2BKIB 3EG5B 3ICBA 4USLA 2LMTA 4KYNA 3NSKA 1FW4A 1XFXO 2COLB 2LE9B 4DIRA 1UHNA 1K9PA 2FCEA 5CSNA 1BT6A 1K94A 2CBLA 2H2KA 3FE6A 2V53A 5CSIA 3OBVA 1PVAA 1SCVA 1NX3A 2SCPA 4FQTA 3PM8A 5I2LA 2M3WA 3OB1B 1CMGA 3SS3A 1QVIZ 4IL1A 1BR4B 2KGRA 2LM5A 1S26D 2PALA 4JPZB 4E68A 1IQ5A 2NCOA 4U8DA 4F7FA 1PSRA 4QJ5B 5I94A 3BJHA 2KBIA 4AOMA 1CLBA 1A2XA 1S6JA 4DUQA 2JT3A 2WC8A 3O2PA 3SS4A 2Y4QA 3Q8IA 3BUNB 1J1EA 1OOGA 1JF2A 3O6BA 1L2OB 3PM2A 2Q4UA 1N2DA 1QXPA 1OOFA 2LANA 1EXRA 1OE9B 4HRHA 1K9UA 1SL7A 2BCXA 5JOLA 3WHUB 3DYEA 1P28A 1SBJA 3EK7A 2KI4C 1CDLA 3CZ1A 2KAYA 1EJ3A 5BPJA 3OX5A 3OGNA 1J7OA 1SCMC 1BR1B 3CR2A 3D76A 2K7CA 1EH2A 5AFPA 1IJ6A 1OW4A 4AQIA 1TIZA 2HQ8A 4L9MA 1TWOA 3DXLA 1CTRA 5D69A 1HQVA 1KFXS 1KK8B 1CDPA 2JTZA 2KNEA 3VGOA 1CLMA 3WHTB 2KHNA 2LC5A 2ZN9A 4HSZA 1KSMA 3I5HC 4WQ2A 3RM1A 1C3YA 1LXFC 1Y0VH 2HPSA 4YGBB 5KU1A 4ORCB 2QEVA 1PALA 3OX6A 3PN7C 1S5GZ 1C07A 4OCIA 1TNQA 3F45A 4P5OE 2M97A 3B7AA 3E3RA 2WCEA 1D1OA 2NXQA 4OVNF 2WORA 4PDZA 1BOCA 1F4QA 1QJTA 2JC2A 3S0BA 3SIBA 2KYCA 1S36A 1OSAA 1RWYA 3MSEB 4TNCA 2KI4B 2KSPA 4OZDA 2LMUA 4PCWA 5DKQA 2FCDA 2MHHA 1BF5A 3SG4A 1CDNA 3FE9A 1DC1A 1DGVA 1IGVA 3TZ1A 1UHKA 2MRDA 2K60A 2WCKA 3NHIA 4YI8A 1FI5A 2LVVA 1BU3A 1S1EA 3UNWA 4A4CA 1CDMA 2LLUA 1GGZA 1RTP1 2BKHB 3I5FC 1C7WA 3JTDB 4XYNA 1IKUA 1M39A 3GK2A 1KQVA 4PE4A 1NCZA 2BNXA 4CLNA 1PK0D 2M0RA 1A03A 2KQ6A 1UHJA 2LVIA 2VRGA 5ER5A 2JZIA 1CFCA 1DF0A 4WRIA 4MZJA 2L5YA 3BUOB 4GFTA 1SY9A 4XJKB 3EVVA 1W7JB 1UWOA 2ZN8A 4BY5A 1QWVA 3I5HB 3D78A 3D73A 4N1FA 4PHNA 2F33A 1UP5A 1LS8A 1K90D 2LHLA 1XFZO 2D8NA 1WLMA 2MJWB 3PLFB 2Y1MA 2BCAA 2OTGC 1G33A 3GK4X 1SCMB 1QX7A 1FI6A 2LNKA 3AKAA 3FIAA 1F55A 1H8BA 1IJ5A 2G2BA 3DZTA 1PULA 2LVKA 4I5JA 3L4AA 1J55A 3H4SE 3V2LA 2JULA 1YUTA 4QJ4B 1IH0A 1DELA 1DTLA 3CABA 2JOJA 3JVTB 1B8LA 1L2OC 3D0YB 3SS5A 2FJUB 1QV1A 1AHRA 3CZTX 3L4LA 3LLEA 4M2PA 1M63B 1XYDA 3QMEA 4NDCA 1KFXL 2H61C 2CCMA 2L2CA 3O78A 3CS1A 1TUZA 4JQ0D 1QTXA 2WCHA 3BXKA 2PMYA 4GBAA 5DICA 2KI6C 1UUSA 2B1UA 1Y1UA 2FJYA 2GGZA 3C1VA 3TDIA 1LKJA 1DJWA 2KQYA 3AKBA 3PALA 2LHIA 3D74A 1YRTB 1L7ZA 4A4BA 2KI6D 2FOTA 2LUXA 1JSAA 1T14A 1SPYA 1Y1XA 3B87A 3D77A 2MLEC 1CLLA 3NGVA 4INWA 1XFVO 1NUBA 5CSJA 1GM0A 2WC5A 4PALA 1U5IB 1ZACA 2NZ0A 1CFFA 2LV7A 3PSRA 3LCPC 2KDHA 2LMVA 3DF0A 4P2YB 1TNXA 1JUOA 3I5GC 1XK4C 1DJZA 2L0PA 3R1OA 1MWNA 2KPHA 1DT7B 1RFJA 1XFWO 1YX7A 4MLWA 1YVLA 3BUMB 2JU0A 1QATA 1KWOC 2LVJA 1UHIA 3TUYB 2KFHA 1AVSA 4UPGA 1SR6B 2CTNA 1E8AA 1NP8A 2E30A 1B47A 1B8RA 3BOWB 3CZ2A 5TNCA 1A29A 1MXLC 3B88A 2YGUA 2WCJA 5FI7A 3BOWA 4C0LA 1K96A 2QACA 1SMGA 3S0GA 3S0FA 1DJYA 1CNPA 3BQ3A 1PSBA 1SR6C 1SSEB 2BL0C 5KTYA 4PT1A 2ZRSA 3ZWHA 3S0AA 1KWOB 5DKRA 1JF0A 1F4OA 1V1GA 4ETOA 2CT9A 1XA5A 4HREE 4MRXA 2QEHA 1BG1A 1JBAA 1QIVA 1M46A 3JVTC 2KBMA 2CXJA 2PVBA 2QEOA 1CB1A 3DF0B 1NIWA 4HRGA 2BAPA 3FS7A 3OB2B 1ALVA 5J3XA 1PVBA 1OQPA 1QVIY 1U5IA 3K21A 2ISDA 4MVFA 2F3YA 1W9ZA 1OZOA 1XFUO 2JNFA 1XO5A 4FQOA 5K89A 5KSZA 1JWDA 2I7AA 5IBWA 2PASA 1B7TY 1MXEA 1Z4HA 1R6PA 2F2PA 2K0JA 2ZKMX 2L2EA 5DKNA 3LK0A 1LA3A 5GQQC 2LP3A 2Y1NA 3SG5A 1MQ1A 1TNWA 3O4XA 1YRUB 4JKTA 3PFVA 1B1GA 2QDIA 5G08A 3EK8A 4ZCVA 2F3ZA 2AUCA 3CYZA 3IF7A 4GNKB 1CKKA 2KGBC 4NDBA 3VB1A 2JTTA 3BUXB 1QLKA 2ZRTA 3CR5X 4GAOA 1HT9A 1TCFA 1TUJA 1IRJA 3R1PA 3SIAA 2F8PA 3SG7A 4CFRA 4DCKA 4ORAB 3D0YA 4N1GA 1UHHA 2M7NA 1DJGA 1NYAA 3WXAA 1QLSA 1FF1A 3RLZA 1Y1AA 3R72A 1SYMA 2LAPA 4YBHB 3QRXA 1KFUS 1QX2A 1NPQA 2RGIA 2ZFDA 3NHTA 3SG3A 4GGFC 4JWQA 5HL1A 1J7QA 1F70A 5HLVA 3CDNA 4PHMA 2HF5A 5B8IB 1CMFA 4F0ZB 3CWGA 2EHBA 1AJ5A 5CSFA 4D1EA 1JC2A 1LA0A 5HKYA 4YGCB 1ZOTB 5JJGA 3OHMB 2MLFC 1TOPA 1BMOA 1GQMA 2KAXA 3O4YA 4PE1A 5AERA 1KSOA 1M31A 3SG2A 1N65A 1S5GY 3M0WA 4I5LB 1JFJA 2QPTA 4XJKA 2H8VA 1DF0B 3KHEA 2JXCA 1ZMZA 1B4CA 1MUXA 3CLNA 3VRNA 1MHOA 3DVKA 1BODA 1KK8C 3K1EA 1M45A 5D3OA 1V1FA 2KFFA 4C0JA 1K8UA 1MF8B 1K9KA 2L4IA 1SL9A 1QV0A 4YRUA 1AUIB 2BBNA 5CPVA 1F8HA 1IIOA 1EL4A 3DVJA 4ORBB 2TN4A 2L5XB 1LVCD 2M1UA 1SKTA 3AAKA 3IQQA 5AANA 3OP0A 4CIDA 2EC6C 2P6BB 4MSPA 4MZKA 2K2FA 2BBMA 2R2IA 3TUYC 4I5KA 1SL8A 2L4HA 1OOIX 2M1KB 3FWBA 5F6TA 1WDCB 4NQGA 4PE7A 5AXIA 4DS7A 4N5XA 1EG3A 1SK6D 1WRKA 3EKJA 3D75A 3CGAA 1G4YR 1CM1A 1AK8A 4GPLB 2I94A 2JNXA 1KQMC 3BUWB 2F2OA 1ZFSA 2LUCA 1Z2CB 2HQWA 1FPWA 1A4PA 3SJSA 1XK4A 1AP4A 2JQ6A 3IVTA 4IJ7A 3SG6A 2K7BA 2SASA 3UO9A 2WOSA 2K7OA 4GGFA 3DY9A 1G8IA 1WRZA 2PQLA 4INXA 3KEVA 1UURA 1KQMB 2BE4A 5HKWA 5I8NA 4PE0A 4YI9A 1NX1A 4OKHA 1ORGA 2M49B 2BECA 1QS7A 3N7HA 2ZNDA 1WDCC 3AAJA 3L47A 1FBVA 2JRFA 2KOTA 2JT8A 2L50A 2MA2A 1DJIA 2EC6B 1ZUZA 2JPOA 2K7DA 1JFKA 1MR8A 4PHJA 1TNPA 3KPXA 4M2OA 5AEQA 1IWQA 3BFHA 4ICBA 1OZSA 1F54A 3NSOA 1LINA 3EKHA 1C7VA 3FWCA 4PHKA 3EVRA 3B6XA 4WQ3A 3BFBA 2JPTA 1NX0A 1Q80A 2GGMA 2PRUA 2H61A 3HCMA 3IQOA 3NXAA 3VROA 2AAOA 3WNXB 2JT0A 1DGUA 5PALA 4YGDB 4MBEA 5FI2A 2OS8C 1H4BA 1SRAA 2GTEA 1ODBA 4Q04A 2I2RE 2JXLA 3ZNIA 3TDZA 1W7IB 1PRWA 1XVJA 2I18A 2M29A 2M7LA 1VRKA 2K2AA 3I5IC 1TN4A 3A4UB 1DJHA 1YX8A 2WCLA 2G9BA 1S3PA 1KK7Y 1SW8A 2OTGB 3A8RA 4OV2A 3GK1A 2IS9A 2P70A 5HLOA 4BY4A 3NSIA 3PATA 1KCYA 3KO0A 3PN7B 3CZ0A 2EGDA 1XFYO 2KLEA 2OS8B 1QASA
chains in the Genus database with same CATH topology
1B7TZ 1DMOA 1YTZC 2Q91A 1BLQA 2NLNA 3D10A 4OR9B 1RECA 2LLTA 4NDDA 2ZNEA 1X02A 1NX2A 1RJVA 1AJ4A 3DD4A 5FYXA 1KK7Z 3I5FB 1DJXA 3EK4A 5I2QA 1Y6WA 1NWDA 3TDUA 1S6CA 4YGAA 2BL0B 1K2HA 1EG4A 1SNLA 3JTDC 2M9GA 1B8CA 3TS5C 1OOJA 1B9AA 3DVMA 1OMVA 2L98A 4R1EA 1NCXA 4MN0A 1K93D 1WY9A 2JWWA 2BCBA 1A75B 2A4JA 1S6IA 2AMIA 2LLSA 1GJYA 1OMRA 1RROA 1YR5A 1RK9A 2K61A 2M8UA 1GGWA 3I5IB 2DOQA 3KF9A 4DRWA 1K95A 1J7PA 5HYDA 1TRFA 2LP2A 3NSLA 1NSHA 3I5GB 1DVIA 1YVHA 2K8MB 2NCPA 3EVUA 4YGEB 4M2QA 2CNPA 3VRPA 2KYFA 2O60A 3GOFA 1ALWA 3LK1A 1N0YA 2L51A 2Y5IA 1OMDA 2E6WA 2KFGA 3VRRA 2WCFA 2PSRA 1A75A 3CTNA 4MZLA 3CR4X 3VRQA 3HX4A 2O5GA 4AQJA 5D7FA 4GUKA 2MAZA 5HKZA 2BE6A 3TS5B 2LCPA 1QX5B 4C0KA 2OPOA 1CM4A 4I5NB 1BJFA 1TTXA 5ER4X 1YUSA 5I2OA 1IQ3A 1KFUL 1YURA 2GV5A 4FTGA 4MRYA 4QJ3B 1TCOB 2WCBA 3BYAA 3DVEA 2MBXA 4CFQA 1WLZA 1J7RA 1CFPA 1CFDA 1NCYA 1QIWA 3LL8B 1WRLA 4CPVA 1IG5A 4MEWA 1J1DA 1R2UA 4GGNA 1YUUA 2KAVA 2HETA 4ZCUA 1F71A 2WNDA 2BKIB 3ICBA 4USLA 2LMTA 3NSKA 1FW4A 1XFXO 2COLB 2LE9B 4DIRA 1UHNA 1K9PA 2FCEA 5CSNA 1BT6A 1K94A 2CBLA 2H2KA 5CSIA 2V53A 1PVAA 1SCVA 1NX3A 2SCPA 3PM8A 5I2LA 2M3WA 3OB1B 1CMGA 1QVIZ 4IL1A 1BR4B 2KGRA 2LM5A 1S26D 2PALA 4JPZB 4E68A 1IQ5A 2NCOA 4U8DA 1PSRA 4QJ5B 2KBIA 4AOMA 1CLBA 1A2XA 1S6JA 4DUQA 2JT3A 2WC8A 3O2PA 2Y4QA 3BUNB 1J1EA 1JF2A 3O6BA 1L2OB 2Q4UA 1N2DA 1QXPA 2LANA 1EXRA 1OE9B 4HRHA 1K9UA 1SL7A 2BCXA 5JOLA 3WHUB 1SBJA 3EK7A 2KI4C 1CDLA 2KAYA 1EJ3A 5BPJA 3OX5A 1J7OA 1SCMC 1BR1B 3CR2A 1EH2A 2K7CA 5AFPA 1IJ6A 4AQIA 1TIZA 2HQ8A 4L9MA 1CTRA 5D69A 1HQVA 1KFXS 1KK8B 1CDPA 2JTZA 2KNEA 3VGOA 1CLMA 3WHTB 2KHNA 2LC5A 2ZN9A 4HSZA 1KSMA 3I5HC 4WQ2A 3RM1A 1LXFC 1Y0VH 2HPSA 4YGBB 5KU1A 4ORCB 1PALA 3OX6A 3PN7C 1S5GZ 1C07A 4OCIA 1TNQA 3F45A 4P5OE 2M97A 3E3RA 2WCEA 1D1OA 2NXQA 4OVNF 2WORA 4PDZA 1BOCA 1F4QA 1QJTA 2JC2A 3SIBA 2KYCA 1S36A 1OSAA 1RWYA 3MSEB 4TNCA 2KI4B 2KSPA 5DKQA 2LMUA 4PCWA 2FCDA 2MHHA 1BF5A 3SG4A 1CDNA 1DGVA 1IGVA 3TZ1A 1UHKA 2MRDA 4YI8A 1FI5A 2LVVA 1BU3A 1S1EA 4A4CA 1CDMA 2LLUA 1GGZA 1RTP1 2BKHB 3I5FC 1C7WA 3JTDB 4XYNA 1IKUA 1M39A 3GK2A 1KQVA 4PE4A 1NCZA 4CLNA 1PK0D 2M0RA 1A03A 2KQ6A 1UHJA 2LVIA 2VRGA 5ER5A 2JZIA 1CFCA 1DF0A 4WRIA 4MZJA 3BUOB 4GFTA 1SY9A 4XJKB 3EVVA 1W7JB 1UWOA 2ZN8A 4BY5A 3I5HB 4N1FA 4PHNA 2F33A 1UP5A 1K90D 2LHLA 1XFZO 2D8NA 1WLMA 2MJWB 3PLFB 2Y1MA 2BCAA 2OTGC 1G33A 3GK4X 1SCMB 1QX7A 1FI6A 2LNKA 3AKAA 3FIAA 1F55A 1H8BA 1IJ5A 2G2BA 1PULA 2LVKA 4I5JA 1J55A 3H4SE 2JULA 1YUTA 4QJ4B 1IH0A 1DTLA 2JOJA 3JVTB 1B8LA 1L2OC 3D0YB 2FJUB 1QV1A 1AHRA 3CZTX 3LLEA 4M2PA 1M63B 1XYDA 4NDCA 1KFXL 2H61C 2CCMA 3O78A 3CS1A 4JQ0D 1QTXA 3BXKA 4GBAA 2PMYA 2KI6C 1UUSA 2B1UA 1Y1UA 2GGZA 3C1VA 3TDIA 1LKJA 1DJWA 2KQYA 3AKBA 3PALA 2LHIA 1YRTB 1L7ZA 4A4BA 2KI6D 2FOTA 2LUXA 1JSAA 1SPYA 1Y1XA 5CSJA 2MLEC 1CLLA 1XFVO 1NUBA 4PALA 1U5IB 1ZACA 2NZ0A 1CFFA 2LV7A 3PSRA 3LCPC 2KDHA 2LMVA 3DF0A 4P2YB 1TNXA 1JUOA 3I5GC 1XK4C 1DJZA 2L0PA 1MWNA 1DT7B 1RFJA 1XFWO 1YX7A 4MLWA 1YVLA 3BUMB 2JU0A 1QATA 1KWOC 2LVJA 1UHIA 3TUYB 2KFHA 1AVSA 4UPGA 1SR6B 2CTNA 1E8AA 1NP8A 2E30A 1B47A 1B8RA 3BOWB 5TNCA 1A29A 1MXLC 3BOWA 4C0LA 1K96A 2QACA 1SMGA 1DJYA 1CNPA 3BQ3A 1PSBA 1SR6C 2BL0C 5KTYA 2ZRSA 3ZWHA 1KWOB 5DKRA 1JF0A 1F4OA 1V1GA 4ETOA 2CT9A 1XA5A 4HREE 4MRXA 1BG1A 1JBAA 1QIVA 1M46A 3JVTC 2KBMA 2CXJA 2PVBA 1CB1A 3DF0B 1NIWA 4HRGA 3FS7A 3OB2B 1ALVA 5J3XA 1PVBA 1OQPA 1QVIY 1U5IA 3K21A 2ISDA 4MVFA 2F3YA 1XFUO 1OZOA 2JNFA 4FQOA 1XO5A 5K89A 5KSZA 1JWDA 2I7AA 5IBWA 2PASA 1B7TY 1MXEA 1R6PA 2F2PA 2K0JA 2ZKMX 2L2EA 5DKNA 3LK0A 1LA3A 5GQQC 2LP3A 2Y1NA 3SG5A 1MQ1A 1TNWA 1YRUB 3PFVA 1B1GA 5G08A 3EK8A 4ZCVA 2F3ZA 2AUCA 3IF7A 4GNKB 1CKKA 2KGBC 4NDBA 2JTTA 3BUXB 1QLKA 2ZRTA 3CR5X 4GAOA 1HT9A 1TCFA 3SIAA 1IRJA 4CFRA 2F8PA 3SG7A 4DCKA 4ORAB 3D0YA 4N1GA 1UHHA 2M7NA 1DJGA 1NYAA 3WXAA 1QLSA 1FF1A 3RLZA 1Y1AA 1SYMA 2LAPA 4YBHB 3QRXA 1KFUS 1QX2A 1NPQA 2RGIA 2ZFDA 3SG3A 4GGFC 4JWQA 1J7QA 1F70A 5HLVA 4PHMA 2HF5A 5B8IB 1CMFA 4F0ZB 3CWGA 2EHBA 1AJ5A 5CSFA 4D1EA 1JC2A 1LA0A 5HKYA 4YGCB 1ZOTB 5JJGA 3OHMB 2MLFC 1TOPA 1BMOA 1GQMA 2KAXA 3O4YA 4PE1A 5AERA 1KSOA 1M31A 3SG2A 1N65A 1S5GY 3M0WA 4I5LB 1JFJA 2QPTA 4XJKA 1DF0B 3KHEA 2JXCA 1ZMZA 1B4CA 1MUXA 3CLNA 3VRNA 1MHOA 3DVKA 1BODA 1KK8C 1M45A 1V1FA 2KFFA 4C0JA 1K8UA 1MF8B 1K9KA 2L4IA 1SL9A 1QV0A 4YRUA 1AUIB 2BBNA 5CPVA 1F8HA 1EL4A 3DVJA 4ORBB 2TN4A 2L5XB 1LVCD 2M1UA 1SKTA 3AAKA 3IQQA 5AANA 3OP0A 4CIDA 2EC6C 2P6BB 4MSPA 4MZKA 2K2FA 2BBMA 2R2IA 3TUYC 4I5KA 1SL8A 2L4HA 2M1KB 5F6TA 3FWBA 4DS7A 1WDCB 4NQGA 4PE7A 5AXIA 4N5XA 1EG3A 1SK6D 1WRKA 3EKJA 3CGAA 1G4YR 1CM1A 1AK8A 4GPLB 2I94A 2JNXA 1KQMC 3BUWB 2F2OA 1ZFSA 2LUCA 2HQWA 1FPWA 1A4PA 3SJSA 1XK4A 1AP4A 2JQ6A 3SG6A 2K7BA 2SASA 2WOSA 2K7OA 4GGFA 1G8IA 1WRZA 5I8NA 5HKWA 3KEVA 1UURA 1KQMB 2BE4A 4PE0A 4YI9A 1NX1A 4OKHA 2M49B 2BECA 1QS7A 2ZNDA 1WDCC 3AAJA 1FBVA 2JRFA 2KOTA 2JT8A 2L50A 2MA2A 1DJIA 2EC6B 1ZUZA 2K7DA 1JFKA 1MR8A 4PHJA 1TNPA 3KPXA 4M2OA 5AEQA 1IWQA 4ICBA 1OZSA 1F54A 3NSOA 1LINA 3EKHA 1C7VA 3FWCA 4PHKA 3EVRA 4WQ3A 2JPTA 1NX0A 1Q80A 2GGMA 2PRUA 2H61A 3HCMA 3IQOA 3NXAA 3VROA 2AAOA 3WNXB 2JT0A 1DGUA 5PALA 4YGDB 4MBEA 1H4BA 2OS8C 1SRAA 4Q04A 1ODBA 2I2RE 2JXLA 3ZNIA 3TDZA 1W7IB 1PRWA 1XVJA 2I18A 2M29A 2M7LA 1VRKA 2K2AA 3I5IC 1TN4A 3A4UB 1DJHA 1YX8A 2G9BA 1S3PA 1KK7Y 1SW8A 2OTGB 3A8RA 4OV2A 3GK1A 2IS9A 4BY4A 5HLOA 3NSIA 3PATA 1KCYA 3KO0A 3PN7B 2EGDA 1XFYO 2OS8B 1QASA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B7T Z;  1DMO A;  1YTZ C;  2Q91 A;  1BLQ A;  2NLN A;  3D10 A;  4OR9 B;  1REC A;  2LLT A;  4NDD A;  2ZNE A;  1X02 A;  1NX2 A;  1RJV A;  1AJ4 A;  3DD4 A;  5FYX A;  1KK7 Z;  3I5F B;  1DJX A;  3EK4 A;  5I2Q A;  1Y6W A;  1NWD A;  3TDU A;  1S6C A;  4YGA A;  2BL0 B;  1K2H A;  1EG4 A;  1SNL A;  3JTD C;  2M9G A;  1B8C A;  3TS5 C;  1OOJ A;  1B9A A;  3DVM A;  1OMV A;  2L98 A;  4R1E A;  1NCX A;  4MN0 A;  1K93 D;  1WY9 A;  2JWW A;  2BCB A;  1A75 B;  2A4J A;  1S6I A;  2AMI A;  2LLS A;  1GJY A;  1OMR A;  1RRO A;  1YR5 A;  1RK9 A;  2K61 A;  2M8U A;  1GGW A;  3I5I B;  2DOQ A;  3KF9 A;  4DRW A;  1K95 A;  1J7P A;  5HYD A;  1TRF A;  2LP2 A;  3NSL A;  1NSH A;  3I5G B;  1DVI A;  1YVH A;  2K8M B;  2NCP A;  3EVU A;  4YGE B;  4M2Q A;  2CNP A;  3VRP A;  2KYF A;  2O60 A;  3GOF A;  1ALW A;  3LK1 A;  1N0Y A;  2L51 A;  2Y5I A;  1OMD A;  2E6W A;  2KFG A;  3VRR A;  2WCF A;  2PSR A;  1A75 A;  3CTN A;  4MZL A;  3CR4 X;  3VRQ A;  3HX4 A;  2O5G A;  4AQJ A;  5D7F A;  4GUK A;  2MAZ A;  5HKZ A;  2BE6 A;  3TS5 B;  2LCP A;  1QX5 B;  4C0K A;  2OPO A;  1CM4 A;  4I5N B;  1BJF A;  1TTX A;  5ER4 X;  1YUS A;  5I2O A;  1IQ3 A;  1KFU L;  1YUR A;  2GV5 A;  4FTG A;  4MRY A;  4QJ3 B;  1TCO B;  2WCB A;  3BYA A;  3DVE A;  2MBX A;  4CFQ A;  1WLZ A;  1J7R A;  1CFP A;  1CFD A;  1NCY A;  1QIW A;  3LL8 B;  1WRL A;  4CPV A;  1IG5 A;  4MEW A;  1J1D A;  1R2U A;  4GGN A;  1YUU A;  2KAV A;  2HET A;  4ZCU A;  1F71 A;  2WND A;  2BKI B;  3ICB A;  4USL A;  2LMT A;  3NSK A;  1FW4 A;  1XFX O;  2COL B;  2LE9 B;  4DIR A;  1UHN A;  1K9P A;  2FCE A;  5CSN A;  1BT6 A;  1K94 A;  2CBL A;  2H2K A;  5CSI A;  2V53 A;  1PVA A;  1SCV A;  1NX3 A;  2SCP A;  3PM8 A;  5I2L A;  2M3W A;  3OB1 B;  1CMG A;  1QVI Z;  4IL1 A;  1BR4 B;  2KGR A;  2LM5 A;  1S26 D;  2PAL A;  4JPZ B;  4E68 A;  1IQ5 A;  2NCO A;  4U8D A;  1PSR A;  4QJ5 B;  2KBI A;  4AOM A;  1CLB A;  1A2X A;  1S6J A;  4DUQ A;  2JT3 A;  2WC8 A;  3O2P A;  2Y4Q A;  3BUN B;  1J1E A;  1JF2 A;  3O6B A;  1L2O B;  2Q4U A;  1N2D A;  1QXP A;  2LAN A;  1EXR A;  1OE9 B;  4HRH A;  1K9U A;  1SL7 A;  2BCX A;  5JOL A;  3WHU B;  1SBJ A;  3EK7 A;  2KI4 C;  1CDL A;  2KAY A;  1EJ3 A;  5BPJ A;  3OX5 A;  1J7O A;  1SCM C;  1BR1 B;  3CR2 A;  1EH2 A;  2K7C A;  5AFP A;  1IJ6 A;  4AQI A;  1TIZ A;  2HQ8 A;  4L9M A;  1CTR A;  5D69 A;  1HQV A;  1KFX S;  1KK8 B;  1CDP A;  2JTZ A;  2KNE A;  3VGO A;  1CLM A;  3WHT B;  2KHN A;  2LC5 A;  2ZN9 A;  4HSZ A;  1KSM A;  3I5H C;  4WQ2 A;  3RM1 A;  1LXF C;  1Y0V H;  2HPS A;  4YGB B;  5KU1 A;  4ORC B;  1PAL A;  3OX6 A;  3PN7 C;  1S5G Z;  1C07 A;  4OCI A;  1TNQ A;  3F45 A;  4P5O E;  2M97 A;  3E3R A;  2WCE A;  1D1O A;  2NXQ A;  4OVN F;  2WOR A;  4PDZ A;  1BOC A;  1F4Q A;  1QJT A;  2JC2 A;  3SIB A;  2KYC A;  1S36 A;  1OSA A;  1RWY A;  3MSE B;  4TNC A;  2KI4 B;  2KSP A;  5DKQ A;  2LMU A;  4PCW A;  2FCD A;  2MHH A;  1BF5 A;  3SG4 A;  1CDN A;  1DGV A;  1IGV A;  3TZ1 A;  1UHK A;  2MRD A;  4YI8 A;  1FI5 A;  2LVV A;  1BU3 A;  1S1E A;  4A4C A;  1CDM A;  2LLU A;  1GGZ A;  1RTP 1;  2BKH B;  3I5F C;  1C7W A;  3JTD B;  4XYN A;  1IKU A;  1M39 A;  3GK2 A;  1KQV A;  4PE4 A;  1NCZ A;  4CLN A;  1PK0 D;  2M0R A;  1A03 A;  2KQ6 A;  1UHJ A;  2LVI A;  2VRG A;  5ER5 A;  2JZI A;  1CFC A;  1DF0 A;  4WRI A;  4MZJ A;  3BUO B;  4GFT A;  1SY9 A;  4XJK B;  3EVV A;  1W7J B;  1UWO A;  2ZN8 A;  4BY5 A;  3I5H B;  4N1F A;  4PHN A;  2F33 A;  1UP5 A;  1K90 D;  2LHL A;  1XFZ O;  2D8N A;  1WLM A;  2MJW B;  3PLF B;  2Y1M A;  2BCA A;  2OTG C;  1G33 A;  3GK4 X;  1SCM B;  1QX7 A;  1FI6 A;  2LNK A;  3AKA A;  3FIA A;  1F55 A;  1H8B A;  1IJ5 A;  2G2B A;  1PUL A;  2LVK A;  4I5J A;  1J55 A;  3H4S E;  2JUL A;  1YUT A;  4QJ4 B;  1IH0 A;  1DTL A;  2JOJ A;  3JVT B;  1B8L A;  1L2O C;  3D0Y B;  2FJU B;  1QV1 A;  1AHR A;  3CZT X;  3LLE A;  4M2P A;  1M63 B;  1XYD A;  4NDC A;  1KFX L;  2H61 C;  2CCM A;  3O78 A;  3CS1 A;  4JQ0 D;  1QTX A;  3BXK A;  4GBA A;  2PMY A;  2KI6 C;  1UUS A;  2B1U A;  1Y1U A;  2GGZ A;  3C1V A;  3TDI A;  1LKJ A;  1DJW A;  2KQY A;  3AKB A;  3PAL A;  2LHI A;  1YRT B;  1L7Z A;  4A4B A;  2KI6 D;  2FOT A;  2LUX A;  1JSA A;  1SPY A;  1Y1X A;  5CSJ A;  2MLE C;  1CLL A;  1XFV O;  1NUB A;  4PAL A;  1U5I B;  1ZAC A;  2NZ0 A;  1CFF A;  2LV7 A;  3PSR A;  3LCP C;  2KDH A;  2LMV A;  3DF0 A;  4P2Y B;  1TNX A;  1JUO A;  3I5G C;  1XK4 C;  1DJZ A;  2L0P A;  1MWN A;  1DT7 B;  1RFJ A;  1XFW O;  1YX7 A;  4MLW A;  1YVL A;  3BUM B;  2JU0 A;  1QAT A;  1KWO C;  2LVJ A;  1UHI A;  3TUY B;  2KFH A;  1AVS A;  4UPG A;  1SR6 B;  2CTN A;  1E8A A;  1NP8 A;  2E30 A;  1B47 A;  1B8R A;  3BOW B;  5TNC A;  1A29 A;  1MXL C;  3BOW A;  4C0L A;  1K96 A;  2QAC A;  1SMG A;  1DJY A;  1CNP A;  3BQ3 A;  1PSB A;  1SR6 C;  2BL0 C;  5KTY A;  2ZRS A;  3ZWH A;  1KWO B;  5DKR A;  1JF0 A;  1F4O A;  1V1G A;  4ETO A;  2CT9 A;  1XA5 A;  4HRE E;  4MRX A;  1BG1 A;  1JBA A;  1QIV A;  1M46 A;  3JVT C;  2KBM A;  2CXJ A;  2PVB A;  1CB1 A;  3DF0 B;  1NIW A;  4HRG A;  3FS7 A;  3OB2 B;  1ALV A;  5J3X A;  1PVB A;  1OQP A;  1QVI Y;  1U5I A;  3K21 A;  2ISD A;  4MVF A;  2F3Y A;  1XFU O;  1OZO A;  2JNF A;  4FQO A;  1XO5 A;  5K89 A;  5KSZ A;  1JWD A;  2I7A A;  5IBW A;  2PAS A;  1B7T Y;  1MXE A;  1R6P A;  2F2P A;  2K0J A;  2ZKM X;  2L2E A;  5DKN A;  3LK0 A;  1LA3 A;  5GQQ C;  2LP3 A;  2Y1N A;  3SG5 A;  1MQ1 A;  1TNW A;  1YRU B;  3PFV A;  1B1G A;  5G08 A;  3EK8 A;  4ZCV A;  2F3Z A;  2AUC A;  3IF7 A;  4GNK B;  1CKK A;  2KGB C;  4NDB A;  2JTT A;  3BUX B;  1QLK A;  2ZRT A;  3CR5 X;  4GAO A;  1HT9 A;  1TCF A;  3SIA A;  1IRJ A;  4CFR A;  2F8P A;  3SG7 A;  4DCK A;  4ORA B;  3D0Y A;  4N1G A;  1UHH A;  2M7N A;  1DJG A;  1NYA A;  3WXA A;  1QLS A;  1FF1 A;  3RLZ A;  1Y1A A;  1SYM A;  2LAP A;  4YBH B;  3QRX A;  1KFU S;  1QX2 A;  1NPQ A;  2RGI A;  2ZFD A;  3SG3 A;  4GGF C;  4JWQ A;  1J7Q A;  1F70 A;  5HLV A;  4PHM A;  2HF5 A;  5B8I B;  1CMF A;  4F0Z B;  3CWG A;  2EHB A;  1AJ5 A;  5CSF A;  4D1E A;  1JC2 A;  1LA0 A;  5HKY A;  4YGC B;  1ZOT B;  5JJG A;  3OHM B;  2MLF C;  1TOP A;  1BMO A;  1GQM A;  2KAX A;  3O4Y A;  4PE1 A;  5AER A;  1KSO A;  1M31 A;  3SG2 A;  1N65 A;  1S5G Y;  3M0W A;  4I5L B;  1JFJ A;  2QPT A;  4XJK A;  1DF0 B;  3KHE A;  2JXC A;  1ZMZ A;  1B4C A;  1MUX A;  3CLN A;  3VRN A;  1MHO A;  3DVK A;  1BOD A;  1KK8 C;  1M45 A;  1V1F A;  2KFF A;  4C0J A;  1K8U A;  1MF8 B;  1K9K A;  2L4I A;  1SL9 A;  1QV0 A;  4YRU A;  1AUI B;  2BBN A;  5CPV A;  1F8H A;  1EL4 A;  3DVJ A;  4ORB B;  2TN4 A;  2L5X B;  1LVC D;  2M1U A;  1SKT A;  3AAK A;  3IQQ A;  5AAN A;  3OP0 A;  4CID A;  2EC6 C;  2P6B B;  4MSP A;  4MZK A;  2K2F A;  2BBM A;  2R2I A;  3TUY C;  4I5K A;  1SL8 A;  2L4H A;  2M1K B;  5F6T A;  3FWB A;  4DS7 A;  1WDC B;  4NQG A;  4PE7 A;  5AXI A;  4N5X A;  1EG3 A;  1SK6 D;  1WRK A;  3EKJ A;  3CGA A;  1G4Y R;  1CM1 A;  1AK8 A;  4GPL B;  2I94 A;  2JNX A;  1KQM C;  3BUW B;  2F2O A;  1ZFS A;  2LUC A;  2HQW A;  1FPW A;  1A4P A;  3SJS A;  1XK4 A;  1AP4 A;  2JQ6 A;  3SG6 A;  2K7B A;  2SAS A;  2WOS A;  2K7O A;  4GGF A;  1G8I A;  1WRZ A;  5I8N A;  5HKW A;  3KEV A;  1UUR A;  1KQM B;  2BE4 A;  4PE0 A;  4YI9 A;  1NX1 A;  4OKH A;  2M49 B;  2BEC A;  1QS7 A;  2ZND A;  1WDC C;  3AAJ A;  1FBV A;  2JRF A;  2KOT A;  2JT8 A;  2L50 A;  2MA2 A;  1DJI A;  2EC6 B;  1ZUZ A;  2K7D A;  1JFK A;  1MR8 A;  4PHJ A;  1TNP A;  3KPX A;  4M2O A;  5AEQ A;  1IWQ A;  4ICB A;  1OZS A;  1F54 A;  3NSO A;  1LIN A;  3EKH A;  1C7V A;  3FWC A;  4PHK A;  3EVR A;  4WQ3 A;  2JPT A;  1NX0 A;  1Q80 A;  2GGM A;  2PRU A;  2H61 A;  3HCM A;  3IQO A;  3NXA A;  3VRO A;  2AAO A;  3WNX B;  2JT0 A;  1DGU A;  5PAL A;  4YGD B;  4MBE A;  1H4B A;  2OS8 C;  1SRA A;  4Q04 A;  1ODB A;  2I2R E;  2JXL A;  3ZNI A;  3TDZ A;  1W7I B;  1PRW A;  1XVJ A;  2I18 A;  2M29 A;  2M7L A;  1VRK A;  2K2A A;  3I5I C;  1TN4 A;  3A4U B;  1DJH A;  1YX8 A;  2G9B A;  1S3P A;  1KK7 Y;  1SW8 A;  2OTG B;  3A8R A;  4OV2 A;  3GK1 A;  2IS9 A;  4BY4 A;  5HLO A;  3NSI A;  3PAT A;  1KCY A;  3KO0 A;  3PN7 B;  2EGD A;  1XFY O;  2OS8 B;  1QAS A; 
#chains in the Genus database with same CATH topology
 1B7T Z;  1DMO A;  1YTZ C;  2Q91 A;  1BLQ A;  2NLN A;  3D10 A;  4OR9 B;  2KLD A;  1REC A;  2LLT A;  4NDD A;  2ZNE A;  1X02 A;  4JD9 A;  1NX2 A;  1RJV A;  1AJ4 A;  3DD4 A;  5FYX A;  1KK7 Z;  3I5F B;  1DJX A;  3EK4 A;  5I2Q A;  1Y6W A;  1NWD A;  3TDU A;  1S6C A;  4YGA A;  2BL0 B;  1K2H A;  1EG4 A;  1SNL A;  3JTD C;  3FE8 A;  2M9G A;  1B8C A;  3RZS A;  3TS5 C;  1OOJ A;  1B9A A;  3DVM A;  1OMV A;  2L98 A;  2WC6 A;  4R1E A;  1NCX A;  4MN0 A;  1K93 D;  1WY9 A;  2JWW A;  3S0E A;  2BCB A;  1A75 B;  2A4J A;  1S6I A;  2AMI A;  2LLS A;  2P71 A;  1GJY A;  1OMR A;  1RRO A;  1YR5 A;  1RK9 A;  5FI6 A;  2K61 A;  2M8U A;  1GGW A;  3I5I B;  3S0D A;  2DOQ A;  2PYQ A;  3KF9 A;  4DRW A;  1K95 A;  1J7P A;  5HYD A;  3PJI A;  1TRF A;  3BFA A;  1DQE A;  2LP2 A;  3NSL A;  1NSH A;  3I5G B;  1DVI A;  1XFR A;  1YVH A;  2K8M B;  3R1V A;  2NCP A;  3EVU A;  1OOH A;  1DEK A;  2ERB A;  2WCM A;  4YGE B;  4M2Q A;  5EL2 A;  2CNP A;  3VRP A;  2KYF A;  2O60 A;  3GOF A;  1ALW A;  3LK1 A;  1N0Y A;  2L51 A;  2Y5I A;  1OMD A;  2E6W A;  2KFG A;  3VRR A;  2WCF A;  2PSR A;  1A75 A;  3CTN A;  4MZL A;  3CR4 X;  3VRQ A;  1C3Z A;  3HX4 A;  2O5G A;  4AQJ A;  5D7F A;  4GUK A;  2MAZ A;  5HKZ A;  2BE6 A;  3TS5 B;  2LCP A;  1QX5 B;  4C0K A;  2OPO A;  1CM4 A;  4I5N B;  1BJF A;  1TTX A;  5ER4 X;  1YUS A;  5I2O A;  1IQ3 A;  1KFU L;  1YUR A;  2GV5 A;  2QEB A;  4FTG A;  4MRY A;  4QJ3 B;  1TCO B;  2WCB A;  3BYA A;  3DVE A;  3B86 A;  2MBX A;  4CFQ A;  1WLZ A;  1J7R A;  1CFP A;  1CFD A;  1NCY A;  1QIW A;  3LL8 B;  1WRL A;  4CPV A;  1IG5 A;  4MEW A;  1J1D A;  1R2U A;  4GGN A;  1YUU A;  2KAV A;  2HET A;  4ZCU A;  1F71 A;  2WND A;  2BKI B;  3EG5 B;  3ICB A;  4USL A;  2LMT A;  4KYN A;  3NSK A;  1FW4 A;  1XFX O;  2COL B;  2LE9 B;  4DIR A;  1UHN A;  1K9P A;  2FCE A;  5CSN A;  1BT6 A;  1K94 A;  2CBL A;  2H2K A;  3FE6 A;  2V53 A;  5CSI A;  3OBV A;  1PVA A;  1SCV A;  1NX3 A;  2SCP A;  4FQT A;  3PM8 A;  5I2L A;  2M3W A;  3OB1 B;  1CMG A;  3SS3 A;  1QVI Z;  4IL1 A;  1BR4 B;  2KGR A;  2LM5 A;  1S26 D;  2PAL A;  4JPZ B;  4E68 A;  1IQ5 A;  2NCO A;  4U8D A;  4F7F A;  1PSR A;  4QJ5 B;  5I94 A;  3BJH A;  2KBI A;  4AOM A;  1CLB A;  1A2X A;  1S6J A;  4DUQ A;  2JT3 A;  2WC8 A;  3O2P A;  3SS4 A;  2Y4Q A;  3Q8I A;  3BUN B;  1J1E A;  1OOG A;  1JF2 A;  3O6B A;  1L2O B;  3PM2 A;  2Q4U A;  1N2D A;  1QXP A;  1OOF A;  2LAN A;  1EXR A;  1OE9 B;  4HRH A;  1K9U A;  1SL7 A;  2BCX A;  5JOL A;  3WHU B;  3DYE A;  1P28 A;  1SBJ A;  3EK7 A;  2KI4 C;  1CDL A;  3CZ1 A;  2KAY A;  1EJ3 A;  5BPJ A;  3OX5 A;  3OGN A;  1J7O A;  1SCM C;  1BR1 B;  3CR2 A;  3D76 A;  2K7C A;  1EH2 A;  5AFP A;  1IJ6 A;  1OW4 A;  4AQI A;  1TIZ A;  2HQ8 A;  4L9M A;  1TWO A;  3DXL A;  1CTR A;  5D69 A;  1HQV A;  1KFX S;  1KK8 B;  1CDP A;  2JTZ A;  2KNE A;  3VGO A;  1CLM A;  3WHT B;  2KHN A;  2LC5 A;  2ZN9 A;  4HSZ A;  1KSM A;  3I5H C;  4WQ2 A;  3RM1 A;  1C3Y A;  1LXF C;  1Y0V H;  2HPS A;  4YGB B;  5KU1 A;  4ORC B;  2QEV A;  1PAL A;  3OX6 A;  3PN7 C;  1S5G Z;  1C07 A;  4OCI A;  1TNQ A;  3F45 A;  4P5O E;  2M97 A;  3B7A A;  3E3R A;  2WCE A;  1D1O A;  2NXQ A;  4OVN F;  2WOR A;  4PDZ A;  1BOC A;  1F4Q A;  1QJT A;  2JC2 A;  3S0B A;  3SIB A;  2KYC A;  1S36 A;  1OSA A;  1RWY A;  3MSE B;  4TNC A;  2KI4 B;  2KSP A;  4OZD A;  2LMU A;  4PCW A;  5DKQ A;  2FCD A;  2MHH A;  1BF5 A;  3SG4 A;  1CDN A;  3FE9 A;  1DC1 A;  1DGV A;  1IGV A;  3TZ1 A;  1UHK A;  2MRD A;  2K60 A;  2WCK A;  3NHI A;  4YI8 A;  1FI5 A;  2LVV A;  1BU3 A;  1S1E A;  3UNW A;  4A4C A;  1CDM A;  2LLU A;  1GGZ A;  1RTP 1;  2BKH B;  3I5F C;  1C7W A;  3JTD B;  4XYN A;  1IKU A;  1M39 A;  3GK2 A;  1KQV A;  4PE4 A;  1NCZ A;  2BNX A;  4CLN A;  1PK0 D;  2M0R A;  1A03 A;  2KQ6 A;  1UHJ A;  2LVI A;  2VRG A;  5ER5 A;  2JZI A;  1CFC A;  1DF0 A;  4WRI A;  4MZJ A;  2L5Y A;  3BUO B;  4GFT A;  1SY9 A;  4XJK B;  3EVV A;  1W7J B;  1UWO A;  2ZN8 A;  4BY5 A;  1QWV A;  3I5H B;  3D78 A;  3D73 A;  4N1F A;  4PHN A;  2F33 A;  1UP5 A;  1LS8 A;  1K90 D;  2LHL A;  1XFZ O;  2D8N A;  1WLM A;  2MJW B;  3PLF B;  2Y1M A;  2BCA A;  2OTG C;  1G33 A;  3GK4 X;  1SCM B;  1QX7 A;  1FI6 A;  2LNK A;  3AKA A;  3FIA A;  1F55 A;  1H8B A;  1IJ5 A;  2G2B A;  3DZT A;  1PUL A;  2LVK A;  4I5J A;  3L4A A;  1J55 A;  3H4S E;  3V2L A;  2JUL A;  1YUT A;  4QJ4 B;  1IH0 A;  1DEL A;  1DTL A;  3CAB A;  2JOJ A;  3JVT B;  1B8L A;  1L2O C;  3D0Y B;  3SS5 A;  2FJU B;  1QV1 A;  1AHR A;  3CZT X;  3L4L A;  3LLE A;  4M2P A;  1M63 B;  1XYD A;  3QME A;  4NDC A;  1KFX L;  2H61 C;  2CCM A;  2L2C A;  3O78 A;  3CS1 A;  1TUZ A;  4JQ0 D;  1QTX A;  2WCH A;  3BXK A;  2PMY A;  4GBA A;  5DIC A;  2KI6 C;  1UUS A;  2B1U A;  1Y1U A;  2FJY A;  2GGZ A;  3C1V A;  3TDI A;  1LKJ A;  1DJW A;  2KQY A;  3AKB A;  3PAL A;  2LHI A;  3D74 A;  1YRT B;  1L7Z A;  4A4B A;  2KI6 D;  2FOT A;  2LUX A;  1JSA A;  1T14 A;  1SPY A;  1Y1X A;  3B87 A;  3D77 A;  2MLE C;  1CLL A;  3NGV A;  4INW A;  1XFV O;  1NUB A;  5CSJ A;  1GM0 A;  2WC5 A;  4PAL A;  1U5I B;  1ZAC A;  2NZ0 A;  1CFF A;  2LV7 A;  3PSR A;  3LCP C;  2KDH A;  2LMV A;  3DF0 A;  4P2Y B;  1TNX A;  1JUO A;  3I5G C;  1XK4 C;  1DJZ A;  2L0P A;  3R1O A;  1MWN A;  2KPH A;  1DT7 B;  1RFJ A;  1XFW O;  1YX7 A;  4MLW A;  1YVL A;  3BUM B;  2JU0 A;  1QAT A;  1KWO C;  2LVJ A;  1UHI A;  3TUY B;  2KFH A;  1AVS A;  4UPG A;  1SR6 B;  2CTN A;  1E8A A;  1NP8 A;  2E30 A;  1B47 A;  1B8R A;  3BOW B;  3CZ2 A;  5TNC A;  1A29 A;  1MXL C;  3B88 A;  2YGU A;  2WCJ A;  5FI7 A;  3BOW A;  4C0L A;  1K96 A;  2QAC A;  1SMG A;  3S0G A;  3S0F A;  1DJY A;  1CNP A;  3BQ3 A;  1PSB A;  1SR6 C;  1SSE B;  2BL0 C;  5KTY A;  4PT1 A;  2ZRS A;  3ZWH A;  3S0A A;  1KWO B;  5DKR A;  1JF0 A;  1F4O A;  1V1G A;  4ETO A;  2CT9 A;  1XA5 A;  4HRE E;  4MRX A;  2QEH A;  1BG1 A;  1JBA A;  1QIV A;  1M46 A;  3JVT C;  2KBM A;  2CXJ A;  2PVB A;  2QEO A;  1CB1 A;  3DF0 B;  1NIW A;  4HRG A;  2BAP A;  3FS7 A;  3OB2 B;  1ALV A;  5J3X A;  1PVB A;  1OQP A;  1QVI Y;  1U5I A;  3K21 A;  2ISD A;  4MVF A;  2F3Y A;  1W9Z A;  1OZO A;  1XFU O;  2JNF A;  1XO5 A;  4FQO A;  5K89 A;  5KSZ A;  1JWD A;  2I7A A;  5IBW A;  2PAS A;  1B7T Y;  1MXE A;  1Z4H A;  1R6P A;  2F2P A;  2K0J A;  2ZKM X;  2L2E A;  5DKN A;  3LK0 A;  1LA3 A;  5GQQ C;  2LP3 A;  2Y1N A;  3SG5 A;  1MQ1 A;  1TNW A;  3O4X A;  1YRU B;  4JKT A;  3PFV A;  1B1G A;  2QDI A;  5G08 A;  3EK8 A;  4ZCV A;  2F3Z A;  2AUC A;  3CYZ A;  3IF7 A;  4GNK B;  1CKK A;  2KGB C;  4NDB A;  3VB1 A;  2JTT A;  3BUX B;  1QLK A;  2ZRT A;  3CR5 X;  4GAO A;  1HT9 A;  1TCF A;  1TUJ A;  1IRJ A;  3R1P A;  3SIA A;  2F8P A;  3SG7 A;  4CFR A;  4DCK A;  4ORA B;  3D0Y A;  4N1G A;  1UHH A;  2M7N A;  1DJG A;  1NYA A;  3WXA A;  1QLS A;  1FF1 A;  3RLZ A;  1Y1A A;  3R72 A;  1SYM A;  2LAP A;  4YBH B;  3QRX A;  1KFU S;  1QX2 A;  1NPQ A;  2RGI A;  2ZFD A;  3NHT A;  3SG3 A;  4GGF C;  4JWQ A;  5HL1 A;  1J7Q A;  1F70 A;  5HLV A;  3CDN A;  4PHM A;  2HF5 A;  5B8I B;  1CMF A;  4F0Z B;  3CWG A;  2EHB A;  1AJ5 A;  5CSF A;  4D1E A;  1JC2 A;  1LA0 A;  5HKY A;  4YGC B;  1ZOT B;  5JJG A;  3OHM B;  2MLF C;  1TOP A;  1BMO A;  1GQM A;  2KAX A;  3O4Y A;  4PE1 A;  5AER A;  1KSO A;  1M31 A;  3SG2 A;  1N65 A;  1S5G Y;  3M0W A;  4I5L B;  1JFJ A;  2QPT A;  4XJK A;  2H8V A;  1DF0 B;  3KHE A;  2JXC A;  1ZMZ A;  1B4C A;  1MUX A;  3CLN A;  3VRN A;  1MHO A;  3DVK A;  1BOD A;  1KK8 C;  3K1E A;  1M45 A;  5D3O A;  1V1F A;  2KFF A;  4C0J A;  1K8U A;  1MF8 B;  1K9K A;  2L4I A;  1SL9 A;  1QV0 A;  4YRU A;  1AUI B;  2BBN A;  5CPV A;  1F8H A;  1IIO A;  1EL4 A;  3DVJ A;  4ORB B;  2TN4 A;  2L5X B;  1LVC D;  2M1U A;  1SKT A;  3AAK A;  3IQQ A;  5AAN A;  3OP0 A;  4CID A;  2EC6 C;  2P6B B;  4MSP A;  4MZK A;  2K2F A;  2BBM A;  2R2I A;  3TUY C;  4I5K A;  1SL8 A;  2L4H A;  1OOI X;  2M1K B;  3FWB A;  5F6T A;  1WDC B;  4NQG A;  4PE7 A;  5AXI A;  4DS7 A;  4N5X A;  1EG3 A;  1SK6 D;  1WRK A;  3EKJ A;  3D75 A;  3CGA A;  1G4Y R;  1CM1 A;  1AK8 A;  4GPL B;  2I94 A;  2JNX A;  1KQM C;  3BUW B;  2F2O A;  1ZFS A;  2LUC A;  1Z2C B;  2HQW A;  1FPW A;  1A4P A;  3SJS A;  1XK4 A;  1AP4 A;  2JQ6 A;  3IVT A;  4IJ7 A;  3SG6 A;  2K7B A;  2SAS A;  3UO9 A;  2WOS A;  2K7O A;  4GGF A;  3DY9 A;  1G8I A;  1WRZ A;  2PQL A;  4INX A;  3KEV A;  1UUR A;  1KQM B;  2BE4 A;  5HKW A;  5I8N A;  4PE0 A;  4YI9 A;  1NX1 A;  4OKH A;  1ORG A;  2M49 B;  2BEC A;  1QS7 A;  3N7H A;  2ZND A;  1WDC C;  3AAJ A;  3L47 A;  1FBV A;  2JRF A;  2KOT A;  2JT8 A;  2L50 A;  2MA2 A;  1DJI A;  2EC6 B;  1ZUZ A;  2JPO A;  2K7D A;  1JFK A;  1MR8 A;  4PHJ A;  1TNP A;  3KPX A;  4M2O A;  5AEQ A;  1IWQ A;  3BFH A;  4ICB A;  1OZS A;  1F54 A;  3NSO A;  1LIN A;  3EKH A;  1C7V A;  3FWC A;  4PHK A;  3EVR A;  3B6X A;  4WQ3 A;  3BFB A;  2JPT A;  1NX0 A;  1Q80 A;  2GGM A;  2PRU A;  2H61 A;  3HCM A;  3IQO A;  3NXA A;  3VRO A;  2AAO A;  3WNX B;  2JT0 A;  1DGU A;  5PAL A;  4YGD B;  4MBE A;  5FI2 A;  2OS8 C;  1H4B A;  1SRA A;  2GTE A;  1ODB A;  4Q04 A;  2I2R E;  2JXL A;  3ZNI A;  3TDZ A;  1W7I B;  1PRW A;  1XVJ A;  2I18 A;  2M29 A;  2M7L A;  1VRK A;  2K2A A;  3I5I C;  1TN4 A;  3A4U B;  1DJH A;  1YX8 A;  2WCL A;  2G9B A;  1S3P A;  1KK7 Y;  1SW8 A;  2OTG B;  3A8R A;  4OV2 A;  3GK1 A;  2IS9 A;  2P70 A;  5HLO A;  4BY4 A;  3NSI A;  3PAT A;  1KCY A;  3KO0 A;  3PN7 B;  3CZ0 A;  2EGD A;  1XFY O;  2KLE A;  2OS8 B;  1QAS A; 
#chains in the Genus database with same CATH homology
 1B7T Z;  1DMO A;  1YTZ C;  2Q91 A;  1BLQ A;  2NLN A;  3D10 A;  4OR9 B;  1REC A;  2LLT A;  4NDD A;  2ZNE A;  1X02 A;  1NX2 A;  1RJV A;  1AJ4 A;  3DD4 A;  5FYX A;  1KK7 Z;  3I5F B;  1DJX A;  3EK4 A;  5I2Q A;  1Y6W A;  1NWD A;  3TDU A;  1S6C A;  4YGA A;  2BL0 B;  1K2H A;  1EG4 A;  1SNL A;  3JTD C;  2M9G A;  1B8C A;  3TS5 C;  1OOJ A;  1B9A A;  3DVM A;  1OMV A;  2L98 A;  4R1E A;  1NCX A;  4MN0 A;  1K93 D;  1WY9 A;  2JWW A;  2BCB A;  1A75 B;  2A4J A;  1S6I A;  2AMI A;  2LLS A;  1GJY A;  1OMR A;  1RRO A;  1YR5 A;  1RK9 A;  2K61 A;  2M8U A;  1GGW A;  3I5I B;  2DOQ A;  3KF9 A;  4DRW A;  1K95 A;  1J7P A;  5HYD A;  1TRF A;  2LP2 A;  3NSL A;  1NSH A;  3I5G B;  1DVI A;  1YVH A;  2K8M B;  2NCP A;  3EVU A;  4YGE B;  4M2Q A;  2CNP A;  3VRP A;  2KYF A;  2O60 A;  3GOF A;  1ALW A;  3LK1 A;  1N0Y A;  2L51 A;  2Y5I A;  1OMD A;  2E6W A;  2KFG A;  3VRR A;  2WCF A;  2PSR A;  1A75 A;  3CTN A;  4MZL A;  3CR4 X;  3VRQ A;  3HX4 A;  2O5G A;  4AQJ A;  5D7F A;  4GUK A;  2MAZ A;  5HKZ A;  2BE6 A;  3TS5 B;  2LCP A;  1QX5 B;  4C0K A;  2OPO A;  1CM4 A;  4I5N B;  1BJF A;  1TTX A;  5ER4 X;  1YUS A;  5I2O A;  1IQ3 A;  1KFU L;  1YUR A;  2GV5 A;  4FTG A;  4MRY A;  4QJ3 B;  1TCO B;  2WCB A;  3BYA A;  3DVE A;  2MBX A;  4CFQ A;  1WLZ A;  1J7R A;  1CFP A;  1CFD A;  1NCY A;  1QIW A;  3LL8 B;  1WRL A;  4CPV A;  1IG5 A;  4MEW A;  1J1D A;  1R2U A;  4GGN A;  1YUU A;  2KAV A;  2HET A;  4ZCU A;  1F71 A;  2WND A;  2BKI B;  3ICB A;  4USL A;  2LMT A;  3NSK A;  1FW4 A;  1XFX O;  2COL B;  2LE9 B;  4DIR A;  1UHN A;  1K9P A;  2FCE A;  5CSN A;  1BT6 A;  1K94 A;  2CBL A;  2H2K A;  5CSI A;  2V53 A;  1PVA A;  1SCV A;  1NX3 A;  2SCP A;  3PM8 A;  5I2L A;  2M3W A;  3OB1 B;  1CMG A;  1QVI Z;  4IL1 A;  1BR4 B;  2KGR A;  2LM5 A;  1S26 D;  2PAL A;  4JPZ B;  4E68 A;  1IQ5 A;  2NCO A;  4U8D A;  1PSR A;  4QJ5 B;  2KBI A;  4AOM A;  1CLB A;  1A2X A;  1S6J A;  4DUQ A;  2JT3 A;  2WC8 A;  3O2P A;  2Y4Q A;  3BUN B;  1J1E A;  1JF2 A;  3O6B A;  1L2O B;  2Q4U A;  1N2D A;  1QXP A;  2LAN A;  1EXR A;  1OE9 B;  4HRH A;  1K9U A;  1SL7 A;  2BCX A;  5JOL A;  3WHU B;  1SBJ A;  3EK7 A;  2KI4 C;  1CDL A;  2KAY A;  1EJ3 A;  5BPJ A;  3OX5 A;  1J7O A;  1SCM C;  1BR1 B;  3CR2 A;  1EH2 A;  2K7C A;  5AFP A;  1IJ6 A;  4AQI A;  1TIZ A;  2HQ8 A;  4L9M A;  1CTR A;  5D69 A;  1HQV A;  1KFX S;  1KK8 B;  1CDP A;  2JTZ A;  2KNE A;  3VGO A;  1CLM A;  3WHT B;  2KHN A;  2LC5 A;  2ZN9 A;  4HSZ A;  1KSM A;  3I5H C;  4WQ2 A;  3RM1 A;  1LXF C;  1Y0V H;  2HPS A;  4YGB B;  5KU1 A;  4ORC B;  1PAL A;  3OX6 A;  3PN7 C;  1S5G Z;  1C07 A;  4OCI A;  1TNQ A;  3F45 A;  4P5O E;  2M97 A;  3E3R A;  2WCE A;  1D1O A;  2NXQ A;  4OVN F;  2WOR A;  4PDZ A;  1BOC A;  1F4Q A;  1QJT A;  2JC2 A;  3SIB A;  2KYC A;  1S36 A;  1OSA A;  1RWY A;  3MSE B;  4TNC A;  2KI4 B;  2KSP A;  5DKQ A;  2LMU A;  4PCW A;  2FCD A;  2MHH A;  1BF5 A;  3SG4 A;  1CDN A;  1DGV A;  1IGV A;  3TZ1 A;  1UHK A;  2MRD A;  4YI8 A;  1FI5 A;  2LVV A;  1BU3 A;  1S1E A;  4A4C A;  1CDM A;  2LLU A;  1GGZ A;  1RTP 1;  2BKH B;  3I5F C;  1C7W A;  3JTD B;  4XYN A;  1IKU A;  1M39 A;  3GK2 A;  1KQV A;  4PE4 A;  1NCZ A;  4CLN A;  1PK0 D;  2M0R A;  1A03 A;  2KQ6 A;  1UHJ A;  2LVI A;  2VRG A;  5ER5 A;  2JZI A;  1CFC A;  1DF0 A;  4WRI A;  4MZJ A;  3BUO B;  4GFT A;  1SY9 A;  4XJK B;  3EVV A;  1W7J B;  1UWO A;  2ZN8 A;  4BY5 A;  3I5H B;  4N1F A;  4PHN A;  2F33 A;  1UP5 A;  1K90 D;  2LHL A;  1XFZ O;  2D8N A;  1WLM A;  2MJW B;  3PLF B;  2Y1M A;  2BCA A;  2OTG C;  1G33 A;  3GK4 X;  1SCM B;  1QX7 A;  1FI6 A;  2LNK A;  3AKA A;  3FIA A;  1F55 A;  1H8B A;  1IJ5 A;  2G2B A;  1PUL A;  2LVK A;  4I5J A;  1J55 A;  3H4S E;  2JUL A;  1YUT A;  4QJ4 B;  1IH0 A;  1DTL A;  2JOJ A;  3JVT B;  1B8L A;  1L2O C;  3D0Y B;  2FJU B;  1QV1 A;  1AHR A;  3CZT X;  3LLE A;  4M2P A;  1M63 B;  1XYD A;  4NDC A;  1KFX L;  2H61 C;  2CCM A;  3O78 A;  3CS1 A;  4JQ0 D;  1QTX A;  3BXK A;  4GBA A;  2PMY A;  2KI6 C;  1UUS A;  2B1U A;  1Y1U A;  2GGZ A;  3C1V A;  3TDI A;  1LKJ A;  1DJW A;  2KQY A;  3AKB A;  3PAL A;  2LHI A;  1YRT B;  1L7Z A;  4A4B A;  2KI6 D;  2FOT A;  2LUX A;  1JSA A;  1SPY A;  1Y1X A;  5CSJ A;  2MLE C;  1CLL A;  1XFV O;  1NUB A;  4PAL A;  1U5I B;  1ZAC A;  2NZ0 A;  1CFF A;  2LV7 A;  3PSR A;  3LCP C;  2KDH A;  2LMV A;  3DF0 A;  4P2Y B;  1TNX A;  1JUO A;  3I5G C;  1XK4 C;  1DJZ A;  2L0P A;  1MWN A;  1DT7 B;  1RFJ A;  1XFW O;  1YX7 A;  4MLW A;  1YVL A;  3BUM B;  2JU0 A;  1QAT A;  1KWO C;  2LVJ A;  1UHI A;  3TUY B;  2KFH A;  1AVS A;  4UPG A;  1SR6 B;  2CTN A;  1E8A A;  1NP8 A;  2E30 A;  1B47 A;  1B8R A;  3BOW B;  5TNC A;  1A29 A;  1MXL C;  3BOW A;  4C0L A;  1K96 A;  2QAC A;  1SMG A;  1DJY A;  1CNP A;  3BQ3 A;  1PSB A;  1SR6 C;  2BL0 C;  5KTY A;  2ZRS A;  3ZWH A;  1KWO B;  5DKR A;  1JF0 A;  1F4O A;  1V1G A;  4ETO A;  2CT9 A;  1XA5 A;  4HRE E;  4MRX A;  1BG1 A;  1JBA A;  1QIV A;  1M46 A;  3JVT C;  2KBM A;  2CXJ A;  2PVB A;  1CB1 A;  3DF0 B;  1NIW A;  4HRG A;  3FS7 A;  3OB2 B;  1ALV A;  5J3X A;  1PVB A;  1OQP A;  1QVI Y;  1U5I A;  3K21 A;  2ISD A;  4MVF A;  2F3Y A;  1XFU O;  1OZO A;  2JNF A;  4FQO A;  1XO5 A;  5K89 A;  5KSZ A;  1JWD A;  2I7A A;  5IBW A;  2PAS A;  1B7T Y;  1MXE A;  1R6P A;  2F2P A;  2K0J A;  2ZKM X;  2L2E A;  5DKN A;  3LK0 A;  1LA3 A;  5GQQ C;  2LP3 A;  2Y1N A;  3SG5 A;  1MQ1 A;  1TNW A;  1YRU B;  3PFV A;  1B1G A;  5G08 A;  3EK8 A;  4ZCV A;  2F3Z A;  2AUC A;  3IF7 A;  4GNK B;  1CKK A;  2KGB C;  4NDB A;  2JTT A;  3BUX B;  1QLK A;  2ZRT A;  3CR5 X;  4GAO A;  1HT9 A;  1TCF A;  3SIA A;  1IRJ A;  4CFR A;  2F8P A;  3SG7 A;  4DCK A;  4ORA B;  3D0Y A;  4N1G A;  1UHH A;  2M7N A;  1DJG A;  1NYA A;  3WXA A;  1QLS A;  1FF1 A;  3RLZ A;  1Y1A A;  1SYM A;  2LAP A;  4YBH B;  3QRX A;  1KFU S;  1QX2 A;  1NPQ A;  2RGI A;  2ZFD A;  3SG3 A;  4GGF C;  4JWQ A;  1J7Q A;  1F70 A;  5HLV A;  4PHM A;  2HF5 A;  5B8I B;  1CMF A;  4F0Z B;  3CWG A;  2EHB A;  1AJ5 A;  5CSF A;  4D1E A;  1JC2 A;  1LA0 A;  5HKY A;  4YGC B;  1ZOT B;  5JJG A;  3OHM B;  2MLF C;  1TOP A;  1BMO A;  1GQM A;  2KAX A;  3O4Y A;  4PE1 A;  5AER A;  1KSO A;  1M31 A;  3SG2 A;  1N65 A;  1S5G Y;  3M0W A;  4I5L B;  1JFJ A;  2QPT A;  4XJK A;  1DF0 B;  3KHE A;  2JXC A;  1ZMZ A;  1B4C A;  1MUX A;  3CLN A;  3VRN A;  1MHO A;  3DVK A;  1BOD A;  1KK8 C;  1M45 A;  1V1F A;  2KFF A;  4C0J A;  1K8U A;  1MF8 B;  1K9K A;  2L4I A;  1SL9 A;  1QV0 A;  4YRU A;  1AUI B;  2BBN A;  5CPV A;  1F8H A;  1EL4 A;  3DVJ A;  4ORB B;  2TN4 A;  2L5X B;  1LVC D;  2M1U A;  1SKT A;  3AAK A;  3IQQ A;  5AAN A;  3OP0 A;  4CID A;  2EC6 C;  2P6B B;  4MSP A;  4MZK A;  2K2F A;  2BBM A;  2R2I A;  3TUY C;  4I5K A;  1SL8 A;  2L4H A;  2M1K B;  5F6T A;  3FWB A;  4DS7 A;  1WDC B;  4NQG A;  4PE7 A;  5AXI A;  4N5X A;  1EG3 A;  1SK6 D;  1WRK A;  3EKJ A;  3CGA A;  1G4Y R;  1CM1 A;  1AK8 A;  4GPL B;  2I94 A;  2JNX A;  1KQM C;  3BUW B;  2F2O A;  1ZFS A;  2LUC A;  2HQW A;  1FPW A;  1A4P A;  3SJS A;  1XK4 A;  1AP4 A;  2JQ6 A;  3SG6 A;  2K7B A;  2SAS A;  2WOS A;  2K7O A;  4GGF A;  1G8I A;  1WRZ A;  5I8N A;  5HKW A;  3KEV A;  1UUR A;  1KQM B;  2BE4 A;  4PE0 A;  4YI9 A;  1NX1 A;  4OKH A;  2M49 B;  2BEC A;  1QS7 A;  2ZND A;  1WDC C;  3AAJ A;  1FBV A;  2JRF A;  2KOT A;  2JT8 A;  2L50 A;  2MA2 A;  1DJI A;  2EC6 B;  1ZUZ A;  2K7D A;  1JFK A;  1MR8 A;  4PHJ A;  1TNP A;  3KPX A;  4M2O A;  5AEQ A;  1IWQ A;  4ICB A;  1OZS A;  1F54 A;  3NSO A;  1LIN A;  3EKH A;  1C7V A;  3FWC A;  4PHK A;  3EVR A;  4WQ3 A;  2JPT A;  1NX0 A;  1Q80 A;  2GGM A;  2PRU A;  2H61 A;  3HCM A;  3IQO A;  3NXA A;  3VRO A;  2AAO A;  3WNX B;  2JT0 A;  1DGU A;  5PAL A;  4YGD B;  4MBE A;  1H4B A;  2OS8 C;  1SRA A;  4Q04 A;  1ODB A;  2I2R E;  2JXL A;  3ZNI A;  3TDZ A;  1W7I B;  1PRW A;  1XVJ A;  2I18 A;  2M29 A;  2M7L A;  1VRK A;  2K2A A;  3I5I C;  1TN4 A;  3A4U B;  1DJH A;  1YX8 A;  2G9B A;  1S3P A;  1KK7 Y;  1SW8 A;  2OTG B;  3A8R A;  4OV2 A;  3GK1 A;  2IS9 A;  4BY4 A;  5HLO A;  3NSI A;  3PAT A;  1KCY A;  3KO0 A;  3PN7 B;  2EGD A;  1XFY O;  2OS8 B;  1QAS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...