1VRKA

The 1.9 angstrom structure of e84k-calmodulin rs20 peptide complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
148
structure length
148
Chain Sequence
ADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEKLKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQVNYEEFVQVMMAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALMODULIN
publication title Analysis of the functional coupling between calmodulin's calcium binding and peptide recognition properties.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Complex(calcium-binding protein/peptide)
total genus 53
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 1997-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1vrkA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1vrkA02
2O60A 1NYAA 3VRPA 1A75B 1K8UA 3DF0B 5JJGA 1LVCD 1NX2A 1SMGA 1XVJA 3DVJA 2LP2A 1ALWA 1JFKA 3BOWB 3CTNA 3JTDC 4WQ2A 3AAJA 2MJWB 5F6TA 3AKBA 2HQ8A 4XYNA 2G9BA 2MLEC 3WHTB 4JPZB 3BUWB 2PASA 4PHNA 2PVBA 2JC2A 3NXAA 1FBVA 5I2LA 5AEQA 1KK7Z 1K9PA 1OQPA 4MEWA 1CNPA 1GGWA 3IQOA 1S6IA 1F4QA 1SL7A 1F71A 2Q91A 3VGOA 1YUUA 1PRWA 1CMFA 1M31A 1YR5A 1CLMA 3CWGA 3PN7B 1M45A 3I5HC 1TNXA 2FCDA 1OMRA 4NDBA 3ZWHA 5K89A 1SY9A 2WCBA 3ICBA 4NDDA 1A4PA 2PALA 3D0YB 4ORBB 1BMOA 2KFGA 4OR9B 1BT6A 1KFUL 1NX1A 2K7BA 1IH0A 4MVFA 1F70A 2WORA 1WRZA 1DJIA 2F3YA 4MSPA 2SASA 1UHHA 1AVSA 4IL1A 2EC6C 3LLEA 4OVNF 4DRWA 4A4BA 4PDZA 1OMVA 3EVRA 4HRGA 5CSFA 1QIVA 3EKHA 1J7OA 1H8BA 1NWDA 2LVIA 1NUBA 1DJHA 4D1EA 1SYMA 1NX3A 4CFRA 3O2PA 1S6CA 2FOTA 2KHNA 2KBMA 1L7ZA 4N1GA 1Y1XA 3SIAA 2ZKMX 1UURA 2BE6A 1DJWA 4I5JA 2M7LA 1AJ4A 1YURA 1EXRA 1EG3A 3LL8B 1YRUB 2LC5A 1J1EA 2KGBC 1NP8A 1CTRA 1SW8A 4GFTA 1BOCA 1B8CA 3NSIA 4ZCUA 3C1VA 3O6BA 3TUYB 3I5GB 2OTGB 1WDCB 1ZUZA 2M7NA 2PSRA 2ZNDA 5IBWA 5KU1A 1CDLA 1BU3A 1BLQA 1NSHA 1UWOA 2KOTA 1KSOA 2K7OA 4YI8A 3FIAA 3NSKA 3SG6A 2JOJA 4UPGA 1A2XA 4MZLA 1DVIA 4PHKA 2LM5A 1K2HA 2JPTA 2LCPA 4MZKA 1B1GA 3D0YA 5PALA 3JTDB 1B7TZ 4M2OA 3SJSA 1SL8A 1KWOC 2JNXA 4FTGA 4P5OE 5HKWA 3OHMB 1MQ1A 4R1EA 1CDNA 5D69A 1J7PA 1K9KA 1LINA 2NCOA 2WOSA 3SG3A 1KFXS 3JVTC 1M39A 3CR5X 2EHBA 1TNWA 4GGFA 1CMGA 1L2OC 1XYDA 1DJZA 3CR2A 1QJTA 1QVIZ 3SG7A 1SR6C 2LE9B 2JULA 2M49B 4XJKB 5KTYA 3WHUB 4OKHA 4GGFC 1FPWA 1K94A 1R6PA 1KFUS 2H61A 4MN0A 2K61A 4PHMA 4PE1A 1SNLA 2Y4QA 2EC6B 1OOJA 3CR4X 1EJ3A 1ZACA 2LLSA 2JRFA 5ER4X 1IKUA 4AOMA 3VRNA 4HSZA 2KQYA 3GK1A 3MSEB 3PM8A 3KHEA 1AP4A 2SCPA 1LKJA 1WY9A 2JTZA 2M3WA 3SIBA 1RFJA 3M0WA 2CCMA 1LXFC 2ZFDA 1TN4A 1B4CA 1H4BA 1DJYA 1SRAA 3OX6A 2E30A 3TZ1A 1G8IA 1K95A 4AQJA 1OSAA 1YVHA 3GK4X 1BR4B 4QJ3B 1CFFA 2FJUB 2ZN9A 4JQ0D 3NSOA 3DVKA 1MF8B 1DF0A 2BBNA 2JWWA 5JOLA 4A4CA 4ORCB 2R2IA 4AQIA 1MWNA 1UHKA 1TCOB 1B8RA 1RECA 2I18A 2KAVA 1F55A 1CFDA 1QXPA 2L50A 5TNCA 2JZIA 1YRTB 1KK8C 1KFXL 3RM1A 1JFJA 2CNPA 3KEVA 2DOQA 1PSRA 2LNKA 4OV2A 2F8PA 3I5IC 4XJKA 1NPQA 1KWOB 1TCFA 1AUIB 1PVAA 2L4HA 2LMUA 3KF9A 1JSAA 1MXLC 2JQ6A 1J55A 3CLNA 1SL9A 1Y6WA 1ODBA 1S5GY 2K0JA 3JVTB 4P2YB 4DUQA 2B1UA 1WLMA 4GPLB 1HT9A 3AKAA 1M46A 3CGAA 5CSIA 1L2OB 1J1DA 1YX8A 1S26D 4YBHB 4CLNA 2L2EA 4USLA 2LANA 2NLNA 2AAOA 1SR6B 2L0PA 3CZTX 1S6JA 1W7JB 3FS7A 1EL4A 1MR8A 2HETA 3HX4A 2HQWA 4HREE 5J3XA 2BL0C 1R2UA 2MLFC 1FI5A 1K9UA 2M29A 1JF0A 2LVJA 1CFPA 3KO0A 1PULA 3BQ3A 1ALVA 1PK0D 3EK8A 5HKZA 1KQMC 1TIZA 2CT9A 2ISDA 2KI6D 1XFZO 2FCEA 2Y1NA 1B8LA 1IRJA 2KQ6A 1QX7A 1FW4A 2KNEA 4BY4A 1KSMA 2NXQA 1OZSA 2LMVA 2L51A 2M97A 3WXAA 4QJ5B 1IQ5A 4PHJA 2RGIA 1JBAA 1GGZA 1A29A 4MRYA 3SG4A 4WRIA 1TNPA 1M63B 1QX2A 2LP3A 2AMIA 4CFQA 2KI4C 2Q4UA 5HYDA 2I94A 2LHLA 1YX7A 1DJGA 2OS8C 1ZOTB 1BR1B 1XK4A 1KQVA 1QLSA 2CXJA 3OX5A 2QACA 1UUSA 3LCPC 2ZNEA 2M8UA 2F2OA 4GUKA 2KFFA 1IJ6A 3PALA 4I5KA 5AFPA 2F2PA 1DTLA 1TTXA 2GGMA 3LK0A 1QS7A 3PATA 1XFYO 1DF0B 1K90D 1KK8B 4ORAB 3LK1A 1XK4C 2KDHA 4GAOA 1V1GA 5I2OA 2CBLA 2F33A 1SK6D 4FQOA 1MUXA 3I5IB 3I5HB 1JF2A 1Q80A 1CM1A 5KSZA 1PVBA 3BYAA 4L9MA 2BCBA 3GK2A 1CFCA 3DD4A 2E6WA 1B47A 2K8MB 1YTZC 1N2DA 2K2AA 4M2PA 5HKYA 2JXLA 1B7TY 5DKRA 3TDIA 4C0LA 1DMOA 1MXEA 3I5FC 1DGUA 3ZNIA 4CIDA 1XFUO 5B8IB 3CS1A 4OCIA 2LUCA 1IG5A 3DVEA 5ER5A 4JWQA 2M9GA 1WRKA 2LVVA 2BL0B 3E3RA 1OMDA 1C07A 2BKIB 3SG2A 2EGDA 1SBJA 3QRXA 2KFHA 4ETOA 4YGCB 1OZOA 2Y1MA 1BG1A 1NX0A 2LUXA 3O78A 2OPOA 4NDCA 4GGNA 2PRUA 4ICBA 3EVVA 3PSRA 1D1OA 2GGZA 1TRFA 1G33A 2LLUA 4PALA 1HQVA 1DJXA 1F4OA 1IJ5A 2LVKA 2BECA 4MLWA 3OP0A 2KBIA 5CSJA 2KYFA 4C0KA 2BKHB 3A8RA 2BE4A 1Y1AA 1BF5A 2I7AA 1B9AA 1GJYA 4YI9A 3EKJA 2P6BB 3TUYC 3I5GC 3RLZA 5AERA 1RK9A 3H4SE 3SG5A 3TDUA 1QIWA 2LV7A 1CKKA 4PCWA 1TNQA 4PE7A 1UHNA 1CDMA 1ZMZA 1CM4A 4CPVA 1RTP1 1LA3A 2LLTA 3EVUA 4E68A 1S5GZ 1YUTA 2TN4A 1MHOA 3EK7A 1QX5B 3A4UB 1TOPA 2D8NA 1V1FA 3BUNB 4N1FA 5CSNA 3OB2B 2BCAA 4BY5A 4HRHA 1NIWA 4YGDB 3TS5C 5HLVA 2WCEA 2HPSA 1NCYA 1C7VA 1K93D 1S1EA 1JC2A 2M1KB 1U5IA 1KK7Y 1EH2A 2L5XB 2LAPA 2MBXA 2BBMA 4GNKB 4YGEB 1WRLA 3BUOB 1AHRA 3TDZA 1QASA 2GV5A 1QLKA 3PFVA 4YGAA 1CDPA 1EG4A 5GQQC 3I5FB 1AK8A 1G4YR 1SCMC 1Y0VH 2JT8A 2KGRA 4YRUA 1F54A 2KAYA 3OB1B 3BXKA 2MAZA 1WLZA 2L98A 4I5NB 1XO5A 3BUMB 4MZJA 4TNCA 3GOFA 4C0JA 2CTNA 2IS9A 1YVLA 1IGVA 2K7CA 2Y5IA 4F0ZB 1BODA 2VRGA 3PLFB 3VRQA 3WNXB 1S36A 5DKQA 2WC8A 1XFWO 1LA0A 1RROA 3D10A 5AXIA 2K2FA 1CLBA 2KSPA 1N65A 1RJVA 2MRDA 2LHIA 2QPTA 1IQ3A 3NSLA 1A75A 3DF0A 3K21A 3AAKA 4U8DA 2WNDA 4ZCVA 3HCMA 2NCPA 4N5XA 2JXCA 1CB1A 1ZFSA 3BOWA 1QV1A 1F8HA 1DGVA 4M2QA 1J7QA 1E8AA 1PALA 1QATA 2I2RE 4WQ3A 1RWYA 2WCFA 2COLB 1AJ5A 2JT0A 3F45A 4Q04A 1SPYA 3VRRA 1QTXA 3EK4A 3FWCA 1C7WA 1N0YA 2HF5A 1NCXA 1W7IB 1QV0A 2KI6C 2AUCA 1X02A 4DS7A 1UHJA 2NZ0A 2BCXA 3IQQA 2ZRTA 1VRKA 2M0RA 1UHIA 3PN7C 3O4YA 1SCVA 2KYCA 4I5LB 1J7RA 3TS5B 2JT3A 1XA5A 4MBEA 1K96A 3IF7A 1XFVO 4QJ4B 1DT7B 1PSBA 2M1UA 5I2QA 1OE9B 2A4JA 2H2KA 1BJFA 4DIRA 2PMYA 1U5IB 1Y1UA 2LMTA 1SCMB 1KQMB 2ZRSA 3FWBA 1FF1A 1NCZA 2L4IA 4YGBB 1QVIY 2G2BA 3DVMA 2JNFA 1YUSA 5HLOA 3VROA 1GQMA 2MA2A 5BPJA 1XFXO 2F3ZA 4DCKA 2KAXA 1JWDA 5D7FA 2V53A 1UP5A 1A03A 4GBAA 4MRXA 4NQGA 2H61C 1CLLA 3KPXA 1KCYA 2MHHA 5G08A 2K7DA 2ZN8A 2KI4B 5FYXA 4PE0A 5DKNA 2OS8B 1JUOA 4PE4A 1SKTA 5I8NA 2OTGC 1WDCC 1IWQA 1S3PA 2JTTA 2JU0A 3BUXB 1FI6A 2O5GA 5AANA 5CPVA
chains in the Genus database with same CATH superfamily
2O60A 1NYAA 3VRPA 1A75B 1K8UA 2QEHA 3DF0B 5JJGA 1LVCD 1NX2A 1SMGA 1XVJA 3CZ1A 3DVJA 2LP2A 1ALWA 1JFKA 3BOWB 3CTNA 3JTDC 4WQ2A 3AAJA 2MJWB 5F6TA 3AKBA 2HQ8A 4XYNA 2G9BA 2MLEC 3SS5A 3WHTB 3S0FA 4JPZB 2H8VA 1IIOA 3BUWB 2PASA 4PHNA 2PVBA 2JC2A 3NXAA 1FBVA 5I2LA 5AEQA 1KK7Z 1K9PA 1OQPA 4MEWA 1CNPA 1F71A 1GGWA 3IQOA 1S6IA 1F4QA 3CZ0A 1SL7A 2YGUA 2Q91A 3VGOA 1YUUA 1PRWA 1CMFA 1M31A 1YR5A 1CLMA 3CWGA 3PN7B 1M45A 3I5HC 1TNXA 2FCDA 1OMRA 4NDBA 3ZWHA 5K89A 1SY9A 2WCBA 3ICBA 4NDDA 1SSEB 1A4PA 2PALA 3D0YB 4ORBB 1BMOA 2KFGA 1W9ZA 1BT6A 4OR9B 1KFUL 1NX1A 2K7BA 1IH0A 4MVFA 1F70A 2WORA 1WRZA 1DJIA 2F3YA 4MSPA 2SASA 1OOHA 1UHHA 1AVSA 2GTEA 4IL1A 2EC6C 3LLEA 4OVNF 5CSIA 4DRWA 4A4BA 4PDZA 1OMVA 3EVRA 4HRGA 5CSFA 1QIVA 3EKHA 1J7OA 1H8BA 1NWDA 2LVIA 1NUBA 1DJHA 4D1EA 1SYMA 1NX3A 4CFRA 3O2PA 1S6CA 2FOTA 2KHNA 2KBMA 1L7ZA 4N1GA 1Y1XA 3D75A 2ZKMX 1UURA 3SIAA 2BE6A 1OW4A 1DJWA 3N7HA 4IJ7A 4I5JA 2M7LA 1AJ4A 1YURA 1EXRA 2WCLA 1EG3A 3LL8B 1YRUB 2LC5A 1J1EA 2KGBC 1NP8A 1CTRA 1SW8A 4GFTA 1BOCA 1B8CA 3NSIA 4ZCUA 3C1VA 3O6BA 3TUYB 3I5GB 2OTGB 2WCJA 1WDCB 5FI2A 1ZUZA 2M7NA 2PSRA 2ZNDA 5IBWA 5KU1A 1CDLA 1BU3A 2BNXA 1BLQA 1NSHA 1UWOA 2KOTA 1KSOA 2K7OA 4INWA 3FIAA 3NSKA 4YI8A 2JOJA 3SG6A 4UPGA 2FJYA 1A2XA 4MZLA 1DVIA 4PHKA 2LM5A 1K2HA 2JPTA 2LCPA 2WC6A 3EG5B 3D0YA 4MZKA 5PALA 3JTDB 1B7TZ 1B1GA 4M2OA 3SJSA 1SL8A 3UO9A 1KWOC 2JNXA 3O4XA 4FTGA 4P5OE 5HKWA 3OHMB 1MQ1A 4R1EA 1CDNA 5D69A 1J7PA 1K9KA 1LINA 2NCOA 2WOSA 3SG3A 1KFXS 3JVTC 1M39A 3CR5X 2EHBA 2L5YA 1TNWA 3OBVA 3OGNA 4GGFA 1CMGA 1L2OC 1XYDA 1DJZA 3CR2A 1QJTA 1DC1A 1QVIZ 2KLDA 2L2CA 1SR6C 3SG7A 3B87A 2LE9B 2JULA 2M49B 4XJKB 3S0DA 5KTYA 3WHUB 4OKHA 4GGFC 1FPWA 1K94A 1R6PA 1KFUS 1GM0A 2H61A 4MN0A 2K61A 4PHMA 4PE1A 1SNLA 2Y4QA 3BJHA 2EC6B 1OOJA 3CR4X 3DZTA 1EJ3A 1ZACA 2LLSA 2JRFA 5ER4X 1IKUA 4AOMA 1C3YA 3VRNA 4HSZA 2KQYA 3GK1A 3MSEB 3PM8A 3KHEA 1AP4A 2SCPA 1LKJA 1WY9A 2JTZA 2M3WA 3Q8IA 3SIBA 2JPOA 5HL1A 1RFJA 3M0WA 2CCMA 1LXFC 2ZFDA 1TN4A 1B4CA 1H4BA 1DJYA 1SRAA 3OX6A 2E30A 3TZ1A 1TUJA 1G8IA 1K95A 2QEOA 1OSAA 4AQJA 2P70A 1YVHA 3GK4X 1BR4B 4QJ3B 1CFFA 2FJUB 2ZN9A 4OZDA 2QDIA 4JQ0D 3NSOA 3DVKA 2P71A 1OOGA 1MF8B 1DF0A 2BBNA 2JWWA 5JOLA 4A4CA 4ORCB 3B7AA 2R2IA 4AQIA 1MWNA 1UHKA 1TCOB 1B8RA 4JD9A 1RECA 2I18A 2KAVA 1F55A 3V2LA 1DQEA 1CFDA 1QXPA 2L50A 5TNCA 2JZIA 1YRTB 1KK8C 1KFXL 3RM1A 1OOFA 1JFJA 2CNPA 3KEVA 2DOQA 1PSRA 3B6XA 2LNKA 4OV2A 2F8PA 3I5IC 4XJKA 1NPQA 1KWOB 1TCFA 1AUIB 1PVAA 3CABA 2L4HA 2LMUA 3RZSA 3PM2A 3KF9A 1JSAA 1MXLC 2JQ6A 1J55A 1P28A 3CLNA 3CYZA 1SL9A 1Y6WA 1ODBA 1S5GY 2K0JA 3JVTB 4P2YB 4DUQA 2B1UA 1WLMA 4GPLB 2WCMA 1HT9A 3AKAA 1M46A 4JKTA 3B88A 2WCKA 1L2OB 1J1DA 1YX8A 1S26D 3CGAA 3L47A 2L2EA 4USLA 4YBHB 2LANA 4CLNA 2NLNA 2AAOA 1SR6B 2L0PA 3CZTX 3NGVA 1S6JA 1W7JB 3FS7A 1EL4A 1MR8A 2HETA 2PQLA 2HQWA 3HX4A 4HREE 2BL0C 5J3XA 1R2UA 2MLFC 1FI5A 1K9UA 2M29A 1JF0A 2LVJA 1CFPA 3KO0A 1PULA 3BQ3A 1ALVA 1PK0D 3EK8A 5HKZA 1KQMC 1TIZA 2CT9A 2ISDA 2BAPA 2KI6D 1XFZO 2FCEA 2Y1NA 3FE8A 1B8LA 1IRJA 2KQ6A 1QX7A 1FW4A 2KNEA 4BY4A 1KSMA 2NXQA 1OZSA 2LMVA 2L51A 2M97A 3WXAA 4QJ5B 1IQ5A 4PHJA 2RGIA 1JBAA 1GGZA 1A29A 4MRYA 3SG4A 3S0AA 4WRIA 1TNPA 1M63B 1QX2A 2LP3A 2AMIA 4CFQA 2KI4C 2Q4UA 5HYDA 2I94A 2LHLA 1YX7A 1DJGA 2OS8C 3FE9A 1ZOTB 1BR1B 1XK4A 1KQVA 1QLSA 2CXJA 3OX5A 3CDNA 3R1VA 2QACA 1UUSA 1XFRA 3LCPC 2ZNEA 2M8UA 2F2OA 4GUKA 2KFFA 1IJ6A 3PALA 4I5KA 5AFPA 2F2PA 1DTLA 1TTXA 2GGMA 3LK0A 1QS7A 1T14A 1XFYO 1DF0B 1K90D 1KK8B 3PATA 3LK1A 4ORAB 1XK4C 2KDHA 1OOIX 4GAOA 1V1GA 5I2OA 2CBLA 2F33A 1SK6D 4FQOA 1MUXA 3IVTA 3I5IB 3I5HB 1QWVA 1JF2A 1Q80A 1CM1A 5KSZA 1PVBA 3BYAA 4L9MA 2BCBA 4KYNA 3GK2A 1CFCA 3DD4A 5I94A 2E6WA 1B47A 2K8MB 1YTZC 1N2DA 2K2AA 4M2PA 5HKYA 2JXLA 1B7TY 5DKRA 3TDIA 4C0LA 3R1PA 1DMOA 1MXEA 3I5FC 1DGUA 3ZNIA 4CIDA 1XFUO 5B8IB 3CS1A 4OCIA 2LUCA 1IG5A 3DVEA 5ER5A 4JWQA 2M9GA 1WRKA 2LVVA 2BL0B 1Z2CB 3E3RA 1OMDA 3DY9A 1C07A 2BKIB 3SG2A 2EGDA 1SBJA 3QRXA 2KFHA 3PJIA 4ETOA 4YGCB 1OZOA 2Y1MA 1BG1A 1NX0A 2LUXA 3O78A 2OPOA 4NDCA 5FI6A 4GGNA 1TUZA 2PRUA 4ICBA 3EVVA 3L4AA 3PSRA 1D1OA 2GGZA 1TRFA 1G33A 2LLUA 4PALA 1HQVA 1DJXA 3K1EA 1F4OA 1IJ5A 2LVKA 2BECA 4MLWA 5FI7A 3OP0A 3B86A 2KBIA 5CSJA 2KYFA 4C0KA 2BKHB 3A8RA 2BE4A 3NHIA 4F7FA 1Y1AA 1BF5A 2I7AA 1B9AA 1GJYA 4YI9A 3D76A 3EKJA 2P6BB 3TUYC 3I5GC 3RLZA 5AERA 1RK9A 3H4SE 3SG5A 3TDUA 1QIWA 3D77A 2LV7A 1CKKA 4PCWA 1C3ZA 1TNQA 4PE7A 1UHNA 1CDMA 1ZMZA 3L4LA 1CM4A 4CPVA 1RTP1 1LA3A 2LLTA 3EVUA 3R1OA 4E68A 1S5GZ 1YUTA 2TN4A 1MHOA 3EK7A 3R72A 1QX5B 3A4UB 1TOPA 2D8NA 1V1FA 3BUNB 4N1FA 5CSNA 3OB2B 1TWOA 2BCAA 4BY5A 4INXA 4HRHA 1NIWA 4YGDB 3TS5C 5HLVA 2WCEA 2HPSA 2KLEA 5D3OA 1NCYA 1C7VA 1K93D 1S1EA 1JC2A 2M1KB 1U5IA 1KK7Y 1EH2A 2L5XB 2LAPA 1ORGA 2QEVA 2MBXA 2BBMA 4GNKB 4YGEB 1WRLA 3BUOB 1AHRA 3TDZA 1QASA 2GV5A 1QLKA 3PFVA 4YGAA 1CDPA 1EG4A 5GQQC 3I5FB 2PYQA 3D73A 2WCHA 1AK8A 1G4YR 1SCMC 1Y0VH 2JT8A 2ERBA 2KGRA 4YRUA 1F54A 2KAYA 3OB1B 3BXKA 2MAZA 1WLZA 2L98A 4I5NB 1XO5A 3BUMB 4MZJA 4TNCA 3GOFA 4C0JA 2CTNA 2IS9A 1YVLA 1IGVA 2K7CA 2Y5IA 4F0ZB 1BODA 3BFAA 2VRGA 3PLFB 3VRQA 3WNXB 1S36A 5DKQA 3FE6A 1DELA 2WC8A 1XFWO 1LA0A 1RROA 3D10A 4PT1A 5AXIA 2K2FA 1CLBA 2KSPA 1N65A 1RJVA 3DXLA 2MRDA 2LHIA 2QPTA 1IQ3A 3NSLA 3CZ2A 1A75A 3DF0A 3K21A 3AAKA 4U8DA 2WNDA 3BFBA 4ZCVA 3HCMA 3UNWA 2NCPA 3D74A 4N5XA 2JXCA 1CB1A 1ZFSA 3BOWA 5EL2A 1QV1A 1F8HA 1DGVA 4M2QA 1J7QA 1E8AA 1PALA 1QATA 2I2RE 4WQ3A 1RWYA 2WCFA 2COLB 3D78A 1AJ5A 2JT0A 3F45A 3QMEA 4Q04A 1SPYA 3SS3A 3VRRA 1QTXA 3EK4A 3FWCA 1C7WA 1N0YA 2HF5A 1NCXA 1W7IB 1QV0A 2KI6C 2AUCA 1X02A 3S0EA 1Z4HA 4DS7A 1UHJA 2NZ0A 2BCXA 3IQQA 3S0GA 2ZRTA 1VRKA 2M0RA 1UHIA 3PN7C 3O4YA 3NHTA 1SCVA 2KYCA 4I5LB 1J7RA 3TS5B 2JT3A 3S0BA 1XA5A 4MBEA 1DEKA 1K96A 3IF7A 1XFVO 4QJ4B 1DT7B 2QEBA 1PSBA 3SS4A 2M1UA 3DYEA 5I2QA 1OE9B 2A4JA 2H2KA 1BJFA 3VB1A 2PMYA 4DIRA 1U5IB 1Y1UA 2LMTA 1SCMB 1KQMB 2ZRSA 3FWBA 1FF1A 1NCZA 2L4IA 4YGBB 1QVIY 2G2BA 3DVMA 2JNFA 3BFHA 1YUSA 5HLOA 3VROA 1GQMA 2MA2A 5BPJA 1XFXO 2F3ZA 4DCKA 2KAXA 1JWDA 5D7FA 2WC5A 2V53A 1UP5A 1A03A 4GBAA 4MRXA 4FQTA 4NQGA 1LS8A 1CLLA 2H61C 3KPXA 1KCYA 2MHHA 5G08A 2K7DA 5DICA 2ZN8A 2KI4B 5FYXA 4PE0A 5DKNA 2OS8B 1JUOA 4PE4A 1SKTA 5I8NA 2OTGC 1WDCC 1IWQA 1S3PA 2JTTA 2K60A 2JU0A 3BUXB 2KPHA 1FI6A 2O5GA 5AANA 5CPVA
chains in the Genus database with same CATH topology
2O60A 1NYAA 3VRPA 1A75B 1K8UA 3DF0B 5JJGA 1LVCD 1NX2A 1SMGA 1XVJA 3DVJA 2LP2A 1ALWA 1JFKA 3BOWB 3CTNA 3JTDC 4WQ2A 3AAJA 2MJWB 5F6TA 3AKBA 2HQ8A 4XYNA 2G9BA 2MLEC 3WHTB 4JPZB 3BUWB 2PASA 4PHNA 2PVBA 2JC2A 3NXAA 1FBVA 5I2LA 5AEQA 1KK7Z 1K9PA 1OQPA 4MEWA 1CNPA 1GGWA 3IQOA 1S6IA 1F4QA 1SL7A 1F71A 2Q91A 3VGOA 1YUUA 1PRWA 1CMFA 1M31A 1YR5A 1CLMA 3CWGA 3PN7B 1M45A 3I5HC 1TNXA 2FCDA 1OMRA 4NDBA 3ZWHA 5K89A 1SY9A 2WCBA 3ICBA 4NDDA 1A4PA 2PALA 3D0YB 4ORBB 1BMOA 2KFGA 4OR9B 1BT6A 1KFUL 1NX1A 2K7BA 1IH0A 4MVFA 1F70A 2WORA 1WRZA 1DJIA 2F3YA 4MSPA 2SASA 1UHHA 1AVSA 4IL1A 2EC6C 3LLEA 4OVNF 4DRWA 4A4BA 4PDZA 1OMVA 3EVRA 4HRGA 5CSFA 1QIVA 3EKHA 1J7OA 1H8BA 1NWDA 2LVIA 1NUBA 1DJHA 4D1EA 1SYMA 1NX3A 4CFRA 3O2PA 1S6CA 2FOTA 2KHNA 2KBMA 1L7ZA 4N1GA 1Y1XA 3SIAA 2ZKMX 1UURA 2BE6A 1DJWA 4I5JA 2M7LA 1AJ4A 1YURA 1EXRA 1EG3A 3LL8B 1YRUB 2LC5A 1J1EA 2KGBC 1NP8A 1CTRA 1SW8A 4GFTA 1BOCA 1B8CA 3NSIA 4ZCUA 3C1VA 3O6BA 3TUYB 3I5GB 2OTGB 1WDCB 1ZUZA 2M7NA 2PSRA 2ZNDA 5IBWA 5KU1A 1CDLA 1BU3A 1BLQA 1NSHA 1UWOA 2KOTA 1KSOA 2K7OA 4YI8A 3FIAA 3NSKA 3SG6A 2JOJA 4UPGA 1A2XA 4MZLA 1DVIA 4PHKA 2LM5A 1K2HA 2JPTA 2LCPA 4MZKA 1B1GA 3D0YA 5PALA 3JTDB 1B7TZ 4M2OA 3SJSA 1SL8A 1KWOC 2JNXA 4FTGA 4P5OE 5HKWA 3OHMB 1MQ1A 4R1EA 1CDNA 5D69A 1J7PA 1K9KA 1LINA 2NCOA 2WOSA 3SG3A 1KFXS 3JVTC 1M39A 3CR5X 2EHBA 1TNWA 4GGFA 1CMGA 1L2OC 1XYDA 1DJZA 3CR2A 1QJTA 1QVIZ 3SG7A 1SR6C 2LE9B 2JULA 2M49B 4XJKB 5KTYA 3WHUB 4OKHA 4GGFC 1FPWA 1K94A 1R6PA 1KFUS 2H61A 4MN0A 2K61A 4PHMA 4PE1A 1SNLA 2Y4QA 2EC6B 1OOJA 3CR4X 1EJ3A 1ZACA 2LLSA 2JRFA 5ER4X 1IKUA 4AOMA 3VRNA 4HSZA 2KQYA 3GK1A 3MSEB 3PM8A 3KHEA 1AP4A 2SCPA 1LKJA 1WY9A 2JTZA 2M3WA 3SIBA 1RFJA 3M0WA 2CCMA 1LXFC 2ZFDA 1TN4A 1B4CA 1H4BA 1DJYA 1SRAA 3OX6A 2E30A 3TZ1A 1G8IA 1K95A 4AQJA 1OSAA 1YVHA 3GK4X 1BR4B 4QJ3B 1CFFA 2FJUB 2ZN9A 4JQ0D 3NSOA 3DVKA 1MF8B 1DF0A 2BBNA 2JWWA 5JOLA 4A4CA 4ORCB 2R2IA 4AQIA 1MWNA 1UHKA 1TCOB 1B8RA 1RECA 2I18A 2KAVA 1F55A 1CFDA 1QXPA 2L50A 5TNCA 2JZIA 1YRTB 1KK8C 1KFXL 3RM1A 1JFJA 2CNPA 3KEVA 2DOQA 1PSRA 2LNKA 4OV2A 2F8PA 3I5IC 4XJKA 1NPQA 1KWOB 1TCFA 1AUIB 1PVAA 2L4HA 2LMUA 3KF9A 1JSAA 1MXLC 2JQ6A 1J55A 3CLNA 1SL9A 1Y6WA 1ODBA 1S5GY 2K0JA 3JVTB 4P2YB 4DUQA 2B1UA 1WLMA 4GPLB 1HT9A 3AKAA 1M46A 3CGAA 5CSIA 1L2OB 1J1DA 1YX8A 1S26D 4YBHB 4CLNA 2L2EA 4USLA 2LANA 2NLNA 2AAOA 1SR6B 2L0PA 3CZTX 1S6JA 1W7JB 3FS7A 1EL4A 1MR8A 2HETA 3HX4A 2HQWA 4HREE 5J3XA 2BL0C 1R2UA 2MLFC 1FI5A 1K9UA 2M29A 1JF0A 2LVJA 1CFPA 3KO0A 1PULA 3BQ3A 1ALVA 1PK0D 3EK8A 5HKZA 1KQMC 1TIZA 2CT9A 2ISDA 2KI6D 1XFZO 2FCEA 2Y1NA 1B8LA 1IRJA 2KQ6A 1QX7A 1FW4A 2KNEA 4BY4A 1KSMA 2NXQA 1OZSA 2LMVA 2L51A 2M97A 3WXAA 4QJ5B 1IQ5A 4PHJA 2RGIA 1JBAA 1GGZA 1A29A 4MRYA 3SG4A 4WRIA 1TNPA 1M63B 1QX2A 2LP3A 2AMIA 4CFQA 2KI4C 2Q4UA 5HYDA 2I94A 2LHLA 1YX7A 1DJGA 2OS8C 1ZOTB 1BR1B 1XK4A 1KQVA 1QLSA 2CXJA 3OX5A 2QACA 1UUSA 3LCPC 2ZNEA 2M8UA 2F2OA 4GUKA 2KFFA 1IJ6A 3PALA 4I5KA 5AFPA 2F2PA 1DTLA 1TTXA 2GGMA 3LK0A 1QS7A 3PATA 1XFYO 1DF0B 1K90D 1KK8B 4ORAB 3LK1A 1XK4C 2KDHA 4GAOA 1V1GA 5I2OA 2CBLA 2F33A 1SK6D 4FQOA 1MUXA 3I5IB 3I5HB 1JF2A 1Q80A 1CM1A 5KSZA 1PVBA 3BYAA 4L9MA 2BCBA 3GK2A 1CFCA 3DD4A 2E6WA 1B47A 2K8MB 1YTZC 1N2DA 2K2AA 4M2PA 5HKYA 2JXLA 1B7TY 5DKRA 3TDIA 4C0LA 1DMOA 1MXEA 3I5FC 1DGUA 3ZNIA 4CIDA 1XFUO 5B8IB 3CS1A 4OCIA 2LUCA 1IG5A 3DVEA 5ER5A 4JWQA 2M9GA 1WRKA 2LVVA 2BL0B 3E3RA 1OMDA 1C07A 2BKIB 3SG2A 2EGDA 1SBJA 3QRXA 2KFHA 4ETOA 4YGCB 1OZOA 2Y1MA 1BG1A 1NX0A 2LUXA 3O78A 2OPOA 4NDCA 4GGNA 2PRUA 4ICBA 3EVVA 3PSRA 1D1OA 2GGZA 1TRFA 1G33A 2LLUA 4PALA 1HQVA 1DJXA 1F4OA 1IJ5A 2LVKA 2BECA 4MLWA 3OP0A 2KBIA 5CSJA 2KYFA 4C0KA 2BKHB 3A8RA 2BE4A 1Y1AA 1BF5A 2I7AA 1B9AA 1GJYA 4YI9A 3EKJA 2P6BB 3TUYC 3I5GC 3RLZA 5AERA 1RK9A 3H4SE 3SG5A 3TDUA 1QIWA 2LV7A 1CKKA 4PCWA 1TNQA 4PE7A 1UHNA 1CDMA 1ZMZA 1CM4A 4CPVA 1RTP1 1LA3A 2LLTA 3EVUA 4E68A 1S5GZ 1YUTA 2TN4A 1MHOA 3EK7A 1QX5B 3A4UB 1TOPA 2D8NA 1V1FA 3BUNB 4N1FA 5CSNA 3OB2B 2BCAA 4BY5A 4HRHA 1NIWA 4YGDB 3TS5C 5HLVA 2WCEA 2HPSA 1NCYA 1C7VA 1K93D 1S1EA 1JC2A 2M1KB 1U5IA 1KK7Y 1EH2A 2L5XB 2LAPA 2MBXA 2BBMA 4GNKB 4YGEB 1WRLA 3BUOB 1AHRA 3TDZA 1QASA 2GV5A 1QLKA 3PFVA 4YGAA 1CDPA 1EG4A 5GQQC 3I5FB 1AK8A 1G4YR 1SCMC 1Y0VH 2JT8A 2KGRA 4YRUA 1F54A 2KAYA 3OB1B 3BXKA 2MAZA 1WLZA 2L98A 4I5NB 1XO5A 3BUMB 4MZJA 4TNCA 3GOFA 4C0JA 2CTNA 2IS9A 1YVLA 1IGVA 2K7CA 2Y5IA 4F0ZB 1BODA 2VRGA 3PLFB 3VRQA 3WNXB 1S36A 5DKQA 2WC8A 1XFWO 1LA0A 1RROA 3D10A 5AXIA 2K2FA 1CLBA 2KSPA 1N65A 1RJVA 2MRDA 2LHIA 2QPTA 1IQ3A 3NSLA 1A75A 3DF0A 3K21A 3AAKA 4U8DA 2WNDA 4ZCVA 3HCMA 2NCPA 4N5XA 2JXCA 1CB1A 1ZFSA 3BOWA 1QV1A 1F8HA 1DGVA 4M2QA 1J7QA 1E8AA 1PALA 1QATA 2I2RE 4WQ3A 1RWYA 2WCFA 2COLB 1AJ5A 2JT0A 3F45A 4Q04A 1SPYA 3VRRA 1QTXA 3EK4A 3FWCA 1C7WA 1N0YA 2HF5A 1NCXA 1W7IB 1QV0A 2KI6C 2AUCA 1X02A 4DS7A 1UHJA 2NZ0A 2BCXA 3IQQA 2ZRTA 1VRKA 2M0RA 1UHIA 3PN7C 3O4YA 1SCVA 2KYCA 4I5LB 1J7RA 3TS5B 2JT3A 1XA5A 4MBEA 1K96A 3IF7A 1XFVO 4QJ4B 1DT7B 1PSBA 2M1UA 5I2QA 1OE9B 2A4JA 2H2KA 1BJFA 4DIRA 2PMYA 1U5IB 1Y1UA 2LMTA 1SCMB 1KQMB 2ZRSA 3FWBA 1FF1A 1NCZA 2L4IA 4YGBB 1QVIY 2G2BA 3DVMA 2JNFA 1YUSA 5HLOA 3VROA 1GQMA 2MA2A 5BPJA 1XFXO 2F3ZA 4DCKA 2KAXA 1JWDA 5D7FA 2V53A 1UP5A 1A03A 4GBAA 4MRXA 4NQGA 2H61C 1CLLA 3KPXA 1KCYA 2MHHA 5G08A 2K7DA 2ZN8A 2KI4B 5FYXA 4PE0A 5DKNA 2OS8B 1JUOA 4PE4A 1SKTA 5I8NA 2OTGC 1WDCC 1IWQA 1S3PA 2JTTA 2JU0A 3BUXB 1FI6A 2O5GA 5AANA 5CPVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O60 A;  1NYA A;  3VRP A;  1A75 B;  1K8U A;  3DF0 B;  5JJG A;  1LVC D;  1NX2 A;  1SMG A;  1XVJ A;  3DVJ A;  2LP2 A;  1ALW A;  1JFK A;  3BOW B;  3CTN A;  3JTD C;  4WQ2 A;  3AAJ A;  2MJW B;  5F6T A;  3AKB A;  2HQ8 A;  4XYN A;  2G9B A;  2MLE C;  3WHT B;  4JPZ B;  3BUW B;  2PAS A;  4PHN A;  2PVB A;  2JC2 A;  3NXA A;  1FBV A;  5I2L A;  5AEQ A;  1KK7 Z;  1K9P A;  1OQP A;  4MEW A;  1CNP A;  1GGW A;  3IQO A;  1S6I A;  1F4Q A;  1SL7 A;  1F71 A;  2Q91 A;  3VGO A;  1YUU A;  1PRW A;  1CMF A;  1M31 A;  1YR5 A;  1CLM A;  3CWG A;  3PN7 B;  1M45 A;  3I5H C;  1TNX A;  2FCD A;  1OMR A;  4NDB A;  3ZWH A;  5K89 A;  1SY9 A;  2WCB A;  3ICB A;  4NDD A;  1A4P A;  2PAL A;  3D0Y B;  4ORB B;  1BMO A;  2KFG A;  4OR9 B;  1BT6 A;  1KFU L;  1NX1 A;  2K7B A;  1IH0 A;  4MVF A;  1F70 A;  2WOR A;  1WRZ A;  1DJI A;  2F3Y A;  4MSP A;  2SAS A;  1UHH A;  1AVS A;  4IL1 A;  2EC6 C;  3LLE A;  4OVN F;  4DRW A;  4A4B A;  4PDZ A;  1OMV A;  3EVR A;  4HRG A;  5CSF A;  1QIV A;  3EKH A;  1J7O A;  1H8B A;  1NWD A;  2LVI A;  1NUB A;  1DJH A;  4D1E A;  1SYM A;  1NX3 A;  4CFR A;  3O2P A;  1S6C A;  2FOT A;  2KHN A;  2KBM A;  1L7Z A;  4N1G A;  1Y1X A;  3SIA A;  2ZKM X;  1UUR A;  2BE6 A;  1DJW A;  4I5J A;  2M7L A;  1AJ4 A;  1YUR A;  1EXR A;  1EG3 A;  3LL8 B;  1YRU B;  2LC5 A;  1J1E A;  2KGB C;  1NP8 A;  1CTR A;  1SW8 A;  4GFT A;  1BOC A;  1B8C A;  3NSI A;  4ZCU A;  3C1V A;  3O6B A;  3TUY B;  3I5G B;  2OTG B;  1WDC B;  1ZUZ A;  2M7N A;  2PSR A;  2ZND A;  5IBW A;  5KU1 A;  1CDL A;  1BU3 A;  1BLQ A;  1NSH A;  1UWO A;  2KOT A;  1KSO A;  2K7O A;  4YI8 A;  3FIA A;  3NSK A;  3SG6 A;  2JOJ A;  4UPG A;  1A2X A;  4MZL A;  1DVI A;  4PHK A;  2LM5 A;  1K2H A;  2JPT A;  2LCP A;  4MZK A;  1B1G A;  3D0Y A;  5PAL A;  3JTD B;  1B7T Z;  4M2O A;  3SJS A;  1SL8 A;  1KWO C;  2JNX A;  4FTG A;  4P5O E;  5HKW A;  3OHM B;  1MQ1 A;  4R1E A;  1CDN A;  5D69 A;  1J7P A;  1K9K A;  1LIN A;  2NCO A;  2WOS A;  3SG3 A;  1KFX S;  3JVT C;  1M39 A;  3CR5 X;  2EHB A;  1TNW A;  4GGF A;  1CMG A;  1L2O C;  1XYD A;  1DJZ A;  3CR2 A;  1QJT A;  1QVI Z;  3SG7 A;  1SR6 C;  2LE9 B;  2JUL A;  2M49 B;  4XJK B;  5KTY A;  3WHU B;  4OKH A;  4GGF C;  1FPW A;  1K94 A;  1R6P A;  1KFU S;  2H61 A;  4MN0 A;  2K61 A;  4PHM A;  4PE1 A;  1SNL A;  2Y4Q A;  2EC6 B;  1OOJ A;  3CR4 X;  1EJ3 A;  1ZAC A;  2LLS A;  2JRF A;  5ER4 X;  1IKU A;  4AOM A;  3VRN A;  4HSZ A;  2KQY A;  3GK1 A;  3MSE B;  3PM8 A;  3KHE A;  1AP4 A;  2SCP A;  1LKJ A;  1WY9 A;  2JTZ A;  2M3W A;  3SIB A;  1RFJ A;  3M0W A;  2CCM A;  1LXF C;  2ZFD A;  1TN4 A;  1B4C A;  1H4B A;  1DJY A;  1SRA A;  3OX6 A;  2E30 A;  3TZ1 A;  1G8I A;  1K95 A;  4AQJ A;  1OSA A;  1YVH A;  3GK4 X;  1BR4 B;  4QJ3 B;  1CFF A;  2FJU B;  2ZN9 A;  4JQ0 D;  3NSO A;  3DVK A;  1MF8 B;  1DF0 A;  2BBN A;  2JWW A;  5JOL A;  4A4C A;  4ORC B;  2R2I A;  4AQI A;  1MWN A;  1UHK A;  1TCO B;  1B8R A;  1REC A;  2I18 A;  2KAV A;  1F55 A;  1CFD A;  1QXP A;  2L50 A;  5TNC A;  2JZI A;  1YRT B;  1KK8 C;  1KFX L;  3RM1 A;  1JFJ A;  2CNP A;  3KEV A;  2DOQ A;  1PSR A;  2LNK A;  4OV2 A;  2F8P A;  3I5I C;  4XJK A;  1NPQ A;  1KWO B;  1TCF A;  1AUI B;  1PVA A;  2L4H A;  2LMU A;  3KF9 A;  1JSA A;  1MXL C;  2JQ6 A;  1J55 A;  3CLN A;  1SL9 A;  1Y6W A;  1ODB A;  1S5G Y;  2K0J A;  3JVT B;  4P2Y B;  4DUQ A;  2B1U A;  1WLM A;  4GPL B;  1HT9 A;  3AKA A;  1M46 A;  3CGA A;  5CSI A;  1L2O B;  1J1D A;  1YX8 A;  1S26 D;  4YBH B;  4CLN A;  2L2E A;  4USL A;  2LAN A;  2NLN A;  2AAO A;  1SR6 B;  2L0P A;  3CZT X;  1S6J A;  1W7J B;  3FS7 A;  1EL4 A;  1MR8 A;  2HET A;  3HX4 A;  2HQW A;  4HRE E;  5J3X A;  2BL0 C;  1R2U A;  2MLF C;  1FI5 A;  1K9U A;  2M29 A;  1JF0 A;  2LVJ A;  1CFP A;  3KO0 A;  1PUL A;  3BQ3 A;  1ALV A;  1PK0 D;  3EK8 A;  5HKZ A;  1KQM C;  1TIZ A;  2CT9 A;  2ISD A;  2KI6 D;  1XFZ O;  2FCE A;  2Y1N A;  1B8L A;  1IRJ A;  2KQ6 A;  1QX7 A;  1FW4 A;  2KNE A;  4BY4 A;  1KSM A;  2NXQ A;  1OZS A;  2LMV A;  2L51 A;  2M97 A;  3WXA A;  4QJ5 B;  1IQ5 A;  4PHJ A;  2RGI A;  1JBA A;  1GGZ A;  1A29 A;  4MRY A;  3SG4 A;  4WRI A;  1TNP A;  1M63 B;  1QX2 A;  2LP3 A;  2AMI A;  4CFQ A;  2KI4 C;  2Q4U A;  5HYD A;  2I94 A;  2LHL A;  1YX7 A;  1DJG A;  2OS8 C;  1ZOT B;  1BR1 B;  1XK4 A;  1KQV A;  1QLS A;  2CXJ A;  3OX5 A;  2QAC A;  1UUS A;  3LCP C;  2ZNE A;  2M8U A;  2F2O A;  4GUK A;  2KFF A;  1IJ6 A;  3PAL A;  4I5K A;  5AFP A;  2F2P A;  1DTL A;  1TTX A;  2GGM A;  3LK0 A;  1QS7 A;  3PAT A;  1XFY O;  1DF0 B;  1K90 D;  1KK8 B;  4ORA B;  3LK1 A;  1XK4 C;  2KDH A;  4GAO A;  1V1G A;  5I2O A;  2CBL A;  2F33 A;  1SK6 D;  4FQO A;  1MUX A;  3I5I B;  3I5H B;  1JF2 A;  1Q80 A;  1CM1 A;  5KSZ A;  1PVB A;  3BYA A;  4L9M A;  2BCB A;  3GK2 A;  1CFC A;  3DD4 A;  2E6W A;  1B47 A;  2K8M B;  1YTZ C;  1N2D A;  2K2A A;  4M2P A;  5HKY A;  2JXL A;  1B7T Y;  5DKR A;  3TDI A;  4C0L A;  1DMO A;  1MXE A;  3I5F C;  1DGU A;  3ZNI A;  4CID A;  1XFU O;  5B8I B;  3CS1 A;  4OCI A;  2LUC A;  1IG5 A;  3DVE A;  5ER5 A;  4JWQ A;  2M9G A;  1WRK A;  2LVV A;  2BL0 B;  3E3R A;  1OMD A;  1C07 A;  2BKI B;  3SG2 A;  2EGD A;  1SBJ A;  3QRX A;  2KFH A;  4ETO A;  4YGC B;  1OZO A;  2Y1M A;  1BG1 A;  1NX0 A;  2LUX A;  3O78 A;  2OPO A;  4NDC A;  4GGN A;  2PRU A;  4ICB A;  3EVV A;  3PSR A;  1D1O A;  2GGZ A;  1TRF A;  1G33 A;  2LLU A;  4PAL A;  1HQV A;  1DJX A;  1F4O A;  1IJ5 A;  2LVK A;  2BEC A;  4MLW A;  3OP0 A;  2KBI A;  5CSJ A;  2KYF A;  4C0K A;  2BKH B;  3A8R A;  2BE4 A;  1Y1A A;  1BF5 A;  2I7A A;  1B9A A;  1GJY A;  4YI9 A;  3EKJ A;  2P6B B;  3TUY C;  3I5G C;  3RLZ A;  5AER A;  1RK9 A;  3H4S E;  3SG5 A;  3TDU A;  1QIW A;  2LV7 A;  1CKK A;  4PCW A;  1TNQ A;  4PE7 A;  1UHN A;  1CDM A;  1ZMZ A;  1CM4 A;  4CPV A;  1RTP 1;  1LA3 A;  2LLT A;  3EVU A;  4E68 A;  1S5G Z;  1YUT A;  2TN4 A;  1MHO A;  3EK7 A;  1QX5 B;  3A4U B;  1TOP A;  2D8N A;  1V1F A;  3BUN B;  4N1F A;  5CSN A;  3OB2 B;  2BCA A;  4BY5 A;  4HRH A;  1NIW A;  4YGD B;  3TS5 C;  5HLV A;  2WCE A;  2HPS A;  1NCY A;  1C7V A;  1K93 D;  1S1E A;  1JC2 A;  2M1K B;  1U5I A;  1KK7 Y;  1EH2 A;  2L5X B;  2LAP A;  2MBX A;  2BBM A;  4GNK B;  4YGE B;  1WRL A;  3BUO B;  1AHR A;  3TDZ A;  1QAS A;  2GV5 A;  1QLK A;  3PFV A;  4YGA A;  1CDP A;  1EG4 A;  5GQQ C;  3I5F B;  1AK8 A;  1G4Y R;  1SCM C;  1Y0V H;  2JT8 A;  2KGR A;  4YRU A;  1F54 A;  2KAY A;  3OB1 B;  3BXK A;  2MAZ A;  1WLZ A;  2L98 A;  4I5N B;  1XO5 A;  3BUM B;  4MZJ A;  4TNC A;  3GOF A;  4C0J A;  2CTN A;  2IS9 A;  1YVL A;  1IGV A;  2K7C A;  2Y5I A;  4F0Z B;  1BOD A;  2VRG A;  3PLF B;  3VRQ A;  3WNX B;  1S36 A;  5DKQ A;  2WC8 A;  1XFW O;  1LA0 A;  1RRO A;  3D10 A;  5AXI A;  2K2F A;  1CLB A;  2KSP A;  1N65 A;  1RJV A;  2MRD A;  2LHI A;  2QPT A;  1IQ3 A;  3NSL A;  1A75 A;  3DF0 A;  3K21 A;  3AAK A;  4U8D A;  2WND A;  4ZCV A;  3HCM A;  2NCP A;  4N5X A;  2JXC A;  1CB1 A;  1ZFS A;  3BOW A;  1QV1 A;  1F8H A;  1DGV A;  4M2Q A;  1J7Q A;  1E8A A;  1PAL A;  1QAT A;  2I2R E;  4WQ3 A;  1RWY A;  2WCF A;  2COL B;  1AJ5 A;  2JT0 A;  3F45 A;  4Q04 A;  1SPY A;  3VRR A;  1QTX A;  3EK4 A;  3FWC A;  1C7W A;  1N0Y A;  2HF5 A;  1NCX A;  1W7I B;  1QV0 A;  2KI6 C;  2AUC A;  1X02 A;  4DS7 A;  1UHJ A;  2NZ0 A;  2BCX A;  3IQQ A;  2ZRT A;  1VRK A;  2M0R A;  1UHI A;  3PN7 C;  3O4Y A;  1SCV A;  2KYC A;  4I5L B;  1J7R A;  3TS5 B;  2JT3 A;  1XA5 A;  4MBE A;  1K96 A;  3IF7 A;  1XFV O;  4QJ4 B;  1DT7 B;  1PSB A;  2M1U A;  5I2Q A;  1OE9 B;  2A4J A;  2H2K A;  1BJF A;  4DIR A;  2PMY A;  1U5I B;  1Y1U A;  2LMT A;  1SCM B;  1KQM B;  2ZRS A;  3FWB A;  1FF1 A;  1NCZ A;  2L4I A;  4YGB B;  1QVI Y;  2G2B A;  3DVM A;  2JNF A;  1YUS A;  5HLO A;  3VRO A;  1GQM A;  2MA2 A;  5BPJ A;  1XFX O;  2F3Z A;  4DCK A;  2KAX A;  1JWD A;  5D7F A;  2V53 A;  1UP5 A;  1A03 A;  4GBA A;  4MRX A;  4NQG A;  2H61 C;  1CLL A;  3KPX A;  1KCY A;  2MHH A;  5G08 A;  2K7D A;  2ZN8 A;  2KI4 B;  5FYX A;  4PE0 A;  5DKN A;  2OS8 B;  1JUO A;  4PE4 A;  1SKT A;  5I8N A;  2OTG C;  1WDC C;  1IWQ A;  1S3P A;  2JTT A;  2JU0 A;  3BUX B;  1FI6 A;  2O5G A;  5AAN A;  5CPV A; 
#chains in the Genus database with same CATH topology
 2O60 A;  1NYA A;  3VRP A;  1A75 B;  1K8U A;  2QEH A;  3DF0 B;  5JJG A;  1LVC D;  1NX2 A;  1SMG A;  1XVJ A;  3CZ1 A;  3DVJ A;  2LP2 A;  1ALW A;  1JFK A;  3BOW B;  3CTN A;  3JTD C;  4WQ2 A;  3AAJ A;  2MJW B;  5F6T A;  3AKB A;  2HQ8 A;  4XYN A;  2G9B A;  2MLE C;  3SS5 A;  3WHT B;  3S0F A;  4JPZ B;  2H8V A;  1IIO A;  3BUW B;  2PAS A;  4PHN A;  2PVB A;  2JC2 A;  3NXA A;  1FBV A;  5I2L A;  5AEQ A;  1KK7 Z;  1K9P A;  1OQP A;  4MEW A;  1CNP A;  1F71 A;  1GGW A;  3IQO A;  1S6I A;  1F4Q A;  3CZ0 A;  1SL7 A;  2YGU A;  2Q91 A;  3VGO A;  1YUU A;  1PRW A;  1CMF A;  1M31 A;  1YR5 A;  1CLM A;  3CWG A;  3PN7 B;  1M45 A;  3I5H C;  1TNX A;  2FCD A;  1OMR A;  4NDB A;  3ZWH A;  5K89 A;  1SY9 A;  2WCB A;  3ICB A;  4NDD A;  1SSE B;  1A4P A;  2PAL A;  3D0Y B;  4ORB B;  1BMO A;  2KFG A;  1W9Z A;  1BT6 A;  4OR9 B;  1KFU L;  1NX1 A;  2K7B A;  1IH0 A;  4MVF A;  1F70 A;  2WOR A;  1WRZ A;  1DJI A;  2F3Y A;  4MSP A;  2SAS A;  1OOH A;  1UHH A;  1AVS A;  2GTE A;  4IL1 A;  2EC6 C;  3LLE A;  4OVN F;  5CSI A;  4DRW A;  4A4B A;  4PDZ A;  1OMV A;  3EVR A;  4HRG A;  5CSF A;  1QIV A;  3EKH A;  1J7O A;  1H8B A;  1NWD A;  2LVI A;  1NUB A;  1DJH A;  4D1E A;  1SYM A;  1NX3 A;  4CFR A;  3O2P A;  1S6C A;  2FOT A;  2KHN A;  2KBM A;  1L7Z A;  4N1G A;  1Y1X A;  3D75 A;  2ZKM X;  1UUR A;  3SIA A;  2BE6 A;  1OW4 A;  1DJW A;  3N7H A;  4IJ7 A;  4I5J A;  2M7L A;  1AJ4 A;  1YUR A;  1EXR A;  2WCL A;  1EG3 A;  3LL8 B;  1YRU B;  2LC5 A;  1J1E A;  2KGB C;  1NP8 A;  1CTR A;  1SW8 A;  4GFT A;  1BOC A;  1B8C A;  3NSI A;  4ZCU A;  3C1V A;  3O6B A;  3TUY B;  3I5G B;  2OTG B;  2WCJ A;  1WDC B;  5FI2 A;  1ZUZ A;  2M7N A;  2PSR A;  2ZND A;  5IBW A;  5KU1 A;  1CDL A;  1BU3 A;  2BNX A;  1BLQ A;  1NSH A;  1UWO A;  2KOT A;  1KSO A;  2K7O A;  4INW A;  3FIA A;  3NSK A;  4YI8 A;  2JOJ A;  3SG6 A;  4UPG A;  2FJY A;  1A2X A;  4MZL A;  1DVI A;  4PHK A;  2LM5 A;  1K2H A;  2JPT A;  2LCP A;  2WC6 A;  3EG5 B;  3D0Y A;  4MZK A;  5PAL A;  3JTD B;  1B7T Z;  1B1G A;  4M2O A;  3SJS A;  1SL8 A;  3UO9 A;  1KWO C;  2JNX A;  3O4X A;  4FTG A;  4P5O E;  5HKW A;  3OHM B;  1MQ1 A;  4R1E A;  1CDN A;  5D69 A;  1J7P A;  1K9K A;  1LIN A;  2NCO A;  2WOS A;  3SG3 A;  1KFX S;  3JVT C;  1M39 A;  3CR5 X;  2EHB A;  2L5Y A;  1TNW A;  3OBV A;  3OGN A;  4GGF A;  1CMG A;  1L2O C;  1XYD A;  1DJZ A;  3CR2 A;  1QJT A;  1DC1 A;  1QVI Z;  2KLD A;  2L2C A;  1SR6 C;  3SG7 A;  3B87 A;  2LE9 B;  2JUL A;  2M49 B;  4XJK B;  3S0D A;  5KTY A;  3WHU B;  4OKH A;  4GGF C;  1FPW A;  1K94 A;  1R6P A;  1KFU S;  1GM0 A;  2H61 A;  4MN0 A;  2K61 A;  4PHM A;  4PE1 A;  1SNL A;  2Y4Q A;  3BJH A;  2EC6 B;  1OOJ A;  3CR4 X;  3DZT A;  1EJ3 A;  1ZAC A;  2LLS A;  2JRF A;  5ER4 X;  1IKU A;  4AOM A;  1C3Y A;  3VRN A;  4HSZ A;  2KQY A;  3GK1 A;  3MSE B;  3PM8 A;  3KHE A;  1AP4 A;  2SCP A;  1LKJ A;  1WY9 A;  2JTZ A;  2M3W A;  3Q8I A;  3SIB A;  2JPO A;  5HL1 A;  1RFJ A;  3M0W A;  2CCM A;  1LXF C;  2ZFD A;  1TN4 A;  1B4C A;  1H4B A;  1DJY A;  1SRA A;  3OX6 A;  2E30 A;  3TZ1 A;  1TUJ A;  1G8I A;  1K95 A;  2QEO A;  1OSA A;  4AQJ A;  2P70 A;  1YVH A;  3GK4 X;  1BR4 B;  4QJ3 B;  1CFF A;  2FJU B;  2ZN9 A;  4OZD A;  2QDI A;  4JQ0 D;  3NSO A;  3DVK A;  2P71 A;  1OOG A;  1MF8 B;  1DF0 A;  2BBN A;  2JWW A;  5JOL A;  4A4C A;  4ORC B;  3B7A A;  2R2I A;  4AQI A;  1MWN A;  1UHK A;  1TCO B;  1B8R A;  4JD9 A;  1REC A;  2I18 A;  2KAV A;  1F55 A;  3V2L A;  1DQE A;  1CFD A;  1QXP A;  2L50 A;  5TNC A;  2JZI A;  1YRT B;  1KK8 C;  1KFX L;  3RM1 A;  1OOF A;  1JFJ A;  2CNP A;  3KEV A;  2DOQ A;  1PSR A;  3B6X A;  2LNK A;  4OV2 A;  2F8P A;  3I5I C;  4XJK A;  1NPQ A;  1KWO B;  1TCF A;  1AUI B;  1PVA A;  3CAB A;  2L4H A;  2LMU A;  3RZS A;  3PM2 A;  3KF9 A;  1JSA A;  1MXL C;  2JQ6 A;  1J55 A;  1P28 A;  3CLN A;  3CYZ A;  1SL9 A;  1Y6W A;  1ODB A;  1S5G Y;  2K0J A;  3JVT B;  4P2Y B;  4DUQ A;  2B1U A;  1WLM A;  4GPL B;  2WCM A;  1HT9 A;  3AKA A;  1M46 A;  4JKT A;  3B88 A;  2WCK A;  1L2O B;  1J1D A;  1YX8 A;  1S26 D;  3CGA A;  3L47 A;  2L2E A;  4USL A;  4YBH B;  2LAN A;  4CLN A;  2NLN A;  2AAO A;  1SR6 B;  2L0P A;  3CZT X;  3NGV A;  1S6J A;  1W7J B;  3FS7 A;  1EL4 A;  1MR8 A;  2HET A;  2PQL A;  2HQW A;  3HX4 A;  4HRE E;  2BL0 C;  5J3X A;  1R2U A;  2MLF C;  1FI5 A;  1K9U A;  2M29 A;  1JF0 A;  2LVJ A;  1CFP A;  3KO0 A;  1PUL A;  3BQ3 A;  1ALV A;  1PK0 D;  3EK8 A;  5HKZ A;  1KQM C;  1TIZ A;  2CT9 A;  2ISD A;  2BAP A;  2KI6 D;  1XFZ O;  2FCE A;  2Y1N A;  3FE8 A;  1B8L A;  1IRJ A;  2KQ6 A;  1QX7 A;  1FW4 A;  2KNE A;  4BY4 A;  1KSM A;  2NXQ A;  1OZS A;  2LMV A;  2L51 A;  2M97 A;  3WXA A;  4QJ5 B;  1IQ5 A;  4PHJ A;  2RGI A;  1JBA A;  1GGZ A;  1A29 A;  4MRY A;  3SG4 A;  3S0A A;  4WRI A;  1TNP A;  1M63 B;  1QX2 A;  2LP3 A;  2AMI A;  4CFQ A;  2KI4 C;  2Q4U A;  5HYD A;  2I94 A;  2LHL A;  1YX7 A;  1DJG A;  2OS8 C;  3FE9 A;  1ZOT B;  1BR1 B;  1XK4 A;  1KQV A;  1QLS A;  2CXJ A;  3OX5 A;  3CDN A;  3R1V A;  2QAC A;  1UUS A;  1XFR A;  3LCP C;  2ZNE A;  2M8U A;  2F2O A;  4GUK A;  2KFF A;  1IJ6 A;  3PAL A;  4I5K A;  5AFP A;  2F2P A;  1DTL A;  1TTX A;  2GGM A;  3LK0 A;  1QS7 A;  1T14 A;  1XFY O;  1DF0 B;  1K90 D;  1KK8 B;  3PAT A;  3LK1 A;  4ORA B;  1XK4 C;  2KDH A;  1OOI X;  4GAO A;  1V1G A;  5I2O A;  2CBL A;  2F33 A;  1SK6 D;  4FQO A;  1MUX A;  3IVT A;  3I5I B;  3I5H B;  1QWV A;  1JF2 A;  1Q80 A;  1CM1 A;  5KSZ A;  1PVB A;  3BYA A;  4L9M A;  2BCB A;  4KYN A;  3GK2 A;  1CFC A;  3DD4 A;  5I94 A;  2E6W A;  1B47 A;  2K8M B;  1YTZ C;  1N2D A;  2K2A A;  4M2P A;  5HKY A;  2JXL A;  1B7T Y;  5DKR A;  3TDI A;  4C0L A;  3R1P A;  1DMO A;  1MXE A;  3I5F C;  1DGU A;  3ZNI A;  4CID A;  1XFU O;  5B8I B;  3CS1 A;  4OCI A;  2LUC A;  1IG5 A;  3DVE A;  5ER5 A;  4JWQ A;  2M9G A;  1WRK A;  2LVV A;  2BL0 B;  1Z2C B;  3E3R A;  1OMD A;  3DY9 A;  1C07 A;  2BKI B;  3SG2 A;  2EGD A;  1SBJ A;  3QRX A;  2KFH A;  3PJI A;  4ETO A;  4YGC B;  1OZO A;  2Y1M A;  1BG1 A;  1NX0 A;  2LUX A;  3O78 A;  2OPO A;  4NDC A;  5FI6 A;  4GGN A;  1TUZ A;  2PRU A;  4ICB A;  3EVV A;  3L4A A;  3PSR A;  1D1O A;  2GGZ A;  1TRF A;  1G33 A;  2LLU A;  4PAL A;  1HQV A;  1DJX A;  3K1E A;  1F4O A;  1IJ5 A;  2LVK A;  2BEC A;  4MLW A;  5FI7 A;  3OP0 A;  3B86 A;  2KBI A;  5CSJ A;  2KYF A;  4C0K A;  2BKH B;  3A8R A;  2BE4 A;  3NHI A;  4F7F A;  1Y1A A;  1BF5 A;  2I7A A;  1B9A A;  1GJY A;  4YI9 A;  3D76 A;  3EKJ A;  2P6B B;  3TUY C;  3I5G C;  3RLZ A;  5AER A;  1RK9 A;  3H4S E;  3SG5 A;  3TDU A;  1QIW A;  3D77 A;  2LV7 A;  1CKK A;  4PCW A;  1C3Z A;  1TNQ A;  4PE7 A;  1UHN A;  1CDM A;  1ZMZ A;  3L4L A;  1CM4 A;  4CPV A;  1RTP 1;  1LA3 A;  2LLT A;  3EVU A;  3R1O A;  4E68 A;  1S5G Z;  1YUT A;  2TN4 A;  1MHO A;  3EK7 A;  3R72 A;  1QX5 B;  3A4U B;  1TOP A;  2D8N A;  1V1F A;  3BUN B;  4N1F A;  5CSN A;  3OB2 B;  1TWO A;  2BCA A;  4BY5 A;  4INX A;  4HRH A;  1NIW A;  4YGD B;  3TS5 C;  5HLV A;  2WCE A;  2HPS A;  2KLE A;  5D3O A;  1NCY A;  1C7V A;  1K93 D;  1S1E A;  1JC2 A;  2M1K B;  1U5I A;  1KK7 Y;  1EH2 A;  2L5X B;  2LAP A;  1ORG A;  2QEV A;  2MBX A;  2BBM A;  4GNK B;  4YGE B;  1WRL A;  3BUO B;  1AHR A;  3TDZ A;  1QAS A;  2GV5 A;  1QLK A;  3PFV A;  4YGA A;  1CDP A;  1EG4 A;  5GQQ C;  3I5F B;  2PYQ A;  3D73 A;  2WCH A;  1AK8 A;  1G4Y R;  1SCM C;  1Y0V H;  2JT8 A;  2ERB A;  2KGR A;  4YRU A;  1F54 A;  2KAY A;  3OB1 B;  3BXK A;  2MAZ A;  1WLZ A;  2L98 A;  4I5N B;  1XO5 A;  3BUM B;  4MZJ A;  4TNC A;  3GOF A;  4C0J A;  2CTN A;  2IS9 A;  1YVL A;  1IGV A;  2K7C A;  2Y5I A;  4F0Z B;  1BOD A;  3BFA A;  2VRG A;  3PLF B;  3VRQ A;  3WNX B;  1S36 A;  5DKQ A;  3FE6 A;  1DEL A;  2WC8 A;  1XFW O;  1LA0 A;  1RRO A;  3D10 A;  4PT1 A;  5AXI A;  2K2F A;  1CLB A;  2KSP A;  1N65 A;  1RJV A;  3DXL A;  2MRD A;  2LHI A;  2QPT A;  1IQ3 A;  3NSL A;  3CZ2 A;  1A75 A;  3DF0 A;  3K21 A;  3AAK A;  4U8D A;  2WND A;  3BFB A;  4ZCV A;  3HCM A;  3UNW A;  2NCP A;  3D74 A;  4N5X A;  2JXC A;  1CB1 A;  1ZFS A;  3BOW A;  5EL2 A;  1QV1 A;  1F8H A;  1DGV A;  4M2Q A;  1J7Q A;  1E8A A;  1PAL A;  1QAT A;  2I2R E;  4WQ3 A;  1RWY A;  2WCF A;  2COL B;  3D78 A;  1AJ5 A;  2JT0 A;  3F45 A;  3QME A;  4Q04 A;  1SPY A;  3SS3 A;  3VRR A;  1QTX A;  3EK4 A;  3FWC A;  1C7W A;  1N0Y A;  2HF5 A;  1NCX A;  1W7I B;  1QV0 A;  2KI6 C;  2AUC A;  1X02 A;  3S0E A;  1Z4H A;  4DS7 A;  1UHJ A;  2NZ0 A;  2BCX A;  3IQQ A;  3S0G A;  2ZRT A;  1VRK A;  2M0R A;  1UHI A;  3PN7 C;  3O4Y A;  3NHT A;  1SCV A;  2KYC A;  4I5L B;  1J7R A;  3TS5 B;  2JT3 A;  3S0B A;  1XA5 A;  4MBE A;  1DEK A;  1K96 A;  3IF7 A;  1XFV O;  4QJ4 B;  1DT7 B;  2QEB A;  1PSB A;  3SS4 A;  2M1U A;  3DYE A;  5I2Q A;  1OE9 B;  2A4J A;  2H2K A;  1BJF A;  3VB1 A;  2PMY A;  4DIR A;  1U5I B;  1Y1U A;  2LMT A;  1SCM B;  1KQM B;  2ZRS A;  3FWB A;  1FF1 A;  1NCZ A;  2L4I A;  4YGB B;  1QVI Y;  2G2B A;  3DVM A;  2JNF A;  3BFH A;  1YUS A;  5HLO A;  3VRO A;  1GQM A;  2MA2 A;  5BPJ A;  1XFX O;  2F3Z A;  4DCK A;  2KAX A;  1JWD A;  5D7F A;  2WC5 A;  2V53 A;  1UP5 A;  1A03 A;  4GBA A;  4MRX A;  4FQT A;  4NQG A;  1LS8 A;  1CLL A;  2H61 C;  3KPX A;  1KCY A;  2MHH A;  5G08 A;  2K7D A;  5DIC A;  2ZN8 A;  2KI4 B;  5FYX A;  4PE0 A;  5DKN A;  2OS8 B;  1JUO A;  4PE4 A;  1SKT A;  5I8N A;  2OTG C;  1WDC C;  1IWQ A;  1S3P A;  2JTT A;  2K60 A;  2JU0 A;  3BUX B;  2KPH A;  1FI6 A;  2O5G A;  5AAN A;  5CPV A; 
#chains in the Genus database with same CATH homology
 2O60 A;  1NYA A;  3VRP A;  1A75 B;  1K8U A;  3DF0 B;  5JJG A;  1LVC D;  1NX2 A;  1SMG A;  1XVJ A;  3DVJ A;  2LP2 A;  1ALW A;  1JFK A;  3BOW B;  3CTN A;  3JTD C;  4WQ2 A;  3AAJ A;  2MJW B;  5F6T A;  3AKB A;  2HQ8 A;  4XYN A;  2G9B A;  2MLE C;  3WHT B;  4JPZ B;  3BUW B;  2PAS A;  4PHN A;  2PVB A;  2JC2 A;  3NXA A;  1FBV A;  5I2L A;  5AEQ A;  1KK7 Z;  1K9P A;  1OQP A;  4MEW A;  1CNP A;  1GGW A;  3IQO A;  1S6I A;  1F4Q A;  1SL7 A;  1F71 A;  2Q91 A;  3VGO A;  1YUU A;  1PRW A;  1CMF A;  1M31 A;  1YR5 A;  1CLM A;  3CWG A;  3PN7 B;  1M45 A;  3I5H C;  1TNX A;  2FCD A;  1OMR A;  4NDB A;  3ZWH A;  5K89 A;  1SY9 A;  2WCB A;  3ICB A;  4NDD A;  1A4P A;  2PAL A;  3D0Y B;  4ORB B;  1BMO A;  2KFG A;  4OR9 B;  1BT6 A;  1KFU L;  1NX1 A;  2K7B A;  1IH0 A;  4MVF A;  1F70 A;  2WOR A;  1WRZ A;  1DJI A;  2F3Y A;  4MSP A;  2SAS A;  1UHH A;  1AVS A;  4IL1 A;  2EC6 C;  3LLE A;  4OVN F;  4DRW A;  4A4B A;  4PDZ A;  1OMV A;  3EVR A;  4HRG A;  5CSF A;  1QIV A;  3EKH A;  1J7O A;  1H8B A;  1NWD A;  2LVI A;  1NUB A;  1DJH A;  4D1E A;  1SYM A;  1NX3 A;  4CFR A;  3O2P A;  1S6C A;  2FOT A;  2KHN A;  2KBM A;  1L7Z A;  4N1G A;  1Y1X A;  3SIA A;  2ZKM X;  1UUR A;  2BE6 A;  1DJW A;  4I5J A;  2M7L A;  1AJ4 A;  1YUR A;  1EXR A;  1EG3 A;  3LL8 B;  1YRU B;  2LC5 A;  1J1E A;  2KGB C;  1NP8 A;  1CTR A;  1SW8 A;  4GFT A;  1BOC A;  1B8C A;  3NSI A;  4ZCU A;  3C1V A;  3O6B A;  3TUY B;  3I5G B;  2OTG B;  1WDC B;  1ZUZ A;  2M7N A;  2PSR A;  2ZND A;  5IBW A;  5KU1 A;  1CDL A;  1BU3 A;  1BLQ A;  1NSH A;  1UWO A;  2KOT A;  1KSO A;  2K7O A;  4YI8 A;  3FIA A;  3NSK A;  3SG6 A;  2JOJ A;  4UPG A;  1A2X A;  4MZL A;  1DVI A;  4PHK A;  2LM5 A;  1K2H A;  2JPT A;  2LCP A;  4MZK A;  1B1G A;  3D0Y A;  5PAL A;  3JTD B;  1B7T Z;  4M2O A;  3SJS A;  1SL8 A;  1KWO C;  2JNX A;  4FTG A;  4P5O E;  5HKW A;  3OHM B;  1MQ1 A;  4R1E A;  1CDN A;  5D69 A;  1J7P A;  1K9K A;  1LIN A;  2NCO A;  2WOS A;  3SG3 A;  1KFX S;  3JVT C;  1M39 A;  3CR5 X;  2EHB A;  1TNW A;  4GGF A;  1CMG A;  1L2O C;  1XYD A;  1DJZ A;  3CR2 A;  1QJT A;  1QVI Z;  3SG7 A;  1SR6 C;  2LE9 B;  2JUL A;  2M49 B;  4XJK B;  5KTY A;  3WHU B;  4OKH A;  4GGF C;  1FPW A;  1K94 A;  1R6P A;  1KFU S;  2H61 A;  4MN0 A;  2K61 A;  4PHM A;  4PE1 A;  1SNL A;  2Y4Q A;  2EC6 B;  1OOJ A;  3CR4 X;  1EJ3 A;  1ZAC A;  2LLS A;  2JRF A;  5ER4 X;  1IKU A;  4AOM A;  3VRN A;  4HSZ A;  2KQY A;  3GK1 A;  3MSE B;  3PM8 A;  3KHE A;  1AP4 A;  2SCP A;  1LKJ A;  1WY9 A;  2JTZ A;  2M3W A;  3SIB A;  1RFJ A;  3M0W A;  2CCM A;  1LXF C;  2ZFD A;  1TN4 A;  1B4C A;  1H4B A;  1DJY A;  1SRA A;  3OX6 A;  2E30 A;  3TZ1 A;  1G8I A;  1K95 A;  4AQJ A;  1OSA A;  1YVH A;  3GK4 X;  1BR4 B;  4QJ3 B;  1CFF A;  2FJU B;  2ZN9 A;  4JQ0 D;  3NSO A;  3DVK A;  1MF8 B;  1DF0 A;  2BBN A;  2JWW A;  5JOL A;  4A4C A;  4ORC B;  2R2I A;  4AQI A;  1MWN A;  1UHK A;  1TCO B;  1B8R A;  1REC A;  2I18 A;  2KAV A;  1F55 A;  1CFD A;  1QXP A;  2L50 A;  5TNC A;  2JZI A;  1YRT B;  1KK8 C;  1KFX L;  3RM1 A;  1JFJ A;  2CNP A;  3KEV A;  2DOQ A;  1PSR A;  2LNK A;  4OV2 A;  2F8P A;  3I5I C;  4XJK A;  1NPQ A;  1KWO B;  1TCF A;  1AUI B;  1PVA A;  2L4H A;  2LMU A;  3KF9 A;  1JSA A;  1MXL C;  2JQ6 A;  1J55 A;  3CLN A;  1SL9 A;  1Y6W A;  1ODB A;  1S5G Y;  2K0J A;  3JVT B;  4P2Y B;  4DUQ A;  2B1U A;  1WLM A;  4GPL B;  1HT9 A;  3AKA A;  1M46 A;  3CGA A;  5CSI A;  1L2O B;  1J1D A;  1YX8 A;  1S26 D;  4YBH B;  4CLN A;  2L2E A;  4USL A;  2LAN A;  2NLN A;  2AAO A;  1SR6 B;  2L0P A;  3CZT X;  1S6J A;  1W7J B;  3FS7 A;  1EL4 A;  1MR8 A;  2HET A;  3HX4 A;  2HQW A;  4HRE E;  5J3X A;  2BL0 C;  1R2U A;  2MLF C;  1FI5 A;  1K9U A;  2M29 A;  1JF0 A;  2LVJ A;  1CFP A;  3KO0 A;  1PUL A;  3BQ3 A;  1ALV A;  1PK0 D;  3EK8 A;  5HKZ A;  1KQM C;  1TIZ A;  2CT9 A;  2ISD A;  2KI6 D;  1XFZ O;  2FCE A;  2Y1N A;  1B8L A;  1IRJ A;  2KQ6 A;  1QX7 A;  1FW4 A;  2KNE A;  4BY4 A;  1KSM A;  2NXQ A;  1OZS A;  2LMV A;  2L51 A;  2M97 A;  3WXA A;  4QJ5 B;  1IQ5 A;  4PHJ A;  2RGI A;  1JBA A;  1GGZ A;  1A29 A;  4MRY A;  3SG4 A;  4WRI A;  1TNP A;  1M63 B;  1QX2 A;  2LP3 A;  2AMI A;  4CFQ A;  2KI4 C;  2Q4U A;  5HYD A;  2I94 A;  2LHL A;  1YX7 A;  1DJG A;  2OS8 C;  1ZOT B;  1BR1 B;  1XK4 A;  1KQV A;  1QLS A;  2CXJ A;  3OX5 A;  2QAC A;  1UUS A;  3LCP C;  2ZNE A;  2M8U A;  2F2O A;  4GUK A;  2KFF A;  1IJ6 A;  3PAL A;  4I5K A;  5AFP A;  2F2P A;  1DTL A;  1TTX A;  2GGM A;  3LK0 A;  1QS7 A;  3PAT A;  1XFY O;  1DF0 B;  1K90 D;  1KK8 B;  4ORA B;  3LK1 A;  1XK4 C;  2KDH A;  4GAO A;  1V1G A;  5I2O A;  2CBL A;  2F33 A;  1SK6 D;  4FQO A;  1MUX A;  3I5I B;  3I5H B;  1JF2 A;  1Q80 A;  1CM1 A;  5KSZ A;  1PVB A;  3BYA A;  4L9M A;  2BCB A;  3GK2 A;  1CFC A;  3DD4 A;  2E6W A;  1B47 A;  2K8M B;  1YTZ C;  1N2D A;  2K2A A;  4M2P A;  5HKY A;  2JXL A;  1B7T Y;  5DKR A;  3TDI A;  4C0L A;  1DMO A;  1MXE A;  3I5F C;  1DGU A;  3ZNI A;  4CID A;  1XFU O;  5B8I B;  3CS1 A;  4OCI A;  2LUC A;  1IG5 A;  3DVE A;  5ER5 A;  4JWQ A;  2M9G A;  1WRK A;  2LVV A;  2BL0 B;  3E3R A;  1OMD A;  1C07 A;  2BKI B;  3SG2 A;  2EGD A;  1SBJ A;  3QRX A;  2KFH A;  4ETO A;  4YGC B;  1OZO A;  2Y1M A;  1BG1 A;  1NX0 A;  2LUX A;  3O78 A;  2OPO A;  4NDC A;  4GGN A;  2PRU A;  4ICB A;  3EVV A;  3PSR A;  1D1O A;  2GGZ A;  1TRF A;  1G33 A;  2LLU A;  4PAL A;  1HQV A;  1DJX A;  1F4O A;  1IJ5 A;  2LVK A;  2BEC A;  4MLW A;  3OP0 A;  2KBI A;  5CSJ A;  2KYF A;  4C0K A;  2BKH B;  3A8R A;  2BE4 A;  1Y1A A;  1BF5 A;  2I7A A;  1B9A A;  1GJY A;  4YI9 A;  3EKJ A;  2P6B B;  3TUY C;  3I5G C;  3RLZ A;  5AER A;  1RK9 A;  3H4S E;  3SG5 A;  3TDU A;  1QIW A;  2LV7 A;  1CKK A;  4PCW A;  1TNQ A;  4PE7 A;  1UHN A;  1CDM A;  1ZMZ A;  1CM4 A;  4CPV A;  1RTP 1;  1LA3 A;  2LLT A;  3EVU A;  4E68 A;  1S5G Z;  1YUT A;  2TN4 A;  1MHO A;  3EK7 A;  1QX5 B;  3A4U B;  1TOP A;  2D8N A;  1V1F A;  3BUN B;  4N1F A;  5CSN A;  3OB2 B;  2BCA A;  4BY5 A;  4HRH A;  1NIW A;  4YGD B;  3TS5 C;  5HLV A;  2WCE A;  2HPS A;  1NCY A;  1C7V A;  1K93 D;  1S1E A;  1JC2 A;  2M1K B;  1U5I A;  1KK7 Y;  1EH2 A;  2L5X B;  2LAP A;  2MBX A;  2BBM A;  4GNK B;  4YGE B;  1WRL A;  3BUO B;  1AHR A;  3TDZ A;  1QAS A;  2GV5 A;  1QLK A;  3PFV A;  4YGA A;  1CDP A;  1EG4 A;  5GQQ C;  3I5F B;  1AK8 A;  1G4Y R;  1SCM C;  1Y0V H;  2JT8 A;  2KGR A;  4YRU A;  1F54 A;  2KAY A;  3OB1 B;  3BXK A;  2MAZ A;  1WLZ A;  2L98 A;  4I5N B;  1XO5 A;  3BUM B;  4MZJ A;  4TNC A;  3GOF A;  4C0J A;  2CTN A;  2IS9 A;  1YVL A;  1IGV A;  2K7C A;  2Y5I A;  4F0Z B;  1BOD A;  2VRG A;  3PLF B;  3VRQ A;  3WNX B;  1S36 A;  5DKQ A;  2WC8 A;  1XFW O;  1LA0 A;  1RRO A;  3D10 A;  5AXI A;  2K2F A;  1CLB A;  2KSP A;  1N65 A;  1RJV A;  2MRD A;  2LHI A;  2QPT A;  1IQ3 A;  3NSL A;  1A75 A;  3DF0 A;  3K21 A;  3AAK A;  4U8D A;  2WND A;  4ZCV A;  3HCM A;  2NCP A;  4N5X A;  2JXC A;  1CB1 A;  1ZFS A;  3BOW A;  1QV1 A;  1F8H A;  1DGV A;  4M2Q A;  1J7Q A;  1E8A A;  1PAL A;  1QAT A;  2I2R E;  4WQ3 A;  1RWY A;  2WCF A;  2COL B;  1AJ5 A;  2JT0 A;  3F45 A;  4Q04 A;  1SPY A;  3VRR A;  1QTX A;  3EK4 A;  3FWC A;  1C7W A;  1N0Y A;  2HF5 A;  1NCX A;  1W7I B;  1QV0 A;  2KI6 C;  2AUC A;  1X02 A;  4DS7 A;  1UHJ A;  2NZ0 A;  2BCX A;  3IQQ A;  2ZRT A;  1VRK A;  2M0R A;  1UHI A;  3PN7 C;  3O4Y A;  1SCV A;  2KYC A;  4I5L B;  1J7R A;  3TS5 B;  2JT3 A;  1XA5 A;  4MBE A;  1K96 A;  3IF7 A;  1XFV O;  4QJ4 B;  1DT7 B;  1PSB A;  2M1U A;  5I2Q A;  1OE9 B;  2A4J A;  2H2K A;  1BJF A;  4DIR A;  2PMY A;  1U5I B;  1Y1U A;  2LMT A;  1SCM B;  1KQM B;  2ZRS A;  3FWB A;  1FF1 A;  1NCZ A;  2L4I A;  4YGB B;  1QVI Y;  2G2B A;  3DVM A;  2JNF A;  1YUS A;  5HLO A;  3VRO A;  1GQM A;  2MA2 A;  5BPJ A;  1XFX O;  2F3Z A;  4DCK A;  2KAX A;  1JWD A;  5D7F A;  2V53 A;  1UP5 A;  1A03 A;  4GBA A;  4MRX A;  4NQG A;  2H61 C;  1CLL A;  3KPX A;  1KCY A;  2MHH A;  5G08 A;  2K7D A;  2ZN8 A;  2KI4 B;  5FYX A;  4PE0 A;  5DKN A;  2OS8 B;  1JUO A;  4PE4 A;  1SKT A;  5I8N A;  2OTG C;  1WDC C;  1IWQ A;  1S3P A;  2JTT A;  2JU0 A;  3BUX B;  1FI6 A;  2O5G A;  5AAN A;  5CPV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...