1VRKA

The 1.9 angstrom structure of e84k-calmodulin rs20 peptide complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
148
structure length
148
Chain Sequence
b'ADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEKLKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQVNYEEFVQVMMAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALMODULIN
publication title Analysis of the functional coupling between calmodulin's calcium binding and peptide recognition properties.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Complex(calcium-binding protein/peptide)
total genus 53
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 1997-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1vrkA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1vrkA02
1SK6D 2R2IA 2KQ6A 2KYCA 1IJ5A 4MN0A 2LM5A 4ICBA 1S6IA 4WRIA 2KYFA 1XFWO 3NSKA 3TDIA 4AQIA 1PSBA 2Y1NA 3D10A 1BR1B 2K7CA 2EC6B 2KFGA 2L51A 4XJKA 1ODBA 1WLZA 2ZRTA 4QJ3B 5D7FA 1YURA 2WCBA 5AANA 1PULA 2NLNA 1AVSA 3MSEB 1UHIA 2LVJA 1M45A 3KF9A 3D0YA 4XJKB 1UHHA 2K7DA 3ICBA 1SRAA 2E30A 2WNDA 1XK4C 2FCEA 3JVTC 4ETOA 3DVMA 3EKJA 4M2QA 1FW4A 1J1DA 3EVRA 3PM8A 1ALVA 1DJIA 3D0YB 4DIRA 1TCFA 2LANA 4N1GA 2F2PA 1OZOA 3VRQA 1SR6C 1QLSA 1NX3A 4MEWA 2LUCA 1GGZA 1YUUA 1YTZC 5CPVA 1BLQA 1IH0A 3GK2A 3SG4A 1BR4B 5KTYA 4WQ2A 2OTGC 2LMUA 1CKKA 2E6WA 1Y0VH 3CR5X 2F8PA 3IF7A 1OE9B 1A75A 1LA0A 1YRUB 2M1UA 3BUMB 3PN7C 1IWQA 1K9UA 1UHNA 2ZN8A 2KI4B 1JBAA 3BQ3A 4PE7A 1CM4A 1YVLA 2LCPA 5DKQA 4AOMA 1DVIA 3EVUA 4JQ0D 2K7OA 3A4UB 1BOCA 1SL9A 1DJYA 2LHIA 3QRXA 2Y4QA 3DF0B 5JJGA 1TNXA 3WNXB 2BBMA 3KO0A 2ZKMX 4ORCB 1DTLA 2K2FA 1RJVA 1S1EA 1S26D 1Q80A 1TNWA 4DRWA 5DKRA 4PE1A 1SL7A 1QVIZ 3TS5C 3O4YA 1RWYA 1FPWA 2Q4UA 1SCMB 1IJ6A 1CDLA 1M39A 4USLA 2BL0B 2WC8A 1J1EA 2M49B 3PSRA 4MVFA 1ZFSA 1QX7A 1NX1A 3CLNA 1IGVA 2PMYA 4MZJA 2PASA 1XA5A 1TOPA 3HCMA 4GBAA 1CTRA 2JZIA 1JWDA 1B8RA 4FQOA 1OSAA 5HLVA 1J7PA 1F55A 2EHBA 1B8CA 3IQOA 4WQ3A 3BUNB 4D1EA 3BXKA 2Y5IA 1WY9A 2QPTA 2L98A 4CFRA 1QV1A 1U5IA 1AUIB 3DD4A 4C0KA 2BCAA 1R6PA 2VRGA 1K94A 1DJHA 1XO5A 1BT6A 3CR2A 1K95A 4HRGA 2LMTA 3NSIA 1NWDA 1PK0D 2M1KB 1MHOA 2M29A 2LLUA 2L0PA 4YGDB 1PALA 2QACA 3JTDB 1U5IB 1HQVA 2B1UA 4YI9A 3IQQA 3RM1A 2KGBC 5AXIA 3VRPA 1H4BA 1WRKA 1UHJA 3GK1A 1JC2A 1NCXA 1V1GA 3OX5A 1CDPA 1YR5A 3JVTB 1AHRA 1N0YA 1DJGA 3AAKA 5KSZA 1PRWA 1QXPA 3BUOB 1GGWA 5TNCA 2OS8C 2MLFC 4DS7A 2MRDA 2JXCA 1YUSA 1XVJA 2I2RE 2JT0A 3I5FC 2F33A 5CSNA 2HQ8A 1S36A 2NZ0A 5BPJA 1B1GA 3I5IC 1K9PA 2JNXA 2JTZA 1V1FA 2FJUB 3PALA 3VROA 2OTGB 4OKHA 3WXAA 3NSLA 1H8BA 1PSRA 1YRTB 2KFFA 2H61C 2NCPA 3EVVA 1S5GZ 1CFPA 4IL1A 1AK8A 1MR8A 1F71A 5CSJA 1N65A 1YUTA 5HYDA 2JQ6A 2LUXA 2BCXA 3OHMB 3PN7B 1VRKA 1S6JA 2M0RA 4DCKA 4N1FA 3ZNIA 4MBEA 5IBWA 4AQJA 4GAOA 1TTXA 4CPVA 2BECA 1QVIY 1KK8B 4ORAB 4FTGA 1BF5A 1NP8A 1QLKA 5CSIA 2LNKA 1NSHA 2I18A 1DMOA 3JTDC 2DOQA 4JWQA 3TUYC 2LMVA 2F2OA 2LVKA 1A2XA 1OMVA 1QTXA 1LVCD 1WLMA 4YI8A 4OR9B 4GFTA 1F70A 1WRLA 2BKHB 2JWWA 1F8HA 1SW8A 3TS5B 5DKNA 4BY5A 2SASA 2F3ZA 5GQQC 1TCOB 1RFJA 3WHTB 2AAOA 1NIWA 1B7TZ 2JPTA 3AAJA 1MUXA 1CFCA 5HKYA 1IKUA 1M46A 2LLSA 3NSOA 2COLB 1AJ4A 5HKWA 2KBIA 2K8MB 1OQPA 2KI6C 2AMIA 5HLOA 1UHKA 2LAPA 4YRUA 5PALA 1B4CA 2FCDA 2L5XB 1QIWA 1QASA 1C7VA 1KSOA 1BU3A 1W7JB 2JTTA 4MZKA 3BOWA 4A4CA 1QATA 3E3RA 1OMDA 1D1OA 5KU1A 1CMGA 2A4JA 1KK8C 1A75B 1JF0A 1RK9A 2KOTA 1G33A 1GQMA 1JUOA 1SKTA 2K61A 5ER4X 4PCWA 4YGEB 3BUWB 3SJSA 1WDCB 4OV2A 1B8LA 1KFUL 1NPQA 5I2LA 3O2PA 4I5KA 1A03A 2F3YA 2TN4A 2PSRA 1QX5B 3M0WA 3CGAA 1S5GY 2I7AA 1K96A 1ZACA 2JULA 2OS8B 3OB2B 5F6TA 2BBNA 1WRZA 1UWOA 2JU0A 1NX0A 1TRFA 2LP2A 1TN4A 2G2BA 2H2KA 3AKAA 2H61A 3I5FB 4MSPA 4PE0A 5ER5A 1J7QA 3WHUB 1SY9A 4GNKB 2ISDA 2KI6D 1IRJA 3I5IB 4HREE 4CIDA 1KCYA 2L4IA 1DGVA 1DF0A 2EGDA 1LINA 3GK4X 1G8IA 1CDMA 3EK7A 2CXJA 2LHLA 2SCPA 1EH2A 2JNFA 2Y1MA 5K89A 3FWCA 3CZTX 1CLLA 3OB1B 4DUQA 1RECA 2O5GA 2P6BB 4PHNA 1QV0A 4I5LB 3TZ1A 1UUSA 2HF5A 4E68A 2D8NA 4C0JA 3I5GC 1SMGA 2JXLA 1CFFA 5AERA 4GUKA 3FIAA 4QJ5B 3BUXB 2MA2A 3TUYB 1B7TY 4P2YB 2M7NA 4CFQA 1SCVA 4OCIA 1WDCC 2KHNA 1QIVA 1AP4A 4PHKA 2LV7A 1KWOC 1E8AA 1MXLC 1XFZO 1FBVA 1LXFC 2L50A 1N2DA 4NDBA 1ALWA 3TDZA 2GGZA 4YBHB 5I2OA 4N5XA 1XFXO 3EKHA 1OOJA 1Y1AA 4BY4A 1A4PA 3CTNA 4ORBB 1C07A 1UP5A 3ZWHA 1EG4A 3FS7A 1J55A 2K0JA 2LP3A 5AEQA 2CCMA 3O6BA 1KK7Z 4MLWA 4PHJA 4YGAA 4ZCUA 4MZLA 1KQVA 1K90D 1YVHA 3PLFB 5B8IB 2CTNA 3KHEA 2LVVA 1LKJA 1DJXA 4R1EA 2LVIA 2ZN9A 2LE9B 5I2QA 2Q91A 1J7RA 1M31A 4GGFA 1IQ3A 4PALA 1K2HA 1J7OA 3PATA 2LLTA 1X02A 2G9BA 3AKBA 1BODA 4Q04A 3H4SE 1JFJA 1XYDA 2KNEA 2PALA 2HPSA 1NUBA 1JFKA 1TNPA 2CNPA 1K8UA 4XYNA 1NYAA 1MQ1A 1CFDA 3OX6A 4ZCVA 1OMRA 1KQMC 3OP0A 3BYAA 1JF2A 2KBMA 1ZMZA 4MRYA 1S6CA 1CM1A 3I5HC 2NXQA 1CDNA 1RTP1 2M97A 4PHMA 3LCPC 2WORA 4QJ4B 5D69A 3HX4A 3SIAA 1JSAA 3SG6A 1SYMA 1G4YR 1KFXL 1FF1A 1L7ZA 1HT9A 1EXRA 2LC5A 2ZFDA 4MRXA 1QX2A 3DVJA 5JOLA 1B47A 5AFPA 2M9GA 3K21A 1F54A 1W7IB 4NDDA 1L2OC 2BE6A 2PVBA 3CS1A 3A8RA 3I5GB 3LL8B 4HRHA 3DVEA 1DGUA 3TDUA 4C0LA 3PFVA 3SG2A 1SPYA 2CBLA 3LK1A 1EG3A 1EJ3A 3BOWB 4CLNA 2JC2A 1BG1A 4NDCA 2KAYA 1QS7A 1F4QA 1YX7A 4GGFC 1KWOB 5FYXA 1KFXS 2HETA 3CR4X 5J3XA 3SG5A 1K9KA 1SNLA 2WOSA 2JT3A 4TNCA 2GV5A 1KK7Y 1XFVO 3EK8A 2OPOA 2EC6C 1EL4A 3DF0A 5CSFA 1AJ5A 2M3WA 2KSPA 2ZRSA 1F4OA 1PVAA 4NQGA 2BCBA 1NCZA 1XFYO 1ZUZA 1YX8A 3SIBA 2RGIA 2IS9A 5HKZA 2BE4A 1MXEA 4M2OA 2GGMA 2MBXA 2KFHA 2K2AA 1RROA 1OZSA 3LK0A 1B9AA 1KFUS 1DF0B 2M8UA 1CNPA 4YGCB 4HSZA 5G08A 2JOJA 2BKIB 1UURA 1PVBA 4I5JA 5I8NA 3KPXA 2NCOA 2KQYA 2ZNDA 4U8DA 1K93D 3VRNA 1CLMA 1TNQA 1DJZA 1CMFA 1SL8A 1NX2A 2M7LA 1S3PA 2KGRA 2MJWB 1BJFA 2KDHA 3DVKA 4YGBB 3VRRA 2JT8A 4PE4A 3C1VA 2MLEC 4OVNF 3LLEA 1FI6A 1SBJA 1Y1UA 2FOTA 3RLZA 3GOFA 1DJWA 1MWNA 2V53A 4L9MA 3SG7A 4M2PA 4JPZB 1CB1A 2KI4C 4UPGA 3F45A 1KQMB 3EK4A 1LA3A 1XK4A 1MF8B 4P5OE 1GJYA 1Y6WA 3I5HB 2ZNEA 2KAXA 4GGNA 2WCFA 1IQ5A 2CT9A 2KAVA 1QJTA 1CLBA 1R2UA 2MHHA 1M63B 4A4BA 2WCEA 2PRUA 4F0ZB 3FWBA 4PDZA 1TIZA 4GPLB 1FI5A 3CWGA 1IG5A 1BMOA 3NXAA 1Y1XA 1DT7B 2K7BA 1NCYA 3SG3A 2MAZA 4I5NB 1ZOTB 1SR6B 3VGOA 2AUCA 1L2OB 1A29A 1C7WA 3O78A 2I94A 3KEVA 1SCMC 2JRFA 2HQWA 1XFUO 2BL0C 2L4HA 2O60A 1KSMA 2L2EA
chains in the Genus database with same CATH superfamily
1SK6D 2R2IA 2P70A 3B88A 2KQ6A 2KYCA 1IJ5A 4INXA 4MN0A 2LM5A 3L47A 4ICBA 1S6IA 4WRIA 2KYFA 1XFWO 3NSKA 3TDIA 4AQIA 1PSBA 1C3ZA 2Y1NA 3D10A 1BR1B 2K7CA 3OBVA 2EC6B 2KFGA 2L51A 4XJKA 1ODBA 1WLZA 2ZRTA 4QJ3B 5D7FA 1YURA 2WCBA 5AANA 1PULA 2NLNA 1AVSA 2KLEA 1UHIA 2LVJA 3MSEB 1M45A 3N7HA 3KF9A 3D0YA 4XJKB 1UHHA 2K7DA 3ICBA 2QEHA 1SRAA 2E30A 2WNDA 1XK4C 2FCEA 3JVTC 4ETOA 3DVMA 3EKJA 4M2QA 1FW4A 1J1DA 3EVRA 3PM8A 1ALVA 1DJIA 3D0YB 4DIRA 1TCFA 2LANA 4N1GA 2F2PA 1OZOA 3VRQA 1SR6C 3S0BA 1OOHA 1QLSA 1NX3A 4MEWA 2LUCA 3BFBA 4INWA 2QEVA 1GGZA 1YUUA 1YTZC 5CPVA 1BLQA 1IH0A 3GK2A 3SG4A 1BR4B 5KTYA 4WQ2A 2OTGC 2LMUA 1CKKA 2E6WA 1Y0VH 3CR5X 2F8PA 3DY9A 3IF7A 1OE9B 3D78A 1A75A 1LA0A 2ERBA 2PQLA 1YRUB 2M1UA 3BUMB 3PN7C 1IWQA 1K9UA 1UHNA 1Z4HA 2KI4B 2ZN8A 1JBAA 3BQ3A 4PE7A 1CM4A 1YVLA 2LCPA 5DKQA 4AOMA 1DVIA 3S0AA 2QEBA 3EVUA 4JQ0D 2K7OA 3A4UB 1BOCA 1SL9A 1DJYA 1IIOA 2WCJA 2LHIA 3QRXA 2Y4QA 3DF0B 5JJGA 1TNXA 3WNXB 2BBMA 3KO0A 2ZKMX 4ORCB 1DTLA 2K2FA 1RJVA 1S1EA 1S26D 1Q80A 1TNWA 4DRWA 5DKRA 2WCMA 4PE1A 1SL7A 1QVIZ 3TS5C 3O4YA 1RWYA 1FPWA 2Q4UA 1SCMB 1IJ6A 1CDLA 1M39A 4USLA 2BL0B 2WC8A 1J1EA 2M49B 3PSRA 4MVFA 1ZFSA 1QX7A 1NX1A 3NHTA 3CLNA 1IGVA 2PMYA 4MZJA 2PASA 1XA5A 1TOPA 3HCMA 4GBAA 1CTRA 2JZIA 1JWDA 1B8RA 4FQOA 1OSAA 5HLVA 3S0DA 1J7PA 2EHBA 1F55A 1B8CA 3IQOA 4WQ3A 3BUNB 3L4LA 4D1EA 3BXKA 3B86A 2Y5IA 1WY9A 1TUZA 2L98A 2QPTA 4CFRA 1QV1A 1U5IA 1AUIB 3DD4A 4C0KA 2BCAA 1R6PA 2VRGA 1K94A 1DJHA 1XO5A 1BT6A 3CR2A 1K95A 4HRGA 1QWVA 2LMTA 3NSIA 1NWDA 3FE8A 1PK0D 2M1KB 3CABA 1MHOA 2M29A 2LLUA 2L0PA 4YGDB 1PALA 2QACA 3JTDB 1U5IB 1HQVA 2B1UA 4YI9A 3IQQA 3RM1A 2KGBC 5AXIA 3VRPA 1H4BA 1WRKA 2WCKA 1UHJA 3GK1A 1JC2A 1NCXA 1V1GA 2K60A 3Q8IA 3OX5A 1CDPA 1YR5A 3JVTB 1AHRA 3S0GA 1N0YA 1DJGA 3AAKA 5KSZA 1PRWA 1QXPA 2FJYA 3O4XA 3BUOB 1GGWA 3DXLA 5TNCA 4F7FA 1OOGA 2OS8C 2MLFC 4DS7A 2MRDA 2JXCA 1YUSA 1XVJA 2I2RE 2JT0A 3I5FC 2F33A 5CSNA 2HQ8A 1S36A 2NZ0A 5BPJA 1B1GA 5I94A 3I5IC 1K9PA 2JNXA 2JTZA 1V1FA 2FJUB 3PALA 2PYQA 3VROA 2OTGB 4OKHA 3WXAA 3NSLA 3PJIA 1H8BA 1PSRA 2QEOA 1YRTB 2KFFA 2H61C 2NCPA 3EVVA 1S5GZ 1CFPA 4IL1A 1AK8A 1MR8A 1F71A 5CSJA 1N65A 1YUTA 5HYDA 2JQ6A 2QDIA 2LUXA 2BCXA 3OHMB 3PN7B 1VRKA 1S6JA 2M0RA 4DCKA 4N1FA 3ZNIA 4MBEA 5IBWA 4AQJA 4GAOA 1TTXA 4CPVA 2BECA 1QVIY 1KK8B 4ORAB 4FTGA 1BF5A 1NP8A 1QLKA 5CSIA 2LNKA 1NSHA 2I18A 1DMOA 3JTDC 2DOQA 4JWQA 3TUYC 2LMVA 2F2OA 1DEKA 1A2XA 2LVKA 1OMVA 1QTXA 1LVCD 1WLMA 4YI8A 4OR9B 4GFTA 1F70A 1WRLA 2BKHB 2JWWA 1DC1A 1F8HA 1SW8A 2JPOA 5DICA 5DKNA 3TS5B 4BY5A 2SASA 2F3ZA 5GQQC 1TCOB 2WC5A 1RFJA 3WHTB 2AAOA 1NIWA 1B7TZ 2JPTA 3AAJA 1MUXA 3K1EA 1CFCA 3SS3A 5HKYA 3D73A 1IKUA 1M46A 2LLSA 3NSOA 2COLB 3QMEA 1AJ4A 3B6XA 5HKWA 2KBIA 2K8MB 1OQPA 2KI6C 2AMIA 5HLOA 1UHKA 2LAPA 4YRUA 5PALA 1B4CA 2FCDA 2L5XB 1QIWA 2YGUA 1QASA 1ORGA 2H8VA 1C7VA 1KSOA 1BU3A 1W7JB 4JD9A 2P71A 2JTTA 4MZKA 3BOWA 4A4CA 1QATA 3E3RA 1T14A 1OMDA 1D1OA 5KU1A 1CMGA 2A4JA 1KK8C 1A75B 3R72A 1C3YA 1JF0A 1RK9A 2KOTA 1G33A 1GQMA 1JUOA 1SKTA 2K61A 5ER4X 4PCWA 3S0FA 4YGEB 3BUWB 3SJSA 1WDCB 4OV2A 1B8LA 1KFUL 1NPQA 2KPHA 5I2LA 3O2PA 4I5KA 1A03A 2F3YA 2TN4A 2WCHA 2PSRA 1QX5B 3M0WA 2GTEA 3CGAA 1S5GY 2I7AA 1K96A 1ZACA 2JULA 1Z2CB 2OS8B 3OB2B 5F6TA 2BBNA 1WRZA 1UWOA 2JU0A 1NX0A 1TRFA 2LP2A 1TN4A 2G2BA 2H2KA 3AKAA 2H61A 3I5FB 4MSPA 4PE0A 5ER5A 5HL1A 1J7QA 3WHUB 1SY9A 4GNKB 2ISDA 2KI6D 1IRJA 3I5IB 4HREE 4CIDA 3FE9A 1KCYA 2L4IA 1DGVA 1DF0A 2EGDA 1LINA 2L2CA 1G8IA 3GK4X 3PM2A 1CDMA 3EK7A 2CXJA 2LHLA 2SCPA 1EH2A 2JNFA 2Y1MA 5K89A 5FI6A 3FWCA 3CZTX 1CLLA 3OB1B 4DUQA 1RECA 2O5GA 3L4AA 2P6BB 4PHNA 1QV0A 4I5LB 3RZSA 3TZ1A 1UUSA 2HF5A 3CZ1A 4E68A 2D8NA 4C0JA 3I5GC 3CYZA 1SMGA 2JXLA 1CFFA 5AERA 4GUKA 3FIAA 4QJ5B 3UNWA 3BUXB 5D3OA 2MA2A 3D75A 3TUYB 1B7TY 4PT1A 4P2YB 2M7NA 3B87A 4CFQA 3D77A 1SCVA 4OCIA 1WDCC 2KHNA 1QIVA 3OGNA 1AP4A 4PHKA 2LV7A 1KWOC 1E8AA 1MXLC 3BJHA 1XFZO 1FBVA 1LXFC 2L50A 1N2DA 4NDBA 1ALWA 3TDZA 2GGZA 4YBHB 5I2OA 4N5XA 1XFXO 3EKHA 5FI2A 1OOJA 1Y1AA 4BY4A 1A4PA 3CTNA 4ORBB 1C07A 1UP5A 3ZWHA 1EG4A 3FS7A 1J55A 2K0JA 2LP3A 3CZ0A 5AEQA 2WCLA 2CCMA 3O6BA 1KK7Z 4MLWA 4PHJA 4YGAA 4ZCUA 4MZLA 4FQTA 1KQVA 1GM0A 1DELA 1K90D 1TWOA 1YVHA 3PLFB 3UO9A 5B8IB 2CTNA 3KHEA 2LVVA 1LKJA 1DJXA 4R1EA 2LVIA 2ZN9A 3FE6A 2LE9B 3VB1A 5I2QA 2Q91A 1J7RA 3R1OA 1M31A 4GGFA 3S0EA 4PALA 1IQ3A 3SS4A 1K2HA 1J7OA 3PATA 2LLTA 1X02A 2G9BA 3AKBA 1BODA 4Q04A 3H4SE 1JFJA 1XYDA 2KNEA 2PALA 1OW4A 2HPSA 3R1PA 1NUBA 1JFKA 1TNPA 2CNPA 1K8UA 1TUJA 4XYNA 1NYAA 3SS5A 1MQ1A 3NGVA 1CFDA 3OX6A 4ZCVA 1OMRA 1KQMC 3OP0A 3BYAA 1JF2A 2KBMA 1ZMZA 4MRYA 1S6CA 1CM1A 3I5HC 2NXQA 1CDNA 1RTP1 2M97A 4PHMA 3LCPC 3D76A 3B7AA 2WORA 4QJ4B 5D69A 3HX4A 3SIAA 1JSAA 3SG6A 1SYMA 1G4YR 1KFXL 1FF1A 1L7ZA 1HT9A 1EXRA 2LC5A 2ZFDA 4MRXA 2BAPA 1QX2A 2BNXA 3DVJA 5JOLA 3R1VA 1B47A 1W9ZA 2M9GA 3K21A 5AFPA 1F54A 1W7IB 4NDDA 1L2OC 2BE6A 2PVBA 3CS1A 3A8RA 3I5GB 3LL8B 4HRHA 3DVEA 1DGUA 1SSEB 3TDUA 4C0LA 1DQEA 2WC6A 3BFHA 3PFVA 3SG2A 1SPYA 2CBLA 3LK1A 1EG3A 1EJ3A 3BOWB 4CLNA 2JC2A 1BG1A 4NDCA 2KAYA 1QS7A 1F4QA 1YX7A 3V2LA 4GGFC 1KWOB 5FYXA 1KFXS 2HETA 3CR4X 5J3XA 3SG5A 1K9KA 1SNLA 4IJ7A 2WOSA 2JT3A 4TNCA 2GV5A 1KK7Y 1XFVO 3EK8A 2OPOA 2EC6C 1EL4A 3DF0A 5CSFA 1AJ5A 2M3WA 2KSPA 2ZRSA 1F4OA 1PVAA 4NQGA 2BCBA 1NCZA 1XFYO 1ZUZA 4OZDA 1YX8A 5FI7A 3SIBA 2RGIA 2IS9A 3D74A 5HKZA 2BE4A 2KLDA 1MXEA 4M2OA 2GGMA 2MBXA 2KFHA 2K2AA 1RROA 1OZSA 3LK0A 1B9AA 1KFUS 1DF0B 2M8UA 3BFAA 1CNPA 4YGCB 4HSZA 5G08A 2JOJA 2BKIB 1UURA 2L5YA 1PVBA 4I5JA 3DYEA 5I8NA 3KPXA 2NCOA 2KQYA 2ZNDA 4U8DA 1K93D 3VRNA 1CLMA 1TNQA 1DJZA 1CMFA 1OOIX 1SL8A 1NX2A 2M7LA 1S3PA 2KGRA 2MJWB 1BJFA 2KDHA 3DVKA 4YGBB 3VRRA 2JT8A 4PE4A 3C1VA 3IVTA 2MLEC 4OVNF 3LLEA 1OOFA 1FI6A 1SBJA 1Y1UA 2FOTA 3RLZA 3GOFA 1DJWA 1MWNA 2V53A 4L9MA 3SG7A 3CZ2A 4JKTA 4M2PA 4JPZB 1CB1A 2KI4C 4UPGA 3F45A 1KQMB 3EK4A 1LA3A 1XK4A 5EL2A 1MF8B 4P5OE 1GJYA 1Y6WA 3I5HB 2ZNEA 2KAXA 4GGNA 2WCFA 1IQ5A 2CT9A 2KAVA 1QJTA 1CLBA 1R2UA 2MHHA 1LS8A 1M63B 4A4BA 4KYNA 1P28A 2WCEA 2PRUA 4F0ZB 3FWBA 4PDZA 1TIZA 4GPLB 3NHIA 1FI5A 3CWGA 1IG5A 1BMOA 3NXAA 1Y1XA 1DT7B 2K7BA 1NCYA 3SG3A 2MAZA 4I5NB 1ZOTB 3CDNA 1SR6B 1XFRA 3VGOA 2AUCA 1L2OB 1A29A 1C7WA 3O78A 2I94A 3DZTA 3KEVA 1SCMC 2JRFA 2HQWA 1XFUO 2BL0C 2L4HA 2O60A 1KSMA 2L2EA 3EG5B
chains in the Genus database with same CATH topology
1SK6D 2R2IA 2KQ6A 2KYCA 1IJ5A 4MN0A 2LM5A 4ICBA 1S6IA 4WRIA 2KYFA 1XFWO 3NSKA 3TDIA 4AQIA 1PSBA 2Y1NA 3D10A 1BR1B 2K7CA 2EC6B 2KFGA 2L51A 4XJKA 1ODBA 1WLZA 2ZRTA 4QJ3B 5D7FA 1YURA 2WCBA 5AANA 1PULA 2NLNA 1AVSA 3MSEB 1UHIA 2LVJA 1M45A 3KF9A 3D0YA 4XJKB 1UHHA 2K7DA 3ICBA 1SRAA 2E30A 2WNDA 1XK4C 2FCEA 3JVTC 4ETOA 3DVMA 3EKJA 4M2QA 1FW4A 1J1DA 3EVRA 3PM8A 1ALVA 1DJIA 3D0YB 4DIRA 1TCFA 2LANA 4N1GA 2F2PA 1OZOA 3VRQA 1SR6C 1QLSA 1NX3A 4MEWA 2LUCA 1GGZA 1YUUA 1YTZC 5CPVA 1BLQA 1IH0A 3GK2A 3SG4A 1BR4B 5KTYA 4WQ2A 2OTGC 2LMUA 1CKKA 2E6WA 1Y0VH 3CR5X 2F8PA 3IF7A 1OE9B 1A75A 1LA0A 1YRUB 2M1UA 3BUMB 3PN7C 1IWQA 1K9UA 1UHNA 2ZN8A 2KI4B 1JBAA 3BQ3A 4PE7A 1CM4A 1YVLA 2LCPA 5DKQA 4AOMA 1DVIA 3EVUA 4JQ0D 2K7OA 3A4UB 1BOCA 1SL9A 1DJYA 2LHIA 3QRXA 2Y4QA 3DF0B 5JJGA 1TNXA 3WNXB 2BBMA 3KO0A 2ZKMX 4ORCB 1DTLA 2K2FA 1RJVA 1S1EA 1S26D 1Q80A 1TNWA 4DRWA 5DKRA 4PE1A 1SL7A 1QVIZ 3TS5C 3O4YA 1RWYA 1FPWA 2Q4UA 1SCMB 1IJ6A 1CDLA 1M39A 4USLA 2BL0B 2WC8A 1J1EA 2M49B 3PSRA 4MVFA 1ZFSA 1QX7A 1NX1A 3CLNA 1IGVA 2PMYA 4MZJA 2PASA 1XA5A 1TOPA 3HCMA 4GBAA 1CTRA 2JZIA 1JWDA 1B8RA 4FQOA 1OSAA 5HLVA 1J7PA 1F55A 2EHBA 1B8CA 3IQOA 4WQ3A 3BUNB 4D1EA 3BXKA 2Y5IA 1WY9A 2QPTA 2L98A 4CFRA 1QV1A 1U5IA 1AUIB 3DD4A 4C0KA 2BCAA 1R6PA 2VRGA 1K94A 1DJHA 1XO5A 1BT6A 3CR2A 1K95A 4HRGA 2LMTA 3NSIA 1NWDA 1PK0D 2M1KB 1MHOA 2M29A 2LLUA 2L0PA 4YGDB 1PALA 2QACA 3JTDB 1U5IB 1HQVA 2B1UA 4YI9A 3IQQA 3RM1A 2KGBC 5AXIA 3VRPA 1H4BA 1WRKA 1UHJA 3GK1A 1JC2A 1NCXA 1V1GA 3OX5A 1CDPA 1YR5A 3JVTB 1AHRA 1N0YA 1DJGA 3AAKA 5KSZA 1PRWA 1QXPA 3BUOB 1GGWA 5TNCA 2OS8C 2MLFC 4DS7A 2MRDA 2JXCA 1YUSA 1XVJA 2I2RE 2JT0A 3I5FC 2F33A 5CSNA 2HQ8A 1S36A 2NZ0A 5BPJA 1B1GA 3I5IC 1K9PA 2JNXA 2JTZA 1V1FA 2FJUB 3PALA 3VROA 2OTGB 4OKHA 3WXAA 3NSLA 1H8BA 1PSRA 1YRTB 2KFFA 2H61C 2NCPA 3EVVA 1S5GZ 1CFPA 4IL1A 1AK8A 1MR8A 1F71A 5CSJA 1N65A 1YUTA 5HYDA 2JQ6A 2LUXA 2BCXA 3OHMB 3PN7B 1VRKA 1S6JA 2M0RA 4DCKA 4N1FA 3ZNIA 4MBEA 5IBWA 4AQJA 4GAOA 1TTXA 4CPVA 2BECA 1QVIY 1KK8B 4ORAB 4FTGA 1BF5A 1NP8A 1QLKA 5CSIA 2LNKA 1NSHA 2I18A 1DMOA 3JTDC 2DOQA 4JWQA 3TUYC 2LMVA 2F2OA 2LVKA 1A2XA 1OMVA 1QTXA 1LVCD 1WLMA 4YI8A 4OR9B 4GFTA 1F70A 1WRLA 2BKHB 2JWWA 1F8HA 1SW8A 3TS5B 5DKNA 4BY5A 2SASA 2F3ZA 5GQQC 1TCOB 1RFJA 3WHTB 2AAOA 1NIWA 1B7TZ 2JPTA 3AAJA 1MUXA 1CFCA 5HKYA 1IKUA 1M46A 2LLSA 3NSOA 2COLB 1AJ4A 5HKWA 2KBIA 2K8MB 1OQPA 2KI6C 2AMIA 5HLOA 1UHKA 2LAPA 4YRUA 5PALA 1B4CA 2FCDA 2L5XB 1QIWA 1QASA 1C7VA 1KSOA 1BU3A 1W7JB 2JTTA 4MZKA 3BOWA 4A4CA 1QATA 3E3RA 1OMDA 1D1OA 5KU1A 1CMGA 2A4JA 1KK8C 1A75B 1JF0A 1RK9A 2KOTA 1G33A 1GQMA 1JUOA 1SKTA 2K61A 5ER4X 4PCWA 4YGEB 3BUWB 3SJSA 1WDCB 4OV2A 1B8LA 1KFUL 1NPQA 5I2LA 3O2PA 4I5KA 1A03A 2F3YA 2TN4A 2PSRA 1QX5B 3M0WA 3CGAA 1S5GY 2I7AA 1K96A 1ZACA 2JULA 2OS8B 3OB2B 5F6TA 2BBNA 1WRZA 1UWOA 2JU0A 1NX0A 1TRFA 2LP2A 1TN4A 2G2BA 2H2KA 3AKAA 2H61A 3I5FB 4MSPA 4PE0A 5ER5A 1J7QA 3WHUB 1SY9A 4GNKB 2ISDA 2KI6D 1IRJA 3I5IB 4HREE 4CIDA 1KCYA 2L4IA 1DGVA 1DF0A 2EGDA 1LINA 3GK4X 1G8IA 1CDMA 3EK7A 2CXJA 2LHLA 2SCPA 1EH2A 2JNFA 2Y1MA 5K89A 3FWCA 3CZTX 1CLLA 3OB1B 4DUQA 1RECA 2O5GA 2P6BB 4PHNA 1QV0A 4I5LB 3TZ1A 1UUSA 2HF5A 4E68A 2D8NA 4C0JA 3I5GC 1SMGA 2JXLA 1CFFA 5AERA 4GUKA 3FIAA 4QJ5B 3BUXB 2MA2A 3TUYB 1B7TY 4P2YB 2M7NA 4CFQA 1SCVA 4OCIA 1WDCC 2KHNA 1QIVA 1AP4A 4PHKA 2LV7A 1KWOC 1E8AA 1MXLC 1XFZO 1FBVA 1LXFC 2L50A 1N2DA 4NDBA 1ALWA 3TDZA 2GGZA 4YBHB 5I2OA 4N5XA 1XFXO 3EKHA 1OOJA 1Y1AA 4BY4A 1A4PA 3CTNA 4ORBB 1C07A 1UP5A 3ZWHA 1EG4A 3FS7A 1J55A 2K0JA 2LP3A 5AEQA 2CCMA 3O6BA 1KK7Z 4MLWA 4PHJA 4YGAA 4ZCUA 4MZLA 1KQVA 1K90D 1YVHA 3PLFB 5B8IB 2CTNA 3KHEA 2LVVA 1LKJA 1DJXA 4R1EA 2LVIA 2ZN9A 2LE9B 5I2QA 2Q91A 1J7RA 1M31A 4GGFA 1IQ3A 4PALA 1K2HA 1J7OA 3PATA 2LLTA 1X02A 2G9BA 3AKBA 1BODA 4Q04A 3H4SE 1JFJA 1XYDA 2KNEA 2PALA 2HPSA 1NUBA 1JFKA 1TNPA 2CNPA 1K8UA 4XYNA 1NYAA 1MQ1A 1CFDA 3OX6A 4ZCVA 1OMRA 1KQMC 3OP0A 3BYAA 1JF2A 2KBMA 1ZMZA 4MRYA 1S6CA 1CM1A 3I5HC 2NXQA 1CDNA 1RTP1 2M97A 4PHMA 3LCPC 2WORA 4QJ4B 5D69A 3HX4A 3SIAA 1JSAA 3SG6A 1SYMA 1G4YR 1KFXL 1FF1A 1L7ZA 1HT9A 1EXRA 2LC5A 2ZFDA 4MRXA 1QX2A 3DVJA 5JOLA 1B47A 5AFPA 2M9GA 3K21A 1F54A 1W7IB 4NDDA 1L2OC 2BE6A 2PVBA 3CS1A 3A8RA 3I5GB 3LL8B 4HRHA 3DVEA 1DGUA 3TDUA 4C0LA 3PFVA 3SG2A 1SPYA 2CBLA 3LK1A 1EG3A 1EJ3A 3BOWB 4CLNA 2JC2A 1BG1A 4NDCA 2KAYA 1QS7A 1F4QA 1YX7A 4GGFC 1KWOB 5FYXA 1KFXS 2HETA 3CR4X 5J3XA 3SG5A 1K9KA 1SNLA 2WOSA 2JT3A 4TNCA 2GV5A 1KK7Y 1XFVO 3EK8A 2OPOA 2EC6C 1EL4A 3DF0A 5CSFA 1AJ5A 2M3WA 2KSPA 2ZRSA 1F4OA 1PVAA 4NQGA 2BCBA 1NCZA 1XFYO 1ZUZA 1YX8A 3SIBA 2RGIA 2IS9A 5HKZA 2BE4A 1MXEA 4M2OA 2GGMA 2MBXA 2KFHA 2K2AA 1RROA 1OZSA 3LK0A 1B9AA 1KFUS 1DF0B 2M8UA 1CNPA 4YGCB 4HSZA 5G08A 2JOJA 2BKIB 1UURA 1PVBA 4I5JA 5I8NA 3KPXA 2NCOA 2KQYA 2ZNDA 4U8DA 1K93D 3VRNA 1CLMA 1TNQA 1DJZA 1CMFA 1SL8A 1NX2A 2M7LA 1S3PA 2KGRA 2MJWB 1BJFA 2KDHA 3DVKA 4YGBB 3VRRA 2JT8A 4PE4A 3C1VA 2MLEC 4OVNF 3LLEA 1FI6A 1SBJA 1Y1UA 2FOTA 3RLZA 3GOFA 1DJWA 1MWNA 2V53A 4L9MA 3SG7A 4M2PA 4JPZB 1CB1A 2KI4C 4UPGA 3F45A 1KQMB 3EK4A 1LA3A 1XK4A 1MF8B 4P5OE 1GJYA 1Y6WA 3I5HB 2ZNEA 2KAXA 4GGNA 2WCFA 1IQ5A 2CT9A 2KAVA 1QJTA 1CLBA 1R2UA 2MHHA 1M63B 4A4BA 2WCEA 2PRUA 4F0ZB 3FWBA 4PDZA 1TIZA 4GPLB 1FI5A 3CWGA 1IG5A 1BMOA 3NXAA 1Y1XA 1DT7B 2K7BA 1NCYA 3SG3A 2MAZA 4I5NB 1ZOTB 1SR6B 3VGOA 2AUCA 1L2OB 1A29A 1C7WA 3O78A 2I94A 3KEVA 1SCMC 2JRFA 2HQWA 1XFUO 2BL0C 2L4HA 2O60A 1KSMA 2L2EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SK6 D;  2R2I A;  2KQ6 A;  2KYC A;  1IJ5 A;  4MN0 A;  2LM5 A;  4ICB A;  1S6I A;  4WRI A;  2KYF A;  1XFW O;  3NSK A;  3TDI A;  4AQI A;  1PSB A;  2Y1N A;  3D10 A;  1BR1 B;  2K7C A;  2EC6 B;  2KFG A;  2L51 A;  4XJK A;  1ODB A;  1WLZ A;  2ZRT A;  4QJ3 B;  5D7F A;  1YUR A;  2WCB A;  5AAN A;  1PUL A;  2NLN A;  1AVS A;  3MSE B;  1UHI A;  2LVJ A;  1M45 A;  3KF9 A;  3D0Y A;  4XJK B;  1UHH A;  2K7D A;  3ICB A;  1SRA A;  2E30 A;  2WND A;  1XK4 C;  2FCE A;  3JVT C;  4ETO A;  3DVM A;  3EKJ A;  4M2Q A;  1FW4 A;  1J1D A;  3EVR A;  3PM8 A;  1ALV A;  1DJI A;  3D0Y B;  4DIR A;  1TCF A;  2LAN A;  4N1G A;  2F2P A;  1OZO A;  3VRQ A;  1SR6 C;  1QLS A;  1NX3 A;  4MEW A;  2LUC A;  1GGZ A;  1YUU A;  1YTZ C;  5CPV A;  1BLQ A;  1IH0 A;  3GK2 A;  3SG4 A;  1BR4 B;  5KTY A;  4WQ2 A;  2OTG C;  2LMU A;  1CKK A;  2E6W A;  1Y0V H;  3CR5 X;  2F8P A;  3IF7 A;  1OE9 B;  1A75 A;  1LA0 A;  1YRU B;  2M1U A;  3BUM B;  3PN7 C;  1IWQ A;  1K9U A;  1UHN A;  2ZN8 A;  2KI4 B;  1JBA A;  3BQ3 A;  4PE7 A;  1CM4 A;  1YVL A;  2LCP A;  5DKQ A;  4AOM A;  1DVI A;  3EVU A;  4JQ0 D;  2K7O A;  3A4U B;  1BOC A;  1SL9 A;  1DJY A;  2LHI A;  3QRX A;  2Y4Q A;  3DF0 B;  5JJG A;  1TNX A;  3WNX B;  2BBM A;  3KO0 A;  2ZKM X;  4ORC B;  1DTL A;  2K2F A;  1RJV A;  1S1E A;  1S26 D;  1Q80 A;  1TNW A;  4DRW A;  5DKR A;  4PE1 A;  1SL7 A;  1QVI Z;  3TS5 C;  3O4Y A;  1RWY A;  1FPW A;  2Q4U A;  1SCM B;  1IJ6 A;  1CDL A;  1M39 A;  4USL A;  2BL0 B;  2WC8 A;  1J1E A;  2M49 B;  3PSR A;  4MVF A;  1ZFS A;  1QX7 A;  1NX1 A;  3CLN A;  1IGV A;  2PMY A;  4MZJ A;  2PAS A;  1XA5 A;  1TOP A;  3HCM A;  4GBA A;  1CTR A;  2JZI A;  1JWD A;  1B8R A;  4FQO A;  1OSA A;  5HLV A;  1J7P A;  1F55 A;  2EHB A;  1B8C A;  3IQO A;  4WQ3 A;  3BUN B;  4D1E A;  3BXK A;  2Y5I A;  1WY9 A;  2QPT A;  2L98 A;  4CFR A;  1QV1 A;  1U5I A;  1AUI B;  3DD4 A;  4C0K A;  2BCA A;  1R6P A;  2VRG A;  1K94 A;  1DJH A;  1XO5 A;  1BT6 A;  3CR2 A;  1K95 A;  4HRG A;  2LMT A;  3NSI A;  1NWD A;  1PK0 D;  2M1K B;  1MHO A;  2M29 A;  2LLU A;  2L0P A;  4YGD B;  1PAL A;  2QAC A;  3JTD B;  1U5I B;  1HQV A;  2B1U A;  4YI9 A;  3IQQ A;  3RM1 A;  2KGB C;  5AXI A;  3VRP A;  1H4B A;  1WRK A;  1UHJ A;  3GK1 A;  1JC2 A;  1NCX A;  1V1G A;  3OX5 A;  1CDP A;  1YR5 A;  3JVT B;  1AHR A;  1N0Y A;  1DJG A;  3AAK A;  5KSZ A;  1PRW A;  1QXP A;  3BUO B;  1GGW A;  5TNC A;  2OS8 C;  2MLF C;  4DS7 A;  2MRD A;  2JXC A;  1YUS A;  1XVJ A;  2I2R E;  2JT0 A;  3I5F C;  2F33 A;  5CSN A;  2HQ8 A;  1S36 A;  2NZ0 A;  5BPJ A;  1B1G A;  3I5I C;  1K9P A;  2JNX A;  2JTZ A;  1V1F A;  2FJU B;  3PAL A;  3VRO A;  2OTG B;  4OKH A;  3WXA A;  3NSL A;  1H8B A;  1PSR A;  1YRT B;  2KFF A;  2H61 C;  2NCP A;  3EVV A;  1S5G Z;  1CFP A;  4IL1 A;  1AK8 A;  1MR8 A;  1F71 A;  5CSJ A;  1N65 A;  1YUT A;  5HYD A;  2JQ6 A;  2LUX A;  2BCX A;  3OHM B;  3PN7 B;  1VRK A;  1S6J A;  2M0R A;  4DCK A;  4N1F A;  3ZNI A;  4MBE A;  5IBW A;  4AQJ A;  4GAO A;  1TTX A;  4CPV A;  2BEC A;  1QVI Y;  1KK8 B;  4ORA B;  4FTG A;  1BF5 A;  1NP8 A;  1QLK A;  5CSI A;  2LNK A;  1NSH A;  2I18 A;  1DMO A;  3JTD C;  2DOQ A;  4JWQ A;  3TUY C;  2LMV A;  2F2O A;  2LVK A;  1A2X A;  1OMV A;  1QTX A;  1LVC D;  1WLM A;  4YI8 A;  4OR9 B;  4GFT A;  1F70 A;  1WRL A;  2BKH B;  2JWW A;  1F8H A;  1SW8 A;  3TS5 B;  5DKN A;  4BY5 A;  2SAS A;  2F3Z A;  5GQQ C;  1TCO B;  1RFJ A;  3WHT B;  2AAO A;  1NIW A;  1B7T Z;  2JPT A;  3AAJ A;  1MUX A;  1CFC A;  5HKY A;  1IKU A;  1M46 A;  2LLS A;  3NSO A;  2COL B;  1AJ4 A;  5HKW A;  2KBI A;  2K8M B;  1OQP A;  2KI6 C;  2AMI A;  5HLO A;  1UHK A;  2LAP A;  4YRU A;  5PAL A;  1B4C A;  2FCD A;  2L5X B;  1QIW A;  1QAS A;  1C7V A;  1KSO A;  1BU3 A;  1W7J B;  2JTT A;  4MZK A;  3BOW A;  4A4C A;  1QAT A;  3E3R A;  1OMD A;  1D1O A;  5KU1 A;  1CMG A;  2A4J A;  1KK8 C;  1A75 B;  1JF0 A;  1RK9 A;  2KOT A;  1G33 A;  1GQM A;  1JUO A;  1SKT A;  2K61 A;  5ER4 X;  4PCW A;  4YGE B;  3BUW B;  3SJS A;  1WDC B;  4OV2 A;  1B8L A;  1KFU L;  1NPQ A;  5I2L A;  3O2P A;  4I5K A;  1A03 A;  2F3Y A;  2TN4 A;  2PSR A;  1QX5 B;  3M0W A;  3CGA A;  1S5G Y;  2I7A A;  1K96 A;  1ZAC A;  2JUL A;  2OS8 B;  3OB2 B;  5F6T A;  2BBN A;  1WRZ A;  1UWO A;  2JU0 A;  1NX0 A;  1TRF A;  2LP2 A;  1TN4 A;  2G2B A;  2H2K A;  3AKA A;  2H61 A;  3I5F B;  4MSP A;  4PE0 A;  5ER5 A;  1J7Q A;  3WHU B;  1SY9 A;  4GNK B;  2ISD A;  2KI6 D;  1IRJ A;  3I5I B;  4HRE E;  4CID A;  1KCY A;  2L4I A;  1DGV A;  1DF0 A;  2EGD A;  1LIN A;  3GK4 X;  1G8I A;  1CDM A;  3EK7 A;  2CXJ A;  2LHL A;  2SCP A;  1EH2 A;  2JNF A;  2Y1M A;  5K89 A;  3FWC A;  3CZT X;  1CLL A;  3OB1 B;  4DUQ A;  1REC A;  2O5G A;  2P6B B;  4PHN A;  1QV0 A;  4I5L B;  3TZ1 A;  1UUS A;  2HF5 A;  4E68 A;  2D8N A;  4C0J A;  3I5G C;  1SMG A;  2JXL A;  1CFF A;  5AER A;  4GUK A;  3FIA A;  4QJ5 B;  3BUX B;  2MA2 A;  3TUY B;  1B7T Y;  4P2Y B;  2M7N A;  4CFQ A;  1SCV A;  4OCI A;  1WDC C;  2KHN A;  1QIV A;  1AP4 A;  4PHK A;  2LV7 A;  1KWO C;  1E8A A;  1MXL C;  1XFZ O;  1FBV A;  1LXF C;  2L50 A;  1N2D A;  4NDB A;  1ALW A;  3TDZ A;  2GGZ A;  4YBH B;  5I2O A;  4N5X A;  1XFX O;  3EKH A;  1OOJ A;  1Y1A A;  4BY4 A;  1A4P A;  3CTN A;  4ORB B;  1C07 A;  1UP5 A;  3ZWH A;  1EG4 A;  3FS7 A;  1J55 A;  2K0J A;  2LP3 A;  5AEQ A;  2CCM A;  3O6B A;  1KK7 Z;  4MLW A;  4PHJ A;  4YGA A;  4ZCU A;  4MZL A;  1KQV A;  1K90 D;  1YVH A;  3PLF B;  5B8I B;  2CTN A;  3KHE A;  2LVV A;  1LKJ A;  1DJX A;  4R1E A;  2LVI A;  2ZN9 A;  2LE9 B;  5I2Q A;  2Q91 A;  1J7R A;  1M31 A;  4GGF A;  1IQ3 A;  4PAL A;  1K2H A;  1J7O A;  3PAT A;  2LLT A;  1X02 A;  2G9B A;  3AKB A;  1BOD A;  4Q04 A;  3H4S E;  1JFJ A;  1XYD A;  2KNE A;  2PAL A;  2HPS A;  1NUB A;  1JFK A;  1TNP A;  2CNP A;  1K8U A;  4XYN A;  1NYA A;  1MQ1 A;  1CFD A;  3OX6 A;  4ZCV A;  1OMR A;  1KQM C;  3OP0 A;  3BYA A;  1JF2 A;  2KBM A;  1ZMZ A;  4MRY A;  1S6C A;  1CM1 A;  3I5H C;  2NXQ A;  1CDN A;  1RTP 1;  2M97 A;  4PHM A;  3LCP C;  2WOR A;  4QJ4 B;  5D69 A;  3HX4 A;  3SIA A;  1JSA A;  3SG6 A;  1SYM A;  1G4Y R;  1KFX L;  1FF1 A;  1L7Z A;  1HT9 A;  1EXR A;  2LC5 A;  2ZFD A;  4MRX A;  1QX2 A;  3DVJ A;  5JOL A;  1B47 A;  5AFP A;  2M9G A;  3K21 A;  1F54 A;  1W7I B;  4NDD A;  1L2O C;  2BE6 A;  2PVB A;  3CS1 A;  3A8R A;  3I5G B;  3LL8 B;  4HRH A;  3DVE A;  1DGU A;  3TDU A;  4C0L A;  3PFV A;  3SG2 A;  1SPY A;  2CBL A;  3LK1 A;  1EG3 A;  1EJ3 A;  3BOW B;  4CLN A;  2JC2 A;  1BG1 A;  4NDC A;  2KAY A;  1QS7 A;  1F4Q A;  1YX7 A;  4GGF C;  1KWO B;  5FYX A;  1KFX S;  2HET A;  3CR4 X;  5J3X A;  3SG5 A;  1K9K A;  1SNL A;  2WOS A;  2JT3 A;  4TNC A;  2GV5 A;  1KK7 Y;  1XFV O;  3EK8 A;  2OPO A;  2EC6 C;  1EL4 A;  3DF0 A;  5CSF A;  1AJ5 A;  2M3W A;  2KSP A;  2ZRS A;  1F4O A;  1PVA A;  4NQG A;  2BCB A;  1NCZ A;  1XFY O;  1ZUZ A;  1YX8 A;  3SIB A;  2RGI A;  2IS9 A;  5HKZ A;  2BE4 A;  1MXE A;  4M2O A;  2GGM A;  2MBX A;  2KFH A;  2K2A A;  1RRO A;  1OZS A;  3LK0 A;  1B9A A;  1KFU S;  1DF0 B;  2M8U A;  1CNP A;  4YGC B;  4HSZ A;  5G08 A;  2JOJ A;  2BKI B;  1UUR A;  1PVB A;  4I5J A;  5I8N A;  3KPX A;  2NCO A;  2KQY A;  2ZND A;  4U8D A;  1K93 D;  3VRN A;  1CLM A;  1TNQ A;  1DJZ A;  1CMF A;  1SL8 A;  1NX2 A;  2M7L A;  1S3P A;  2KGR A;  2MJW B;  1BJF A;  2KDH A;  3DVK A;  4YGB B;  3VRR A;  2JT8 A;  4PE4 A;  3C1V A;  2MLE C;  4OVN F;  3LLE A;  1FI6 A;  1SBJ A;  1Y1U A;  2FOT A;  3RLZ A;  3GOF A;  1DJW A;  1MWN A;  2V53 A;  4L9M A;  3SG7 A;  4M2P A;  4JPZ B;  1CB1 A;  2KI4 C;  4UPG A;  3F45 A;  1KQM B;  3EK4 A;  1LA3 A;  1XK4 A;  1MF8 B;  4P5O E;  1GJY A;  1Y6W A;  3I5H B;  2ZNE A;  2KAX A;  4GGN A;  2WCF A;  1IQ5 A;  2CT9 A;  2KAV A;  1QJT A;  1CLB A;  1R2U A;  2MHH A;  1M63 B;  4A4B A;  2WCE A;  2PRU A;  4F0Z B;  3FWB A;  4PDZ A;  1TIZ A;  4GPL B;  1FI5 A;  3CWG A;  1IG5 A;  1BMO A;  3NXA A;  1Y1X A;  1DT7 B;  2K7B A;  1NCY A;  3SG3 A;  2MAZ A;  4I5N B;  1ZOT B;  1SR6 B;  3VGO A;  2AUC A;  1L2O B;  1A29 A;  1C7W A;  3O78 A;  2I94 A;  3KEV A;  1SCM C;  2JRF A;  2HQW A;  1XFU O;  2BL0 C;  2L4H A;  2O60 A;  1KSM A;  2L2E A; 
#chains in the Genus database with same CATH topology
 1SK6 D;  2R2I A;  2P70 A;  3B88 A;  2KQ6 A;  2KYC A;  1IJ5 A;  4INX A;  4MN0 A;  2LM5 A;  3L47 A;  4ICB A;  1S6I A;  4WRI A;  2KYF A;  1XFW O;  3NSK A;  3TDI A;  4AQI A;  1PSB A;  1C3Z A;  2Y1N A;  3D10 A;  1BR1 B;  2K7C A;  3OBV A;  2EC6 B;  2KFG A;  2L51 A;  4XJK A;  1ODB A;  1WLZ A;  2ZRT A;  4QJ3 B;  5D7F A;  1YUR A;  2WCB A;  5AAN A;  1PUL A;  2NLN A;  1AVS A;  2KLE A;  1UHI A;  2LVJ A;  3MSE B;  1M45 A;  3N7H A;  3KF9 A;  3D0Y A;  4XJK B;  1UHH A;  2K7D A;  3ICB A;  2QEH A;  1SRA A;  2E30 A;  2WND A;  1XK4 C;  2FCE A;  3JVT C;  4ETO A;  3DVM A;  3EKJ A;  4M2Q A;  1FW4 A;  1J1D A;  3EVR A;  3PM8 A;  1ALV A;  1DJI A;  3D0Y B;  4DIR A;  1TCF A;  2LAN A;  4N1G A;  2F2P A;  1OZO A;  3VRQ A;  1SR6 C;  3S0B A;  1OOH A;  1QLS A;  1NX3 A;  4MEW A;  2LUC A;  3BFB A;  4INW A;  2QEV A;  1GGZ A;  1YUU A;  1YTZ C;  5CPV A;  1BLQ A;  1IH0 A;  3GK2 A;  3SG4 A;  1BR4 B;  5KTY A;  4WQ2 A;  2OTG C;  2LMU A;  1CKK A;  2E6W A;  1Y0V H;  3CR5 X;  2F8P A;  3DY9 A;  3IF7 A;  1OE9 B;  3D78 A;  1A75 A;  1LA0 A;  2ERB A;  2PQL A;  1YRU B;  2M1U A;  3BUM B;  3PN7 C;  1IWQ A;  1K9U A;  1UHN A;  1Z4H A;  2KI4 B;  2ZN8 A;  1JBA A;  3BQ3 A;  4PE7 A;  1CM4 A;  1YVL A;  2LCP A;  5DKQ A;  4AOM A;  1DVI A;  3S0A A;  2QEB A;  3EVU A;  4JQ0 D;  2K7O A;  3A4U B;  1BOC A;  1SL9 A;  1DJY A;  1IIO A;  2WCJ A;  2LHI A;  3QRX A;  2Y4Q A;  3DF0 B;  5JJG A;  1TNX A;  3WNX B;  2BBM A;  3KO0 A;  2ZKM X;  4ORC B;  1DTL A;  2K2F A;  1RJV A;  1S1E A;  1S26 D;  1Q80 A;  1TNW A;  4DRW A;  5DKR A;  2WCM A;  4PE1 A;  1SL7 A;  1QVI Z;  3TS5 C;  3O4Y A;  1RWY A;  1FPW A;  2Q4U A;  1SCM B;  1IJ6 A;  1CDL A;  1M39 A;  4USL A;  2BL0 B;  2WC8 A;  1J1E A;  2M49 B;  3PSR A;  4MVF A;  1ZFS A;  1QX7 A;  1NX1 A;  3NHT A;  3CLN A;  1IGV A;  2PMY A;  4MZJ A;  2PAS A;  1XA5 A;  1TOP A;  3HCM A;  4GBA A;  1CTR A;  2JZI A;  1JWD A;  1B8R A;  4FQO A;  1OSA A;  5HLV A;  3S0D A;  1J7P A;  2EHB A;  1F55 A;  1B8C A;  3IQO A;  4WQ3 A;  3BUN B;  3L4L A;  4D1E A;  3BXK A;  3B86 A;  2Y5I A;  1WY9 A;  1TUZ A;  2L98 A;  2QPT A;  4CFR A;  1QV1 A;  1U5I A;  1AUI B;  3DD4 A;  4C0K A;  2BCA A;  1R6P A;  2VRG A;  1K94 A;  1DJH A;  1XO5 A;  1BT6 A;  3CR2 A;  1K95 A;  4HRG A;  1QWV A;  2LMT A;  3NSI A;  1NWD A;  3FE8 A;  1PK0 D;  2M1K B;  3CAB A;  1MHO A;  2M29 A;  2LLU A;  2L0P A;  4YGD B;  1PAL A;  2QAC A;  3JTD B;  1U5I B;  1HQV A;  2B1U A;  4YI9 A;  3IQQ A;  3RM1 A;  2KGB C;  5AXI A;  3VRP A;  1H4B A;  1WRK A;  2WCK A;  1UHJ A;  3GK1 A;  1JC2 A;  1NCX A;  1V1G A;  2K60 A;  3Q8I A;  3OX5 A;  1CDP A;  1YR5 A;  3JVT B;  1AHR A;  3S0G A;  1N0Y A;  1DJG A;  3AAK A;  5KSZ A;  1PRW A;  1QXP A;  2FJY A;  3O4X A;  3BUO B;  1GGW A;  3DXL A;  5TNC A;  4F7F A;  1OOG A;  2OS8 C;  2MLF C;  4DS7 A;  2MRD A;  2JXC A;  1YUS A;  1XVJ A;  2I2R E;  2JT0 A;  3I5F C;  2F33 A;  5CSN A;  2HQ8 A;  1S36 A;  2NZ0 A;  5BPJ A;  1B1G A;  5I94 A;  3I5I C;  1K9P A;  2JNX A;  2JTZ A;  1V1F A;  2FJU B;  3PAL A;  2PYQ A;  3VRO A;  2OTG B;  4OKH A;  3WXA A;  3NSL A;  3PJI A;  1H8B A;  1PSR A;  2QEO A;  1YRT B;  2KFF A;  2H61 C;  2NCP A;  3EVV A;  1S5G Z;  1CFP A;  4IL1 A;  1AK8 A;  1MR8 A;  1F71 A;  5CSJ A;  1N65 A;  1YUT A;  5HYD A;  2JQ6 A;  2QDI A;  2LUX A;  2BCX A;  3OHM B;  3PN7 B;  1VRK A;  1S6J A;  2M0R A;  4DCK A;  4N1F A;  3ZNI A;  4MBE A;  5IBW A;  4AQJ A;  4GAO A;  1TTX A;  4CPV A;  2BEC A;  1QVI Y;  1KK8 B;  4ORA B;  4FTG A;  1BF5 A;  1NP8 A;  1QLK A;  5CSI A;  2LNK A;  1NSH A;  2I18 A;  1DMO A;  3JTD C;  2DOQ A;  4JWQ A;  3TUY C;  2LMV A;  2F2O A;  1DEK A;  1A2X A;  2LVK A;  1OMV A;  1QTX A;  1LVC D;  1WLM A;  4YI8 A;  4OR9 B;  4GFT A;  1F70 A;  1WRL A;  2BKH B;  2JWW A;  1DC1 A;  1F8H A;  1SW8 A;  2JPO A;  5DIC A;  5DKN A;  3TS5 B;  4BY5 A;  2SAS A;  2F3Z A;  5GQQ C;  1TCO B;  2WC5 A;  1RFJ A;  3WHT B;  2AAO A;  1NIW A;  1B7T Z;  2JPT A;  3AAJ A;  1MUX A;  3K1E A;  1CFC A;  3SS3 A;  5HKY A;  3D73 A;  1IKU A;  1M46 A;  2LLS A;  3NSO A;  2COL B;  3QME A;  1AJ4 A;  3B6X A;  5HKW A;  2KBI A;  2K8M B;  1OQP A;  2KI6 C;  2AMI A;  5HLO A;  1UHK A;  2LAP A;  4YRU A;  5PAL A;  1B4C A;  2FCD A;  2L5X B;  1QIW A;  2YGU A;  1QAS A;  1ORG A;  2H8V A;  1C7V A;  1KSO A;  1BU3 A;  1W7J B;  4JD9 A;  2P71 A;  2JTT A;  4MZK A;  3BOW A;  4A4C A;  1QAT A;  3E3R A;  1T14 A;  1OMD A;  1D1O A;  5KU1 A;  1CMG A;  2A4J A;  1KK8 C;  1A75 B;  3R72 A;  1C3Y A;  1JF0 A;  1RK9 A;  2KOT A;  1G33 A;  1GQM A;  1JUO A;  1SKT A;  2K61 A;  5ER4 X;  4PCW A;  3S0F A;  4YGE B;  3BUW B;  3SJS A;  1WDC B;  4OV2 A;  1B8L A;  1KFU L;  1NPQ A;  2KPH A;  5I2L A;  3O2P A;  4I5K A;  1A03 A;  2F3Y A;  2TN4 A;  2WCH A;  2PSR A;  1QX5 B;  3M0W A;  2GTE A;  3CGA A;  1S5G Y;  2I7A A;  1K96 A;  1ZAC A;  2JUL A;  1Z2C B;  2OS8 B;  3OB2 B;  5F6T A;  2BBN A;  1WRZ A;  1UWO A;  2JU0 A;  1NX0 A;  1TRF A;  2LP2 A;  1TN4 A;  2G2B A;  2H2K A;  3AKA A;  2H61 A;  3I5F B;  4MSP A;  4PE0 A;  5ER5 A;  5HL1 A;  1J7Q A;  3WHU B;  1SY9 A;  4GNK B;  2ISD A;  2KI6 D;  1IRJ A;  3I5I B;  4HRE E;  4CID A;  3FE9 A;  1KCY A;  2L4I A;  1DGV A;  1DF0 A;  2EGD A;  1LIN A;  2L2C A;  1G8I A;  3GK4 X;  3PM2 A;  1CDM A;  3EK7 A;  2CXJ A;  2LHL A;  2SCP A;  1EH2 A;  2JNF A;  2Y1M A;  5K89 A;  5FI6 A;  3FWC A;  3CZT X;  1CLL A;  3OB1 B;  4DUQ A;  1REC A;  2O5G A;  3L4A A;  2P6B B;  4PHN A;  1QV0 A;  4I5L B;  3RZS A;  3TZ1 A;  1UUS A;  2HF5 A;  3CZ1 A;  4E68 A;  2D8N A;  4C0J A;  3I5G C;  3CYZ A;  1SMG A;  2JXL A;  1CFF A;  5AER A;  4GUK A;  3FIA A;  4QJ5 B;  3UNW A;  3BUX B;  5D3O A;  2MA2 A;  3D75 A;  3TUY B;  1B7T Y;  4PT1 A;  4P2Y B;  2M7N A;  3B87 A;  4CFQ A;  3D77 A;  1SCV A;  4OCI A;  1WDC C;  2KHN A;  1QIV A;  3OGN A;  1AP4 A;  4PHK A;  2LV7 A;  1KWO C;  1E8A A;  1MXL C;  3BJH A;  1XFZ O;  1FBV A;  1LXF C;  2L50 A;  1N2D A;  4NDB A;  1ALW A;  3TDZ A;  2GGZ A;  4YBH B;  5I2O A;  4N5X A;  1XFX O;  3EKH A;  5FI2 A;  1OOJ A;  1Y1A A;  4BY4 A;  1A4P A;  3CTN A;  4ORB B;  1C07 A;  1UP5 A;  3ZWH A;  1EG4 A;  3FS7 A;  1J55 A;  2K0J A;  2LP3 A;  3CZ0 A;  5AEQ A;  2WCL A;  2CCM A;  3O6B A;  1KK7 Z;  4MLW A;  4PHJ A;  4YGA A;  4ZCU A;  4MZL A;  4FQT A;  1KQV A;  1GM0 A;  1DEL A;  1K90 D;  1TWO A;  1YVH A;  3PLF B;  3UO9 A;  5B8I B;  2CTN A;  3KHE A;  2LVV A;  1LKJ A;  1DJX A;  4R1E A;  2LVI A;  2ZN9 A;  3FE6 A;  2LE9 B;  3VB1 A;  5I2Q A;  2Q91 A;  1J7R A;  3R1O A;  1M31 A;  4GGF A;  3S0E A;  4PAL A;  1IQ3 A;  3SS4 A;  1K2H A;  1J7O A;  3PAT A;  2LLT A;  1X02 A;  2G9B A;  3AKB A;  1BOD A;  4Q04 A;  3H4S E;  1JFJ A;  1XYD A;  2KNE A;  2PAL A;  1OW4 A;  2HPS A;  3R1P A;  1NUB A;  1JFK A;  1TNP A;  2CNP A;  1K8U A;  1TUJ A;  4XYN A;  1NYA A;  3SS5 A;  1MQ1 A;  3NGV A;  1CFD A;  3OX6 A;  4ZCV A;  1OMR A;  1KQM C;  3OP0 A;  3BYA A;  1JF2 A;  2KBM A;  1ZMZ A;  4MRY A;  1S6C A;  1CM1 A;  3I5H C;  2NXQ A;  1CDN A;  1RTP 1;  2M97 A;  4PHM A;  3LCP C;  3D76 A;  3B7A A;  2WOR A;  4QJ4 B;  5D69 A;  3HX4 A;  3SIA A;  1JSA A;  3SG6 A;  1SYM A;  1G4Y R;  1KFX L;  1FF1 A;  1L7Z A;  1HT9 A;  1EXR A;  2LC5 A;  2ZFD A;  4MRX A;  2BAP A;  1QX2 A;  2BNX A;  3DVJ A;  5JOL A;  3R1V A;  1B47 A;  1W9Z A;  2M9G A;  3K21 A;  5AFP A;  1F54 A;  1W7I B;  4NDD A;  1L2O C;  2BE6 A;  2PVB A;  3CS1 A;  3A8R A;  3I5G B;  3LL8 B;  4HRH A;  3DVE A;  1DGU A;  1SSE B;  3TDU A;  4C0L A;  1DQE A;  2WC6 A;  3BFH A;  3PFV A;  3SG2 A;  1SPY A;  2CBL A;  3LK1 A;  1EG3 A;  1EJ3 A;  3BOW B;  4CLN A;  2JC2 A;  1BG1 A;  4NDC A;  2KAY A;  1QS7 A;  1F4Q A;  1YX7 A;  3V2L A;  4GGF C;  1KWO B;  5FYX A;  1KFX S;  2HET A;  3CR4 X;  5J3X A;  3SG5 A;  1K9K A;  1SNL A;  4IJ7 A;  2WOS A;  2JT3 A;  4TNC A;  2GV5 A;  1KK7 Y;  1XFV O;  3EK8 A;  2OPO A;  2EC6 C;  1EL4 A;  3DF0 A;  5CSF A;  1AJ5 A;  2M3W A;  2KSP A;  2ZRS A;  1F4O A;  1PVA A;  4NQG A;  2BCB A;  1NCZ A;  1XFY O;  1ZUZ A;  4OZD A;  1YX8 A;  5FI7 A;  3SIB A;  2RGI A;  2IS9 A;  3D74 A;  5HKZ A;  2BE4 A;  2KLD A;  1MXE A;  4M2O A;  2GGM A;  2MBX A;  2KFH A;  2K2A A;  1RRO A;  1OZS A;  3LK0 A;  1B9A A;  1KFU S;  1DF0 B;  2M8U A;  3BFA A;  1CNP A;  4YGC B;  4HSZ A;  5G08 A;  2JOJ A;  2BKI B;  1UUR A;  2L5Y A;  1PVB A;  4I5J A;  3DYE A;  5I8N A;  3KPX A;  2NCO A;  2KQY A;  2ZND A;  4U8D A;  1K93 D;  3VRN A;  1CLM A;  1TNQ A;  1DJZ A;  1CMF A;  1OOI X;  1SL8 A;  1NX2 A;  2M7L A;  1S3P A;  2KGR A;  2MJW B;  1BJF A;  2KDH A;  3DVK A;  4YGB B;  3VRR A;  2JT8 A;  4PE4 A;  3C1V A;  3IVT A;  2MLE C;  4OVN F;  3LLE A;  1OOF A;  1FI6 A;  1SBJ A;  1Y1U A;  2FOT A;  3RLZ A;  3GOF A;  1DJW A;  1MWN A;  2V53 A;  4L9M A;  3SG7 A;  3CZ2 A;  4JKT A;  4M2P A;  4JPZ B;  1CB1 A;  2KI4 C;  4UPG A;  3F45 A;  1KQM B;  3EK4 A;  1LA3 A;  1XK4 A;  5EL2 A;  1MF8 B;  4P5O E;  1GJY A;  1Y6W A;  3I5H B;  2ZNE A;  2KAX A;  4GGN A;  2WCF A;  1IQ5 A;  2CT9 A;  2KAV A;  1QJT A;  1CLB A;  1R2U A;  2MHH A;  1LS8 A;  1M63 B;  4A4B A;  4KYN A;  1P28 A;  2WCE A;  2PRU A;  4F0Z B;  3FWB A;  4PDZ A;  1TIZ A;  4GPL B;  3NHI A;  1FI5 A;  3CWG A;  1IG5 A;  1BMO A;  3NXA A;  1Y1X A;  1DT7 B;  2K7B A;  1NCY A;  3SG3 A;  2MAZ A;  4I5N B;  1ZOT B;  3CDN A;  1SR6 B;  1XFR A;  3VGO A;  2AUC A;  1L2O B;  1A29 A;  1C7W A;  3O78 A;  2I94 A;  3DZT A;  3KEV A;  1SCM C;  2JRF A;  2HQW A;  1XFU O;  2BL0 C;  2L4H A;  2O60 A;  1KSM A;  2L2E A;  3EG5 B; 
#chains in the Genus database with same CATH homology
 1SK6 D;  2R2I A;  2KQ6 A;  2KYC A;  1IJ5 A;  4MN0 A;  2LM5 A;  4ICB A;  1S6I A;  4WRI A;  2KYF A;  1XFW O;  3NSK A;  3TDI A;  4AQI A;  1PSB A;  2Y1N A;  3D10 A;  1BR1 B;  2K7C A;  2EC6 B;  2KFG A;  2L51 A;  4XJK A;  1ODB A;  1WLZ A;  2ZRT A;  4QJ3 B;  5D7F A;  1YUR A;  2WCB A;  5AAN A;  1PUL A;  2NLN A;  1AVS A;  3MSE B;  1UHI A;  2LVJ A;  1M45 A;  3KF9 A;  3D0Y A;  4XJK B;  1UHH A;  2K7D A;  3ICB A;  1SRA A;  2E30 A;  2WND A;  1XK4 C;  2FCE A;  3JVT C;  4ETO A;  3DVM A;  3EKJ A;  4M2Q A;  1FW4 A;  1J1D A;  3EVR A;  3PM8 A;  1ALV A;  1DJI A;  3D0Y B;  4DIR A;  1TCF A;  2LAN A;  4N1G A;  2F2P A;  1OZO A;  3VRQ A;  1SR6 C;  1QLS A;  1NX3 A;  4MEW A;  2LUC A;  1GGZ A;  1YUU A;  1YTZ C;  5CPV A;  1BLQ A;  1IH0 A;  3GK2 A;  3SG4 A;  1BR4 B;  5KTY A;  4WQ2 A;  2OTG C;  2LMU A;  1CKK A;  2E6W A;  1Y0V H;  3CR5 X;  2F8P A;  3IF7 A;  1OE9 B;  1A75 A;  1LA0 A;  1YRU B;  2M1U A;  3BUM B;  3PN7 C;  1IWQ A;  1K9U A;  1UHN A;  2ZN8 A;  2KI4 B;  1JBA A;  3BQ3 A;  4PE7 A;  1CM4 A;  1YVL A;  2LCP A;  5DKQ A;  4AOM A;  1DVI A;  3EVU A;  4JQ0 D;  2K7O A;  3A4U B;  1BOC A;  1SL9 A;  1DJY A;  2LHI A;  3QRX A;  2Y4Q A;  3DF0 B;  5JJG A;  1TNX A;  3WNX B;  2BBM A;  3KO0 A;  2ZKM X;  4ORC B;  1DTL A;  2K2F A;  1RJV A;  1S1E A;  1S26 D;  1Q80 A;  1TNW A;  4DRW A;  5DKR A;  4PE1 A;  1SL7 A;  1QVI Z;  3TS5 C;  3O4Y A;  1RWY A;  1FPW A;  2Q4U A;  1SCM B;  1IJ6 A;  1CDL A;  1M39 A;  4USL A;  2BL0 B;  2WC8 A;  1J1E A;  2M49 B;  3PSR A;  4MVF A;  1ZFS A;  1QX7 A;  1NX1 A;  3CLN A;  1IGV A;  2PMY A;  4MZJ A;  2PAS A;  1XA5 A;  1TOP A;  3HCM A;  4GBA A;  1CTR A;  2JZI A;  1JWD A;  1B8R A;  4FQO A;  1OSA A;  5HLV A;  1J7P A;  1F55 A;  2EHB A;  1B8C A;  3IQO A;  4WQ3 A;  3BUN B;  4D1E A;  3BXK A;  2Y5I A;  1WY9 A;  2QPT A;  2L98 A;  4CFR A;  1QV1 A;  1U5I A;  1AUI B;  3DD4 A;  4C0K A;  2BCA A;  1R6P A;  2VRG A;  1K94 A;  1DJH A;  1XO5 A;  1BT6 A;  3CR2 A;  1K95 A;  4HRG A;  2LMT A;  3NSI A;  1NWD A;  1PK0 D;  2M1K B;  1MHO A;  2M29 A;  2LLU A;  2L0P A;  4YGD B;  1PAL A;  2QAC A;  3JTD B;  1U5I B;  1HQV A;  2B1U A;  4YI9 A;  3IQQ A;  3RM1 A;  2KGB C;  5AXI A;  3VRP A;  1H4B A;  1WRK A;  1UHJ A;  3GK1 A;  1JC2 A;  1NCX A;  1V1G A;  3OX5 A;  1CDP A;  1YR5 A;  3JVT B;  1AHR A;  1N0Y A;  1DJG A;  3AAK A;  5KSZ A;  1PRW A;  1QXP A;  3BUO B;  1GGW A;  5TNC A;  2OS8 C;  2MLF C;  4DS7 A;  2MRD A;  2JXC A;  1YUS A;  1XVJ A;  2I2R E;  2JT0 A;  3I5F C;  2F33 A;  5CSN A;  2HQ8 A;  1S36 A;  2NZ0 A;  5BPJ A;  1B1G A;  3I5I C;  1K9P A;  2JNX A;  2JTZ A;  1V1F A;  2FJU B;  3PAL A;  3VRO A;  2OTG B;  4OKH A;  3WXA A;  3NSL A;  1H8B A;  1PSR A;  1YRT B;  2KFF A;  2H61 C;  2NCP A;  3EVV A;  1S5G Z;  1CFP A;  4IL1 A;  1AK8 A;  1MR8 A;  1F71 A;  5CSJ A;  1N65 A;  1YUT A;  5HYD A;  2JQ6 A;  2LUX A;  2BCX A;  3OHM B;  3PN7 B;  1VRK A;  1S6J A;  2M0R A;  4DCK A;  4N1F A;  3ZNI A;  4MBE A;  5IBW A;  4AQJ A;  4GAO A;  1TTX A;  4CPV A;  2BEC A;  1QVI Y;  1KK8 B;  4ORA B;  4FTG A;  1BF5 A;  1NP8 A;  1QLK A;  5CSI A;  2LNK A;  1NSH A;  2I18 A;  1DMO A;  3JTD C;  2DOQ A;  4JWQ A;  3TUY C;  2LMV A;  2F2O A;  2LVK A;  1A2X A;  1OMV A;  1QTX A;  1LVC D;  1WLM A;  4YI8 A;  4OR9 B;  4GFT A;  1F70 A;  1WRL A;  2BKH B;  2JWW A;  1F8H A;  1SW8 A;  3TS5 B;  5DKN A;  4BY5 A;  2SAS A;  2F3Z A;  5GQQ C;  1TCO B;  1RFJ A;  3WHT B;  2AAO A;  1NIW A;  1B7T Z;  2JPT A;  3AAJ A;  1MUX A;  1CFC A;  5HKY A;  1IKU A;  1M46 A;  2LLS A;  3NSO A;  2COL B;  1AJ4 A;  5HKW A;  2KBI A;  2K8M B;  1OQP A;  2KI6 C;  2AMI A;  5HLO A;  1UHK A;  2LAP A;  4YRU A;  5PAL A;  1B4C A;  2FCD A;  2L5X B;  1QIW A;  1QAS A;  1C7V A;  1KSO A;  1BU3 A;  1W7J B;  2JTT A;  4MZK A;  3BOW A;  4A4C A;  1QAT A;  3E3R A;  1OMD A;  1D1O A;  5KU1 A;  1CMG A;  2A4J A;  1KK8 C;  1A75 B;  1JF0 A;  1RK9 A;  2KOT A;  1G33 A;  1GQM A;  1JUO A;  1SKT A;  2K61 A;  5ER4 X;  4PCW A;  4YGE B;  3BUW B;  3SJS A;  1WDC B;  4OV2 A;  1B8L A;  1KFU L;  1NPQ A;  5I2L A;  3O2P A;  4I5K A;  1A03 A;  2F3Y A;  2TN4 A;  2PSR A;  1QX5 B;  3M0W A;  3CGA A;  1S5G Y;  2I7A A;  1K96 A;  1ZAC A;  2JUL A;  2OS8 B;  3OB2 B;  5F6T A;  2BBN A;  1WRZ A;  1UWO A;  2JU0 A;  1NX0 A;  1TRF A;  2LP2 A;  1TN4 A;  2G2B A;  2H2K A;  3AKA A;  2H61 A;  3I5F B;  4MSP A;  4PE0 A;  5ER5 A;  1J7Q A;  3WHU B;  1SY9 A;  4GNK B;  2ISD A;  2KI6 D;  1IRJ A;  3I5I B;  4HRE E;  4CID A;  1KCY A;  2L4I A;  1DGV A;  1DF0 A;  2EGD A;  1LIN A;  3GK4 X;  1G8I A;  1CDM A;  3EK7 A;  2CXJ A;  2LHL A;  2SCP A;  1EH2 A;  2JNF A;  2Y1M A;  5K89 A;  3FWC A;  3CZT X;  1CLL A;  3OB1 B;  4DUQ A;  1REC A;  2O5G A;  2P6B B;  4PHN A;  1QV0 A;  4I5L B;  3TZ1 A;  1UUS A;  2HF5 A;  4E68 A;  2D8N A;  4C0J A;  3I5G C;  1SMG A;  2JXL A;  1CFF A;  5AER A;  4GUK A;  3FIA A;  4QJ5 B;  3BUX B;  2MA2 A;  3TUY B;  1B7T Y;  4P2Y B;  2M7N A;  4CFQ A;  1SCV A;  4OCI A;  1WDC C;  2KHN A;  1QIV A;  1AP4 A;  4PHK A;  2LV7 A;  1KWO C;  1E8A A;  1MXL C;  1XFZ O;  1FBV A;  1LXF C;  2L50 A;  1N2D A;  4NDB A;  1ALW A;  3TDZ A;  2GGZ A;  4YBH B;  5I2O A;  4N5X A;  1XFX O;  3EKH A;  1OOJ A;  1Y1A A;  4BY4 A;  1A4P A;  3CTN A;  4ORB B;  1C07 A;  1UP5 A;  3ZWH A;  1EG4 A;  3FS7 A;  1J55 A;  2K0J A;  2LP3 A;  5AEQ A;  2CCM A;  3O6B A;  1KK7 Z;  4MLW A;  4PHJ A;  4YGA A;  4ZCU A;  4MZL A;  1KQV A;  1K90 D;  1YVH A;  3PLF B;  5B8I B;  2CTN A;  3KHE A;  2LVV A;  1LKJ A;  1DJX A;  4R1E A;  2LVI A;  2ZN9 A;  2LE9 B;  5I2Q A;  2Q91 A;  1J7R A;  1M31 A;  4GGF A;  1IQ3 A;  4PAL A;  1K2H A;  1J7O A;  3PAT A;  2LLT A;  1X02 A;  2G9B A;  3AKB A;  1BOD A;  4Q04 A;  3H4S E;  1JFJ A;  1XYD A;  2KNE A;  2PAL A;  2HPS A;  1NUB A;  1JFK A;  1TNP A;  2CNP A;  1K8U A;  4XYN A;  1NYA A;  1MQ1 A;  1CFD A;  3OX6 A;  4ZCV A;  1OMR A;  1KQM C;  3OP0 A;  3BYA A;  1JF2 A;  2KBM A;  1ZMZ A;  4MRY A;  1S6C A;  1CM1 A;  3I5H C;  2NXQ A;  1CDN A;  1RTP 1;  2M97 A;  4PHM A;  3LCP C;  2WOR A;  4QJ4 B;  5D69 A;  3HX4 A;  3SIA A;  1JSA A;  3SG6 A;  1SYM A;  1G4Y R;  1KFX L;  1FF1 A;  1L7Z A;  1HT9 A;  1EXR A;  2LC5 A;  2ZFD A;  4MRX A;  1QX2 A;  3DVJ A;  5JOL A;  1B47 A;  5AFP A;  2M9G A;  3K21 A;  1F54 A;  1W7I B;  4NDD A;  1L2O C;  2BE6 A;  2PVB A;  3CS1 A;  3A8R A;  3I5G B;  3LL8 B;  4HRH A;  3DVE A;  1DGU A;  3TDU A;  4C0L A;  3PFV A;  3SG2 A;  1SPY A;  2CBL A;  3LK1 A;  1EG3 A;  1EJ3 A;  3BOW B;  4CLN A;  2JC2 A;  1BG1 A;  4NDC A;  2KAY A;  1QS7 A;  1F4Q A;  1YX7 A;  4GGF C;  1KWO B;  5FYX A;  1KFX S;  2HET A;  3CR4 X;  5J3X A;  3SG5 A;  1K9K A;  1SNL A;  2WOS A;  2JT3 A;  4TNC A;  2GV5 A;  1KK7 Y;  1XFV O;  3EK8 A;  2OPO A;  2EC6 C;  1EL4 A;  3DF0 A;  5CSF A;  1AJ5 A;  2M3W A;  2KSP A;  2ZRS A;  1F4O A;  1PVA A;  4NQG A;  2BCB A;  1NCZ A;  1XFY O;  1ZUZ A;  1YX8 A;  3SIB A;  2RGI A;  2IS9 A;  5HKZ A;  2BE4 A;  1MXE A;  4M2O A;  2GGM A;  2MBX A;  2KFH A;  2K2A A;  1RRO A;  1OZS A;  3LK0 A;  1B9A A;  1KFU S;  1DF0 B;  2M8U A;  1CNP A;  4YGC B;  4HSZ A;  5G08 A;  2JOJ A;  2BKI B;  1UUR A;  1PVB A;  4I5J A;  5I8N A;  3KPX A;  2NCO A;  2KQY A;  2ZND A;  4U8D A;  1K93 D;  3VRN A;  1CLM A;  1TNQ A;  1DJZ A;  1CMF A;  1SL8 A;  1NX2 A;  2M7L A;  1S3P A;  2KGR A;  2MJW B;  1BJF A;  2KDH A;  3DVK A;  4YGB B;  3VRR A;  2JT8 A;  4PE4 A;  3C1V A;  2MLE C;  4OVN F;  3LLE A;  1FI6 A;  1SBJ A;  1Y1U A;  2FOT A;  3RLZ A;  3GOF A;  1DJW A;  1MWN A;  2V53 A;  4L9M A;  3SG7 A;  4M2P A;  4JPZ B;  1CB1 A;  2KI4 C;  4UPG A;  3F45 A;  1KQM B;  3EK4 A;  1LA3 A;  1XK4 A;  1MF8 B;  4P5O E;  1GJY A;  1Y6W A;  3I5H B;  2ZNE A;  2KAX A;  4GGN A;  2WCF A;  1IQ5 A;  2CT9 A;  2KAV A;  1QJT A;  1CLB A;  1R2U A;  2MHH A;  1M63 B;  4A4B A;  2WCE A;  2PRU A;  4F0Z B;  3FWB A;  4PDZ A;  1TIZ A;  4GPL B;  1FI5 A;  3CWG A;  1IG5 A;  1BMO A;  3NXA A;  1Y1X A;  1DT7 B;  2K7B A;  1NCY A;  3SG3 A;  2MAZ A;  4I5N B;  1ZOT B;  1SR6 B;  3VGO A;  2AUC A;  1L2O B;  1A29 A;  1C7W A;  3O78 A;  2I94 A;  3KEV A;  1SCM C;  2JRF A;  2HQW A;  1XFU O;  2BL0 C;  2L4H A;  2O60 A;  1KSM A;  2L2E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...