1VRKA

The 1.9 angstrom structure of e84k-calmodulin rs20 peptide complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
148
structure length
148
Chain Sequence
ADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEKLKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQVNYEEFVQVMMAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALMODULIN
publication title Analysis of the functional coupling between calmodulin's calcium binding and peptide recognition properties.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Complex(calcium-binding protein/peptide)
total genus 53
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 1997-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1vrkA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1vrkA02
1V1FA 1L7ZA 3SIAA 2IS9A 1F55A 1K96A 1QLKA 4XJKB 3RLZA 3OHMB 1F70A 1ODBA 4E68A 4MVFA 1QV0A 1FI5A 4GAOA 3M0WA 2F2OA 1IH0A 4ETOA 2PALA 1MF8B 1BLQA 3CWGA 1NUBA 2PVBA 5G08A 1YRTB 4M2QA 5AANA 2LP3A 1PRWA 1S6JA 2GGZA 4JWQA 3HCMA 2I7AA 1UHHA 5JOLA 1ALWA 5BPJA 1BT6A 1J7PA 1CMFA 1WDCB 1CFPA 2F33A 2KAVA 3I5HC 4YRUA 3CZTX 3VRPA 5I2OA 1M46A 1CDLA 1SR6C 2MLFC 3BYAA 3IQQA 2SCPA 1HT9A 4L9MA 1AUIB 2LCPA 1MXLC 2JXCA 4MN0A 1L2OB 2BKHB 2M97A 1S1EA 4YBHB 1B8CA 2BCAA 2ZN9A 1NP8A 1RROA 4NDBA 4DIRA 1J7QA 4JPZB 3SG2A 3SG6A 5HKWA 3EK7A 2CXJA 2LLTA 4DUQA 2JWWA 4MRYA 4CPVA 1DMOA 1YX8A 2FOTA 1YUSA 2L51A 5I2QA 1WLZA 1Q80A 2GV5A 2Q4UA 2BCBA 3LLEA 3O78A 5DKNA 2L4HA 2BE6A 3OB2B 1CB1A 5J3XA 1OQPA 1IQ3A 2L98A 1OMDA 2KSPA 5FYXA 3NXAA 1N0YA 3ZNIA 2KDHA 1IGVA 1BU3A 1PVBA 2OS8B 1XO5A 1SCMC 2D8NA 4MZLA 4HRHA 2CCMA 1H4BA 2LUXA 1B9AA 1DJGA 2WCBA 1S6CA 4GGFC 1CDNA 3EVRA 1EH2A 1KFXL 1CFCA 1HQVA 4GFTA 2M7NA 1MQ1A 1CLBA 2LHLA 3I5FB 2O5GA 3NSIA 2HF5A 4P5OE 1E8AA 1UURA 2KOTA 3SG4A 2L0PA 4DS7A 1AJ4A 1YRUB 4N5XA 4AQIA 1FPWA 5I2LA 1QX7A 1MUXA 3VGOA 2JTZA 1CFFA 1DGUA 4R1EA 3TDZA 4PHJA 1YUUA 2L50A 2LC5A 1CLLA 1DJIA 3EK8A 2Y4QA 1Y6WA 2KFFA 2E30A 1SW8A 2KGRA 1YR5A 2KBIA 3MSEB 3GK4X 1SNLA 1YVHA 4YGEB 2PASA 3AKBA 2H61A 1KK7Z 4FQOA 1K95A 3E3RA 4IL1A 1GGZA 4MRXA 1PVAA 1K90D 4DRWA 1R6PA 1JC2A 2R2IA 3F45A 3LCPC 2K0JA 3HX4A 1H8BA 3FWBA 5CSIA 1Y0VH 1TNWA 3PSRA 3I5IC 5D7FA 3IQOA 2MAZA 1JUOA 2BBMA 5D69A 2L4IA 1NCYA 2DOQA 1NYAA 1BF5A 2EGDA 1GGWA 1MR8A 2BL0B 1K9KA 1M39A 3DVEA 2WNDA 1QASA 2LVKA 1DJZA 1SCVA 2MRDA 2KQ6A 3GK1A 4YGAA 2K7DA 4WQ2A 5GQQC 1IKUA 3BOWA 1KQVA 2ZKMX 1S3PA 1TOPA 2F2PA 4N1FA 1M31A 1NPQA 2HPSA 1KCYA 3NSOA 4F0ZB 2RGIA 2LMVA 1PSRA 2V53A 4WRIA 3AAJA 2M3WA 1DTLA 3TDUA 4C0KA 1RTP1 1CDMA 1CKKA 5CPVA 1B47A 2PSRA 1TTXA 3AAKA 1QJTA 3KF9A 1QX5B 1QATA 3EVUA 2G2BA 3KO0A 5F6TA 4I5LB 2COLB 1J1DA 3PN7C 2JZIA 1K9PA 1SL9A 2JRFA 1CM1A 3VROA 4HSZA 4XYNA 4HRGA 1RFJA 1KWOC 2FCEA 1CNPA 1BOCA 1BR4B 2EHBA 1XYDA 4ZCVA 1KK7Y 4Q04A 1NWDA 2FCDA 1QX2A 2I18A 1FW4A 3I5HB 1TCOB 3BOWB 1M45A 2M8UA 1SR6B 1IJ5A 1QIWA 3IF7A 1BODA 4PHMA 5IBWA 2KI6D 5HLVA 2AUCA 2JT3A 4OVNF 1TNXA 3FWCA 4N1GA 1GJYA 4GGFA 2JNFA 4M2PA 1UHKA 1XFXO 3BUNB 2JULA 1N65A 1OMRA 1SBJA 1WY9A 1OMVA 2JQ6A 1K2HA 1SK6D 1XVJA 4PHNA 3OX6A 1AP4A 1F4OA 1LKJA 3EVVA 3FIAA 3CR4X 1JFJA 1JSAA 2E6WA 3SG3A 5PALA 1NX2A 2P6BB 3DD4A 2Y5IA 5AERA 4D1EA 1B7TZ 4MEWA 4MSPA 1QIVA 4TNCA 2CTNA 1S36A 4CFQA 1J7OA 1WLMA 3FS7A 2M29A 2WCEA 1JF2A 2ZNDA 1C07A 1AK8A 3EK4A 1RK9A 1ZUZA 4A4BA 3LK0A 1G8IA 3TS5C 2LUCA 1UHIA 1OOJA 1SCMB 1TNPA 2EC6C 1XFYO 3D0YA 1SL8A 5TNCA 1SKTA 2JT8A 1KFUS 1KK8C 1KK8B 4C0JA 1KQMC 1UHJA 2M9GA 1AVSA 2LLSA 2NLNA 2JTTA 3A8RA 3O2PA 1BG1A 1CMGA 4ZCUA 2L5XB 2LANA 2JXLA 1CTRA 1YTZC 2PMYA 3WNXB 2M1UA 3PFVA 4P2YB 2JU0A 4QJ5B 4PE4A 2AMIA 2MA2A 1QVIZ 2MLEC 1TCFA 1A2XA 2HETA 1JWDA 2QPTA 1RWYA 3WXAA 3VRRA 5CSFA 2K7OA 4JQ0D 2KI6C 1LA3A 3DVKA 2BKIB 1V1GA 4NDDA 2LM5A 2WORA 1SYMA 3JVTC 1F8HA 2BBNA 2ZRTA 1UHNA 1A75A 2LVJA 1DJHA 2JC2A 3C1VA 2M7LA 2HQ8A 2B1UA 3TUYB 3TUYC 1SY9A 1A4PA 3NSKA 1C7VA 2NCPA 1QTXA 3D0YB 1Y1XA 2ZN8A 1OE9B 3ZWHA 2ZFDA 3PALA 1F71A 1DGVA 4AOMA 1PK0D 4FTGA 5K89A 1SPYA 1B7TY 2KFGA 3BUXB 2BECA 2K2FA 3I5IB 1XFVO 2LLUA 1S26D 1S5GZ 2OPOA 3I5GC 1MWNA 2KAXA 3BXKA 4QJ4B 2F8PA 1KSOA 1VRKA 4XJKA 1QLSA 3PM8A 1IWQA 1A03A 1TN4A 2GGMA 3JTDC 2K7CA 3JTDB 3SJSA 1FBVA 1TRFA 4ORBB 4PCWA 4DCKA 4CFRA 5DKRA 2LE9B 2JOJA 4M2OA 2KQYA 1A29A 1CDPA 3BUMB 2F3ZA 1A75B 4PHKA 1F4QA 4I5NB 1K8UA 1JF0A 3EKJA 2WC8A 2CT9A 1W7JB 2F3YA 1KSMA 2LAPA 3CR2A 2OTGC 2OTGB 1IRJA 2LNKA 1UP5A 1QVIY 2KBMA 1Y1UA 3BUWB 3PN7B 1CFDA 4AQJA 1QXPA 2I2RE 5KSZA 1EJ3A 4GUKA 2M0RA 2H2KA 2MJWB 4U8DA 1PSBA 2NZ0A 1KWOB 1RECA 4I5JA 1IG5A 2Y1MA 1J55A 4CLNA 1B1GA 2CNPA 4OCIA 2M1KB 4YI8A 3OP0A 1CM4A 3CLNA 3K21A 3ICBA 4ORAB 2K2AA 2LV7A 2NCOA 3O6BA 1MHOA 1UWOA 1BMOA 5JJGA 3RM1A 1B8LA 3KPXA 1YX7A 1DF0A 3WHUB 4QJ3B 4ICBA 5HYDA 1DVIA 2KYFA 4PE0A 1OZSA 1R2UA 2LVVA 1S5GY 1WDCC 4UPGA 1G4YR 3LL8B 1ZOTB 1XA5A 4GGNA 1QV1A 3DVJA 1EXRA 4OV2A 1ZFSA 3CR5X 2O60A 2MBXA 3VRNA 1XFUO 2CBLA 4OR9B 2ZRSA 4MBEA 3CTNA 1RJVA 2WOSA 1EG4A 1NX0A 2KYCA 1L2OC 4I5KA 4ORCB 1PULA 3H4SE 2MHHA 1SRAA 3GK2A 3GOFA 4WQ3A 1UUSA 3TS5B 4NDCA 5ER4X 1EL4A 3KHEA 2WCFA 2EC6B 1WRLA 2TN4A 1NX3A 4GPLB 2FJUB 2QACA 3BUOB 1XK4A 1ZMZA 1KFXS 1KQMB 1Y1AA 2K8MB 1DF0B 1YVLA 3CS1A 3PATA 3SG7A 1DJYA 2KAYA 1BR1B 1C7WA 5HKZA 1GQMA 1JFKA 1XFWO 2I94A 2K61A 1DJWA 2JNXA 4YGDB 4BY5A 1NCXA 1W7IB 5KU1A 2BE4A 3OX5A 1EG3A 2LMTA 1B4CA 3SIBA 3OB1B 2OS8C 5AEQA 2Q91A 1J1EA 2SASA 1M63B 5B8IB 1FI6A 1F54A 2KFHA 1U5IA 1LXFC 1KFUL 1QS7A 2M49B 2KI4C 1IQ5A 2KI4B 1FF1A 1YURA 3KEVA 4C0LA 4YGBB 1LA0A 3JVTB 3I5FC 5I8NA 2PRUA 2LMUA 1AHRA 4MZJA 1ZACA 2KHNA 3WHTB 5AXIA 1JBAA 3D10A 1OZOA 1J7RA 1G33A 1XK4C 4YI9A 2ISDA 1K94A 2AAOA 2BCXA 2JT0A 3DF0A 1DJXA 4A4CA 4GBAA 4USLA 1K93D 2K7BA 1DT7B 3O4YA 1X02A 1B8RA 1NCZA 3VRQA 5HKYA 2HQWA 2ZNEA 4MZKA 4YGCB 3I5GB 2G9BA 2VRGA 4CIDA 2KGBC 1NSHA 5DKQA 4GNKB 1SL7A 1AJ5A 4OKHA 3NSLA 5ER5A 3CGAA 1U5IB 4PDZA 1CLMA 2NXQA 5CSJA 3PLFB 4HREE 3TDIA 4PE1A 1WRKA 4PALA 4MLWA 1K9UA 4PE7A 1TNQA 4BY4A 2LVIA 5AFPA 1S6IA 1SMGA 1XFZO 1YUTA 1WRZA 3QRXA 5KTYA 3TZ1A 2A4JA 4NQGA 1N2DA 2JPTA 1ALVA 2LP2A 3LK1A 2LHIA 2BL0C 2Y1NA 3AKAA 1BJFA 3SG5A 5HLOA 3DF0B 1NX1A 1D1OA 1TIZA 1NIWA 5CSNA 1LVCD 3EKHA 1PALA 2KNEA 1OSAA 1MXEA 1IJ6A 3DVMA 3BQ3A 2L2EA 3A4UB 2H61C 1LINA
chains in the Genus database with same CATH superfamily
3DXLA 3BFAA 1V1FA 1L7ZA 3SIAA 2IS9A 2P70A 1F55A 1K96A 1QLKA 4XJKB 5EL2A 3RLZA 3OHMB 1F70A 1ODBA 4E68A 4MVFA 1QV0A 1FI5A 4GAOA 3S0EA 3M0WA 5I94A 2F2OA 1IH0A 4ETOA 2PALA 1MF8B 1BLQA 3CWGA 3CABA 1NUBA 3UO9A 2PVBA 5G08A 1YRTB 4M2QA 5AANA 2LP3A 1PRWA 1S6JA 1C3YA 2GGZA 4JWQA 3HCMA 2I7AA 1UHHA 5JOLA 1LS8A 2JPOA 1ALWA 5BPJA 1BT6A 1J7PA 1CMFA 5HL1A 2WCJA 1WDCB 1CFPA 2F33A 2KAVA 3I5HC 4YRUA 3CZTX 3VRPA 5I2OA 1TUJA 1M46A 1CDLA 1SR6C 2MLFC 3BYAA 3IQQA 3D76A 3R1PA 2SCPA 1HT9A 4L9MA 1AUIB 5D3OA 2LCPA 1MXLC 2JXCA 4MN0A 1L2OB 2BKHB 2M97A 1S1EA 4YBHB 1B8CA 2BCAA 2ZN9A 1NP8A 1OOIX 1RROA 4NDBA 4DIRA 1J7QA 4JPZB 3DYEA 3PJIA 3B6XA 2L2CA 5HKWA 2FJYA 3EK7A 3SG2A 3SG6A 2CXJA 2LLTA 4DUQA 2JWWA 4MRYA 4CPVA 3EG5B 1QWVA 1DMOA 1YX8A 2FOTA 1YUSA 2L51A 3QMEA 5I2QA 1WLZA 1Q80A 3SS4A 2GV5A 2Q4UA 2BCBA 3LLEA 3O78A 5DKNA 2L4HA 2BE6A 3OB2B 1CB1A 5J3XA 1OQPA 1IQ3A 2L98A 1OMDA 2KSPA 5FYXA 3NXAA 1N0YA 3R72A 3S0AA 2K60A 3ZNIA 2KDHA 2KLEA 3R1VA 1IGVA 1BU3A 1PVBA 2OS8B 1XO5A 1SCMC 2D8NA 4MZLA 4HRHA 2CCMA 3S0DA 1H4BA 2LUXA 1B9AA 1DJGA 2WCBA 1S6CA 3D75A 4GGFC 1CDNA 3EVRA 1EH2A 1KFXL 1CFCA 1HQVA 4GFTA 2M7NA 1MQ1A 1CLBA 2LHLA 3I5FB 2O5GA 3NSIA 2HF5A 4P5OE 1E8AA 1UURA 2KOTA 3SG4A 2L0PA 4DS7A 1AJ4A 1YRUB 4N5XA 4AQIA 1FPWA 2WC5A 3L4LA 5I2LA 1QX7A 1MUXA 3VGOA 2JTZA 2KLDA 1DGUA 1CFFA 4R1EA 3TDZA 4PHJA 1YUUA 2L50A 2LC5A 1CLLA 1DJIA 3SS5A 3EK8A 2Y4QA 1Y6WA 2KFFA 2E30A 1SW8A 2KGRA 1YR5A 2KBIA 3MSEB 3CZ0A 1SNLA 1YVHA 3GK4X 2PASA 3AKBA 3R1OA 4YGEB 2QEVA 2H61A 1KK7Z 4FQOA 1K95A 3E3RA 4IL1A 1GGZA 2KPHA 4MRXA 1PVAA 1K90D 4DRWA 2QEBA 1R6PA 3V2LA 1JC2A 2R2IA 3F45A 3LCPC 2WCKA 2K0JA 3HX4A 1H8BA 3FWBA 5CSIA 1Y0VH 1TNWA 3PSRA 3I5IC 5D7FA 3IQOA 2MAZA 3BFBA 1T14A 1JUOA 2BBMA 5D69A 2L4IA 1NCYA 2DOQA 1NYAA 3B87A 2EGDA 1BF5A 1GGWA 1MR8A 2BL0B 1K9KA 1M39A 3DVEA 2WNDA 1QASA 2ERBA 2LVKA 3B88A 1DJZA 1SCVA 1W9ZA 2MRDA 2KQ6A 3GK1A 4YGAA 2K7DA 3FE6A 4WQ2A 5GQQC 3VB1A 3BOWA 1IKUA 1KQVA 2ZKMX 1S3PA 1TOPA 2F2PA 4N1FA 3D77A 1M31A 1NPQA 2HPSA 1KCYA 1OOGA 3NSOA 4F0ZB 2RGIA 2WCHA 2LMVA 1PSRA 2V53A 4WRIA 3AAJA 2M3WA 1DTLA 3TDUA 4C0KA 1RTP1 1CDMA 1CKKA 5CPVA 1B47A 2PSRA 1TTXA 3AAKA 1QJTA 3KF9A 1QX5B 1QATA 3EVUA 2G2BA 3KO0A 3SS3A 1GM0A 1SSEB 4INXA 4I5LB 5F6TA 2COLB 1J1DA 3PN7C 2JZIA 1K9PA 1SL9A 3S0FA 2JRFA 1CM1A 3VROA 3O4XA 4HSZA 4XYNA 4HRGA 1RFJA 1KWOC 2FCEA 1CNPA 1BOCA 1BR4B 2EHBA 1XYDA 3L47A 4ZCVA 1KK7Y 4Q04A 1NWDA 2FCDA 1QX2A 2I18A 1FW4A 3I5HB 1TCOB 3BOWB 1M45A 2M8UA 1SR6B 1IJ5A 1QIWA 2YGUA 3IF7A 1BODA 4PHMA 5IBWA 2KI6D 3K1EA 2AUCA 5HLVA 2JT3A 4OVNF 1TNXA 3FWCA 4N1GA 1GJYA 4GGFA 2JNFA 4M2PA 1UHKA 1XFXO 3BUNB 1P28A 2JULA 1N65A 1OMRA 2H8VA 1SBJA 2BNXA 1WY9A 1OMVA 2JQ6A 1K2HA 1SK6D 1XVJA 3CZ2A 4PHNA 1DC1A 3OX6A 1AP4A 1F4OA 1LKJA 3EVVA 3FIAA 3CR4X 1JFJA 1JSAA 2E6WA 3IVTA 3SG3A 5PALA 1NX2A 1OW4A 2P6BB 2Y5IA 3DD4A 5AERA 4D1EA 1B7TZ 4MEWA 4MSPA 1QIVA 4TNCA 2CTNA 1S36A 4CFQA 1J7OA 1WLMA 3FS7A 1TWOA 2M29A 3PM2A 2WCEA 1JF2A 2ZNDA 1C07A 1AK8A 3EK4A 1RK9A 1ZUZA 4A4BA 3LK0A 4JD9A 1G8IA 3TS5C 1OOFA 2LUCA 3S0BA 1UHIA 3FE9A 1OOJA 1SCMB 1TNPA 2EC6C 1XFYO 3D0YA 1SL8A 5TNCA 1SKTA 2JT8A 1KFUS 1KK8C 1KK8B 4C0JA 1KQMC 1UHJA 3CYZA 2M9GA 1AVSA 2LLSA 2NLNA 2JTTA 3A8RA 3O2PA 1BG1A 1CMGA 4ZCUA 2L5XB 2LANA 2JXLA 2WCMA 1CTRA 1YTZC 2PMYA 3WNXB 2M1UA 3D78A 3PFVA 2JU0A 4P2YB 4QJ5B 2P71A 2AMIA 2MA2A 2PYQA 4PE4A 1QVIZ 2MLEC 1TCFA 3Q8IA 1A2XA 2HETA 1JWDA 2QPTA 1RWYA 3WXAA 3VRRA 5CSFA 2K7OA 4JQ0D 2KI6C 1LA3A 3DVKA 2BKIB 1V1GA 4NDDA 2LM5A 2WORA 1SYMA 3JVTC 1F8HA 2BBNA 2ZRTA 1UHNA 1A75A 2LVJA 1DJHA 2JC2A 3C1VA 2M7LA 2HQ8A 2B1UA 1Z2CB 3TUYB 3TUYC 1SY9A 1A4PA 3NSKA 1C7VA 2NCPA 5FI7A 1QTXA 3D0YB 1Y1XA 2WC6A 2ZN8A 1OE9B 3ZWHA 2ZFDA 3PALA 1F71A 1DGVA 4AOMA 1PK0D 4FTGA 5K89A 1SPYA 1B7TY 2KFGA 3BUXB 2BECA 3NGVA 4KYNA 2K2FA 3I5IB 1XFVO 2QEOA 2LLUA 1S26D 1S5GZ 2OPOA 3I5GC 1MWNA 3CDNA 2KAXA 3BXKA 4QJ4B 2F8PA 1KSOA 1VRKA 4XJKA 1QLSA 3PM8A 1IWQA 1A03A 1TN4A 2GGMA 3JTDC 2K7CA 3JTDB 3SJSA 1FBVA 1TRFA 4ORBB 4PCWA 4DCKA 4CFRA 5DKRA 2LE9B 2JOJA 4M2OA 2KQYA 1A29A 1CDPA 3BUMB 2F3ZA 1A75B 4PHKA 1C3ZA 1F4QA 2QEHA 1K8UA 4I5NB 3RZSA 1JF0A 3EKJA 2WC8A 2CT9A 1W7JB 2F3YA 1KSMA 1ORGA 2LAPA 3CR2A 2OTGC 2OTGB 1IRJA 3B7AA 2LNKA 1UP5A 1QVIY 2KBMA 3D74A 1Y1UA 3BUWB 3PN7B 1CFDA 4AQJA 1QXPA 2I2RE 5KSZA 1EJ3A 2L5YA 2M0RA 2H2KA 4GUKA 2MJWB 4U8DA 1PSBA 2NZ0A 1KWOB 1RECA 4I5JA 3UNWA 1IG5A 2Y1MA 1OOHA 1J55A 4CLNA 1B1GA 2CNPA 4OCIA 2M1KB 4YI8A 3OP0A 1CM4A 3CLNA 3K21A 3ICBA 4ORAB 4F7FA 2K2AA 2LV7A 2NCOA 3O6BA 4INWA 1MHOA 1UWOA 3CZ1A 1BMOA 5JJGA 3RM1A 1B8LA 3KPXA 1YX7A 1DF0A 1IIOA 3WHUB 4QJ3B 4ICBA 5HYDA 1DVIA 2KYFA 4PE0A 1OZSA 1R2UA 2LVVA 1S5GY 4FQTA 1WDCC 4UPGA 1G4YR 3LL8B 1ZOTB 1XA5A 4GGNA 1QV1A 3DVJA 3NHTA 1EXRA 4OV2A 1ZFSA 3CR5X 2O60A 2MBXA 3VRNA 1XFUO 2CBLA 4OR9B 2ZRSA 2BAPA 4MBEA 3CTNA 1RJVA 2WOSA 1EG4A 1NX0A 2KYCA 1L2OC 4I5KA 4ORCB 1PULA 3H4SE 2MHHA 1SRAA 3GK2A 3S0GA 3GOFA 4WQ3A 4OZDA 1UUSA 3TS5B 4NDCA 1TUZA 5ER4X 1EL4A 3KHEA 3NHIA 2QDIA 2EC6B 2WCFA 1WRLA 2TN4A 3D73A 1NX3A 4GPLB 2FJUB 2QACA 3BUOB 1XK4A 1ZMZA 1KFXS 1KQMB 1Y1AA 2K8MB 1DF0B 1YVLA 3CS1A 3BFHA 3DY9A 3PATA 3SG7A 1DEKA 1DJYA 2KAYA 1BR1B 3BJHA 1C7WA 5FI6A 5HKZA 1GQMA 1JFKA 1DELA 1XFWO 2I94A 2K61A 1DJWA 2JNXA 4YGDB 3OGNA 4BY5A 1NCXA 1W7IB 5KU1A 2BE4A 3OX5A 1EG3A 2LMTA 1B4CA 3SIBA 3OB1B 2OS8C 4IJ7A 2Q91A 5AEQA 1J1EA 2SASA 1M63B 5B8IB 1FI6A 1F54A 2KFHA 1U5IA 1LXFC 1KFUL 1QS7A 4JKTA 2M49B 2KI4C 1DQEA 1IQ5A 2KI4B 1FF1A 1YURA 3KEVA 4C0LA 4YGBB 1LA0A 3JVTB 3I5FC 5I8NA 2PRUA 2LMUA 1AHRA 4MZJA 1ZACA 2KHNA 1XFRA 3WHTB 5AXIA 1JBAA 3D10A 1OZOA 1J7RA 1G33A 1Z4HA 4PT1A 1XK4C 4YI9A 2ISDA 1K94A 2AAOA 2BCXA 2JT0A 3DF0A 1DJXA 4A4CA 4GBAA 4USLA 1K93D 2K7BA 1DT7B 3O4YA 1X02A 1B8RA 5DICA 1NCZA 3VRQA 5HKYA 2HQWA 2ZNEA 4MZKA 4YGCB 3I5GB 2G9BA 2VRGA 4CIDA 2KGBC 1NSHA 2PQLA 5DKQA 5FI2A 4GNKB 1SL7A 3B86A 1AJ5A 3OBVA 4OKHA 3NSLA 5ER5A 3CGAA 1U5IB 4PDZA 3DZTA 1CLMA 3N7HA 2NXQA 5CSJA 3PLFB 4HREE 3TDIA 4PE1A 1WRKA 3L4AA 4PALA 4MLWA 1K9UA 4PE7A 1TNQA 4BY4A 2LVIA 5AFPA 1S6IA 1SMGA 1XFZO 1YUTA 1WRZA 3QRXA 5KTYA 3TZ1A 2A4JA 3FE8A 4NQGA 1N2DA 2JPTA 2WCLA 1ALVA 2LP2A 3LK1A 2LHIA 2BL0C 2Y1NA 3AKAA 1BJFA 3SG5A 5HLOA 3DF0B 1NX1A 1D1OA 1TIZA 1NIWA 5CSNA 1LVCD 3EKHA 2GTEA 1PALA 2KNEA 1OSAA 1MXEA 1IJ6A 3DVMA 3BQ3A 2L2EA 3A4UB 2H61C 1LINA
chains in the Genus database with same CATH topology
1V1FA 1L7ZA 3SIAA 2IS9A 1F55A 1K96A 1QLKA 4XJKB 3RLZA 3OHMB 1F70A 1ODBA 4E68A 4MVFA 1QV0A 1FI5A 4GAOA 3M0WA 2F2OA 1IH0A 4ETOA 2PALA 1MF8B 1BLQA 3CWGA 1NUBA 2PVBA 5G08A 1YRTB 4M2QA 5AANA 2LP3A 1PRWA 1S6JA 2GGZA 4JWQA 3HCMA 2I7AA 1UHHA 5JOLA 1ALWA 5BPJA 1BT6A 1J7PA 1CMFA 1WDCB 1CFPA 2F33A 2KAVA 3I5HC 4YRUA 3CZTX 3VRPA 5I2OA 1M46A 1CDLA 1SR6C 2MLFC 3BYAA 3IQQA 2SCPA 1HT9A 4L9MA 1AUIB 2LCPA 1MXLC 2JXCA 4MN0A 1L2OB 2BKHB 2M97A 1S1EA 4YBHB 1B8CA 2BCAA 2ZN9A 1NP8A 1RROA 4NDBA 4DIRA 1J7QA 4JPZB 3SG2A 3SG6A 5HKWA 3EK7A 2CXJA 2LLTA 4DUQA 2JWWA 4MRYA 4CPVA 1DMOA 1YX8A 2FOTA 1YUSA 2L51A 5I2QA 1WLZA 1Q80A 2GV5A 2Q4UA 2BCBA 3LLEA 3O78A 5DKNA 2L4HA 2BE6A 3OB2B 1CB1A 5J3XA 1OQPA 1IQ3A 2L98A 1OMDA 2KSPA 5FYXA 3NXAA 1N0YA 3ZNIA 2KDHA 1IGVA 1BU3A 1PVBA 2OS8B 1XO5A 1SCMC 2D8NA 4MZLA 4HRHA 2CCMA 1H4BA 2LUXA 1B9AA 1DJGA 2WCBA 1S6CA 4GGFC 1CDNA 3EVRA 1EH2A 1KFXL 1CFCA 1HQVA 4GFTA 2M7NA 1MQ1A 1CLBA 2LHLA 3I5FB 2O5GA 3NSIA 2HF5A 4P5OE 1E8AA 1UURA 2KOTA 3SG4A 2L0PA 4DS7A 1AJ4A 1YRUB 4N5XA 4AQIA 1FPWA 5I2LA 1QX7A 1MUXA 3VGOA 2JTZA 1CFFA 1DGUA 4R1EA 3TDZA 4PHJA 1YUUA 2L50A 2LC5A 1CLLA 1DJIA 3EK8A 2Y4QA 1Y6WA 2KFFA 2E30A 1SW8A 2KGRA 1YR5A 2KBIA 3MSEB 3GK4X 1SNLA 1YVHA 4YGEB 2PASA 3AKBA 2H61A 1KK7Z 4FQOA 1K95A 3E3RA 4IL1A 1GGZA 4MRXA 1PVAA 1K90D 4DRWA 1R6PA 1JC2A 2R2IA 3F45A 3LCPC 2K0JA 3HX4A 1H8BA 3FWBA 5CSIA 1Y0VH 1TNWA 3PSRA 3I5IC 5D7FA 3IQOA 2MAZA 1JUOA 2BBMA 5D69A 2L4IA 1NCYA 2DOQA 1NYAA 1BF5A 2EGDA 1GGWA 1MR8A 2BL0B 1K9KA 1M39A 3DVEA 2WNDA 1QASA 2LVKA 1DJZA 1SCVA 2MRDA 2KQ6A 3GK1A 4YGAA 2K7DA 4WQ2A 5GQQC 1IKUA 3BOWA 1KQVA 2ZKMX 1S3PA 1TOPA 2F2PA 4N1FA 1M31A 1NPQA 2HPSA 1KCYA 3NSOA 4F0ZB 2RGIA 2LMVA 1PSRA 2V53A 4WRIA 3AAJA 2M3WA 1DTLA 3TDUA 4C0KA 1RTP1 1CDMA 1CKKA 5CPVA 1B47A 2PSRA 1TTXA 3AAKA 1QJTA 3KF9A 1QX5B 1QATA 3EVUA 2G2BA 3KO0A 5F6TA 4I5LB 2COLB 1J1DA 3PN7C 2JZIA 1K9PA 1SL9A 2JRFA 1CM1A 3VROA 4HSZA 4XYNA 4HRGA 1RFJA 1KWOC 2FCEA 1CNPA 1BOCA 1BR4B 2EHBA 1XYDA 4ZCVA 1KK7Y 4Q04A 1NWDA 2FCDA 1QX2A 2I18A 1FW4A 3I5HB 1TCOB 3BOWB 1M45A 2M8UA 1SR6B 1IJ5A 1QIWA 3IF7A 1BODA 4PHMA 5IBWA 2KI6D 5HLVA 2AUCA 2JT3A 4OVNF 1TNXA 3FWCA 4N1GA 1GJYA 4GGFA 2JNFA 4M2PA 1UHKA 1XFXO 3BUNB 2JULA 1N65A 1OMRA 1SBJA 1WY9A 1OMVA 2JQ6A 1K2HA 1SK6D 1XVJA 4PHNA 3OX6A 1AP4A 1F4OA 1LKJA 3EVVA 3FIAA 3CR4X 1JFJA 1JSAA 2E6WA 3SG3A 5PALA 1NX2A 2P6BB 3DD4A 2Y5IA 5AERA 4D1EA 1B7TZ 4MEWA 4MSPA 1QIVA 4TNCA 2CTNA 1S36A 4CFQA 1J7OA 1WLMA 3FS7A 2M29A 2WCEA 1JF2A 2ZNDA 1C07A 1AK8A 3EK4A 1RK9A 1ZUZA 4A4BA 3LK0A 1G8IA 3TS5C 2LUCA 1UHIA 1OOJA 1SCMB 1TNPA 2EC6C 1XFYO 3D0YA 1SL8A 5TNCA 1SKTA 2JT8A 1KFUS 1KK8C 1KK8B 4C0JA 1KQMC 1UHJA 2M9GA 1AVSA 2LLSA 2NLNA 2JTTA 3A8RA 3O2PA 1BG1A 1CMGA 4ZCUA 2L5XB 2LANA 2JXLA 1CTRA 1YTZC 2PMYA 3WNXB 2M1UA 3PFVA 4P2YB 2JU0A 4QJ5B 4PE4A 2AMIA 2MA2A 1QVIZ 2MLEC 1TCFA 1A2XA 2HETA 1JWDA 2QPTA 1RWYA 3WXAA 3VRRA 5CSFA 2K7OA 4JQ0D 2KI6C 1LA3A 3DVKA 2BKIB 1V1GA 4NDDA 2LM5A 2WORA 1SYMA 3JVTC 1F8HA 2BBNA 2ZRTA 1UHNA 1A75A 2LVJA 1DJHA 2JC2A 3C1VA 2M7LA 2HQ8A 2B1UA 3TUYB 3TUYC 1SY9A 1A4PA 3NSKA 1C7VA 2NCPA 1QTXA 3D0YB 1Y1XA 2ZN8A 1OE9B 3ZWHA 2ZFDA 3PALA 1F71A 1DGVA 4AOMA 1PK0D 4FTGA 5K89A 1SPYA 1B7TY 2KFGA 3BUXB 2BECA 2K2FA 3I5IB 1XFVO 2LLUA 1S26D 1S5GZ 2OPOA 3I5GC 1MWNA 2KAXA 3BXKA 4QJ4B 2F8PA 1KSOA 1VRKA 4XJKA 1QLSA 3PM8A 1IWQA 1A03A 1TN4A 2GGMA 3JTDC 2K7CA 3JTDB 3SJSA 1FBVA 1TRFA 4ORBB 4PCWA 4DCKA 4CFRA 5DKRA 2LE9B 2JOJA 4M2OA 2KQYA 1A29A 1CDPA 3BUMB 2F3ZA 1A75B 4PHKA 1F4QA 4I5NB 1K8UA 1JF0A 3EKJA 2WC8A 2CT9A 1W7JB 2F3YA 1KSMA 2LAPA 3CR2A 2OTGC 2OTGB 1IRJA 2LNKA 1UP5A 1QVIY 2KBMA 1Y1UA 3BUWB 3PN7B 1CFDA 4AQJA 1QXPA 2I2RE 5KSZA 1EJ3A 4GUKA 2M0RA 2H2KA 2MJWB 4U8DA 1PSBA 2NZ0A 1KWOB 1RECA 4I5JA 1IG5A 2Y1MA 1J55A 4CLNA 1B1GA 2CNPA 4OCIA 2M1KB 4YI8A 3OP0A 1CM4A 3CLNA 3K21A 3ICBA 4ORAB 2K2AA 2LV7A 2NCOA 3O6BA 1MHOA 1UWOA 1BMOA 5JJGA 3RM1A 1B8LA 3KPXA 1YX7A 1DF0A 3WHUB 4QJ3B 4ICBA 5HYDA 1DVIA 2KYFA 4PE0A 1OZSA 1R2UA 2LVVA 1S5GY 1WDCC 4UPGA 1G4YR 3LL8B 1ZOTB 1XA5A 4GGNA 1QV1A 3DVJA 1EXRA 4OV2A 1ZFSA 3CR5X 2O60A 2MBXA 3VRNA 1XFUO 2CBLA 4OR9B 2ZRSA 4MBEA 3CTNA 1RJVA 2WOSA 1EG4A 1NX0A 2KYCA 1L2OC 4I5KA 4ORCB 1PULA 3H4SE 2MHHA 1SRAA 3GK2A 3GOFA 4WQ3A 1UUSA 3TS5B 4NDCA 5ER4X 1EL4A 3KHEA 2WCFA 2EC6B 1WRLA 2TN4A 1NX3A 4GPLB 2FJUB 2QACA 3BUOB 1XK4A 1ZMZA 1KFXS 1KQMB 1Y1AA 2K8MB 1DF0B 1YVLA 3CS1A 3PATA 3SG7A 1DJYA 2KAYA 1BR1B 1C7WA 5HKZA 1GQMA 1JFKA 1XFWO 2I94A 2K61A 1DJWA 2JNXA 4YGDB 4BY5A 1NCXA 1W7IB 5KU1A 2BE4A 3OX5A 1EG3A 2LMTA 1B4CA 3SIBA 3OB1B 2OS8C 5AEQA 2Q91A 1J1EA 2SASA 1M63B 5B8IB 1FI6A 1F54A 2KFHA 1U5IA 1LXFC 1KFUL 1QS7A 2M49B 2KI4C 1IQ5A 2KI4B 1FF1A 1YURA 3KEVA 4C0LA 4YGBB 1LA0A 3JVTB 3I5FC 5I8NA 2PRUA 2LMUA 1AHRA 4MZJA 1ZACA 2KHNA 3WHTB 5AXIA 1JBAA 3D10A 1OZOA 1J7RA 1G33A 1XK4C 4YI9A 2ISDA 1K94A 2AAOA 2BCXA 2JT0A 3DF0A 1DJXA 4A4CA 4GBAA 4USLA 1K93D 2K7BA 1DT7B 3O4YA 1X02A 1B8RA 1NCZA 3VRQA 5HKYA 2HQWA 2ZNEA 4MZKA 4YGCB 3I5GB 2G9BA 2VRGA 4CIDA 2KGBC 1NSHA 5DKQA 4GNKB 1SL7A 1AJ5A 4OKHA 3NSLA 5ER5A 3CGAA 1U5IB 4PDZA 1CLMA 2NXQA 5CSJA 3PLFB 4HREE 3TDIA 4PE1A 1WRKA 4PALA 4MLWA 1K9UA 4PE7A 1TNQA 4BY4A 2LVIA 5AFPA 1S6IA 1SMGA 1XFZO 1YUTA 1WRZA 3QRXA 5KTYA 3TZ1A 2A4JA 4NQGA 1N2DA 2JPTA 1ALVA 2LP2A 3LK1A 2LHIA 2BL0C 2Y1NA 3AKAA 1BJFA 3SG5A 5HLOA 3DF0B 1NX1A 1D1OA 1TIZA 1NIWA 5CSNA 1LVCD 3EKHA 1PALA 2KNEA 1OSAA 1MXEA 1IJ6A 3DVMA 3BQ3A 2L2EA 3A4UB 2H61C 1LINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V1F A;  1L7Z A;  3SIA A;  2IS9 A;  1F55 A;  1K96 A;  1QLK A;  4XJK B;  3RLZ A;  3OHM B;  1F70 A;  1ODB A;  4E68 A;  4MVF A;  1QV0 A;  1FI5 A;  4GAO A;  3M0W A;  2F2O A;  1IH0 A;  4ETO A;  2PAL A;  1MF8 B;  1BLQ A;  3CWG A;  1NUB A;  2PVB A;  5G08 A;  1YRT B;  4M2Q A;  5AAN A;  2LP3 A;  1PRW A;  1S6J A;  2GGZ A;  4JWQ A;  3HCM A;  2I7A A;  1UHH A;  5JOL A;  1ALW A;  5BPJ A;  1BT6 A;  1J7P A;  1CMF A;  1WDC B;  1CFP A;  2F33 A;  2KAV A;  3I5H C;  4YRU A;  3CZT X;  3VRP A;  5I2O A;  1M46 A;  1CDL A;  1SR6 C;  2MLF C;  3BYA A;  3IQQ A;  2SCP A;  1HT9 A;  4L9M A;  1AUI B;  2LCP A;  1MXL C;  2JXC A;  4MN0 A;  1L2O B;  2BKH B;  2M97 A;  1S1E A;  4YBH B;  1B8C A;  2BCA A;  2ZN9 A;  1NP8 A;  1RRO A;  4NDB A;  4DIR A;  1J7Q A;  4JPZ B;  3SG2 A;  3SG6 A;  5HKW A;  3EK7 A;  2CXJ A;  2LLT A;  4DUQ A;  2JWW A;  4MRY A;  4CPV A;  1DMO A;  1YX8 A;  2FOT A;  1YUS A;  2L51 A;  5I2Q A;  1WLZ A;  1Q80 A;  2GV5 A;  2Q4U A;  2BCB A;  3LLE A;  3O78 A;  5DKN A;  2L4H A;  2BE6 A;  3OB2 B;  1CB1 A;  5J3X A;  1OQP A;  1IQ3 A;  2L98 A;  1OMD A;  2KSP A;  5FYX A;  3NXA A;  1N0Y A;  3ZNI A;  2KDH A;  1IGV A;  1BU3 A;  1PVB A;  2OS8 B;  1XO5 A;  1SCM C;  2D8N A;  4MZL A;  4HRH A;  2CCM A;  1H4B A;  2LUX A;  1B9A A;  1DJG A;  2WCB A;  1S6C A;  4GGF C;  1CDN A;  3EVR A;  1EH2 A;  1KFX L;  1CFC A;  1HQV A;  4GFT A;  2M7N A;  1MQ1 A;  1CLB A;  2LHL A;  3I5F B;  2O5G A;  3NSI A;  2HF5 A;  4P5O E;  1E8A A;  1UUR A;  2KOT A;  3SG4 A;  2L0P A;  4DS7 A;  1AJ4 A;  1YRU B;  4N5X A;  4AQI A;  1FPW A;  5I2L A;  1QX7 A;  1MUX A;  3VGO A;  2JTZ A;  1CFF A;  1DGU A;  4R1E A;  3TDZ A;  4PHJ A;  1YUU A;  2L50 A;  2LC5 A;  1CLL A;  1DJI A;  3EK8 A;  2Y4Q A;  1Y6W A;  2KFF A;  2E30 A;  1SW8 A;  2KGR A;  1YR5 A;  2KBI A;  3MSE B;  3GK4 X;  1SNL A;  1YVH A;  4YGE B;  2PAS A;  3AKB A;  2H61 A;  1KK7 Z;  4FQO A;  1K95 A;  3E3R A;  4IL1 A;  1GGZ A;  4MRX A;  1PVA A;  1K90 D;  4DRW A;  1R6P A;  1JC2 A;  2R2I A;  3F45 A;  3LCP C;  2K0J A;  3HX4 A;  1H8B A;  3FWB A;  5CSI A;  1Y0V H;  1TNW A;  3PSR A;  3I5I C;  5D7F A;  3IQO A;  2MAZ A;  1JUO A;  2BBM A;  5D69 A;  2L4I A;  1NCY A;  2DOQ A;  1NYA A;  1BF5 A;  2EGD A;  1GGW A;  1MR8 A;  2BL0 B;  1K9K A;  1M39 A;  3DVE A;  2WND A;  1QAS A;  2LVK A;  1DJZ A;  1SCV A;  2MRD A;  2KQ6 A;  3GK1 A;  4YGA A;  2K7D A;  4WQ2 A;  5GQQ C;  1IKU A;  3BOW A;  1KQV A;  2ZKM X;  1S3P A;  1TOP A;  2F2P A;  4N1F A;  1M31 A;  1NPQ A;  2HPS A;  1KCY A;  3NSO A;  4F0Z B;  2RGI A;  2LMV A;  1PSR A;  2V53 A;  4WRI A;  3AAJ A;  2M3W A;  1DTL A;  3TDU A;  4C0K A;  1RTP 1;  1CDM A;  1CKK A;  5CPV A;  1B47 A;  2PSR A;  1TTX A;  3AAK A;  1QJT A;  3KF9 A;  1QX5 B;  1QAT A;  3EVU A;  2G2B A;  3KO0 A;  5F6T A;  4I5L B;  2COL B;  1J1D A;  3PN7 C;  2JZI A;  1K9P A;  1SL9 A;  2JRF A;  1CM1 A;  3VRO A;  4HSZ A;  4XYN A;  4HRG A;  1RFJ A;  1KWO C;  2FCE A;  1CNP A;  1BOC A;  1BR4 B;  2EHB A;  1XYD A;  4ZCV A;  1KK7 Y;  4Q04 A;  1NWD A;  2FCD A;  1QX2 A;  2I18 A;  1FW4 A;  3I5H B;  1TCO B;  3BOW B;  1M45 A;  2M8U A;  1SR6 B;  1IJ5 A;  1QIW A;  3IF7 A;  1BOD A;  4PHM A;  5IBW A;  2KI6 D;  5HLV A;  2AUC A;  2JT3 A;  4OVN F;  1TNX A;  3FWC A;  4N1G A;  1GJY A;  4GGF A;  2JNF A;  4M2P A;  1UHK A;  1XFX O;  3BUN B;  2JUL A;  1N65 A;  1OMR A;  1SBJ A;  1WY9 A;  1OMV A;  2JQ6 A;  1K2H A;  1SK6 D;  1XVJ A;  4PHN A;  3OX6 A;  1AP4 A;  1F4O A;  1LKJ A;  3EVV A;  3FIA A;  3CR4 X;  1JFJ A;  1JSA A;  2E6W A;  3SG3 A;  5PAL A;  1NX2 A;  2P6B B;  3DD4 A;  2Y5I A;  5AER A;  4D1E A;  1B7T Z;  4MEW A;  4MSP A;  1QIV A;  4TNC A;  2CTN A;  1S36 A;  4CFQ A;  1J7O A;  1WLM A;  3FS7 A;  2M29 A;  2WCE A;  1JF2 A;  2ZND A;  1C07 A;  1AK8 A;  3EK4 A;  1RK9 A;  1ZUZ A;  4A4B A;  3LK0 A;  1G8I A;  3TS5 C;  2LUC A;  1UHI A;  1OOJ A;  1SCM B;  1TNP A;  2EC6 C;  1XFY O;  3D0Y A;  1SL8 A;  5TNC A;  1SKT A;  2JT8 A;  1KFU S;  1KK8 C;  1KK8 B;  4C0J A;  1KQM C;  1UHJ A;  2M9G A;  1AVS A;  2LLS A;  2NLN A;  2JTT A;  3A8R A;  3O2P A;  1BG1 A;  1CMG A;  4ZCU A;  2L5X B;  2LAN A;  2JXL A;  1CTR A;  1YTZ C;  2PMY A;  3WNX B;  2M1U A;  3PFV A;  4P2Y B;  2JU0 A;  4QJ5 B;  4PE4 A;  2AMI A;  2MA2 A;  1QVI Z;  2MLE C;  1TCF A;  1A2X A;  2HET A;  1JWD A;  2QPT A;  1RWY A;  3WXA A;  3VRR A;  5CSF A;  2K7O A;  4JQ0 D;  2KI6 C;  1LA3 A;  3DVK A;  2BKI B;  1V1G A;  4NDD A;  2LM5 A;  2WOR A;  1SYM A;  3JVT C;  1F8H A;  2BBN A;  2ZRT A;  1UHN A;  1A75 A;  2LVJ A;  1DJH A;  2JC2 A;  3C1V A;  2M7L A;  2HQ8 A;  2B1U A;  3TUY B;  3TUY C;  1SY9 A;  1A4P A;  3NSK A;  1C7V A;  2NCP A;  1QTX A;  3D0Y B;  1Y1X A;  2ZN8 A;  1OE9 B;  3ZWH A;  2ZFD A;  3PAL A;  1F71 A;  1DGV A;  4AOM A;  1PK0 D;  4FTG A;  5K89 A;  1SPY A;  1B7T Y;  2KFG A;  3BUX B;  2BEC A;  2K2F A;  3I5I B;  1XFV O;  2LLU A;  1S26 D;  1S5G Z;  2OPO A;  3I5G C;  1MWN A;  2KAX A;  3BXK A;  4QJ4 B;  2F8P A;  1KSO A;  1VRK A;  4XJK A;  1QLS A;  3PM8 A;  1IWQ A;  1A03 A;  1TN4 A;  2GGM A;  3JTD C;  2K7C A;  3JTD B;  3SJS A;  1FBV A;  1TRF A;  4ORB B;  4PCW A;  4DCK A;  4CFR A;  5DKR A;  2LE9 B;  2JOJ A;  4M2O A;  2KQY A;  1A29 A;  1CDP A;  3BUM B;  2F3Z A;  1A75 B;  4PHK A;  1F4Q A;  4I5N B;  1K8U A;  1JF0 A;  3EKJ A;  2WC8 A;  2CT9 A;  1W7J B;  2F3Y A;  1KSM A;  2LAP A;  3CR2 A;  2OTG C;  2OTG B;  1IRJ A;  2LNK A;  1UP5 A;  1QVI Y;  2KBM A;  1Y1U A;  3BUW B;  3PN7 B;  1CFD A;  4AQJ A;  1QXP A;  2I2R E;  5KSZ A;  1EJ3 A;  4GUK A;  2M0R A;  2H2K A;  2MJW B;  4U8D A;  1PSB A;  2NZ0 A;  1KWO B;  1REC A;  4I5J A;  1IG5 A;  2Y1M A;  1J55 A;  4CLN A;  1B1G A;  2CNP A;  4OCI A;  2M1K B;  4YI8 A;  3OP0 A;  1CM4 A;  3CLN A;  3K21 A;  3ICB A;  4ORA B;  2K2A A;  2LV7 A;  2NCO A;  3O6B A;  1MHO A;  1UWO A;  1BMO A;  5JJG A;  3RM1 A;  1B8L A;  3KPX A;  1YX7 A;  1DF0 A;  3WHU B;  4QJ3 B;  4ICB A;  5HYD A;  1DVI A;  2KYF A;  4PE0 A;  1OZS A;  1R2U A;  2LVV A;  1S5G Y;  1WDC C;  4UPG A;  1G4Y R;  3LL8 B;  1ZOT B;  1XA5 A;  4GGN A;  1QV1 A;  3DVJ A;  1EXR A;  4OV2 A;  1ZFS A;  3CR5 X;  2O60 A;  2MBX A;  3VRN A;  1XFU O;  2CBL A;  4OR9 B;  2ZRS A;  4MBE A;  3CTN A;  1RJV A;  2WOS A;  1EG4 A;  1NX0 A;  2KYC A;  1L2O C;  4I5K A;  4ORC B;  1PUL A;  3H4S E;  2MHH A;  1SRA A;  3GK2 A;  3GOF A;  4WQ3 A;  1UUS A;  3TS5 B;  4NDC A;  5ER4 X;  1EL4 A;  3KHE A;  2WCF A;  2EC6 B;  1WRL A;  2TN4 A;  1NX3 A;  4GPL B;  2FJU B;  2QAC A;  3BUO B;  1XK4 A;  1ZMZ A;  1KFX S;  1KQM B;  1Y1A A;  2K8M B;  1DF0 B;  1YVL A;  3CS1 A;  3PAT A;  3SG7 A;  1DJY A;  2KAY A;  1BR1 B;  1C7W A;  5HKZ A;  1GQM A;  1JFK A;  1XFW O;  2I94 A;  2K61 A;  1DJW A;  2JNX A;  4YGD B;  4BY5 A;  1NCX A;  1W7I B;  5KU1 A;  2BE4 A;  3OX5 A;  1EG3 A;  2LMT A;  1B4C A;  3SIB A;  3OB1 B;  2OS8 C;  5AEQ A;  2Q91 A;  1J1E A;  2SAS A;  1M63 B;  5B8I B;  1FI6 A;  1F54 A;  2KFH A;  1U5I A;  1LXF C;  1KFU L;  1QS7 A;  2M49 B;  2KI4 C;  1IQ5 A;  2KI4 B;  1FF1 A;  1YUR A;  3KEV A;  4C0L A;  4YGB B;  1LA0 A;  3JVT B;  3I5F C;  5I8N A;  2PRU A;  2LMU A;  1AHR A;  4MZJ A;  1ZAC A;  2KHN A;  3WHT B;  5AXI A;  1JBA A;  3D10 A;  1OZO A;  1J7R A;  1G33 A;  1XK4 C;  4YI9 A;  2ISD A;  1K94 A;  2AAO A;  2BCX A;  2JT0 A;  3DF0 A;  1DJX A;  4A4C A;  4GBA A;  4USL A;  1K93 D;  2K7B A;  1DT7 B;  3O4Y A;  1X02 A;  1B8R A;  1NCZ A;  3VRQ A;  5HKY A;  2HQW A;  2ZNE A;  4MZK A;  4YGC B;  3I5G B;  2G9B A;  2VRG A;  4CID A;  2KGB C;  1NSH A;  5DKQ A;  4GNK B;  1SL7 A;  1AJ5 A;  4OKH A;  3NSL A;  5ER5 A;  3CGA A;  1U5I B;  4PDZ A;  1CLM A;  2NXQ A;  5CSJ A;  3PLF B;  4HRE E;  3TDI A;  4PE1 A;  1WRK A;  4PAL A;  4MLW A;  1K9U A;  4PE7 A;  1TNQ A;  4BY4 A;  2LVI A;  5AFP A;  1S6I A;  1SMG A;  1XFZ O;  1YUT A;  1WRZ A;  3QRX A;  5KTY A;  3TZ1 A;  2A4J A;  4NQG A;  1N2D A;  2JPT A;  1ALV A;  2LP2 A;  3LK1 A;  2LHI A;  2BL0 C;  2Y1N A;  3AKA A;  1BJF A;  3SG5 A;  5HLO A;  3DF0 B;  1NX1 A;  1D1O A;  1TIZ A;  1NIW A;  5CSN A;  1LVC D;  3EKH A;  1PAL A;  2KNE A;  1OSA A;  1MXE A;  1IJ6 A;  3DVM A;  3BQ3 A;  2L2E A;  3A4U B;  2H61 C;  1LIN A; 
#chains in the Genus database with same CATH topology
 3DXL A;  3BFA A;  1V1F A;  1L7Z A;  3SIA A;  2IS9 A;  2P70 A;  1F55 A;  1K96 A;  1QLK A;  4XJK B;  5EL2 A;  3RLZ A;  3OHM B;  1F70 A;  1ODB A;  4E68 A;  4MVF A;  1QV0 A;  1FI5 A;  4GAO A;  3S0E A;  3M0W A;  5I94 A;  2F2O A;  1IH0 A;  4ETO A;  2PAL A;  1MF8 B;  1BLQ A;  3CWG A;  3CAB A;  1NUB A;  3UO9 A;  2PVB A;  5G08 A;  1YRT B;  4M2Q A;  5AAN A;  2LP3 A;  1PRW A;  1S6J A;  1C3Y A;  2GGZ A;  4JWQ A;  3HCM A;  2I7A A;  1UHH A;  5JOL A;  1LS8 A;  2JPO A;  1ALW A;  5BPJ A;  1BT6 A;  1J7P A;  1CMF A;  5HL1 A;  2WCJ A;  1WDC B;  1CFP A;  2F33 A;  2KAV A;  3I5H C;  4YRU A;  3CZT X;  3VRP A;  5I2O A;  1TUJ A;  1M46 A;  1CDL A;  1SR6 C;  2MLF C;  3BYA A;  3IQQ A;  3D76 A;  3R1P A;  2SCP A;  1HT9 A;  4L9M A;  1AUI B;  5D3O A;  2LCP A;  1MXL C;  2JXC A;  4MN0 A;  1L2O B;  2BKH B;  2M97 A;  1S1E A;  4YBH B;  1B8C A;  2BCA A;  2ZN9 A;  1NP8 A;  1OOI X;  1RRO A;  4NDB A;  4DIR A;  1J7Q A;  4JPZ B;  3DYE A;  3PJI A;  3B6X A;  2L2C A;  5HKW A;  2FJY A;  3EK7 A;  3SG2 A;  3SG6 A;  2CXJ A;  2LLT A;  4DUQ A;  2JWW A;  4MRY A;  4CPV A;  3EG5 B;  1QWV A;  1DMO A;  1YX8 A;  2FOT A;  1YUS A;  2L51 A;  3QME A;  5I2Q A;  1WLZ A;  1Q80 A;  3SS4 A;  2GV5 A;  2Q4U A;  2BCB A;  3LLE A;  3O78 A;  5DKN A;  2L4H A;  2BE6 A;  3OB2 B;  1CB1 A;  5J3X A;  1OQP A;  1IQ3 A;  2L98 A;  1OMD A;  2KSP A;  5FYX A;  3NXA A;  1N0Y A;  3R72 A;  3S0A A;  2K60 A;  3ZNI A;  2KDH A;  2KLE A;  3R1V A;  1IGV A;  1BU3 A;  1PVB A;  2OS8 B;  1XO5 A;  1SCM C;  2D8N A;  4MZL A;  4HRH A;  2CCM A;  3S0D A;  1H4B A;  2LUX A;  1B9A A;  1DJG A;  2WCB A;  1S6C A;  3D75 A;  4GGF C;  1CDN A;  3EVR A;  1EH2 A;  1KFX L;  1CFC A;  1HQV A;  4GFT A;  2M7N A;  1MQ1 A;  1CLB A;  2LHL A;  3I5F B;  2O5G A;  3NSI A;  2HF5 A;  4P5O E;  1E8A A;  1UUR A;  2KOT A;  3SG4 A;  2L0P A;  4DS7 A;  1AJ4 A;  1YRU B;  4N5X A;  4AQI A;  1FPW A;  2WC5 A;  3L4L A;  5I2L A;  1QX7 A;  1MUX A;  3VGO A;  2JTZ A;  2KLD A;  1DGU A;  1CFF A;  4R1E A;  3TDZ A;  4PHJ A;  1YUU A;  2L50 A;  2LC5 A;  1CLL A;  1DJI A;  3SS5 A;  3EK8 A;  2Y4Q A;  1Y6W A;  2KFF A;  2E30 A;  1SW8 A;  2KGR A;  1YR5 A;  2KBI A;  3MSE B;  3CZ0 A;  1SNL A;  1YVH A;  3GK4 X;  2PAS A;  3AKB A;  3R1O A;  4YGE B;  2QEV A;  2H61 A;  1KK7 Z;  4FQO A;  1K95 A;  3E3R A;  4IL1 A;  1GGZ A;  2KPH A;  4MRX A;  1PVA A;  1K90 D;  4DRW A;  2QEB A;  1R6P A;  3V2L A;  1JC2 A;  2R2I A;  3F45 A;  3LCP C;  2WCK A;  2K0J A;  3HX4 A;  1H8B A;  3FWB A;  5CSI A;  1Y0V H;  1TNW A;  3PSR A;  3I5I C;  5D7F A;  3IQO A;  2MAZ A;  3BFB A;  1T14 A;  1JUO A;  2BBM A;  5D69 A;  2L4I A;  1NCY A;  2DOQ A;  1NYA A;  3B87 A;  2EGD A;  1BF5 A;  1GGW A;  1MR8 A;  2BL0 B;  1K9K A;  1M39 A;  3DVE A;  2WND A;  1QAS A;  2ERB A;  2LVK A;  3B88 A;  1DJZ A;  1SCV A;  1W9Z A;  2MRD A;  2KQ6 A;  3GK1 A;  4YGA A;  2K7D A;  3FE6 A;  4WQ2 A;  5GQQ C;  3VB1 A;  3BOW A;  1IKU A;  1KQV A;  2ZKM X;  1S3P A;  1TOP A;  2F2P A;  4N1F A;  3D77 A;  1M31 A;  1NPQ A;  2HPS A;  1KCY A;  1OOG A;  3NSO A;  4F0Z B;  2RGI A;  2WCH A;  2LMV A;  1PSR A;  2V53 A;  4WRI A;  3AAJ A;  2M3W A;  1DTL A;  3TDU A;  4C0K A;  1RTP 1;  1CDM A;  1CKK A;  5CPV A;  1B47 A;  2PSR A;  1TTX A;  3AAK A;  1QJT A;  3KF9 A;  1QX5 B;  1QAT A;  3EVU A;  2G2B A;  3KO0 A;  3SS3 A;  1GM0 A;  1SSE B;  4INX A;  4I5L B;  5F6T A;  2COL B;  1J1D A;  3PN7 C;  2JZI A;  1K9P A;  1SL9 A;  3S0F A;  2JRF A;  1CM1 A;  3VRO A;  3O4X A;  4HSZ A;  4XYN A;  4HRG A;  1RFJ A;  1KWO C;  2FCE A;  1CNP A;  1BOC A;  1BR4 B;  2EHB A;  1XYD A;  3L47 A;  4ZCV A;  1KK7 Y;  4Q04 A;  1NWD A;  2FCD A;  1QX2 A;  2I18 A;  1FW4 A;  3I5H B;  1TCO B;  3BOW B;  1M45 A;  2M8U A;  1SR6 B;  1IJ5 A;  1QIW A;  2YGU A;  3IF7 A;  1BOD A;  4PHM A;  5IBW A;  2KI6 D;  3K1E A;  2AUC A;  5HLV A;  2JT3 A;  4OVN F;  1TNX A;  3FWC A;  4N1G A;  1GJY A;  4GGF A;  2JNF A;  4M2P A;  1UHK A;  1XFX O;  3BUN B;  1P28 A;  2JUL A;  1N65 A;  1OMR A;  2H8V A;  1SBJ A;  2BNX A;  1WY9 A;  1OMV A;  2JQ6 A;  1K2H A;  1SK6 D;  1XVJ A;  3CZ2 A;  4PHN A;  1DC1 A;  3OX6 A;  1AP4 A;  1F4O A;  1LKJ A;  3EVV A;  3FIA A;  3CR4 X;  1JFJ A;  1JSA A;  2E6W A;  3IVT A;  3SG3 A;  5PAL A;  1NX2 A;  1OW4 A;  2P6B B;  2Y5I A;  3DD4 A;  5AER A;  4D1E A;  1B7T Z;  4MEW A;  4MSP A;  1QIV A;  4TNC A;  2CTN A;  1S36 A;  4CFQ A;  1J7O A;  1WLM A;  3FS7 A;  1TWO A;  2M29 A;  3PM2 A;  2WCE A;  1JF2 A;  2ZND A;  1C07 A;  1AK8 A;  3EK4 A;  1RK9 A;  1ZUZ A;  4A4B A;  3LK0 A;  4JD9 A;  1G8I A;  3TS5 C;  1OOF A;  2LUC A;  3S0B A;  1UHI A;  3FE9 A;  1OOJ A;  1SCM B;  1TNP A;  2EC6 C;  1XFY O;  3D0Y A;  1SL8 A;  5TNC A;  1SKT A;  2JT8 A;  1KFU S;  1KK8 C;  1KK8 B;  4C0J A;  1KQM C;  1UHJ A;  3CYZ A;  2M9G A;  1AVS A;  2LLS A;  2NLN A;  2JTT A;  3A8R A;  3O2P A;  1BG1 A;  1CMG A;  4ZCU A;  2L5X B;  2LAN A;  2JXL A;  2WCM A;  1CTR A;  1YTZ C;  2PMY A;  3WNX B;  2M1U A;  3D78 A;  3PFV A;  2JU0 A;  4P2Y B;  4QJ5 B;  2P71 A;  2AMI A;  2MA2 A;  2PYQ A;  4PE4 A;  1QVI Z;  2MLE C;  1TCF A;  3Q8I A;  1A2X A;  2HET A;  1JWD A;  2QPT A;  1RWY A;  3WXA A;  3VRR A;  5CSF A;  2K7O A;  4JQ0 D;  2KI6 C;  1LA3 A;  3DVK A;  2BKI B;  1V1G A;  4NDD A;  2LM5 A;  2WOR A;  1SYM A;  3JVT C;  1F8H A;  2BBN A;  2ZRT A;  1UHN A;  1A75 A;  2LVJ A;  1DJH A;  2JC2 A;  3C1V A;  2M7L A;  2HQ8 A;  2B1U A;  1Z2C B;  3TUY B;  3TUY C;  1SY9 A;  1A4P A;  3NSK A;  1C7V A;  2NCP A;  5FI7 A;  1QTX A;  3D0Y B;  1Y1X A;  2WC6 A;  2ZN8 A;  1OE9 B;  3ZWH A;  2ZFD A;  3PAL A;  1F71 A;  1DGV A;  4AOM A;  1PK0 D;  4FTG A;  5K89 A;  1SPY A;  1B7T Y;  2KFG A;  3BUX B;  2BEC A;  3NGV A;  4KYN A;  2K2F A;  3I5I B;  1XFV O;  2QEO A;  2LLU A;  1S26 D;  1S5G Z;  2OPO A;  3I5G C;  1MWN A;  3CDN A;  2KAX A;  3BXK A;  4QJ4 B;  2F8P A;  1KSO A;  1VRK A;  4XJK A;  1QLS A;  3PM8 A;  1IWQ A;  1A03 A;  1TN4 A;  2GGM A;  3JTD C;  2K7C A;  3JTD B;  3SJS A;  1FBV A;  1TRF A;  4ORB B;  4PCW A;  4DCK A;  4CFR A;  5DKR A;  2LE9 B;  2JOJ A;  4M2O A;  2KQY A;  1A29 A;  1CDP A;  3BUM B;  2F3Z A;  1A75 B;  4PHK A;  1C3Z A;  1F4Q A;  2QEH A;  1K8U A;  4I5N B;  3RZS A;  1JF0 A;  3EKJ A;  2WC8 A;  2CT9 A;  1W7J B;  2F3Y A;  1KSM A;  1ORG A;  2LAP A;  3CR2 A;  2OTG C;  2OTG B;  1IRJ A;  3B7A A;  2LNK A;  1UP5 A;  1QVI Y;  2KBM A;  3D74 A;  1Y1U A;  3BUW B;  3PN7 B;  1CFD A;  4AQJ A;  1QXP A;  2I2R E;  5KSZ A;  1EJ3 A;  2L5Y A;  2M0R A;  2H2K A;  4GUK A;  2MJW B;  4U8D A;  1PSB A;  2NZ0 A;  1KWO B;  1REC A;  4I5J A;  3UNW A;  1IG5 A;  2Y1M A;  1OOH A;  1J55 A;  4CLN A;  1B1G A;  2CNP A;  4OCI A;  2M1K B;  4YI8 A;  3OP0 A;  1CM4 A;  3CLN A;  3K21 A;  3ICB A;  4ORA B;  4F7F A;  2K2A A;  2LV7 A;  2NCO A;  3O6B A;  4INW A;  1MHO A;  1UWO A;  3CZ1 A;  1BMO A;  5JJG A;  3RM1 A;  1B8L A;  3KPX A;  1YX7 A;  1DF0 A;  1IIO A;  3WHU B;  4QJ3 B;  4ICB A;  5HYD A;  1DVI A;  2KYF A;  4PE0 A;  1OZS A;  1R2U A;  2LVV A;  1S5G Y;  4FQT A;  1WDC C;  4UPG A;  1G4Y R;  3LL8 B;  1ZOT B;  1XA5 A;  4GGN A;  1QV1 A;  3DVJ A;  3NHT A;  1EXR A;  4OV2 A;  1ZFS A;  3CR5 X;  2O60 A;  2MBX A;  3VRN A;  1XFU O;  2CBL A;  4OR9 B;  2ZRS A;  2BAP A;  4MBE A;  3CTN A;  1RJV A;  2WOS A;  1EG4 A;  1NX0 A;  2KYC A;  1L2O C;  4I5K A;  4ORC B;  1PUL A;  3H4S E;  2MHH A;  1SRA A;  3GK2 A;  3S0G A;  3GOF A;  4WQ3 A;  4OZD A;  1UUS A;  3TS5 B;  4NDC A;  1TUZ A;  5ER4 X;  1EL4 A;  3KHE A;  3NHI A;  2QDI A;  2EC6 B;  2WCF A;  1WRL A;  2TN4 A;  3D73 A;  1NX3 A;  4GPL B;  2FJU B;  2QAC A;  3BUO B;  1XK4 A;  1ZMZ A;  1KFX S;  1KQM B;  1Y1A A;  2K8M B;  1DF0 B;  1YVL A;  3CS1 A;  3BFH A;  3DY9 A;  3PAT A;  3SG7 A;  1DEK A;  1DJY A;  2KAY A;  1BR1 B;  3BJH A;  1C7W A;  5FI6 A;  5HKZ A;  1GQM A;  1JFK A;  1DEL A;  1XFW O;  2I94 A;  2K61 A;  1DJW A;  2JNX A;  4YGD B;  3OGN A;  4BY5 A;  1NCX A;  1W7I B;  5KU1 A;  2BE4 A;  3OX5 A;  1EG3 A;  2LMT A;  1B4C A;  3SIB A;  3OB1 B;  2OS8 C;  4IJ7 A;  2Q91 A;  5AEQ A;  1J1E A;  2SAS A;  1M63 B;  5B8I B;  1FI6 A;  1F54 A;  2KFH A;  1U5I A;  1LXF C;  1KFU L;  1QS7 A;  4JKT A;  2M49 B;  2KI4 C;  1DQE A;  1IQ5 A;  2KI4 B;  1FF1 A;  1YUR A;  3KEV A;  4C0L A;  4YGB B;  1LA0 A;  3JVT B;  3I5F C;  5I8N A;  2PRU A;  2LMU A;  1AHR A;  4MZJ A;  1ZAC A;  2KHN A;  1XFR A;  3WHT B;  5AXI A;  1JBA A;  3D10 A;  1OZO A;  1J7R A;  1G33 A;  1Z4H A;  4PT1 A;  1XK4 C;  4YI9 A;  2ISD A;  1K94 A;  2AAO A;  2BCX A;  2JT0 A;  3DF0 A;  1DJX A;  4A4C A;  4GBA A;  4USL A;  1K93 D;  2K7B A;  1DT7 B;  3O4Y A;  1X02 A;  1B8R A;  5DIC A;  1NCZ A;  3VRQ A;  5HKY A;  2HQW A;  2ZNE A;  4MZK A;  4YGC B;  3I5G B;  2G9B A;  2VRG A;  4CID A;  2KGB C;  1NSH A;  2PQL A;  5DKQ A;  5FI2 A;  4GNK B;  1SL7 A;  3B86 A;  1AJ5 A;  3OBV A;  4OKH A;  3NSL A;  5ER5 A;  3CGA A;  1U5I B;  4PDZ A;  3DZT A;  1CLM A;  3N7H A;  2NXQ A;  5CSJ A;  3PLF B;  4HRE E;  3TDI A;  4PE1 A;  1WRK A;  3L4A A;  4PAL A;  4MLW A;  1K9U A;  4PE7 A;  1TNQ A;  4BY4 A;  2LVI A;  5AFP A;  1S6I A;  1SMG A;  1XFZ O;  1YUT A;  1WRZ A;  3QRX A;  5KTY A;  3TZ1 A;  2A4J A;  3FE8 A;  4NQG A;  1N2D A;  2JPT A;  2WCL A;  1ALV A;  2LP2 A;  3LK1 A;  2LHI A;  2BL0 C;  2Y1N A;  3AKA A;  1BJF A;  3SG5 A;  5HLO A;  3DF0 B;  1NX1 A;  1D1O A;  1TIZ A;  1NIW A;  5CSN A;  1LVC D;  3EKH A;  2GTE A;  1PAL A;  2KNE A;  1OSA A;  1MXE A;  1IJ6 A;  3DVM A;  3BQ3 A;  2L2E A;  3A4U B;  2H61 C;  1LIN A; 
#chains in the Genus database with same CATH homology
 1V1F A;  1L7Z A;  3SIA A;  2IS9 A;  1F55 A;  1K96 A;  1QLK A;  4XJK B;  3RLZ A;  3OHM B;  1F70 A;  1ODB A;  4E68 A;  4MVF A;  1QV0 A;  1FI5 A;  4GAO A;  3M0W A;  2F2O A;  1IH0 A;  4ETO A;  2PAL A;  1MF8 B;  1BLQ A;  3CWG A;  1NUB A;  2PVB A;  5G08 A;  1YRT B;  4M2Q A;  5AAN A;  2LP3 A;  1PRW A;  1S6J A;  2GGZ A;  4JWQ A;  3HCM A;  2I7A A;  1UHH A;  5JOL A;  1ALW A;  5BPJ A;  1BT6 A;  1J7P A;  1CMF A;  1WDC B;  1CFP A;  2F33 A;  2KAV A;  3I5H C;  4YRU A;  3CZT X;  3VRP A;  5I2O A;  1M46 A;  1CDL A;  1SR6 C;  2MLF C;  3BYA A;  3IQQ A;  2SCP A;  1HT9 A;  4L9M A;  1AUI B;  2LCP A;  1MXL C;  2JXC A;  4MN0 A;  1L2O B;  2BKH B;  2M97 A;  1S1E A;  4YBH B;  1B8C A;  2BCA A;  2ZN9 A;  1NP8 A;  1RRO A;  4NDB A;  4DIR A;  1J7Q A;  4JPZ B;  3SG2 A;  3SG6 A;  5HKW A;  3EK7 A;  2CXJ A;  2LLT A;  4DUQ A;  2JWW A;  4MRY A;  4CPV A;  1DMO A;  1YX8 A;  2FOT A;  1YUS A;  2L51 A;  5I2Q A;  1WLZ A;  1Q80 A;  2GV5 A;  2Q4U A;  2BCB A;  3LLE A;  3O78 A;  5DKN A;  2L4H A;  2BE6 A;  3OB2 B;  1CB1 A;  5J3X A;  1OQP A;  1IQ3 A;  2L98 A;  1OMD A;  2KSP A;  5FYX A;  3NXA A;  1N0Y A;  3ZNI A;  2KDH A;  1IGV A;  1BU3 A;  1PVB A;  2OS8 B;  1XO5 A;  1SCM C;  2D8N A;  4MZL A;  4HRH A;  2CCM A;  1H4B A;  2LUX A;  1B9A A;  1DJG A;  2WCB A;  1S6C A;  4GGF C;  1CDN A;  3EVR A;  1EH2 A;  1KFX L;  1CFC A;  1HQV A;  4GFT A;  2M7N A;  1MQ1 A;  1CLB A;  2LHL A;  3I5F B;  2O5G A;  3NSI A;  2HF5 A;  4P5O E;  1E8A A;  1UUR A;  2KOT A;  3SG4 A;  2L0P A;  4DS7 A;  1AJ4 A;  1YRU B;  4N5X A;  4AQI A;  1FPW A;  5I2L A;  1QX7 A;  1MUX A;  3VGO A;  2JTZ A;  1CFF A;  1DGU A;  4R1E A;  3TDZ A;  4PHJ A;  1YUU A;  2L50 A;  2LC5 A;  1CLL A;  1DJI A;  3EK8 A;  2Y4Q A;  1Y6W A;  2KFF A;  2E30 A;  1SW8 A;  2KGR A;  1YR5 A;  2KBI A;  3MSE B;  3GK4 X;  1SNL A;  1YVH A;  4YGE B;  2PAS A;  3AKB A;  2H61 A;  1KK7 Z;  4FQO A;  1K95 A;  3E3R A;  4IL1 A;  1GGZ A;  4MRX A;  1PVA A;  1K90 D;  4DRW A;  1R6P A;  1JC2 A;  2R2I A;  3F45 A;  3LCP C;  2K0J A;  3HX4 A;  1H8B A;  3FWB A;  5CSI A;  1Y0V H;  1TNW A;  3PSR A;  3I5I C;  5D7F A;  3IQO A;  2MAZ A;  1JUO A;  2BBM A;  5D69 A;  2L4I A;  1NCY A;  2DOQ A;  1NYA A;  1BF5 A;  2EGD A;  1GGW A;  1MR8 A;  2BL0 B;  1K9K A;  1M39 A;  3DVE A;  2WND A;  1QAS A;  2LVK A;  1DJZ A;  1SCV A;  2MRD A;  2KQ6 A;  3GK1 A;  4YGA A;  2K7D A;  4WQ2 A;  5GQQ C;  1IKU A;  3BOW A;  1KQV A;  2ZKM X;  1S3P A;  1TOP A;  2F2P A;  4N1F A;  1M31 A;  1NPQ A;  2HPS A;  1KCY A;  3NSO A;  4F0Z B;  2RGI A;  2LMV A;  1PSR A;  2V53 A;  4WRI A;  3AAJ A;  2M3W A;  1DTL A;  3TDU A;  4C0K A;  1RTP 1;  1CDM A;  1CKK A;  5CPV A;  1B47 A;  2PSR A;  1TTX A;  3AAK A;  1QJT A;  3KF9 A;  1QX5 B;  1QAT A;  3EVU A;  2G2B A;  3KO0 A;  5F6T A;  4I5L B;  2COL B;  1J1D A;  3PN7 C;  2JZI A;  1K9P A;  1SL9 A;  2JRF A;  1CM1 A;  3VRO A;  4HSZ A;  4XYN A;  4HRG A;  1RFJ A;  1KWO C;  2FCE A;  1CNP A;  1BOC A;  1BR4 B;  2EHB A;  1XYD A;  4ZCV A;  1KK7 Y;  4Q04 A;  1NWD A;  2FCD A;  1QX2 A;  2I18 A;  1FW4 A;  3I5H B;  1TCO B;  3BOW B;  1M45 A;  2M8U A;  1SR6 B;  1IJ5 A;  1QIW A;  3IF7 A;  1BOD A;  4PHM A;  5IBW A;  2KI6 D;  5HLV A;  2AUC A;  2JT3 A;  4OVN F;  1TNX A;  3FWC A;  4N1G A;  1GJY A;  4GGF A;  2JNF A;  4M2P A;  1UHK A;  1XFX O;  3BUN B;  2JUL A;  1N65 A;  1OMR A;  1SBJ A;  1WY9 A;  1OMV A;  2JQ6 A;  1K2H A;  1SK6 D;  1XVJ A;  4PHN A;  3OX6 A;  1AP4 A;  1F4O A;  1LKJ A;  3EVV A;  3FIA A;  3CR4 X;  1JFJ A;  1JSA A;  2E6W A;  3SG3 A;  5PAL A;  1NX2 A;  2P6B B;  3DD4 A;  2Y5I A;  5AER A;  4D1E A;  1B7T Z;  4MEW A;  4MSP A;  1QIV A;  4TNC A;  2CTN A;  1S36 A;  4CFQ A;  1J7O A;  1WLM A;  3FS7 A;  2M29 A;  2WCE A;  1JF2 A;  2ZND A;  1C07 A;  1AK8 A;  3EK4 A;  1RK9 A;  1ZUZ A;  4A4B A;  3LK0 A;  1G8I A;  3TS5 C;  2LUC A;  1UHI A;  1OOJ A;  1SCM B;  1TNP A;  2EC6 C;  1XFY O;  3D0Y A;  1SL8 A;  5TNC A;  1SKT A;  2JT8 A;  1KFU S;  1KK8 C;  1KK8 B;  4C0J A;  1KQM C;  1UHJ A;  2M9G A;  1AVS A;  2LLS A;  2NLN A;  2JTT A;  3A8R A;  3O2P A;  1BG1 A;  1CMG A;  4ZCU A;  2L5X B;  2LAN A;  2JXL A;  1CTR A;  1YTZ C;  2PMY A;  3WNX B;  2M1U A;  3PFV A;  4P2Y B;  2JU0 A;  4QJ5 B;  4PE4 A;  2AMI A;  2MA2 A;  1QVI Z;  2MLE C;  1TCF A;  1A2X A;  2HET A;  1JWD A;  2QPT A;  1RWY A;  3WXA A;  3VRR A;  5CSF A;  2K7O A;  4JQ0 D;  2KI6 C;  1LA3 A;  3DVK A;  2BKI B;  1V1G A;  4NDD A;  2LM5 A;  2WOR A;  1SYM A;  3JVT C;  1F8H A;  2BBN A;  2ZRT A;  1UHN A;  1A75 A;  2LVJ A;  1DJH A;  2JC2 A;  3C1V A;  2M7L A;  2HQ8 A;  2B1U A;  3TUY B;  3TUY C;  1SY9 A;  1A4P A;  3NSK A;  1C7V A;  2NCP A;  1QTX A;  3D0Y B;  1Y1X A;  2ZN8 A;  1OE9 B;  3ZWH A;  2ZFD A;  3PAL A;  1F71 A;  1DGV A;  4AOM A;  1PK0 D;  4FTG A;  5K89 A;  1SPY A;  1B7T Y;  2KFG A;  3BUX B;  2BEC A;  2K2F A;  3I5I B;  1XFV O;  2LLU A;  1S26 D;  1S5G Z;  2OPO A;  3I5G C;  1MWN A;  2KAX A;  3BXK A;  4QJ4 B;  2F8P A;  1KSO A;  1VRK A;  4XJK A;  1QLS A;  3PM8 A;  1IWQ A;  1A03 A;  1TN4 A;  2GGM A;  3JTD C;  2K7C A;  3JTD B;  3SJS A;  1FBV A;  1TRF A;  4ORB B;  4PCW A;  4DCK A;  4CFR A;  5DKR A;  2LE9 B;  2JOJ A;  4M2O A;  2KQY A;  1A29 A;  1CDP A;  3BUM B;  2F3Z A;  1A75 B;  4PHK A;  1F4Q A;  4I5N B;  1K8U A;  1JF0 A;  3EKJ A;  2WC8 A;  2CT9 A;  1W7J B;  2F3Y A;  1KSM A;  2LAP A;  3CR2 A;  2OTG C;  2OTG B;  1IRJ A;  2LNK A;  1UP5 A;  1QVI Y;  2KBM A;  1Y1U A;  3BUW B;  3PN7 B;  1CFD A;  4AQJ A;  1QXP A;  2I2R E;  5KSZ A;  1EJ3 A;  4GUK A;  2M0R A;  2H2K A;  2MJW B;  4U8D A;  1PSB A;  2NZ0 A;  1KWO B;  1REC A;  4I5J A;  1IG5 A;  2Y1M A;  1J55 A;  4CLN A;  1B1G A;  2CNP A;  4OCI A;  2M1K B;  4YI8 A;  3OP0 A;  1CM4 A;  3CLN A;  3K21 A;  3ICB A;  4ORA B;  2K2A A;  2LV7 A;  2NCO A;  3O6B A;  1MHO A;  1UWO A;  1BMO A;  5JJG A;  3RM1 A;  1B8L A;  3KPX A;  1YX7 A;  1DF0 A;  3WHU B;  4QJ3 B;  4ICB A;  5HYD A;  1DVI A;  2KYF A;  4PE0 A;  1OZS A;  1R2U A;  2LVV A;  1S5G Y;  1WDC C;  4UPG A;  1G4Y R;  3LL8 B;  1ZOT B;  1XA5 A;  4GGN A;  1QV1 A;  3DVJ A;  1EXR A;  4OV2 A;  1ZFS A;  3CR5 X;  2O60 A;  2MBX A;  3VRN A;  1XFU O;  2CBL A;  4OR9 B;  2ZRS A;  4MBE A;  3CTN A;  1RJV A;  2WOS A;  1EG4 A;  1NX0 A;  2KYC A;  1L2O C;  4I5K A;  4ORC B;  1PUL A;  3H4S E;  2MHH A;  1SRA A;  3GK2 A;  3GOF A;  4WQ3 A;  1UUS A;  3TS5 B;  4NDC A;  5ER4 X;  1EL4 A;  3KHE A;  2WCF A;  2EC6 B;  1WRL A;  2TN4 A;  1NX3 A;  4GPL B;  2FJU B;  2QAC A;  3BUO B;  1XK4 A;  1ZMZ A;  1KFX S;  1KQM B;  1Y1A A;  2K8M B;  1DF0 B;  1YVL A;  3CS1 A;  3PAT A;  3SG7 A;  1DJY A;  2KAY A;  1BR1 B;  1C7W A;  5HKZ A;  1GQM A;  1JFK A;  1XFW O;  2I94 A;  2K61 A;  1DJW A;  2JNX A;  4YGD B;  4BY5 A;  1NCX A;  1W7I B;  5KU1 A;  2BE4 A;  3OX5 A;  1EG3 A;  2LMT A;  1B4C A;  3SIB A;  3OB1 B;  2OS8 C;  5AEQ A;  2Q91 A;  1J1E A;  2SAS A;  1M63 B;  5B8I B;  1FI6 A;  1F54 A;  2KFH A;  1U5I A;  1LXF C;  1KFU L;  1QS7 A;  2M49 B;  2KI4 C;  1IQ5 A;  2KI4 B;  1FF1 A;  1YUR A;  3KEV A;  4C0L A;  4YGB B;  1LA0 A;  3JVT B;  3I5F C;  5I8N A;  2PRU A;  2LMU A;  1AHR A;  4MZJ A;  1ZAC A;  2KHN A;  3WHT B;  5AXI A;  1JBA A;  3D10 A;  1OZO A;  1J7R A;  1G33 A;  1XK4 C;  4YI9 A;  2ISD A;  1K94 A;  2AAO A;  2BCX A;  2JT0 A;  3DF0 A;  1DJX A;  4A4C A;  4GBA A;  4USL A;  1K93 D;  2K7B A;  1DT7 B;  3O4Y A;  1X02 A;  1B8R A;  1NCZ A;  3VRQ A;  5HKY A;  2HQW A;  2ZNE A;  4MZK A;  4YGC B;  3I5G B;  2G9B A;  2VRG A;  4CID A;  2KGB C;  1NSH A;  5DKQ A;  4GNK B;  1SL7 A;  1AJ5 A;  4OKH A;  3NSL A;  5ER5 A;  3CGA A;  1U5I B;  4PDZ A;  1CLM A;  2NXQ A;  5CSJ A;  3PLF B;  4HRE E;  3TDI A;  4PE1 A;  1WRK A;  4PAL A;  4MLW A;  1K9U A;  4PE7 A;  1TNQ A;  4BY4 A;  2LVI A;  5AFP A;  1S6I A;  1SMG A;  1XFZ O;  1YUT A;  1WRZ A;  3QRX A;  5KTY A;  3TZ1 A;  2A4J A;  4NQG A;  1N2D A;  2JPT A;  1ALV A;  2LP2 A;  3LK1 A;  2LHI A;  2BL0 C;  2Y1N A;  3AKA A;  1BJF A;  3SG5 A;  5HLO A;  3DF0 B;  1NX1 A;  1D1O A;  1TIZ A;  1NIW A;  5CSN A;  1LVC D;  3EKH A;  1PAL A;  2KNE A;  1OSA A;  1MXE A;  1IJ6 A;  3DVM A;  3BQ3 A;  2L2E A;  3A4U B;  2H61 C;  1LIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...