3LK1A

X-ray structure of bovine sc0322,ca(2+)-s100b
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
88
structure length
88
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title In vitro screening and structural characterization of inhibitors of the S100B-p53 interaction.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 30
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2010-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3lk1A00
2A4JA 2MRDA 1JF0A 1CLMA 2MBXA 3BYAA 1YX7A 5I2OA 1KSMA 4C0JA 4HSZA 4GFTA 1KFXS 4ORAB 1TIZA 4ETOA 4BY4A 4E68A 2AAOA 2AMIA 1MR8A 1MXLC 2QACA 5JOLA 1N0YA 1K9KA 1GGZA 2KFGA 1HT9A 2I94A 2LUCA 2JXLA 1DJXA 2Y1MA 3DVMA 1J7RA 1CMFA 2TN4A 1KSOA 1ZMZA 2SASA 2M1UA 3DVKA 3I5IC 3BOWB 4XJKB 5G08A 2Y4QA 5FYXA 2CXJA 3SG4A 2WC8A 1C7VA 1KQMB 2L98A 2BECA 3GK1A 4F0ZB 2RGIA 1XA5A 1HQVA 2CTNA 2Y5IA 4ORBB 3CWGA 1WRKA 1PK0D 3PM8A 2LNKA 2KFHA 4PE1A 1KQVA 4OVNF 2BBNA 4YGEB 1JFKA 1DJWA 1K96A 4CIDA 1FI5A 1NSHA 1DF0A 3ZNIA 4GAOA 5CSNA 1ZACA 4MSPA 4GGNA 2JWWA 2K61A 2H2KA 4U8DA 1ALVA 2K7OA 1DJIA 1L7ZA 2K7DA 1YRTB 2PMYA 1BR4B 2WCFA 4DRWA 1KFUS 2H61C 1YUTA 1QIWA 3O2PA 1QVIZ 2EGDA 1S26D 2BKHB 2F8PA 1XVJA 2M0RA 1SBJA 3FWCA 3TS5B 3C1VA 3EKJA 1BG1A 1JC2A 3BQ3A 2BBMA 5K89A 2ZRTA 1TOPA 4HRHA 1A75A 1SCVA 3BXKA 2KBIA 2CCMA 2R2IA 4PHKA 4YI9A 4USLA 2OTGC 2ZFDA 2K8MB 3DVJA 4GGFA 3WHUB 2F3ZA 5TNCA 3LL8B 1YTZC 3SG6A 4C0KA 5HLOA 2JXCA 2M97A 4MLWA 1AHRA 3EK8A 1CTRA 3H4SE 3CGAA 1QASA 1S3PA 1QATA 5CSFA 2KAVA 2GGMA 1IG5A 4DUQA 2KGRA 1CLLA 1RFJA 1BLQA 1PULA 2KHNA 1BR1B 4MRYA 2M49B 1DJZA 2FCDA 2M29A 2MLFC 4CPVA 3BUOB 4DIRA 5HYDA 1S5GY 1F70A 1NX0A 2QPTA 1EJ3A 1SR6B 1TCFA 1XFWO 4NQGA 1V1FA 2ZRSA 2M7NA 4CFRA 1A03A 1NX1A 1NYAA 1AJ4A 1TNQA 1YVLA 4MZLA 3F45A 1YRUB 2KAXA 3BUMB 4WQ2A 1XFUO 1YVHA 2KNEA 2LVVA 1NCYA 1XFZO 1SR6C 4HREE 1L2OC 1M31A 2M1KB 1Y1XA 1PALA 4DS7A 3RLZA 3OX5A 1ALWA 3SJSA 1JSAA 2JTZA 1F4QA 1SY9A 3HX4A 1QV1A 4GPLB 4GBAA 1CDLA 2JNXA 3SG5A 2JNFA 2JULA 5AEQA 2BE4A 1LINA 2LMVA 5DKRA 1M39A 1AJ5A 4PHNA 3EK4A 5B8IB 1PVAA 1FBVA 1AP4A 3DVEA 2KGBC 3LLEA 4XYNA 1YR5A 1B9AA 3I5HC 3JTDC 3NSIA 1Y6WA 2K2FA 1EG4A 4ICBA 4MZJA 1CB1A 2JT0A 4YGCB 1QTXA 5I2QA 1DVIA 1MWNA 2BCAA 3TUYB 2EHBA 2E30A 4MBEA 2LLUA 1OMVA 1UWOA 4WQ3A 2HPSA 1WRLA 1XO5A 3K21A 1CLBA 1C7WA 4MRXA 1W7IB 2HF5A 2H61A 2LVIA 1NCXA 2KOTA 3BUXB 1PSBA 2LMUA 3AAJA 3WXAA 2HQ8A 1QLKA 3CLNA 4P5OE 3TUYC 1XFYO 3I5IB 1RWYA 4I5KA 1CFFA 2K2AA 5AANA 2JT8A 1ZFSA 1WDCC 1EH2A 2JTTA 3CR5X 3FS7A 2LHLA 1QX2A 4QJ5B 1MHOA 4QJ4B 2P6BB 3OX6A 1ODBA 4CLNA 3O6BA 1CFCA 2O5GA 1BU3A 2LC5A 1LKJA 1W7JB 2AUCA 1YX8A 4HRGA 4NDBA 2LHIA 1UHHA 3CR2A 1GQMA 4OKHA 1XFXO 2KSPA 2PALA 1BT6A 2MAZA 1IGVA 1SL9A 3CTNA 4QJ3B 3NSLA 5AFPA 3EKHA 1KK8C 1IH0A 2KAYA 1ZUZA 1QX7A 2NCPA 2K0JA 1SW8A 4MN0A 4N1FA 3ZWHA 1BMOA 2BCXA 1PVBA 1LVCD 4GNKB 1S5GZ 5HKWA 3SG3A 3LK0A 4PALA 3PSRA 2F33A 2LE9B 3EVUA 5KTYA 4AOMA 1XYDA 2OTGB 1EXRA 4MVFA 1BJFA 2Q4UA 2CBLA 2OPOA 1K9UA 1K95A 1Q80A 3D0YA 1SYMA 2F2PA 2JZIA 4YGBB 2PRUA 1QXPA 1YUSA 2VRGA 1J1DA 5HLVA 1G8IA 1SL7A 1J7QA 1B47A 3IF7A 3KO0A 1K9PA 3GK4X 1KK7Z 1G4YR 1IRJA 2LV7A 1TTXA 1NCZA 4BY5A 3HCMA 2LUXA 1OSAA 1JFJA 3JVTC 1F4OA 2NXQA 3OB1B 4YI8A 2HETA 4YGDB 5CPVA 3VRPA 1EL4A 1G33A 3SG2A 1OZSA 4FQOA 2M7LA 2I7AA 2NLNA 4AQJA 4I5NB 1TN4A 4JPZB 3IQOA 1SL8A 1PSRA 3FIAA 3I5GC 1MQ1A 1H4BA 1L2OB 3CS1A 4PDZA 1K2HA 1SPYA 2Y1NA 2BKIB 4M2QA 1FF1A 4C0LA 4JQ0D 1U5IB 1UP5A 4M2OA 3D0YB 2M8UA 4CFQA 1IKUA 2NZ0A 4MEWA 1CDMA 2KI6C 3MSEB 1ZOTB 3TDIA 1DMOA 2LP3A 1CDNA 2KBMA 1B4CA 1AUIB 2MJWB 1NWDA 1H8BA 1RK9A 4PE0A 1QX5B 1DGVA 3I5HB 3JTDB 1CM1A 4R1EA 1M45A 1BF5A 2LP2A 3DF0B 1Y0VH 3AKAA 3PN7B 1KK7Y 3ICBA 3IQQA 1QJTA 1XFVO 2WCEA 2KI6D 1AK8A 1B8LA 4A4BA 3AAKA 1S6IA 5D69A 1LA3A 2LCPA 2ZN8A 4JWQA 1XK4C 3RM1A 3SG7A 1KCYA 3PN7C 1LXFC 4I5LB 4GUKA 1TNPA 1A2XA 3EVRA 4PE7A 1DGUA 1R2UA 3PFVA 4GGFC 2L51A 5BPJA 1UHKA 3O4YA 4N5XA 2L4HA 1WDCB 3M0WA 3NSKA 1CFPA 5I2LA 1IJ6A 4WRIA 1DTLA 3BUNB 2JRFA 1UUSA 3GOFA 2DOQA 2L0PA 2GV5A 3PALA 1QLSA 2B1UA 2L4IA 4OCIA 1F8HA 3PATA 5ER5A 1TNWA 2OS8B 4PE4A 3TDZA 2EC6C 1J7OA 1B7TZ 1DT7B 1M63B 2KQYA 2PSRA 1NX3A 2I2RE 2ZNDA 3OP0A 1MUXA 3OHMB 2K7CA 2WOSA 3NXAA 1R6PA 1Y1AA 4D1EA 1SNLA 1JBAA 1KK8B 5PALA 1KWOC 1JWDA 2OS8C 1SCMB 3LCPC 3I5FC 3DD4A 4N1GA 1TCOB 4MZKA 1S36A 1K93D 4ZCVA 5D7FA 1BOCA 1A29A 1CKKA 1OMRA 3VGOA 1NUBA 1S1EA 4P2YB 4Q04A 2L50A 3EVVA 1K94A 1DJGA 3O78A 3SIAA 4YBHB 2ZKMX 5CSJA 2KDHA 1YUUA 5IBWA 1IJ5A 1IQ5A 1SCMC 2LLSA 2M9GA 3D10A 3OB2B 5ER4X 5AXIA 4NDCA 1F71A 3KHEA 1Y1UA 1IQ3A 2G9BA 3NSOA 1J7PA 1A4PA 1KFXL 1QS7A 1DJYA 2BCBA 1PRWA 1B1GA 1CMGA 1UHNA 1CNPA 1FW4A 4I5JA 2PVBA 2I18A 3EK7A 1CFDA 4OR9B 2FJUB 3A8RA 2LLTA 2LVKA 1KQMC 1VRKA 4L9MA 4ORCB 3FWBA 1F55A 1WLMA 1U5IA 2KFFA 5HKYA 3LK1A 2Q91A 3KEVA 1B7TY 3CZTX 2MLEC 3QRXA 2JOJA 1E8AA 1N65A 3JVTB 1LA0A 2LVJA 1UHIA 3KPXA 2D8NA 2MA2A 4YGAA 1OQPA 2K7BA 1CDPA 2LMTA 1F54A 2L2EA 5I8NA 2L5XB 4OV2A 1N2DA 1RROA 5CSIA 1WLZA 4DCKA 2BL0B 1D1OA 1DJHA 2IS9A 5DKNA 1JF2A 3I5GB 2GGZA 3DF0A 1SK6D 1XK4A 5HKZA 1RTP1 2LAPA 3E3RA 1EG3A 1CM4A 5J3XA 2CT9A 1J1EA 2COLB 3GK2A 5DKQA 1WRZA 1C07A 2JC2A 2BL0C 1KFUL 1M46A 4PCWA 3TS5C 1S6CA 3SIBA 3PLFB 5KU1A 1DF0B 4M2PA 2ISDA 1K90D 1AVSA 2KQ6A 1UHJA 2V53A 2BE6A 1RJVA 1J55A 2LANA 2O60A 2NCOA 1RECA 1FI6A 3WHTB 1IWQA 1UURA 2F3YA 3CR4X 1MXEA 1SMGA 2E6WA 1OZOA 4FTGA 2JPTA 2M3WA 2KI4B 1NIWA 1QVIY 2SCPA 2LM5A 1X02A 1A75B 3VROA 1K8UA 2JQ6A 2G2BA 4NDDA 1OMDA 2HQWA 2WCBA 1NPQA 1BODA 2PASA 1S6JA 4PHMA 1FPWA 1B8RA 3VRQA 3TDUA 1TNXA 2KI4C 5AERA 4ZCUA 2F2OA 3TZ1A 4A4CA 3AKBA 4TNCA 2JT3A 2CNPA 3KF9A 1TRFA 2FOTA 1SKTA 3VRNA 4AQIA 1YURA 3A4UB 4IL1A 4PHJA 5GQQC 1V1GA 1GGWA 2WNDA 5KSZA 3BUWB 1QV0A 2JU0A 1NP8A 2EC6B 2FCEA 2KYCA 1B8CA 1WY9A 2ZNEA 3BOWA 4XJKA 4UPGA 1NX2A 3WNXB 5JJGA 1OOJA 1GJYA 2ZN9A 3VRRA 4YRUA 1KWOB 3I5FB 1QIVA 2MHHA 1MF8B 1JUOA 1OE9B 1SRAA 2WORA 2KYFA 5F6TA
chains in the Genus database with same CATH superfamily
2A4JA 2FJYA 2MRDA 1JF0A 1CLMA 2MBXA 3BYAA 3CZ0A 1YX7A 5I2OA 1KSMA 4C0JA 3DXLA 4HSZA 3D76A 4GFTA 1KFXS 4ORAB 1TIZA 4ETOA 1GM0A 4BY4A 4E68A 2AAOA 2AMIA 2H8VA 1MR8A 1MXLC 2QACA 5JOLA 1N0YA 1K9KA 1DQEA 1GGZA 2KFGA 1HT9A 2I94A 2LUCA 2JXLA 1DJXA 3S0GA 2Y1MA 3DVMA 1J7RA 1CMFA 2TN4A 1KSOA 1ZMZA 3PJIA 2SASA 2M1UA 3DVKA 3I5IC 1OOIX 3BOWB 4XJKB 5G08A 2Y4QA 5FYXA 2CXJA 3SG4A 2WC8A 1C7VA 1KQMB 2L98A 2BECA 3GK1A 4F0ZB 2RGIA 1XA5A 1HQVA 2CTNA 2Y5IA 3OBVA 4ORBB 2PYQA 3CWGA 1WRKA 1PK0D 3PM8A 2LNKA 2KFHA 4PE1A 1KQVA 1Z2CB 2BBNA 4OVNF 4YGEB 1JFKA 1DJWA 1K96A 4CIDA 1FI5A 3IVTA 1NSHA 1DF0A 3ZNIA 4GAOA 3N7HA 3B6XA 1ZACA 5CSNA 4MSPA 4GGNA 2JWWA 2K61A 2H2KA 4U8DA 1ALVA 2K7OA 1DJIA 1L7ZA 2K7DA 1YRTB 2PMYA 1BR4B 2WCFA 4DRWA 1KFUS 2H61C 1YUTA 1QIWA 3O2PA 1QVIZ 2EGDA 1S26D 2BKHB 2F8PA 1XVJA 2M0RA 1SBJA 3CABA 3FWCA 3R1OA 3TS5B 3C1VA 3EKJA 1BG1A 1JC2A 3BQ3A 2BBMA 2QEBA 5K89A 2ZRTA 1TOPA 4HRHA 1A75A 1SCVA 3BXKA 2KBIA 2CCMA 2R2IA 4PHKA 4YI9A 4USLA 2OTGC 2ZFDA 2K8MB 3DVJA 4GGFA 3WHUB 2F3ZA 5TNCA 3LL8B 1YTZC 3SG6A 4C0KA 5HLOA 2JXCA 1OW4A 2M97A 4MLWA 1AHRA 3EK8A 1CTRA 3H4SE 3CGAA 1QASA 1S3PA 1QATA 5CSFA 3BFAA 2KAVA 2GGMA 1IG5A 4DUQA 2KGRA 1CLLA 3B87A 1RFJA 1BLQA 1PULA 2KHNA 1BR1B 4MRYA 2M49B 1DJZA 2FCDA 2M29A 2MLFC 4CPVA 3BUOB 4DIRA 5HYDA 1S5GY 1F70A 1NX0A 2QPTA 1EJ3A 1SR6B 1TCFA 1XFWO 4NQGA 1V1FA 2ZRSA 2M7NA 4CFRA 1A03A 2QEVA 1NX1A 1NYAA 1AJ4A 1TNQA 1YVLA 4MZLA 3F45A 1YRUB 2KAXA 3BUMB 1TUJA 4WQ2A 3V2LA 1XFUO 1YVHA 2L2CA 2KNEA 2LVVA 1NCYA 1XFZO 1SR6C 2WC6A 1L2OC 4HREE 1M31A 2M1KB 1Y1XA 1PALA 4DS7A 3RLZA 4JD9A 3OX5A 1ALWA 3SJSA 1JSAA 2JTZA 1F4QA 1SY9A 3HX4A 1QV1A 4GPLB 4GBAA 1CDLA 2JNXA 2WCJA 3SG5A 2JNFA 2JULA 5AEQA 2BE4A 1LINA 2LMVA 3S0FA 5DKRA 1M39A 1W9ZA 1AJ5A 4PHNA 5FI2A 3EK4A 4INWA 1PVAA 5B8IB 1FBVA 1AP4A 1Z4HA 3DVEA 2KGBC 3LLEA 4XYNA 1YR5A 1B9AA 3I5HC 3JTDC 3NSIA 1Y6WA 1DELA 2K2FA 3RZSA 1EG4A 4ICBA 4MZJA 1CB1A 2JT0A 4YGCB 1QTXA 5I2QA 1DVIA 2K60A 1MWNA 2BCAA 3TUYB 2EHBA 2E30A 4MBEA 2LLUA 1OMVA 1UWOA 4WQ3A 2HPSA 1WRLA 1XO5A 3K21A 1CLBA 1C7WA 4MRXA 1W7IB 2HF5A 2H61A 2LVIA 1NCXA 2KOTA 1LS8A 3R72A 3BUXB 1TWOA 1PSBA 2LMUA 3AAJA 3WXAA 2HQ8A 1QLKA 3CLNA 4P5OE 3TUYC 1XFYO 3SS3A 3I5IB 1RWYA 3B88A 4I5KA 3CYZA 1CFFA 2K2AA 5AANA 2JT8A 1ZFSA 1WDCC 1EH2A 2JTTA 2WC5A 3CR5X 3FS7A 3DZTA 3L47A 2LHLA 1QX2A 4QJ5B 1DC1A 1MHOA 4QJ4B 2P6BB 3OX6A 1ODBA 4CLNA 3O6BA 1CFCA 2O5GA 1BU3A 2LC5A 1LKJA 1W7JB 2AUCA 1YX8A 3NGVA 1SSEB 4HRGA 4NDBA 2LHIA 1UHHA 3CR2A 2KPHA 1GQMA 3R1PA 4OKHA 1XFXO 2KSPA 2PALA 1BT6A 2MAZA 1IGVA 1SL9A 3CTNA 4QJ3B 3NSLA 5AFPA 3EKHA 1KK8C 1IH0A 2KAYA 1ZUZA 1QX7A 2NCPA 2K0JA 1SW8A 4MN0A 4N1FA 3ZWHA 1BMOA 2BCXA 1PVBA 1LVCD 4GNKB 1S5GZ 5HKWA 3SG3A 3LK0A 4PALA 3PSRA 2F33A 2LE9B 3EVUA 5KTYA 4AOMA 1XYDA 1T14A 2OTGB 1EXRA 4MVFA 1BJFA 2Q4UA 2CBLA 2OPOA 1K9UA 2GTEA 1K95A 1Q80A 1OOHA 3D0YA 1SYMA 3SS4A 3CDNA 2F2PA 2JZIA 4YGBB 2PRUA 1QXPA 1YUSA 2VRGA 2WCHA 1J1DA 5HLVA 3S0AA 1G8IA 1SL7A 2PQLA 3BJHA 1J7QA 1B47A 3IF7A 3KO0A 1K9PA 3GK4X 3S0DA 1KK7Z 1G4YR 1IRJA 2LV7A 2P70A 1TTXA 1NCZA 4BY5A 3HCMA 2LUXA 1OSAA 1JFJA 3JVTC 1F4OA 2NXQA 3OB1B 4YI8A 2HETA 4YGDB 2KLDA 5CPVA 3VRPA 1EL4A 1G33A 1OOFA 3SG2A 1OZSA 4FQOA 1P28A 2P71A 5D3OA 2M7LA 2I7AA 2NLNA 4AQJA 4I5NB 1TN4A 4JPZB 3IQOA 3VB1A 1SL8A 1PSRA 3FIAA 3I5GC 1MQ1A 1OOGA 1H4BA 1L2OB 3CS1A 4PDZA 1K2HA 1SPYA 2Y1NA 2BKIB 4M2QA 3QMEA 1FF1A 4C0LA 4JQ0D 1U5IB 1UP5A 4M2OA 3D0YB 2M8UA 4CFQA 3S0BA 1IKUA 1IIOA 2NZ0A 4MEWA 1CDMA 2KI6C 3MSEB 5DICA 1ZOTB 2BAPA 3TDIA 2QDIA 2LP3A 1DMOA 1CDNA 2KBMA 1B4CA 3B86A 1AUIB 2MJWB 1NWDA 1H8BA 1RK9A 4PE0A 1QX5B 3EG5B 1DGVA 3I5HB 3JTDB 1CM1A 3R1VA 4R1EA 1M45A 3L4LA 1BF5A 2LP2A 3DF0B 1Y0VH 3AKAA 3DYEA 3PN7B 1KK7Y 3ICBA 3IQQA 1QJTA 1C3YA 1XFVO 2WCEA 2KI6D 3FE9A 1B8LA 4A4BA 3AAKA 1S6IA 1AK8A 5D69A 1LA3A 2LCPA 2ZN8A 3D77A 1XK4C 4JWQA 3RM1A 3SG7A 1KCYA 3PN7C 1LXFC 4I5LB 2QEOA 4GUKA 3D78A 1TNPA 1A2XA 3EVRA 4PE7A 1DGUA 1R2UA 2ERBA 3PFVA 2L51A 4GGFC 5BPJA 1UHKA 3O4YA 4N5XA 2L4HA 1WDCB 3M0WA 3NSKA 1CFPA 2WCLA 1IJ6A 5I2LA 4WRIA 1DTLA 3NHTA 3BUNB 2JRFA 1UUSA 3GOFA 2DOQA 2L0PA 2GV5A 3PALA 1QLSA 2B1UA 2L4IA 1DEKA 4OCIA 1F8HA 1QWVA 3PATA 3BFBA 5ER5A 4PT1A 1TNWA 2OS8B 4PE4A 2JPOA 3TDZA 1TUZA 2EC6C 3B7AA 1J7OA 1B7TZ 4F7FA 1DT7B 1M63B 4FQTA 2KQYA 2PSRA 1NX3A 2I2RE 2ZNDA 3OP0A 1MUXA 3OHMB 2K7CA 2WOSA 1ORGA 1R6PA 3NXAA 1Y1AA 4D1EA 1SNLA 1JBAA 1KK8B 5PALA 1KWOC 1JWDA 2OS8C 1SCMB 3LCPC 3I5FC 3DD4A 4N1GA 1TCOB 4MZKA 1S36A 1K93D 4ZCVA 5D7FA 1BOCA 1A29A 1CKKA 1OMRA 3D73A 3VGOA 1NUBA 1S1EA 4P2YB 4Q04A 3OGNA 2L50A 3EVVA 1K94A 1DJGA 3O78A 3SIAA 4YBHB 2ZKMX 5CSJA 2KDHA 1YUUA 5IBWA 1IJ5A 1IQ5A 1SCMC 2LLSA 2M9GA 3D10A 3OB2B 3L4AA 5ER4X 2WCKA 4NDCA 1F71A 3KHEA 1Y1UA 1IQ3A 2G9BA 3NSOA 1J7PA 1A4PA 1KFXL 1QS7A 5FI6A 1DJYA 2BCBA 1PRWA 1B1GA 1CMGA 1UHNA 1CNPA 1FW4A 4I5JA 2PVBA 2I18A 2YGUA 3EK7A 1CFDA 4OR9B 2FJUB 3A8RA 3SS5A 2LLTA 2LVKA 1KQMC 1VRKA 4L9MA 4ORCB 3FWBA 1F55A 1WLMA 1U5IA 3K1EA 2KFFA 2QEHA 3LK1A 2Q91A 3KEVA 4KYNA 5HKYA 1B7TY 3CZTX 2MLEC 3QRXA 5FI7A 1XFRA 2JOJA 1E8AA 1N65A 3JVTB 1LA0A 4JKTA 2LVJA 1UHIA 3KPXA 2D8NA 2MA2A 4YGAA 1OQPA 2K7BA 1CDPA 2LMTA 1F54A 2L2EA 2L5YA 3D74A 5I8NA 2L5XB 4OV2A 1N2DA 1RROA 5CSIA 1WLZA 4DCKA 2BL0B 1D1OA 1DJHA 2IS9A 5DKNA 1JF2A 3I5GB 2GGZA 3DF0A 1SK6D 1XK4A 5HKZA 1RTP1 2LAPA 3E3RA 1EG3A 1CM4A 5J3XA 2CT9A 1J1EA 2BNXA 2COLB 3GK2A 5DKQA 1WRZA 3S0EA 1C07A 2JC2A 2BL0C 3Q8IA 5HL1A 1KFUL 1C3ZA 1M46A 3DY9A 4PCWA 3TS5C 1S6CA 3SIBA 3PLFB 5KU1A 1DF0B 4M2PA 2ISDA 1K90D 3D75A 1AVSA 2KQ6A 5I94A 1UHJA 2V53A 3UO9A 2BE6A 5EL2A 1RJVA 1J55A 2WCMA 2LANA 2O60A 2NCOA 1RECA 1FI6A 3WHTB 1IWQA 1UURA 2F3YA 3CZ2A 3CR4X 4INXA 1MXEA 1SMGA 2E6WA 1OZOA 4FTGA 2JPTA 2M3WA 3O4XA 2KI4B 5AXIA 1NIWA 1QVIY 2SCPA 2LM5A 1X02A 1A75B 3VROA 1K8UA 2JQ6A 2G2BA 4NDDA 3PM2A 1OMDA 2HQWA 2WCBA 3CZ1A 1NPQA 1BODA 2PASA 1S6JA 4PHMA 1FPWA 1B8RA 3VRQA 3TDUA 1TNXA 2KI4C 5AERA 4ZCUA 2F2OA 3TZ1A 4A4CA 3AKBA 4TNCA 2JT3A 2CNPA 3KF9A 1TRFA 2FOTA 1SKTA 3VRNA 4AQIA 1YURA 3A4UB 4IL1A 4IJ7A 4PHJA 5GQQC 1V1GA 1GGWA 2WNDA 5KSZA 3FE8A 3BUWB 1QV0A 2JU0A 1NP8A 2EC6B 2FCEA 2KYCA 1B8CA 1WY9A 2ZNEA 3BOWA 4XJKA 4UPGA 1NX2A 3NHIA 3WNXB 5JJGA 1OOJA 1GJYA 2KLEA 2ZN9A 3FE6A 3VRRA 4YRUA 1KWOB 3I5FB 1QIVA 2MHHA 3BFHA 1MF8B 1JUOA 1OE9B 1SRAA 3UNWA 4OZDA 2WORA 2KYFA 5F6TA
chains in the Genus database with same CATH topology
2A4JA 2MRDA 1JF0A 1CLMA 2MBXA 3BYAA 1YX7A 5I2OA 1KSMA 4C0JA 4HSZA 4GFTA 1KFXS 4ORAB 1TIZA 4ETOA 4BY4A 4E68A 2AAOA 2AMIA 1MR8A 1MXLC 2QACA 5JOLA 1N0YA 1K9KA 1GGZA 2KFGA 1HT9A 2I94A 2LUCA 2JXLA 1DJXA 2Y1MA 3DVMA 1J7RA 1CMFA 2TN4A 1KSOA 1ZMZA 2SASA 2M1UA 3DVKA 3I5IC 3BOWB 4XJKB 5G08A 2Y4QA 5FYXA 2CXJA 3SG4A 2WC8A 1C7VA 1KQMB 2L98A 2BECA 3GK1A 4F0ZB 2RGIA 1XA5A 1HQVA 2CTNA 2Y5IA 4ORBB 3CWGA 1WRKA 1PK0D 3PM8A 2LNKA 2KFHA 4PE1A 1KQVA 4OVNF 2BBNA 4YGEB 1JFKA 1DJWA 1K96A 4CIDA 1FI5A 1NSHA 1DF0A 3ZNIA 4GAOA 5CSNA 1ZACA 4MSPA 4GGNA 2JWWA 2K61A 2H2KA 4U8DA 1ALVA 2K7OA 1DJIA 1L7ZA 2K7DA 1YRTB 2PMYA 1BR4B 2WCFA 4DRWA 1KFUS 2H61C 1YUTA 1QIWA 3O2PA 1QVIZ 2EGDA 1S26D 2BKHB 2F8PA 1XVJA 2M0RA 1SBJA 3FWCA 3TS5B 3C1VA 3EKJA 1BG1A 1JC2A 3BQ3A 2BBMA 5K89A 2ZRTA 1TOPA 4HRHA 1A75A 1SCVA 3BXKA 2KBIA 2CCMA 2R2IA 4PHKA 4YI9A 4USLA 2OTGC 2ZFDA 2K8MB 3DVJA 4GGFA 3WHUB 2F3ZA 5TNCA 3LL8B 1YTZC 3SG6A 4C0KA 5HLOA 2JXCA 2M97A 4MLWA 1AHRA 3EK8A 1CTRA 3H4SE 3CGAA 1QASA 1S3PA 1QATA 5CSFA 2KAVA 2GGMA 1IG5A 4DUQA 2KGRA 1CLLA 1RFJA 1BLQA 1PULA 2KHNA 1BR1B 4MRYA 2M49B 1DJZA 2FCDA 2M29A 2MLFC 4CPVA 3BUOB 4DIRA 5HYDA 1S5GY 1F70A 1NX0A 2QPTA 1EJ3A 1SR6B 1TCFA 1XFWO 4NQGA 1V1FA 2ZRSA 2M7NA 4CFRA 1A03A 1NX1A 1NYAA 1AJ4A 1TNQA 1YVLA 4MZLA 3F45A 1YRUB 2KAXA 3BUMB 4WQ2A 1XFUO 1YVHA 2KNEA 2LVVA 1NCYA 1XFZO 1SR6C 4HREE 1L2OC 1M31A 2M1KB 1Y1XA 1PALA 4DS7A 3RLZA 3OX5A 1ALWA 3SJSA 1JSAA 2JTZA 1F4QA 1SY9A 3HX4A 1QV1A 4GPLB 4GBAA 1CDLA 2JNXA 3SG5A 2JNFA 2JULA 5AEQA 2BE4A 1LINA 2LMVA 5DKRA 1M39A 1AJ5A 4PHNA 3EK4A 5B8IB 1PVAA 1FBVA 1AP4A 3DVEA 2KGBC 3LLEA 4XYNA 1YR5A 1B9AA 3I5HC 3JTDC 3NSIA 1Y6WA 2K2FA 1EG4A 4ICBA 4MZJA 1CB1A 2JT0A 4YGCB 1QTXA 5I2QA 1DVIA 1MWNA 2BCAA 3TUYB 2EHBA 2E30A 4MBEA 2LLUA 1OMVA 1UWOA 4WQ3A 2HPSA 1WRLA 1XO5A 3K21A 1CLBA 1C7WA 4MRXA 1W7IB 2HF5A 2H61A 2LVIA 1NCXA 2KOTA 3BUXB 1PSBA 2LMUA 3AAJA 3WXAA 2HQ8A 1QLKA 3CLNA 4P5OE 3TUYC 1XFYO 3I5IB 1RWYA 4I5KA 1CFFA 2K2AA 5AANA 2JT8A 1ZFSA 1WDCC 1EH2A 2JTTA 3CR5X 3FS7A 2LHLA 1QX2A 4QJ5B 1MHOA 4QJ4B 2P6BB 3OX6A 1ODBA 4CLNA 3O6BA 1CFCA 2O5GA 1BU3A 2LC5A 1LKJA 1W7JB 2AUCA 1YX8A 4HRGA 4NDBA 2LHIA 1UHHA 3CR2A 1GQMA 4OKHA 1XFXO 2KSPA 2PALA 1BT6A 2MAZA 1IGVA 1SL9A 3CTNA 4QJ3B 3NSLA 5AFPA 3EKHA 1KK8C 1IH0A 2KAYA 1ZUZA 1QX7A 2NCPA 2K0JA 1SW8A 4MN0A 4N1FA 3ZWHA 1BMOA 2BCXA 1PVBA 1LVCD 4GNKB 1S5GZ 5HKWA 3SG3A 3LK0A 4PALA 3PSRA 2F33A 2LE9B 3EVUA 5KTYA 4AOMA 1XYDA 2OTGB 1EXRA 4MVFA 1BJFA 2Q4UA 2CBLA 2OPOA 1K9UA 1K95A 1Q80A 3D0YA 1SYMA 2F2PA 2JZIA 4YGBB 2PRUA 1QXPA 1YUSA 2VRGA 1J1DA 5HLVA 1G8IA 1SL7A 1J7QA 1B47A 3IF7A 3KO0A 1K9PA 3GK4X 1KK7Z 1G4YR 1IRJA 2LV7A 1TTXA 1NCZA 4BY5A 3HCMA 2LUXA 1OSAA 1JFJA 3JVTC 1F4OA 2NXQA 3OB1B 4YI8A 2HETA 4YGDB 5CPVA 3VRPA 1EL4A 1G33A 3SG2A 1OZSA 4FQOA 2M7LA 2I7AA 2NLNA 4AQJA 4I5NB 1TN4A 4JPZB 3IQOA 1SL8A 1PSRA 3FIAA 3I5GC 1MQ1A 1H4BA 1L2OB 3CS1A 4PDZA 1K2HA 1SPYA 2Y1NA 2BKIB 4M2QA 1FF1A 4C0LA 4JQ0D 1U5IB 1UP5A 4M2OA 3D0YB 2M8UA 4CFQA 1IKUA 2NZ0A 4MEWA 1CDMA 2KI6C 3MSEB 1ZOTB 3TDIA 1DMOA 2LP3A 1CDNA 2KBMA 1B4CA 1AUIB 2MJWB 1NWDA 1H8BA 1RK9A 4PE0A 1QX5B 1DGVA 3I5HB 3JTDB 1CM1A 4R1EA 1M45A 1BF5A 2LP2A 3DF0B 1Y0VH 3AKAA 3PN7B 1KK7Y 3ICBA 3IQQA 1QJTA 1XFVO 2WCEA 2KI6D 1AK8A 1B8LA 4A4BA 3AAKA 1S6IA 5D69A 1LA3A 2LCPA 2ZN8A 4JWQA 1XK4C 3RM1A 3SG7A 1KCYA 3PN7C 1LXFC 4I5LB 4GUKA 1TNPA 1A2XA 3EVRA 4PE7A 1DGUA 1R2UA 3PFVA 4GGFC 2L51A 5BPJA 1UHKA 3O4YA 4N5XA 2L4HA 1WDCB 3M0WA 3NSKA 1CFPA 5I2LA 1IJ6A 4WRIA 1DTLA 3BUNB 2JRFA 1UUSA 3GOFA 2DOQA 2L0PA 2GV5A 3PALA 1QLSA 2B1UA 2L4IA 4OCIA 1F8HA 3PATA 5ER5A 1TNWA 2OS8B 4PE4A 3TDZA 2EC6C 1J7OA 1B7TZ 1DT7B 1M63B 2KQYA 2PSRA 1NX3A 2I2RE 2ZNDA 3OP0A 1MUXA 3OHMB 2K7CA 2WOSA 3NXAA 1R6PA 1Y1AA 4D1EA 1SNLA 1JBAA 1KK8B 5PALA 1KWOC 1JWDA 2OS8C 1SCMB 3LCPC 3I5FC 3DD4A 4N1GA 1TCOB 4MZKA 1S36A 1K93D 4ZCVA 5D7FA 1BOCA 1A29A 1CKKA 1OMRA 3VGOA 1NUBA 1S1EA 4P2YB 4Q04A 2L50A 3EVVA 1K94A 1DJGA 3O78A 3SIAA 4YBHB 2ZKMX 5CSJA 2KDHA 1YUUA 5IBWA 1IJ5A 1IQ5A 1SCMC 2LLSA 2M9GA 3D10A 3OB2B 5ER4X 5AXIA 4NDCA 1F71A 3KHEA 1Y1UA 1IQ3A 2G9BA 3NSOA 1J7PA 1A4PA 1KFXL 1QS7A 1DJYA 2BCBA 1PRWA 1B1GA 1CMGA 1UHNA 1CNPA 1FW4A 4I5JA 2PVBA 2I18A 3EK7A 1CFDA 4OR9B 2FJUB 3A8RA 2LLTA 2LVKA 1KQMC 1VRKA 4L9MA 4ORCB 3FWBA 1F55A 1WLMA 1U5IA 2KFFA 5HKYA 3LK1A 2Q91A 3KEVA 1B7TY 3CZTX 2MLEC 3QRXA 2JOJA 1E8AA 1N65A 3JVTB 1LA0A 2LVJA 1UHIA 3KPXA 2D8NA 2MA2A 4YGAA 1OQPA 2K7BA 1CDPA 2LMTA 1F54A 2L2EA 5I8NA 2L5XB 4OV2A 1N2DA 1RROA 5CSIA 1WLZA 4DCKA 2BL0B 1D1OA 1DJHA 2IS9A 5DKNA 1JF2A 3I5GB 2GGZA 3DF0A 1SK6D 1XK4A 5HKZA 1RTP1 2LAPA 3E3RA 1EG3A 1CM4A 5J3XA 2CT9A 1J1EA 2COLB 3GK2A 5DKQA 1WRZA 1C07A 2JC2A 2BL0C 1KFUL 1M46A 4PCWA 3TS5C 1S6CA 3SIBA 3PLFB 5KU1A 1DF0B 4M2PA 2ISDA 1K90D 1AVSA 2KQ6A 1UHJA 2V53A 2BE6A 1RJVA 1J55A 2LANA 2O60A 2NCOA 1RECA 1FI6A 3WHTB 1IWQA 1UURA 2F3YA 3CR4X 1MXEA 1SMGA 2E6WA 1OZOA 4FTGA 2JPTA 2M3WA 2KI4B 1NIWA 1QVIY 2SCPA 2LM5A 1X02A 1A75B 3VROA 1K8UA 2JQ6A 2G2BA 4NDDA 1OMDA 2HQWA 2WCBA 1NPQA 1BODA 2PASA 1S6JA 4PHMA 1FPWA 1B8RA 3VRQA 3TDUA 1TNXA 2KI4C 5AERA 4ZCUA 2F2OA 3TZ1A 4A4CA 3AKBA 4TNCA 2JT3A 2CNPA 3KF9A 1TRFA 2FOTA 1SKTA 3VRNA 4AQIA 1YURA 3A4UB 4IL1A 4PHJA 5GQQC 1V1GA 1GGWA 2WNDA 5KSZA 3BUWB 1QV0A 2JU0A 1NP8A 2EC6B 2FCEA 2KYCA 1B8CA 1WY9A 2ZNEA 3BOWA 4XJKA 4UPGA 1NX2A 3WNXB 5JJGA 1OOJA 1GJYA 2ZN9A 3VRRA 4YRUA 1KWOB 3I5FB 1QIVA 2MHHA 1MF8B 1JUOA 1OE9B 1SRAA 2WORA 2KYFA 5F6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A4J A;  2MRD A;  1JF0 A;  1CLM A;  2MBX A;  3BYA A;  1YX7 A;  5I2O A;  1KSM A;  4C0J A;  4HSZ A;  4GFT A;  1KFX S;  4ORA B;  1TIZ A;  4ETO A;  4BY4 A;  4E68 A;  2AAO A;  2AMI A;  1MR8 A;  1MXL C;  2QAC A;  5JOL A;  1N0Y A;  1K9K A;  1GGZ A;  2KFG A;  1HT9 A;  2I94 A;  2LUC A;  2JXL A;  1DJX A;  2Y1M A;  3DVM A;  1J7R A;  1CMF A;  2TN4 A;  1KSO A;  1ZMZ A;  2SAS A;  2M1U A;  3DVK A;  3I5I C;  3BOW B;  4XJK B;  5G08 A;  2Y4Q A;  5FYX A;  2CXJ A;  3SG4 A;  2WC8 A;  1C7V A;  1KQM B;  2L98 A;  2BEC A;  3GK1 A;  4F0Z B;  2RGI A;  1XA5 A;  1HQV A;  2CTN A;  2Y5I A;  4ORB B;  3CWG A;  1WRK A;  1PK0 D;  3PM8 A;  2LNK A;  2KFH A;  4PE1 A;  1KQV A;  4OVN F;  2BBN A;  4YGE B;  1JFK A;  1DJW A;  1K96 A;  4CID A;  1FI5 A;  1NSH A;  1DF0 A;  3ZNI A;  4GAO A;  5CSN A;  1ZAC A;  4MSP A;  4GGN A;  2JWW A;  2K61 A;  2H2K A;  4U8D A;  1ALV A;  2K7O A;  1DJI A;  1L7Z A;  2K7D A;  1YRT B;  2PMY A;  1BR4 B;  2WCF A;  4DRW A;  1KFU S;  2H61 C;  1YUT A;  1QIW A;  3O2P A;  1QVI Z;  2EGD A;  1S26 D;  2BKH B;  2F8P A;  1XVJ A;  2M0R A;  1SBJ A;  3FWC A;  3TS5 B;  3C1V A;  3EKJ A;  1BG1 A;  1JC2 A;  3BQ3 A;  2BBM A;  5K89 A;  2ZRT A;  1TOP A;  4HRH A;  1A75 A;  1SCV A;  3BXK A;  2KBI A;  2CCM A;  2R2I A;  4PHK A;  4YI9 A;  4USL A;  2OTG C;  2ZFD A;  2K8M B;  3DVJ A;  4GGF A;  3WHU B;  2F3Z A;  5TNC A;  3LL8 B;  1YTZ C;  3SG6 A;  4C0K A;  5HLO A;  2JXC A;  2M97 A;  4MLW A;  1AHR A;  3EK8 A;  1CTR A;  3H4S E;  3CGA A;  1QAS A;  1S3P A;  1QAT A;  5CSF A;  2KAV A;  2GGM A;  1IG5 A;  4DUQ A;  2KGR A;  1CLL A;  1RFJ A;  1BLQ A;  1PUL A;  2KHN A;  1BR1 B;  4MRY A;  2M49 B;  1DJZ A;  2FCD A;  2M29 A;  2MLF C;  4CPV A;  3BUO B;  4DIR A;  5HYD A;  1S5G Y;  1F70 A;  1NX0 A;  2QPT A;  1EJ3 A;  1SR6 B;  1TCF A;  1XFW O;  4NQG A;  1V1F A;  2ZRS A;  2M7N A;  4CFR A;  1A03 A;  1NX1 A;  1NYA A;  1AJ4 A;  1TNQ A;  1YVL A;  4MZL A;  3F45 A;  1YRU B;  2KAX A;  3BUM B;  4WQ2 A;  1XFU O;  1YVH A;  2KNE A;  2LVV A;  1NCY A;  1XFZ O;  1SR6 C;  4HRE E;  1L2O C;  1M31 A;  2M1K B;  1Y1X A;  1PAL A;  4DS7 A;  3RLZ A;  3OX5 A;  1ALW A;  3SJS A;  1JSA A;  2JTZ A;  1F4Q A;  1SY9 A;  3HX4 A;  1QV1 A;  4GPL B;  4GBA A;  1CDL A;  2JNX A;  3SG5 A;  2JNF A;  2JUL A;  5AEQ A;  2BE4 A;  1LIN A;  2LMV A;  5DKR A;  1M39 A;  1AJ5 A;  4PHN A;  3EK4 A;  5B8I B;  1PVA A;  1FBV A;  1AP4 A;  3DVE A;  2KGB C;  3LLE A;  4XYN A;  1YR5 A;  1B9A A;  3I5H C;  3JTD C;  3NSI A;  1Y6W A;  2K2F A;  1EG4 A;  4ICB A;  4MZJ A;  1CB1 A;  2JT0 A;  4YGC B;  1QTX A;  5I2Q A;  1DVI A;  1MWN A;  2BCA A;  3TUY B;  2EHB A;  2E30 A;  4MBE A;  2LLU A;  1OMV A;  1UWO A;  4WQ3 A;  2HPS A;  1WRL A;  1XO5 A;  3K21 A;  1CLB A;  1C7W A;  4MRX A;  1W7I B;  2HF5 A;  2H61 A;  2LVI A;  1NCX A;  2KOT A;  3BUX B;  1PSB A;  2LMU A;  3AAJ A;  3WXA A;  2HQ8 A;  1QLK A;  3CLN A;  4P5O E;  3TUY C;  1XFY O;  3I5I B;  1RWY A;  4I5K A;  1CFF A;  2K2A A;  5AAN A;  2JT8 A;  1ZFS A;  1WDC C;  1EH2 A;  2JTT A;  3CR5 X;  3FS7 A;  2LHL A;  1QX2 A;  4QJ5 B;  1MHO A;  4QJ4 B;  2P6B B;  3OX6 A;  1ODB A;  4CLN A;  3O6B A;  1CFC A;  2O5G A;  1BU3 A;  2LC5 A;  1LKJ A;  1W7J B;  2AUC A;  1YX8 A;  4HRG A;  4NDB A;  2LHI A;  1UHH A;  3CR2 A;  1GQM A;  4OKH A;  1XFX O;  2KSP A;  2PAL A;  1BT6 A;  2MAZ A;  1IGV A;  1SL9 A;  3CTN A;  4QJ3 B;  3NSL A;  5AFP A;  3EKH A;  1KK8 C;  1IH0 A;  2KAY A;  1ZUZ A;  1QX7 A;  2NCP A;  2K0J A;  1SW8 A;  4MN0 A;  4N1F A;  3ZWH A;  1BMO A;  2BCX A;  1PVB A;  1LVC D;  4GNK B;  1S5G Z;  5HKW A;  3SG3 A;  3LK0 A;  4PAL A;  3PSR A;  2F33 A;  2LE9 B;  3EVU A;  5KTY A;  4AOM A;  1XYD A;  2OTG B;  1EXR A;  4MVF A;  1BJF A;  2Q4U A;  2CBL A;  2OPO A;  1K9U A;  1K95 A;  1Q80 A;  3D0Y A;  1SYM A;  2F2P A;  2JZI A;  4YGB B;  2PRU A;  1QXP A;  1YUS A;  2VRG A;  1J1D A;  5HLV A;  1G8I A;  1SL7 A;  1J7Q A;  1B47 A;  3IF7 A;  3KO0 A;  1K9P A;  3GK4 X;  1KK7 Z;  1G4Y R;  1IRJ A;  2LV7 A;  1TTX A;  1NCZ A;  4BY5 A;  3HCM A;  2LUX A;  1OSA A;  1JFJ A;  3JVT C;  1F4O A;  2NXQ A;  3OB1 B;  4YI8 A;  2HET A;  4YGD B;  5CPV A;  3VRP A;  1EL4 A;  1G33 A;  3SG2 A;  1OZS A;  4FQO A;  2M7L A;  2I7A A;  2NLN A;  4AQJ A;  4I5N B;  1TN4 A;  4JPZ B;  3IQO A;  1SL8 A;  1PSR A;  3FIA A;  3I5G C;  1MQ1 A;  1H4B A;  1L2O B;  3CS1 A;  4PDZ A;  1K2H A;  1SPY A;  2Y1N A;  2BKI B;  4M2Q A;  1FF1 A;  4C0L A;  4JQ0 D;  1U5I B;  1UP5 A;  4M2O A;  3D0Y B;  2M8U A;  4CFQ A;  1IKU A;  2NZ0 A;  4MEW A;  1CDM A;  2KI6 C;  3MSE B;  1ZOT B;  3TDI A;  1DMO A;  2LP3 A;  1CDN A;  2KBM A;  1B4C A;  1AUI B;  2MJW B;  1NWD A;  1H8B A;  1RK9 A;  4PE0 A;  1QX5 B;  1DGV A;  3I5H B;  3JTD B;  1CM1 A;  4R1E A;  1M45 A;  1BF5 A;  2LP2 A;  3DF0 B;  1Y0V H;  3AKA A;  3PN7 B;  1KK7 Y;  3ICB A;  3IQQ A;  1QJT A;  1XFV O;  2WCE A;  2KI6 D;  1AK8 A;  1B8L A;  4A4B A;  3AAK A;  1S6I A;  5D69 A;  1LA3 A;  2LCP A;  2ZN8 A;  4JWQ A;  1XK4 C;  3RM1 A;  3SG7 A;  1KCY A;  3PN7 C;  1LXF C;  4I5L B;  4GUK A;  1TNP A;  1A2X A;  3EVR A;  4PE7 A;  1DGU A;  1R2U A;  3PFV A;  4GGF C;  2L51 A;  5BPJ A;  1UHK A;  3O4Y A;  4N5X A;  2L4H A;  1WDC B;  3M0W A;  3NSK A;  1CFP A;  5I2L A;  1IJ6 A;  4WRI A;  1DTL A;  3BUN B;  2JRF A;  1UUS A;  3GOF A;  2DOQ A;  2L0P A;  2GV5 A;  3PAL A;  1QLS A;  2B1U A;  2L4I A;  4OCI A;  1F8H A;  3PAT A;  5ER5 A;  1TNW A;  2OS8 B;  4PE4 A;  3TDZ A;  2EC6 C;  1J7O A;  1B7T Z;  1DT7 B;  1M63 B;  2KQY A;  2PSR A;  1NX3 A;  2I2R E;  2ZND A;  3OP0 A;  1MUX A;  3OHM B;  2K7C A;  2WOS A;  3NXA A;  1R6P A;  1Y1A A;  4D1E A;  1SNL A;  1JBA A;  1KK8 B;  5PAL A;  1KWO C;  1JWD A;  2OS8 C;  1SCM B;  3LCP C;  3I5F C;  3DD4 A;  4N1G A;  1TCO B;  4MZK A;  1S36 A;  1K93 D;  4ZCV A;  5D7F A;  1BOC A;  1A29 A;  1CKK A;  1OMR A;  3VGO A;  1NUB A;  1S1E A;  4P2Y B;  4Q04 A;  2L50 A;  3EVV A;  1K94 A;  1DJG A;  3O78 A;  3SIA A;  4YBH B;  2ZKM X;  5CSJ A;  2KDH A;  1YUU A;  5IBW A;  1IJ5 A;  1IQ5 A;  1SCM C;  2LLS A;  2M9G A;  3D10 A;  3OB2 B;  5ER4 X;  5AXI A;  4NDC A;  1F71 A;  3KHE A;  1Y1U A;  1IQ3 A;  2G9B A;  3NSO A;  1J7P A;  1A4P A;  1KFX L;  1QS7 A;  1DJY A;  2BCB A;  1PRW A;  1B1G A;  1CMG A;  1UHN A;  1CNP A;  1FW4 A;  4I5J A;  2PVB A;  2I18 A;  3EK7 A;  1CFD A;  4OR9 B;  2FJU B;  3A8R A;  2LLT A;  2LVK A;  1KQM C;  1VRK A;  4L9M A;  4ORC B;  3FWB A;  1F55 A;  1WLM A;  1U5I A;  2KFF A;  5HKY A;  3LK1 A;  2Q91 A;  3KEV A;  1B7T Y;  3CZT X;  2MLE C;  3QRX A;  2JOJ A;  1E8A A;  1N65 A;  3JVT B;  1LA0 A;  2LVJ A;  1UHI A;  3KPX A;  2D8N A;  2MA2 A;  4YGA A;  1OQP A;  2K7B A;  1CDP A;  2LMT A;  1F54 A;  2L2E A;  5I8N A;  2L5X B;  4OV2 A;  1N2D A;  1RRO A;  5CSI A;  1WLZ A;  4DCK A;  2BL0 B;  1D1O A;  1DJH A;  2IS9 A;  5DKN A;  1JF2 A;  3I5G B;  2GGZ A;  3DF0 A;  1SK6 D;  1XK4 A;  5HKZ A;  1RTP 1;  2LAP A;  3E3R A;  1EG3 A;  1CM4 A;  5J3X A;  2CT9 A;  1J1E A;  2COL B;  3GK2 A;  5DKQ A;  1WRZ A;  1C07 A;  2JC2 A;  2BL0 C;  1KFU L;  1M46 A;  4PCW A;  3TS5 C;  1S6C A;  3SIB A;  3PLF B;  5KU1 A;  1DF0 B;  4M2P A;  2ISD A;  1K90 D;  1AVS A;  2KQ6 A;  1UHJ A;  2V53 A;  2BE6 A;  1RJV A;  1J55 A;  2LAN A;  2O60 A;  2NCO A;  1REC A;  1FI6 A;  3WHT B;  1IWQ A;  1UUR A;  2F3Y A;  3CR4 X;  1MXE A;  1SMG A;  2E6W A;  1OZO A;  4FTG A;  2JPT A;  2M3W A;  2KI4 B;  1NIW A;  1QVI Y;  2SCP A;  2LM5 A;  1X02 A;  1A75 B;  3VRO A;  1K8U A;  2JQ6 A;  2G2B A;  4NDD A;  1OMD A;  2HQW A;  2WCB A;  1NPQ A;  1BOD A;  2PAS A;  1S6J A;  4PHM A;  1FPW A;  1B8R A;  3VRQ A;  3TDU A;  1TNX A;  2KI4 C;  5AER A;  4ZCU A;  2F2O A;  3TZ1 A;  4A4C A;  3AKB A;  4TNC A;  2JT3 A;  2CNP A;  3KF9 A;  1TRF A;  2FOT A;  1SKT A;  3VRN A;  4AQI A;  1YUR A;  3A4U B;  4IL1 A;  4PHJ A;  5GQQ C;  1V1G A;  1GGW A;  2WND A;  5KSZ A;  3BUW B;  1QV0 A;  2JU0 A;  1NP8 A;  2EC6 B;  2FCE A;  2KYC A;  1B8C A;  1WY9 A;  2ZNE A;  3BOW A;  4XJK A;  4UPG A;  1NX2 A;  3WNX B;  5JJG A;  1OOJ A;  1GJY A;  2ZN9 A;  3VRR A;  4YRU A;  1KWO B;  3I5F B;  1QIV A;  2MHH A;  1MF8 B;  1JUO A;  1OE9 B;  1SRA A;  2WOR A;  2KYF A;  5F6T A; 
#chains in the Genus database with same CATH topology
 2A4J A;  2FJY A;  2MRD A;  1JF0 A;  1CLM A;  2MBX A;  3BYA A;  3CZ0 A;  1YX7 A;  5I2O A;  1KSM A;  4C0J A;  3DXL A;  4HSZ A;  3D76 A;  4GFT A;  1KFX S;  4ORA B;  1TIZ A;  4ETO A;  1GM0 A;  4BY4 A;  4E68 A;  2AAO A;  2AMI A;  2H8V A;  1MR8 A;  1MXL C;  2QAC A;  5JOL A;  1N0Y A;  1K9K A;  1DQE A;  1GGZ A;  2KFG A;  1HT9 A;  2I94 A;  2LUC A;  2JXL A;  1DJX A;  3S0G A;  2Y1M A;  3DVM A;  1J7R A;  1CMF A;  2TN4 A;  1KSO A;  1ZMZ A;  3PJI A;  2SAS A;  2M1U A;  3DVK A;  3I5I C;  1OOI X;  3BOW B;  4XJK B;  5G08 A;  2Y4Q A;  5FYX A;  2CXJ A;  3SG4 A;  2WC8 A;  1C7V A;  1KQM B;  2L98 A;  2BEC A;  3GK1 A;  4F0Z B;  2RGI A;  1XA5 A;  1HQV A;  2CTN A;  2Y5I A;  3OBV A;  4ORB B;  2PYQ A;  3CWG A;  1WRK A;  1PK0 D;  3PM8 A;  2LNK A;  2KFH A;  4PE1 A;  1KQV A;  1Z2C B;  2BBN A;  4OVN F;  4YGE B;  1JFK A;  1DJW A;  1K96 A;  4CID A;  1FI5 A;  3IVT A;  1NSH A;  1DF0 A;  3ZNI A;  4GAO A;  3N7H A;  3B6X A;  1ZAC A;  5CSN A;  4MSP A;  4GGN A;  2JWW A;  2K61 A;  2H2K A;  4U8D A;  1ALV A;  2K7O A;  1DJI A;  1L7Z A;  2K7D A;  1YRT B;  2PMY A;  1BR4 B;  2WCF A;  4DRW A;  1KFU S;  2H61 C;  1YUT A;  1QIW A;  3O2P A;  1QVI Z;  2EGD A;  1S26 D;  2BKH B;  2F8P A;  1XVJ A;  2M0R A;  1SBJ A;  3CAB A;  3FWC A;  3R1O A;  3TS5 B;  3C1V A;  3EKJ A;  1BG1 A;  1JC2 A;  3BQ3 A;  2BBM A;  2QEB A;  5K89 A;  2ZRT A;  1TOP A;  4HRH A;  1A75 A;  1SCV A;  3BXK A;  2KBI A;  2CCM A;  2R2I A;  4PHK A;  4YI9 A;  4USL A;  2OTG C;  2ZFD A;  2K8M B;  3DVJ A;  4GGF A;  3WHU B;  2F3Z A;  5TNC A;  3LL8 B;  1YTZ C;  3SG6 A;  4C0K A;  5HLO A;  2JXC A;  1OW4 A;  2M97 A;  4MLW A;  1AHR A;  3EK8 A;  1CTR A;  3H4S E;  3CGA A;  1QAS A;  1S3P A;  1QAT A;  5CSF A;  3BFA A;  2KAV A;  2GGM A;  1IG5 A;  4DUQ A;  2KGR A;  1CLL A;  3B87 A;  1RFJ A;  1BLQ A;  1PUL A;  2KHN A;  1BR1 B;  4MRY A;  2M49 B;  1DJZ A;  2FCD A;  2M29 A;  2MLF C;  4CPV A;  3BUO B;  4DIR A;  5HYD A;  1S5G Y;  1F70 A;  1NX0 A;  2QPT A;  1EJ3 A;  1SR6 B;  1TCF A;  1XFW O;  4NQG A;  1V1F A;  2ZRS A;  2M7N A;  4CFR A;  1A03 A;  2QEV A;  1NX1 A;  1NYA A;  1AJ4 A;  1TNQ A;  1YVL A;  4MZL A;  3F45 A;  1YRU B;  2KAX A;  3BUM B;  1TUJ A;  4WQ2 A;  3V2L A;  1XFU O;  1YVH A;  2L2C A;  2KNE A;  2LVV A;  1NCY A;  1XFZ O;  1SR6 C;  2WC6 A;  1L2O C;  4HRE E;  1M31 A;  2M1K B;  1Y1X A;  1PAL A;  4DS7 A;  3RLZ A;  4JD9 A;  3OX5 A;  1ALW A;  3SJS A;  1JSA A;  2JTZ A;  1F4Q A;  1SY9 A;  3HX4 A;  1QV1 A;  4GPL B;  4GBA A;  1CDL A;  2JNX A;  2WCJ A;  3SG5 A;  2JNF A;  2JUL A;  5AEQ A;  2BE4 A;  1LIN A;  2LMV A;  3S0F A;  5DKR A;  1M39 A;  1W9Z A;  1AJ5 A;  4PHN A;  5FI2 A;  3EK4 A;  4INW A;  1PVA A;  5B8I B;  1FBV A;  1AP4 A;  1Z4H A;  3DVE A;  2KGB C;  3LLE A;  4XYN A;  1YR5 A;  1B9A A;  3I5H C;  3JTD C;  3NSI A;  1Y6W A;  1DEL A;  2K2F A;  3RZS A;  1EG4 A;  4ICB A;  4MZJ A;  1CB1 A;  2JT0 A;  4YGC B;  1QTX A;  5I2Q A;  1DVI A;  2K60 A;  1MWN A;  2BCA A;  3TUY B;  2EHB A;  2E30 A;  4MBE A;  2LLU A;  1OMV A;  1UWO A;  4WQ3 A;  2HPS A;  1WRL A;  1XO5 A;  3K21 A;  1CLB A;  1C7W A;  4MRX A;  1W7I B;  2HF5 A;  2H61 A;  2LVI A;  1NCX A;  2KOT A;  1LS8 A;  3R72 A;  3BUX B;  1TWO A;  1PSB A;  2LMU A;  3AAJ A;  3WXA A;  2HQ8 A;  1QLK A;  3CLN A;  4P5O E;  3TUY C;  1XFY O;  3SS3 A;  3I5I B;  1RWY A;  3B88 A;  4I5K A;  3CYZ A;  1CFF A;  2K2A A;  5AAN A;  2JT8 A;  1ZFS A;  1WDC C;  1EH2 A;  2JTT A;  2WC5 A;  3CR5 X;  3FS7 A;  3DZT A;  3L47 A;  2LHL A;  1QX2 A;  4QJ5 B;  1DC1 A;  1MHO A;  4QJ4 B;  2P6B B;  3OX6 A;  1ODB A;  4CLN A;  3O6B A;  1CFC A;  2O5G A;  1BU3 A;  2LC5 A;  1LKJ A;  1W7J B;  2AUC A;  1YX8 A;  3NGV A;  1SSE B;  4HRG A;  4NDB A;  2LHI A;  1UHH A;  3CR2 A;  2KPH A;  1GQM A;  3R1P A;  4OKH A;  1XFX O;  2KSP A;  2PAL A;  1BT6 A;  2MAZ A;  1IGV A;  1SL9 A;  3CTN A;  4QJ3 B;  3NSL A;  5AFP A;  3EKH A;  1KK8 C;  1IH0 A;  2KAY A;  1ZUZ A;  1QX7 A;  2NCP A;  2K0J A;  1SW8 A;  4MN0 A;  4N1F A;  3ZWH A;  1BMO A;  2BCX A;  1PVB A;  1LVC D;  4GNK B;  1S5G Z;  5HKW A;  3SG3 A;  3LK0 A;  4PAL A;  3PSR A;  2F33 A;  2LE9 B;  3EVU A;  5KTY A;  4AOM A;  1XYD A;  1T14 A;  2OTG B;  1EXR A;  4MVF A;  1BJF A;  2Q4U A;  2CBL A;  2OPO A;  1K9U A;  2GTE A;  1K95 A;  1Q80 A;  1OOH A;  3D0Y A;  1SYM A;  3SS4 A;  3CDN A;  2F2P A;  2JZI A;  4YGB B;  2PRU A;  1QXP A;  1YUS A;  2VRG A;  2WCH A;  1J1D A;  5HLV A;  3S0A A;  1G8I A;  1SL7 A;  2PQL A;  3BJH A;  1J7Q A;  1B47 A;  3IF7 A;  3KO0 A;  1K9P A;  3GK4 X;  3S0D A;  1KK7 Z;  1G4Y R;  1IRJ A;  2LV7 A;  2P70 A;  1TTX A;  1NCZ A;  4BY5 A;  3HCM A;  2LUX A;  1OSA A;  1JFJ A;  3JVT C;  1F4O A;  2NXQ A;  3OB1 B;  4YI8 A;  2HET A;  4YGD B;  2KLD A;  5CPV A;  3VRP A;  1EL4 A;  1G33 A;  1OOF A;  3SG2 A;  1OZS A;  4FQO A;  1P28 A;  2P71 A;  5D3O A;  2M7L A;  2I7A A;  2NLN A;  4AQJ A;  4I5N B;  1TN4 A;  4JPZ B;  3IQO A;  3VB1 A;  1SL8 A;  1PSR A;  3FIA A;  3I5G C;  1MQ1 A;  1OOG A;  1H4B A;  1L2O B;  3CS1 A;  4PDZ A;  1K2H A;  1SPY A;  2Y1N A;  2BKI B;  4M2Q A;  3QME A;  1FF1 A;  4C0L A;  4JQ0 D;  1U5I B;  1UP5 A;  4M2O A;  3D0Y B;  2M8U A;  4CFQ A;  3S0B A;  1IKU A;  1IIO A;  2NZ0 A;  4MEW A;  1CDM A;  2KI6 C;  3MSE B;  5DIC A;  1ZOT B;  2BAP A;  3TDI A;  2QDI A;  2LP3 A;  1DMO A;  1CDN A;  2KBM A;  1B4C A;  3B86 A;  1AUI B;  2MJW B;  1NWD A;  1H8B A;  1RK9 A;  4PE0 A;  1QX5 B;  3EG5 B;  1DGV A;  3I5H B;  3JTD B;  1CM1 A;  3R1V A;  4R1E A;  1M45 A;  3L4L A;  1BF5 A;  2LP2 A;  3DF0 B;  1Y0V H;  3AKA A;  3DYE A;  3PN7 B;  1KK7 Y;  3ICB A;  3IQQ A;  1QJT A;  1C3Y A;  1XFV O;  2WCE A;  2KI6 D;  3FE9 A;  1B8L A;  4A4B A;  3AAK A;  1S6I A;  1AK8 A;  5D69 A;  1LA3 A;  2LCP A;  2ZN8 A;  3D77 A;  1XK4 C;  4JWQ A;  3RM1 A;  3SG7 A;  1KCY A;  3PN7 C;  1LXF C;  4I5L B;  2QEO A;  4GUK A;  3D78 A;  1TNP A;  1A2X A;  3EVR A;  4PE7 A;  1DGU A;  1R2U A;  2ERB A;  3PFV A;  2L51 A;  4GGF C;  5BPJ A;  1UHK A;  3O4Y A;  4N5X A;  2L4H A;  1WDC B;  3M0W A;  3NSK A;  1CFP A;  2WCL A;  1IJ6 A;  5I2L A;  4WRI A;  1DTL A;  3NHT A;  3BUN B;  2JRF A;  1UUS A;  3GOF A;  2DOQ A;  2L0P A;  2GV5 A;  3PAL A;  1QLS A;  2B1U A;  2L4I A;  1DEK A;  4OCI A;  1F8H A;  1QWV A;  3PAT A;  3BFB A;  5ER5 A;  4PT1 A;  1TNW A;  2OS8 B;  4PE4 A;  2JPO A;  3TDZ A;  1TUZ A;  2EC6 C;  3B7A A;  1J7O A;  1B7T Z;  4F7F A;  1DT7 B;  1M63 B;  4FQT A;  2KQY A;  2PSR A;  1NX3 A;  2I2R E;  2ZND A;  3OP0 A;  1MUX A;  3OHM B;  2K7C A;  2WOS A;  1ORG A;  1R6P A;  3NXA A;  1Y1A A;  4D1E A;  1SNL A;  1JBA A;  1KK8 B;  5PAL A;  1KWO C;  1JWD A;  2OS8 C;  1SCM B;  3LCP C;  3I5F C;  3DD4 A;  4N1G A;  1TCO B;  4MZK A;  1S36 A;  1K93 D;  4ZCV A;  5D7F A;  1BOC A;  1A29 A;  1CKK A;  1OMR A;  3D73 A;  3VGO A;  1NUB A;  1S1E A;  4P2Y B;  4Q04 A;  3OGN A;  2L50 A;  3EVV A;  1K94 A;  1DJG A;  3O78 A;  3SIA A;  4YBH B;  2ZKM X;  5CSJ A;  2KDH A;  1YUU A;  5IBW A;  1IJ5 A;  1IQ5 A;  1SCM C;  2LLS A;  2M9G A;  3D10 A;  3OB2 B;  3L4A A;  5ER4 X;  2WCK A;  4NDC A;  1F71 A;  3KHE A;  1Y1U A;  1IQ3 A;  2G9B A;  3NSO A;  1J7P A;  1A4P A;  1KFX L;  1QS7 A;  5FI6 A;  1DJY A;  2BCB A;  1PRW A;  1B1G A;  1CMG A;  1UHN A;  1CNP A;  1FW4 A;  4I5J A;  2PVB A;  2I18 A;  2YGU A;  3EK7 A;  1CFD A;  4OR9 B;  2FJU B;  3A8R A;  3SS5 A;  2LLT A;  2LVK A;  1KQM C;  1VRK A;  4L9M A;  4ORC B;  3FWB A;  1F55 A;  1WLM A;  1U5I A;  3K1E A;  2KFF A;  2QEH A;  3LK1 A;  2Q91 A;  3KEV A;  4KYN A;  5HKY A;  1B7T Y;  3CZT X;  2MLE C;  3QRX A;  5FI7 A;  1XFR A;  2JOJ A;  1E8A A;  1N65 A;  3JVT B;  1LA0 A;  4JKT A;  2LVJ A;  1UHI A;  3KPX A;  2D8N A;  2MA2 A;  4YGA A;  1OQP A;  2K7B A;  1CDP A;  2LMT A;  1F54 A;  2L2E A;  2L5Y A;  3D74 A;  5I8N A;  2L5X B;  4OV2 A;  1N2D A;  1RRO A;  5CSI A;  1WLZ A;  4DCK A;  2BL0 B;  1D1O A;  1DJH A;  2IS9 A;  5DKN A;  1JF2 A;  3I5G B;  2GGZ A;  3DF0 A;  1SK6 D;  1XK4 A;  5HKZ A;  1RTP 1;  2LAP A;  3E3R A;  1EG3 A;  1CM4 A;  5J3X A;  2CT9 A;  1J1E A;  2BNX A;  2COL B;  3GK2 A;  5DKQ A;  1WRZ A;  3S0E A;  1C07 A;  2JC2 A;  2BL0 C;  3Q8I A;  5HL1 A;  1KFU L;  1C3Z A;  1M46 A;  3DY9 A;  4PCW A;  3TS5 C;  1S6C A;  3SIB A;  3PLF B;  5KU1 A;  1DF0 B;  4M2P A;  2ISD A;  1K90 D;  3D75 A;  1AVS A;  2KQ6 A;  5I94 A;  1UHJ A;  2V53 A;  3UO9 A;  2BE6 A;  5EL2 A;  1RJV A;  1J55 A;  2WCM A;  2LAN A;  2O60 A;  2NCO A;  1REC A;  1FI6 A;  3WHT B;  1IWQ A;  1UUR A;  2F3Y A;  3CZ2 A;  3CR4 X;  4INX A;  1MXE A;  1SMG A;  2E6W A;  1OZO A;  4FTG A;  2JPT A;  2M3W A;  3O4X A;  2KI4 B;  5AXI A;  1NIW A;  1QVI Y;  2SCP A;  2LM5 A;  1X02 A;  1A75 B;  3VRO A;  1K8U A;  2JQ6 A;  2G2B A;  4NDD A;  3PM2 A;  1OMD A;  2HQW A;  2WCB A;  3CZ1 A;  1NPQ A;  1BOD A;  2PAS A;  1S6J A;  4PHM A;  1FPW A;  1B8R A;  3VRQ A;  3TDU A;  1TNX A;  2KI4 C;  5AER A;  4ZCU A;  2F2O A;  3TZ1 A;  4A4C A;  3AKB A;  4TNC A;  2JT3 A;  2CNP A;  3KF9 A;  1TRF A;  2FOT A;  1SKT A;  3VRN A;  4AQI A;  1YUR A;  3A4U B;  4IL1 A;  4IJ7 A;  4PHJ A;  5GQQ C;  1V1G A;  1GGW A;  2WND A;  5KSZ A;  3FE8 A;  3BUW B;  1QV0 A;  2JU0 A;  1NP8 A;  2EC6 B;  2FCE A;  2KYC A;  1B8C A;  1WY9 A;  2ZNE A;  3BOW A;  4XJK A;  4UPG A;  1NX2 A;  3NHI A;  3WNX B;  5JJG A;  1OOJ A;  1GJY A;  2KLE A;  2ZN9 A;  3FE6 A;  3VRR A;  4YRU A;  1KWO B;  3I5F B;  1QIV A;  2MHH A;  3BFH A;  1MF8 B;  1JUO A;  1OE9 B;  1SRA A;  3UNW A;  4OZD A;  2WOR A;  2KYF A;  5F6T A; 
#chains in the Genus database with same CATH homology
 2A4J A;  2MRD A;  1JF0 A;  1CLM A;  2MBX A;  3BYA A;  1YX7 A;  5I2O A;  1KSM A;  4C0J A;  4HSZ A;  4GFT A;  1KFX S;  4ORA B;  1TIZ A;  4ETO A;  4BY4 A;  4E68 A;  2AAO A;  2AMI A;  1MR8 A;  1MXL C;  2QAC A;  5JOL A;  1N0Y A;  1K9K A;  1GGZ A;  2KFG A;  1HT9 A;  2I94 A;  2LUC A;  2JXL A;  1DJX A;  2Y1M A;  3DVM A;  1J7R A;  1CMF A;  2TN4 A;  1KSO A;  1ZMZ A;  2SAS A;  2M1U A;  3DVK A;  3I5I C;  3BOW B;  4XJK B;  5G08 A;  2Y4Q A;  5FYX A;  2CXJ A;  3SG4 A;  2WC8 A;  1C7V A;  1KQM B;  2L98 A;  2BEC A;  3GK1 A;  4F0Z B;  2RGI A;  1XA5 A;  1HQV A;  2CTN A;  2Y5I A;  4ORB B;  3CWG A;  1WRK A;  1PK0 D;  3PM8 A;  2LNK A;  2KFH A;  4PE1 A;  1KQV A;  4OVN F;  2BBN A;  4YGE B;  1JFK A;  1DJW A;  1K96 A;  4CID A;  1FI5 A;  1NSH A;  1DF0 A;  3ZNI A;  4GAO A;  5CSN A;  1ZAC A;  4MSP A;  4GGN A;  2JWW A;  2K61 A;  2H2K A;  4U8D A;  1ALV A;  2K7O A;  1DJI A;  1L7Z A;  2K7D A;  1YRT B;  2PMY A;  1BR4 B;  2WCF A;  4DRW A;  1KFU S;  2H61 C;  1YUT A;  1QIW A;  3O2P A;  1QVI Z;  2EGD A;  1S26 D;  2BKH B;  2F8P A;  1XVJ A;  2M0R A;  1SBJ A;  3FWC A;  3TS5 B;  3C1V A;  3EKJ A;  1BG1 A;  1JC2 A;  3BQ3 A;  2BBM A;  5K89 A;  2ZRT A;  1TOP A;  4HRH A;  1A75 A;  1SCV A;  3BXK A;  2KBI A;  2CCM A;  2R2I A;  4PHK A;  4YI9 A;  4USL A;  2OTG C;  2ZFD A;  2K8M B;  3DVJ A;  4GGF A;  3WHU B;  2F3Z A;  5TNC A;  3LL8 B;  1YTZ C;  3SG6 A;  4C0K A;  5HLO A;  2JXC A;  2M97 A;  4MLW A;  1AHR A;  3EK8 A;  1CTR A;  3H4S E;  3CGA A;  1QAS A;  1S3P A;  1QAT A;  5CSF A;  2KAV A;  2GGM A;  1IG5 A;  4DUQ A;  2KGR A;  1CLL A;  1RFJ A;  1BLQ A;  1PUL A;  2KHN A;  1BR1 B;  4MRY A;  2M49 B;  1DJZ A;  2FCD A;  2M29 A;  2MLF C;  4CPV A;  3BUO B;  4DIR A;  5HYD A;  1S5G Y;  1F70 A;  1NX0 A;  2QPT A;  1EJ3 A;  1SR6 B;  1TCF A;  1XFW O;  4NQG A;  1V1F A;  2ZRS A;  2M7N A;  4CFR A;  1A03 A;  1NX1 A;  1NYA A;  1AJ4 A;  1TNQ A;  1YVL A;  4MZL A;  3F45 A;  1YRU B;  2KAX A;  3BUM B;  4WQ2 A;  1XFU O;  1YVH A;  2KNE A;  2LVV A;  1NCY A;  1XFZ O;  1SR6 C;  4HRE E;  1L2O C;  1M31 A;  2M1K B;  1Y1X A;  1PAL A;  4DS7 A;  3RLZ A;  3OX5 A;  1ALW A;  3SJS A;  1JSA A;  2JTZ A;  1F4Q A;  1SY9 A;  3HX4 A;  1QV1 A;  4GPL B;  4GBA A;  1CDL A;  2JNX A;  3SG5 A;  2JNF A;  2JUL A;  5AEQ A;  2BE4 A;  1LIN A;  2LMV A;  5DKR A;  1M39 A;  1AJ5 A;  4PHN A;  3EK4 A;  5B8I B;  1PVA A;  1FBV A;  1AP4 A;  3DVE A;  2KGB C;  3LLE A;  4XYN A;  1YR5 A;  1B9A A;  3I5H C;  3JTD C;  3NSI A;  1Y6W A;  2K2F A;  1EG4 A;  4ICB A;  4MZJ A;  1CB1 A;  2JT0 A;  4YGC B;  1QTX A;  5I2Q A;  1DVI A;  1MWN A;  2BCA A;  3TUY B;  2EHB A;  2E30 A;  4MBE A;  2LLU A;  1OMV A;  1UWO A;  4WQ3 A;  2HPS A;  1WRL A;  1XO5 A;  3K21 A;  1CLB A;  1C7W A;  4MRX A;  1W7I B;  2HF5 A;  2H61 A;  2LVI A;  1NCX A;  2KOT A;  3BUX B;  1PSB A;  2LMU A;  3AAJ A;  3WXA A;  2HQ8 A;  1QLK A;  3CLN A;  4P5O E;  3TUY C;  1XFY O;  3I5I B;  1RWY A;  4I5K A;  1CFF A;  2K2A A;  5AAN A;  2JT8 A;  1ZFS A;  1WDC C;  1EH2 A;  2JTT A;  3CR5 X;  3FS7 A;  2LHL A;  1QX2 A;  4QJ5 B;  1MHO A;  4QJ4 B;  2P6B B;  3OX6 A;  1ODB A;  4CLN A;  3O6B A;  1CFC A;  2O5G A;  1BU3 A;  2LC5 A;  1LKJ A;  1W7J B;  2AUC A;  1YX8 A;  4HRG A;  4NDB A;  2LHI A;  1UHH A;  3CR2 A;  1GQM A;  4OKH A;  1XFX O;  2KSP A;  2PAL A;  1BT6 A;  2MAZ A;  1IGV A;  1SL9 A;  3CTN A;  4QJ3 B;  3NSL A;  5AFP A;  3EKH A;  1KK8 C;  1IH0 A;  2KAY A;  1ZUZ A;  1QX7 A;  2NCP A;  2K0J A;  1SW8 A;  4MN0 A;  4N1F A;  3ZWH A;  1BMO A;  2BCX A;  1PVB A;  1LVC D;  4GNK B;  1S5G Z;  5HKW A;  3SG3 A;  3LK0 A;  4PAL A;  3PSR A;  2F33 A;  2LE9 B;  3EVU A;  5KTY A;  4AOM A;  1XYD A;  2OTG B;  1EXR A;  4MVF A;  1BJF A;  2Q4U A;  2CBL A;  2OPO A;  1K9U A;  1K95 A;  1Q80 A;  3D0Y A;  1SYM A;  2F2P A;  2JZI A;  4YGB B;  2PRU A;  1QXP A;  1YUS A;  2VRG A;  1J1D A;  5HLV A;  1G8I A;  1SL7 A;  1J7Q A;  1B47 A;  3IF7 A;  3KO0 A;  1K9P A;  3GK4 X;  1KK7 Z;  1G4Y R;  1IRJ A;  2LV7 A;  1TTX A;  1NCZ A;  4BY5 A;  3HCM A;  2LUX A;  1OSA A;  1JFJ A;  3JVT C;  1F4O A;  2NXQ A;  3OB1 B;  4YI8 A;  2HET A;  4YGD B;  5CPV A;  3VRP A;  1EL4 A;  1G33 A;  3SG2 A;  1OZS A;  4FQO A;  2M7L A;  2I7A A;  2NLN A;  4AQJ A;  4I5N B;  1TN4 A;  4JPZ B;  3IQO A;  1SL8 A;  1PSR A;  3FIA A;  3I5G C;  1MQ1 A;  1H4B A;  1L2O B;  3CS1 A;  4PDZ A;  1K2H A;  1SPY A;  2Y1N A;  2BKI B;  4M2Q A;  1FF1 A;  4C0L A;  4JQ0 D;  1U5I B;  1UP5 A;  4M2O A;  3D0Y B;  2M8U A;  4CFQ A;  1IKU A;  2NZ0 A;  4MEW A;  1CDM A;  2KI6 C;  3MSE B;  1ZOT B;  3TDI A;  1DMO A;  2LP3 A;  1CDN A;  2KBM A;  1B4C A;  1AUI B;  2MJW B;  1NWD A;  1H8B A;  1RK9 A;  4PE0 A;  1QX5 B;  1DGV A;  3I5H B;  3JTD B;  1CM1 A;  4R1E A;  1M45 A;  1BF5 A;  2LP2 A;  3DF0 B;  1Y0V H;  3AKA A;  3PN7 B;  1KK7 Y;  3ICB A;  3IQQ A;  1QJT A;  1XFV O;  2WCE A;  2KI6 D;  1AK8 A;  1B8L A;  4A4B A;  3AAK A;  1S6I A;  5D69 A;  1LA3 A;  2LCP A;  2ZN8 A;  4JWQ A;  1XK4 C;  3RM1 A;  3SG7 A;  1KCY A;  3PN7 C;  1LXF C;  4I5L B;  4GUK A;  1TNP A;  1A2X A;  3EVR A;  4PE7 A;  1DGU A;  1R2U A;  3PFV A;  4GGF C;  2L51 A;  5BPJ A;  1UHK A;  3O4Y A;  4N5X A;  2L4H A;  1WDC B;  3M0W A;  3NSK A;  1CFP A;  5I2L A;  1IJ6 A;  4WRI A;  1DTL A;  3BUN B;  2JRF A;  1UUS A;  3GOF A;  2DOQ A;  2L0P A;  2GV5 A;  3PAL A;  1QLS A;  2B1U A;  2L4I A;  4OCI A;  1F8H A;  3PAT A;  5ER5 A;  1TNW A;  2OS8 B;  4PE4 A;  3TDZ A;  2EC6 C;  1J7O A;  1B7T Z;  1DT7 B;  1M63 B;  2KQY A;  2PSR A;  1NX3 A;  2I2R E;  2ZND A;  3OP0 A;  1MUX A;  3OHM B;  2K7C A;  2WOS A;  3NXA A;  1R6P A;  1Y1A A;  4D1E A;  1SNL A;  1JBA A;  1KK8 B;  5PAL A;  1KWO C;  1JWD A;  2OS8 C;  1SCM B;  3LCP C;  3I5F C;  3DD4 A;  4N1G A;  1TCO B;  4MZK A;  1S36 A;  1K93 D;  4ZCV A;  5D7F A;  1BOC A;  1A29 A;  1CKK A;  1OMR A;  3VGO A;  1NUB A;  1S1E A;  4P2Y B;  4Q04 A;  2L50 A;  3EVV A;  1K94 A;  1DJG A;  3O78 A;  3SIA A;  4YBH B;  2ZKM X;  5CSJ A;  2KDH A;  1YUU A;  5IBW A;  1IJ5 A;  1IQ5 A;  1SCM C;  2LLS A;  2M9G A;  3D10 A;  3OB2 B;  5ER4 X;  5AXI A;  4NDC A;  1F71 A;  3KHE A;  1Y1U A;  1IQ3 A;  2G9B A;  3NSO A;  1J7P A;  1A4P A;  1KFX L;  1QS7 A;  1DJY A;  2BCB A;  1PRW A;  1B1G A;  1CMG A;  1UHN A;  1CNP A;  1FW4 A;  4I5J A;  2PVB A;  2I18 A;  3EK7 A;  1CFD A;  4OR9 B;  2FJU B;  3A8R A;  2LLT A;  2LVK A;  1KQM C;  1VRK A;  4L9M A;  4ORC B;  3FWB A;  1F55 A;  1WLM A;  1U5I A;  2KFF A;  5HKY A;  3LK1 A;  2Q91 A;  3KEV A;  1B7T Y;  3CZT X;  2MLE C;  3QRX A;  2JOJ A;  1E8A A;  1N65 A;  3JVT B;  1LA0 A;  2LVJ A;  1UHI A;  3KPX A;  2D8N A;  2MA2 A;  4YGA A;  1OQP A;  2K7B A;  1CDP A;  2LMT A;  1F54 A;  2L2E A;  5I8N A;  2L5X B;  4OV2 A;  1N2D A;  1RRO A;  5CSI A;  1WLZ A;  4DCK A;  2BL0 B;  1D1O A;  1DJH A;  2IS9 A;  5DKN A;  1JF2 A;  3I5G B;  2GGZ A;  3DF0 A;  1SK6 D;  1XK4 A;  5HKZ A;  1RTP 1;  2LAP A;  3E3R A;  1EG3 A;  1CM4 A;  5J3X A;  2CT9 A;  1J1E A;  2COL B;  3GK2 A;  5DKQ A;  1WRZ A;  1C07 A;  2JC2 A;  2BL0 C;  1KFU L;  1M46 A;  4PCW A;  3TS5 C;  1S6C A;  3SIB A;  3PLF B;  5KU1 A;  1DF0 B;  4M2P A;  2ISD A;  1K90 D;  1AVS A;  2KQ6 A;  1UHJ A;  2V53 A;  2BE6 A;  1RJV A;  1J55 A;  2LAN A;  2O60 A;  2NCO A;  1REC A;  1FI6 A;  3WHT B;  1IWQ A;  1UUR A;  2F3Y A;  3CR4 X;  1MXE A;  1SMG A;  2E6W A;  1OZO A;  4FTG A;  2JPT A;  2M3W A;  2KI4 B;  1NIW A;  1QVI Y;  2SCP A;  2LM5 A;  1X02 A;  1A75 B;  3VRO A;  1K8U A;  2JQ6 A;  2G2B A;  4NDD A;  1OMD A;  2HQW A;  2WCB A;  1NPQ A;  1BOD A;  2PAS A;  1S6J A;  4PHM A;  1FPW A;  1B8R A;  3VRQ A;  3TDU A;  1TNX A;  2KI4 C;  5AER A;  4ZCU A;  2F2O A;  3TZ1 A;  4A4C A;  3AKB A;  4TNC A;  2JT3 A;  2CNP A;  3KF9 A;  1TRF A;  2FOT A;  1SKT A;  3VRN A;  4AQI A;  1YUR A;  3A4U B;  4IL1 A;  4PHJ A;  5GQQ C;  1V1G A;  1GGW A;  2WND A;  5KSZ A;  3BUW B;  1QV0 A;  2JU0 A;  1NP8 A;  2EC6 B;  2FCE A;  2KYC A;  1B8C A;  1WY9 A;  2ZNE A;  3BOW A;  4XJK A;  4UPG A;  1NX2 A;  3WNX B;  5JJG A;  1OOJ A;  1GJY A;  2ZN9 A;  3VRR A;  4YRU A;  1KWO B;  3I5F B;  1QIV A;  2MHH A;  1MF8 B;  1JUO A;  1OE9 B;  1SRA A;  2WOR A;  2KYF A;  5F6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...