1VRKA

The 1.9 angstrom structure of e84k-calmodulin rs20 peptide complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
148
structure length
148
Chain Sequence
ADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEKLKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQVNYEEFVQVMMAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of the functional coupling between calmodulin's calcium binding and peptide recognition properties.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Complex(calcium-binding protein/peptide)
molecule keywords CALMODULIN
total genus 53
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 1997-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1vrkA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1vrkA02
1B9AA 3M0WA 4YRUA 1BJFA 2AMIA 3I5FC 2EGDA 1TN4A 3ZNIA 1LXFC 1QLSA 2H2KA 1XFYO 2GGZA 2M29A 1MXEA 3MSEB 1ZUZA 3PM8A 4GGFC 4IL1A 1CKKA 1LA0A 2EC6B 1YR5A 4Q04A 1AUIB 3SG5A 1ALVA 1YX7A 1WY9A 1A2XA 2Y5IA 1YVHA 2BBMA 2L5XB 3O4YA 2JNXA 2L4HA 1IH0A 2LVVA 3PLFB 5IBWA 1A75A 1OMDA 1BU3A 2MJWB 1Y6WA 1CDLA 1S6IA 1SRAA 1CB1A 2KQYA 3CR4X 2L50A 1K9KA 2JWWA 4ZCVA 1GGWA 2LE9B 1TOPA 5JOLA 3OB1B 3KEVA 1B8RA 1L7ZA 3DVMA 2LUCA 1AHRA 3BUXB 3CTNA 4YBHB 1QLKA 1X02A 2BBNA 5FYXA 1TCOB 2F2OA 2FOTA 2L51A 5AXIA 2JXCA 3TS5B 3WHUB 2JT3A 1TTXA 3SG6A 3I5IB 1OQPA 2V53A 4M2QA 2I7AA 4C0KA 1YUTA 1M46A 1QX5B 2PSRA 4PE7A 1AJ4A 1UHIA 3JTDC 2JOJA 2LLUA 2O60A 5G08A 5GQQC 1Y1UA 1MUXA 4A4CA 3LL8B 2M7NA 1DGUA 2LVKA 2MHHA 2M97A 1K2HA 3JVTB 2JPTA 1WLMA 1CM1A 1CDMA 1YVLA 1NYAA 1G8IA 2JT8A 1TNWA 4YGAA 1DJIA 1IQ5A 3AAKA 1B7TY 2CNPA 5HKZA 1KQMB 4DUQA 2PMYA 2WC8A 1OE9B 4MN0A 2NCOA 1BT6A 1J55A 4MZLA 2M7LA 1QASA 2KFHA 2LMUA 2LUXA 4P2YB 2CT9A 1Y0VH 2A4JA 2H61C 2KGRA 1BMOA 5AANA 3TZ1A 5JJGA 3JVTC 2LP3A 2MAZA 2F33A 3TDUA 2FCDA 4XJKB 1NUBA 4MZJA 1CTRA 2BKHB 1BF5A 1YUUA 3EK8A 4OV2A 1N2DA 3F45A 3CGAA 1EG4A 2ISDA 3OX6A 3SJSA 2LNKA 1UP5A 1B7TZ 5HLVA 2ZRTA 1DJWA 2LP2A 4HRGA 4GAOA 2Y1MA 3O2PA 1OSAA 3AKBA 1BLQA 2E30A 5CPVA 3VGOA 3H4SE 1IJ5A 4PE1A 4WQ2A 2E6WA 3SG3A 2I94A 2BCXA 1KK8C 1WRKA 3GK1A 1XVJA 1ZMZA 1QS7A 1S3PA 1WRZA 2JT0A 3A8RA 3NXAA 5DKNA 2HQWA 2QPTA 1W7JB 1SK6D 3AKAA 2GGMA 5AFPA 2LHLA 3HX4A 2KDHA 3BYAA 1MR8A 4YGCB 4D1EA 1S1EA 3TS5C 1SCVA 3D0YB 1PSRA 3KPXA 5I8NA 5DKRA 1M63B 1TCFA 2SASA 3KF9A 4CFQA 1A4PA 2KI6D 3BOWB 2KI6C 2AUCA 1DJYA 3DF0A 1CFPA 3GOFA 1KWOB 1CM4A 3DD4A 4A4BA 3I5GC 3D10A 1K9UA 1V1FA 1YX8A 2F8PA 1UHHA 2K7CA 4FQOA 4JQ0D 1NX0A 1U5IA 4P5OE 4QJ3B 1FI5A 1F70A 4HRHA 4HSZA 2M3WA 4ICBA 3OB2B 5HYDA 2GV5A 3SG7A 2LMTA 2R2IA 1SBJA 3GK4X 1PULA 3KO0A 5KU1A 3PATA 4MSPA 2KQ6A 2D8NA 4R1EA 1KK7Z 4MLWA 1OMVA 1QX7A 3LK1A 2M8UA 1UURA 2K7DA 1LA3A 3BXKA 2JULA 4GBAA 1JC2A 5HLOA 1TNQA 2BL0C 1K90D 1EL4A 1L2OB 4GFTA 1QXPA 1B8CA 1GGZA 1QATA 2WCFA 3VRRA 2LHIA 5J3XA 1DT7B 1XK4A 3DVJA 1DF0B 3O78A 2KAVA 2CXJA 4OKHA 2L4IA 1YRTB 2M1KB 1NX1A 2KAXA 3PN7B 1MHOA 3LCPC 1KQMC 1LVCD 1M39A 1MWNA 4MRYA 5BPJA 3QRXA 1KK8B 2JTZA 1S6CA 5CSFA 2MLEC 4UPGA 3DF0B 1KK7Y 1NSHA 2PALA 1C7VA 1SL9A 1CDNA 3RLZA 4NDBA 4I5KA 3IQOA 2LLTA 3PN7C 1RJVA 3ZWHA 2VRGA 1GQMA 1NWDA 1CNPA 2MRDA 2BE6A 3BUNB 1D1OA 2PASA 4GGNA 5F6TA 2BE4A 3DVEA 2WCBA 2KAYA 5KSZA 1NPQA 2PVBA 1PVBA 3VRNA 2BKIB 1ODBA 1S6JA 2ZN9A 2F2PA 1TNPA 2KNEA 2WOSA 2KSPA 2NLNA 2L0PA 1YTZC 4N5XA 2AAOA 4PDZA 1EJ3A 3KHEA 1NX3A 2MBXA 1SR6C 1CFCA 4HREE 2KBMA 1J1DA 1DJGA 2JC2A 2NCPA 3HCMA 1ZACA 2MA2A 1IWQA 2LMVA 1NCZA 1A75B 4JWQA 1YUSA 2KOTA 2M9GA 4CFRA 1LINA 1KFXS 1UUSA 3BUWB 2Q4UA 4ORBB 2OPOA 4QJ5B 2ZNEA 2TN4A 4ORAB 4MBEA 1TRFA 1WRLA 3E3RA 4PHMA 1SL7A 2KI4B 2Y1NA 4USLA 1WDCB 1ZFSA 1Q80A 2L2EA 4I5NB 4MZKA 1PVAA 1R2UA 1K8UA 1IJ6A 2L98A 2OTGC 2P6BB 1IKUA 1N65A 4YGBB 1VRKA 1WLZA 1CLMA 5I2QA 1QVIZ 1YRUB 5PALA 1OOJA 1SNLA 5I2LA 3CR5X 4PE0A 4E68A 2G2BA 4AQIA 1A29A 1BG1A 4BY4A 1C07A 2HF5A 1KFUS 2LV7A 1JFJA 2KHNA 1KFXL 4XJKA 1KWOC 3LLEA 5CSNA 1SR6B 1BODA 4GUKA 1BR4B 1K9PA 2BCAA 2EHBA 4YGDB 1DMOA 1FPWA 3C1VA 1UHNA 1EG3A 1QJTA 2LVIA 4TNCA 1RTP1 1BOCA 1S26D 2Q91A 3IQQA 1Y1XA 4I5LB 1LKJA 1J7RA 2Y4QA 1QIVA 1U5IB 1DJXA 1S36A 2M49B 1UWOA 4PALA 5I2OA 2CCMA 1CDPA 1FBVA 1KFUL 3O6BA 3VRPA 1DTLA 3VRQA 1HT9A 2LANA 2ZFDA 1H8BA 1XFZO 2BCBA 4PHKA 3EK4A 4DIRA 3CLNA 3SG2A 3I5HB 3K21A 1JWDA 2B1UA 3I5GB 5DKQA 1AP4A 2M1UA 1GJYA 4N1FA 4CPVA 1W7IB 1L2OC 1AK8A 2CTNA 4ETOA 4GPLB 1IQ3A 2LVJA 1AVSA 4ORCB 2OS8B 3EK7A 4CIDA 4L9MA 3NSOA 1K93D 1JF0A 1J1EA 1JFKA 3EVRA 4PCWA 4U8DA 3TDIA 2K2AA 2FCEA 1PALA 1TIZA 3AAJA 1NP8A 5ER5A 1M45A 2F3YA 4PE4A 1NCYA 3OX5A 3WHTB 1PRWA 2KYFA 1EH2A 2WCEA 2KI4C 4NDDA 1V1GA 2K8MB 1QVIY 4N1GA 2FJUB 1WDCC 1JUOA 3WNXB 3I5IC 4OR9B 2JTTA 1UHKA 5CSIA 1F8HA 1K94A 2LAPA 3PSRA 4WRIA 4ZCUA 1S5GY 4GGFA 3OP0A 2RGIA 1A03A 1DVIA 3WXAA 1XYDA 4OVNF 2ZRSA 5K89A 1QTXA 1DGVA 2K7OA 1OMRA 1SY9A 1XFUO 1JF2A 1QV0A 1XFVO 3BUOB 1MQ1A 2JU0A 3CS1A 4AQJA 3NSKA 4GNKB 3BQ3A 2ZN8A 2LC5A 1H4BA 5D7FA 2I18A 4C0JA 3TDZA 3TUYC 1RROA 5CSJA 2HPSA 2PRUA 1FW4A 2CBLA 1K96A 1F55A 1G4YR 1F4OA 1K95A 2ZNDA 1PK0D 2KGBC 1CMFA 1ZOTB 4NDCA 2COLB 4NQGA 1IG5A 1SKTA 3I5FB 4PHJA 3VROA 1XFXO 1ALWA 2LCPA 4M2OA 1F71A 1RECA 3OHMB 1B8LA 2ZKMX 3FWBA 3PFVA 3RM1A 2I2RE 3FS7A 1SMGA 1SYMA 5B8IB 3IF7A 1JBAA 4C0LA 2KBIA 4XYNA 1PSBA 1CLBA 1IRJA 1N0YA 3TUYB 1RWYA 3FIAA 5D69A 1FF1A 1IGVA 3EVUA 3I5HC 2NZ0A 1XO5A 3SIBA 4QJ4B 1B4CA 5HKYA 2LM5A 3EKHA 1QIWA 1EXRA 1MXLC 1KSMA 2KFFA 5AERA 3SIAA 1QV1A 1E8AA 1SL8A 1F4QA 3FWCA 1RK9A 4MEWA 4FTGA 1J7QA 3DVKA 3CWGA 2O5GA 1HQVA 1M31A 1B1GA 1OZSA 3BOWA 1FI6A 3CZTX 2JQ6A 2JRFA 4F0ZB 2WNDA 1TNXA 1SCMB 2H61A 2F3ZA 3EKJA 1QX2A 2M0RA 3GK2A 1DJZA 1XFWO 5AEQA 4MVFA 2SCPA 3JTDB 1KQVA 3LK0A 5HKWA 1KSOA 1XK4C 1UHJA 1R6PA 2K2FA 3BUMB 1B47A 1OZOA 4AOMA 1NX2A 4MRXA 2JZIA 2EC6C 1YURA 2BECA 1S5GZ 4CLNA 1DF0A 4YI8A 3ICBA 1AJ5A 1SCMC 1Y1AA 4JPZB 4YGEB 2KFGA 2QACA 2BL0B 1NCXA 2WORA 3EVVA 1JSAA 2LLSA 2HQ8A 1G33A 1CLLA 1KCYA 3NSLA 1SPYA 1MF8B 2K7BA 4OCIA 4DRWA 2MLFC 4PHNA 2G9BA 2HETA 2IS9A 1CFFA 1C7WA 5ER4X 1BR1B 4WQ3A 3CR2A 1CMGA 1NIWA 2JNFA 1CFDA 3SG4A 1DJHA 2K61A 3NSIA 5TNCA 1RFJA 4YI9A 2NXQA 1SW8A 5KTYA 4BY5A 3PALA 1J7OA 2OS8C 3D0YA 3A4UB 1J7PA 1F54A 2DOQA 4DCKA 4I5JA 4M2PA 4DS7A 2JXLA 2KYCA 1XA5A 2OTGB 2K0JA
chains in the Genus database with same CATH superfamily
1B9AA 3M0WA 4YRUA 1BJFA 2AMIA 3R1VA 3I5FC 2EGDA 1TN4A 3ZNIA 1LXFC 1QLSA 2H2KA 1XFYO 2GGZA 2M29A 1MXEA 3MSEB 1ZUZA 3BFBA 3PM8A 4GGFC 4IL1A 3V2LA 1LA0A 2EC6B 1CKKA 1YR5A 4Q04A 2JPOA 1AUIB 3SG5A 3D74A 1ALVA 1YX7A 1WY9A 1A2XA 2Y5IA 1YVHA 2BBMA 2L5XB 3O4YA 2JNXA 2L4HA 1IH0A 1OOHA 2LVVA 2PQLA 3PLFB 5IBWA 1A75A 1OMDA 1BU3A 2MJWB 1Y6WA 1CDLA 1S6IA 1SRAA 1CB1A 2KQYA 3CR4X 2L50A 1K9KA 2JWWA 3OBVA 4ZCVA 1GGWA 2LE9B 1TOPA 5JOLA 3OB1B 3KEVA 1B8RA 1L7ZA 3DVMA 2LUCA 3FE8A 1AHRA 3BUXB 3CTNA 4YBHB 1QLKA 1X02A 2BBNA 5FYXA 5I94A 1TCOB 2F2OA 2FOTA 2L51A 4INWA 3BJHA 5AXIA 2JXCA 3TS5B 3IVTA 2JT3A 5FI7A 3WHUB 1TTXA 3SG6A 3I5IB 1OQPA 2V53A 4M2QA 2I7AA 4C0KA 1YUTA 1M46A 1QX5B 2PSRA 4PE7A 1AJ4A 1UHIA 3JTDC 2JOJA 2LLUA 2O60A 5G08A 5GQQC 1Y1UA 1MUXA 4A4CA 3CABA 3LL8B 2M7NA 3RZSA 1DGUA 2LVKA 2MHHA 2M97A 1K2HA 3JVTB 2JPTA 1WLMA 1CM1A 1CDMA 1YVLA 1NYAA 1G8IA 2JT8A 1TNWA 1IIOA 4YGAA 1DJIA 1IQ5A 3AAKA 1B7TY 2CNPA 5HKZA 1KQMB 4DUQA 2PMYA 2WC8A 1OE9B 4MN0A 2NCOA 1BT6A 1J55A 4MZLA 2M7LA 1QASA 3NGVA 2KFHA 2LMUA 3PM2A 2LUXA 3CZ1A 4P2YB 2CT9A 1Y0VH 2A4JA 2H61C 2KGRA 3D75A 1BMOA 4IJ7A 5AANA 3TZ1A 5EL2A 5JJGA 2WC6A 3JVTC 2LP3A 2MAZA 3FE9A 4F7FA 2F33A 3TDUA 2FCDA 4XJKB 1NUBA 3SS5A 4MZJA 1CTRA 2BKHB 1BF5A 1YUUA 3EK8A 4OV2A 1N2DA 3F45A 1DEKA 3CGAA 1EG4A 2KLDA 4INXA 2ISDA 3S0DA 3OX6A 3SJSA 2LNKA 1W9ZA 1UP5A 3BFHA 1B7TZ 5HLVA 2ZRTA 1DJWA 2LP2A 4HRGA 4GAOA 2Y1MA 3O2PA 1OSAA 3Q8IA 3AKBA 1BLQA 2E30A 5CPVA 3VGOA 3H4SE 1IJ5A 4PE1A 4WQ2A 2E6WA 3SG3A 2I94A 2BCXA 1KK8C 1WRKA 3GK1A 1XVJA 1LS8A 4KYNA 1ZMZA 1QS7A 1S3PA 1WRZA 2JT0A 3A8RA 3NXAA 5DKNA 2HQWA 2QPTA 1W7JB 3DZTA 3R72A 1SK6D 3AKAA 2GGMA 3UNWA 5AFPA 4OZDA 2LHLA 3DY9A 3HX4A 1QWVA 2KDHA 3BYAA 1MR8A 1DQEA 4YGCB 4D1EA 1S1EA 3TS5C 1SCVA 3D0YB 1PSRA 4FQTA 3KPXA 5I8NA 5DKRA 1M63B 1TCFA 2SASA 3KF9A 4CFQA 1A4PA 2FJYA 2KI6D 3BOWB 2KI6C 2AUCA 1DJYA 3DF0A 1CFPA 3GOFA 1KWOB 1CM4A 3DD4A 4A4BA 1DELA 3I5GC 5D3OA 3D10A 1K9UA 1V1FA 1YX8A 2F8PA 3BFAA 1UHHA 2K7CA 1TUZA 4FQOA 1C3YA 4JQ0D 1NX0A 1U5IA 4P5OE 4QJ3B 1FI5A 1F70A 4HRHA 2WCMA 4HSZA 2M3WA 4ICBA 3OB2B 5HYDA 2GV5A 3SG7A 2LMTA 2R2IA 1SBJA 3GK4X 1PULA 3KO0A 5KU1A 3PATA 4MSPA 2KQ6A 2D8NA 2BAPA 4R1EA 1KK7Z 3L47A 4MLWA 1OMVA 1QX7A 3D77A 3LK1A 2M8UA 1UURA 2K7DA 1LA3A 3BXKA 2JULA 3OGNA 4GBAA 1JC2A 5HLOA 1TNQA 2BL0C 1K90D 1EL4A 1L2OB 4GFTA 1QXPA 1B8CA 1GGZA 1QATA 2WCFA 3VRRA 2LHIA 5J3XA 1DT7B 1XK4A 3DVJA 1DF0B 3O4XA 3O78A 2KAVA 2CXJA 4OKHA 2L4IA 1YRTB 2M1KB 1NX1A 2KAXA 3PN7B 1MHOA 3DYEA 3S0GA 3LCPC 1KQMC 1TWOA 1LVCD 1M39A 1MWNA 4MRYA 5BPJA 3QRXA 1KK8B 2JTZA 1S6CA 1C3ZA 5CSFA 2MLEC 3CZ2A 4UPGA 3DF0B 1KK7Y 3K1EA 1NSHA 2PALA 1C7VA 1SL9A 1CDNA 3RLZA 4NDBA 4I5KA 2QEOA 3IQOA 1Z4HA 2LLTA 3PN7C 1RJVA 3ZWHA 2VRGA 1GQMA 1NWDA 1CNPA 2MRDA 2BE6A 3BUNB 1D1OA 2PASA 4GGNA 5F6TA 2BE4A 3DVEA 2WCBA 2KAYA 5KSZA 1NPQA 2PVBA 2QEVA 1PVBA 3VRNA 2BKIB 1ODBA 1S6JA 2ZN9A 2F2PA 1TNPA 2KNEA 2WOSA 1T14A 2KSPA 2NLNA 2L0PA 1YTZC 4N5XA 2AAOA 4PDZA 1EJ3A 2ERBA 3KHEA 1NX3A 2MBXA 2WCJA 5FI2A 1SR6C 1CFCA 4HREE 2KBMA 1J1DA 1DJGA 1OOIX 2JC2A 2NCPA 3HCMA 1ZACA 2MA2A 1IWQA 2LMVA 1NCZA 1A75B 3B88A 4JWQA 1YUSA 2KOTA 2M9GA 4CFRA 1TUJA 1LINA 3CZ0A 1KFXS 2QEBA 1UUSA 3BUWB 2Q4UA 4ORBB 2OPOA 4QJ5B 3L4AA 2ZNEA 2TN4A 4ORAB 4MBEA 1TRFA 1WRLA 3E3RA 4PHMA 1SL7A 2KI4B 2KLEA 2Y1NA 1WDCB 1ZFSA 1Q80A 4USLA 2L2EA 4I5NB 4MZKA 1PVAA 1R2UA 1K8UA 1IJ6A 1OOGA 2L98A 2OTGC 2P6BB 1IKUA 1N65A 4YGBB 1VRKA 1WLZA 1CLMA 5DICA 2WCKA 4JD9A 5I2QA 1QVIZ 1YRUB 5PALA 1GM0A 1OOJA 5FI6A 1SNLA 5I2LA 5HL1A 3CR5X 4PE0A 4E68A 2G2BA 4AQIA 1A29A 1BG1A 4BY4A 1C07A 2HF5A 1KFUS 2LV7A 1JFJA 2KHNA 3DXLA 1KFXL 4XJKA 1KWOC 3LLEA 5CSNA 1SR6B 1BODA 4GUKA 1BR4B 1K9PA 2BCAA 2EHBA 4YGDB 1DMOA 1FPWA 3C1VA 1UHNA 1EG3A 1QJTA 2H8VA 2LVIA 1P28A 1RTP1 4TNCA 1BOCA 1S26D 2Q91A 3IQQA 1Y1XA 4I5LB 1LKJA 1J7RA 2Y4QA 1QIVA 1U5IB 1DJXA 1S36A 2M49B 1UWOA 2P71A 4PALA 5I2OA 2CCMA 1CDPA 1FBVA 1KFUL 3O6BA 3VRPA 1DTLA 2P70A 3VRQA 1HT9A 2LANA 2ZFDA 1H8BA 1XFZO 2BCBA 4PHKA 3EK4A 4DIRA 3CLNA 2WCLA 1OW4A 3SG2A 3I5HB 3K21A 1JWDA 2B1UA 3SS4A 3I5GB 4JKTA 5DKQA 1AP4A 3N7HA 2M1UA 1GJYA 3EG5B 4N1FA 4CPVA 1W7IB 1L2OC 1AK8A 2CTNA 4ETOA 3B86A 4GPLB 1IQ3A 2LVJA 1AVSA 4ORCB 3L4LA 2OS8B 3CYZA 3EK7A 4CIDA 4L9MA 3NSOA 3B6XA 1K93D 1ORGA 1JF0A 1J1EA 3R1OA 1JFKA 3CDNA 3EVRA 4PCWA 4U8DA 3TDIA 2K2AA 2FCEA 1PALA 1TIZA 1XFRA 1NP8A 3AAJA 5ER5A 1M45A 2F3YA 4PE4A 1NCYA 3OX5A 3WHTB 1PRWA 2KYFA 2WC5A 1EH2A 2WCEA 2KI4C 4NDDA 1V1GA 2K8MB 1QVIY 4N1GA 2FJUB 1WDCC 1JUOA 3WNXB 3I5IC 4OR9B 2JTTA 1UHKA 5CSIA 1F8HA 1K94A 2LAPA 3PSRA 4WRIA 2K60A 1S5GY 4ZCUA 4GGFA 3OP0A 2RGIA 3D76A 1A03A 1DVIA 3WXAA 1XYDA 4OVNF 2ZRSA 5K89A 1QTXA 1DGVA 2K7OA 1OMRA 1SY9A 3S0EA 1XFUO 1JF2A 1QV0A 1XFVO 2QEHA 3BUOB 1MQ1A 2JU0A 3CS1A 3D78A 4AQJA 2QDIA 3NSKA 4GNKB 2KPHA 2ZN8A 3BQ3A 2LC5A 1H4BA 5D7FA 2I18A 4C0JA 3TDZA 3TUYC 1RROA 5CSJA 2HPSA 2PRUA 1FW4A 2CBLA 1K96A 1F55A 1G4YR 1F4OA 1K95A 2ZNDA 1PK0D 2KGBC 1CMFA 1ZOTB 4NDCA 2COLB 4NQGA 1IG5A 1SKTA 3B87A 3I5FB 2GTEA 4PHJA 1OOFA 1XFXO 3VROA 1ALWA 2LCPA 3QMEA 4M2OA 1F71A 1RECA 2L2CA 3OHMB 1B8LA 2ZKMX 3FWBA 3PFVA 3S0BA 3RM1A 2I2RE 3FS7A 1SMGA 1SYMA 3UO9A 5B8IB 3IF7A 1JBAA 4C0LA 2KBIA 4XYNA 1PSBA 1CLBA 1IRJA 1N0YA 3TUYB 1RWYA 3S0FA 3FIAA 5D69A 1FF1A 1IGVA 3EVUA 3I5HC 2NZ0A 3PJIA 1XO5A 3SIBA 4QJ4B 1B4CA 5HKYA 2LM5A 3EKHA 1QIWA 3R1PA 1EXRA 1MXLC 1KSMA 2KFFA 5AERA 3SIAA 1QV1A 1E8AA 1SL8A 1F4QA 3FWCA 1RK9A 4MEWA 4FTGA 3VB1A 1J7QA 3DVKA 3CWGA 2O5GA 1HQVA 1M31A 1DC1A 1B1GA 1OZSA 3BOWA 1FI6A 3S0AA 3CZTX 2JQ6A 2JRFA 4F0ZB 2WNDA 1TNXA 1SCMB 2H61A 2F3ZA 3EKJA 3NHIA 1QX2A 2M0RA 3GK2A 1DJZA 1XFWO 5AEQA 4MVFA 2SCPA 3JTDB 1KQVA 3LK0A 5HKWA 1KSOA 1XK4C 1UHJA 1R6PA 2K2FA 3BUMB 1B47A 1OZOA 2PYQA 4AOMA 1NX2A 4MRXA 2JZIA 2L5YA 2EC6C 1YURA 2BECA 1S5GZ 1Z2CB 3B7AA 1DF0A 4YI8A 3FE6A 1AJ5A 3ICBA 4CLNA 1SCMC 1Y1AA 4JPZB 4YGEB 2KFGA 2QACA 2BL0B 1NCXA 2WORA 3EVVA 4PT1A 2LLSA 2HQ8A 1G33A 3SS3A 1JSAA 1CLLA 1KCYA 3NSLA 1SPYA 1MF8B 2K7BA 4OCIA 4DRWA 2MLFC 4PHNA 2G9BA 2HETA 3D73A 2IS9A 1CFFA 1C7WA 5ER4X 1BR1B 4WQ3A 3CR2A 1CMGA 1NIWA 2JNFA 1CFDA 3SG4A 1DJHA 2K61A 3NSIA 5TNCA 1RFJA 4YI9A 2NXQA 1SW8A 5KTYA 2WCHA 4BY5A 3PALA 1J7OA 2OS8C 3D0YA 3A4UB 1J7PA 3NHTA 1F54A 2DOQA 4DCKA 4I5JA 4M2PA 2BNXA 4DS7A 1SSEB 2JXLA 2KYCA 1XA5A 2YGUA 2OTGB 2K0JA
chains in the Genus database with same CATH topology
1B9AA 3M0WA 4YRUA 1BJFA 2AMIA 3I5FC 2EGDA 1TN4A 3ZNIA 1LXFC 1QLSA 2H2KA 1XFYO 2GGZA 2M29A 1MXEA 3MSEB 1ZUZA 3PM8A 4GGFC 4IL1A 1CKKA 1LA0A 2EC6B 1YR5A 4Q04A 1AUIB 3SG5A 1ALVA 1YX7A 1WY9A 1A2XA 2Y5IA 1YVHA 2BBMA 2L5XB 3O4YA 2JNXA 2L4HA 1IH0A 2LVVA 3PLFB 5IBWA 1A75A 1OMDA 1BU3A 2MJWB 1Y6WA 1CDLA 1S6IA 1SRAA 1CB1A 2KQYA 3CR4X 2L50A 1K9KA 2JWWA 4ZCVA 1GGWA 2LE9B 1TOPA 5JOLA 3OB1B 3KEVA 1B8RA 1L7ZA 3DVMA 2LUCA 1AHRA 3BUXB 3CTNA 4YBHB 1QLKA 1X02A 2BBNA 5FYXA 1TCOB 2F2OA 2FOTA 2L51A 5AXIA 2JXCA 3TS5B 3WHUB 2JT3A 1TTXA 3SG6A 3I5IB 1OQPA 2V53A 4M2QA 2I7AA 4C0KA 1YUTA 1M46A 1QX5B 2PSRA 4PE7A 1AJ4A 1UHIA 3JTDC 2JOJA 2LLUA 2O60A 5G08A 5GQQC 1Y1UA 1MUXA 4A4CA 3LL8B 2M7NA 1DGUA 2LVKA 2MHHA 2M97A 1K2HA 3JVTB 2JPTA 1WLMA 1CM1A 1CDMA 1YVLA 1NYAA 1G8IA 2JT8A 1TNWA 4YGAA 1DJIA 1IQ5A 3AAKA 1B7TY 2CNPA 5HKZA 1KQMB 4DUQA 2PMYA 2WC8A 1OE9B 4MN0A 2NCOA 1BT6A 1J55A 4MZLA 2M7LA 1QASA 2KFHA 2LMUA 2LUXA 4P2YB 2CT9A 1Y0VH 2A4JA 2H61C 2KGRA 1BMOA 5AANA 3TZ1A 5JJGA 3JVTC 2LP3A 2MAZA 2F33A 3TDUA 2FCDA 4XJKB 1NUBA 4MZJA 1CTRA 2BKHB 1BF5A 1YUUA 3EK8A 4OV2A 1N2DA 3F45A 3CGAA 1EG4A 2ISDA 3OX6A 3SJSA 2LNKA 1UP5A 1B7TZ 5HLVA 2ZRTA 1DJWA 2LP2A 4HRGA 4GAOA 2Y1MA 3O2PA 1OSAA 3AKBA 1BLQA 2E30A 5CPVA 3VGOA 3H4SE 1IJ5A 4PE1A 4WQ2A 2E6WA 3SG3A 2I94A 2BCXA 1KK8C 1WRKA 3GK1A 1XVJA 1ZMZA 1QS7A 1S3PA 1WRZA 2JT0A 3A8RA 3NXAA 5DKNA 2HQWA 2QPTA 1W7JB 1SK6D 3AKAA 2GGMA 5AFPA 2LHLA 3HX4A 2KDHA 3BYAA 1MR8A 4YGCB 4D1EA 1S1EA 3TS5C 1SCVA 3D0YB 1PSRA 3KPXA 5I8NA 5DKRA 1M63B 1TCFA 2SASA 3KF9A 4CFQA 1A4PA 2KI6D 3BOWB 2KI6C 2AUCA 1DJYA 3DF0A 1CFPA 3GOFA 1KWOB 1CM4A 3DD4A 4A4BA 3I5GC 3D10A 1K9UA 1V1FA 1YX8A 2F8PA 1UHHA 2K7CA 4FQOA 4JQ0D 1NX0A 1U5IA 4P5OE 4QJ3B 1FI5A 1F70A 4HRHA 4HSZA 2M3WA 4ICBA 3OB2B 5HYDA 2GV5A 3SG7A 2LMTA 2R2IA 1SBJA 3GK4X 1PULA 3KO0A 5KU1A 3PATA 4MSPA 2KQ6A 2D8NA 4R1EA 1KK7Z 4MLWA 1OMVA 1QX7A 3LK1A 2M8UA 1UURA 2K7DA 1LA3A 3BXKA 2JULA 4GBAA 1JC2A 5HLOA 1TNQA 2BL0C 1K90D 1EL4A 1L2OB 4GFTA 1QXPA 1B8CA 1GGZA 1QATA 2WCFA 3VRRA 2LHIA 5J3XA 1DT7B 1XK4A 3DVJA 1DF0B 3O78A 2KAVA 2CXJA 4OKHA 2L4IA 1YRTB 2M1KB 1NX1A 2KAXA 3PN7B 1MHOA 3LCPC 1KQMC 1LVCD 1M39A 1MWNA 4MRYA 5BPJA 3QRXA 1KK8B 2JTZA 1S6CA 5CSFA 2MLEC 4UPGA 3DF0B 1KK7Y 1NSHA 2PALA 1C7VA 1SL9A 1CDNA 3RLZA 4NDBA 4I5KA 3IQOA 2LLTA 3PN7C 1RJVA 3ZWHA 2VRGA 1GQMA 1NWDA 1CNPA 2MRDA 2BE6A 3BUNB 1D1OA 2PASA 4GGNA 5F6TA 2BE4A 3DVEA 2WCBA 2KAYA 5KSZA 1NPQA 2PVBA 1PVBA 3VRNA 2BKIB 1ODBA 1S6JA 2ZN9A 2F2PA 1TNPA 2KNEA 2WOSA 2KSPA 2NLNA 2L0PA 1YTZC 4N5XA 2AAOA 4PDZA 1EJ3A 3KHEA 1NX3A 2MBXA 1SR6C 1CFCA 4HREE 2KBMA 1J1DA 1DJGA 2JC2A 2NCPA 3HCMA 1ZACA 2MA2A 1IWQA 2LMVA 1NCZA 1A75B 4JWQA 1YUSA 2KOTA 2M9GA 4CFRA 1LINA 1KFXS 1UUSA 3BUWB 2Q4UA 4ORBB 2OPOA 4QJ5B 2ZNEA 2TN4A 4ORAB 4MBEA 1TRFA 1WRLA 3E3RA 4PHMA 1SL7A 2KI4B 2Y1NA 4USLA 1WDCB 1ZFSA 1Q80A 2L2EA 4I5NB 4MZKA 1PVAA 1R2UA 1K8UA 1IJ6A 2L98A 2OTGC 2P6BB 1IKUA 1N65A 4YGBB 1VRKA 1WLZA 1CLMA 5I2QA 1QVIZ 1YRUB 5PALA 1OOJA 1SNLA 5I2LA 3CR5X 4PE0A 4E68A 2G2BA 4AQIA 1A29A 1BG1A 4BY4A 1C07A 2HF5A 1KFUS 2LV7A 1JFJA 2KHNA 1KFXL 4XJKA 1KWOC 3LLEA 5CSNA 1SR6B 1BODA 4GUKA 1BR4B 1K9PA 2BCAA 2EHBA 4YGDB 1DMOA 1FPWA 3C1VA 1UHNA 1EG3A 1QJTA 2LVIA 4TNCA 1RTP1 1BOCA 1S26D 2Q91A 3IQQA 1Y1XA 4I5LB 1LKJA 1J7RA 2Y4QA 1QIVA 1U5IB 1DJXA 1S36A 2M49B 1UWOA 4PALA 5I2OA 2CCMA 1CDPA 1FBVA 1KFUL 3O6BA 3VRPA 1DTLA 3VRQA 1HT9A 2LANA 2ZFDA 1H8BA 1XFZO 2BCBA 4PHKA 3EK4A 4DIRA 3CLNA 3SG2A 3I5HB 3K21A 1JWDA 2B1UA 3I5GB 5DKQA 1AP4A 2M1UA 1GJYA 4N1FA 4CPVA 1W7IB 1L2OC 1AK8A 2CTNA 4ETOA 4GPLB 1IQ3A 2LVJA 1AVSA 4ORCB 2OS8B 3EK7A 4CIDA 4L9MA 3NSOA 1K93D 1JF0A 1J1EA 1JFKA 3EVRA 4PCWA 4U8DA 3TDIA 2K2AA 2FCEA 1PALA 1TIZA 3AAJA 1NP8A 5ER5A 1M45A 2F3YA 4PE4A 1NCYA 3OX5A 3WHTB 1PRWA 2KYFA 1EH2A 2WCEA 2KI4C 4NDDA 1V1GA 2K8MB 1QVIY 4N1GA 2FJUB 1WDCC 1JUOA 3WNXB 3I5IC 4OR9B 2JTTA 1UHKA 5CSIA 1F8HA 1K94A 2LAPA 3PSRA 4WRIA 4ZCUA 1S5GY 4GGFA 3OP0A 2RGIA 1A03A 1DVIA 3WXAA 1XYDA 4OVNF 2ZRSA 5K89A 1QTXA 1DGVA 2K7OA 1OMRA 1SY9A 1XFUO 1JF2A 1QV0A 1XFVO 3BUOB 1MQ1A 2JU0A 3CS1A 4AQJA 3NSKA 4GNKB 3BQ3A 2ZN8A 2LC5A 1H4BA 5D7FA 2I18A 4C0JA 3TDZA 3TUYC 1RROA 5CSJA 2HPSA 2PRUA 1FW4A 2CBLA 1K96A 1F55A 1G4YR 1F4OA 1K95A 2ZNDA 1PK0D 2KGBC 1CMFA 1ZOTB 4NDCA 2COLB 4NQGA 1IG5A 1SKTA 3I5FB 4PHJA 3VROA 1XFXO 1ALWA 2LCPA 4M2OA 1F71A 1RECA 3OHMB 1B8LA 2ZKMX 3FWBA 3PFVA 3RM1A 2I2RE 3FS7A 1SMGA 1SYMA 5B8IB 3IF7A 1JBAA 4C0LA 2KBIA 4XYNA 1PSBA 1CLBA 1IRJA 1N0YA 3TUYB 1RWYA 3FIAA 5D69A 1FF1A 1IGVA 3EVUA 3I5HC 2NZ0A 1XO5A 3SIBA 4QJ4B 1B4CA 5HKYA 2LM5A 3EKHA 1QIWA 1EXRA 1MXLC 1KSMA 2KFFA 5AERA 3SIAA 1QV1A 1E8AA 1SL8A 1F4QA 3FWCA 1RK9A 4MEWA 4FTGA 1J7QA 3DVKA 3CWGA 2O5GA 1HQVA 1M31A 1B1GA 1OZSA 3BOWA 1FI6A 3CZTX 2JQ6A 2JRFA 4F0ZB 2WNDA 1TNXA 1SCMB 2H61A 2F3ZA 3EKJA 1QX2A 2M0RA 3GK2A 1DJZA 1XFWO 5AEQA 4MVFA 2SCPA 3JTDB 1KQVA 3LK0A 5HKWA 1KSOA 1XK4C 1UHJA 1R6PA 2K2FA 3BUMB 1B47A 1OZOA 4AOMA 1NX2A 4MRXA 2JZIA 2EC6C 1YURA 2BECA 1S5GZ 4CLNA 1DF0A 4YI8A 3ICBA 1AJ5A 1SCMC 1Y1AA 4JPZB 4YGEB 2KFGA 2QACA 2BL0B 1NCXA 2WORA 3EVVA 1JSAA 2LLSA 2HQ8A 1G33A 1CLLA 1KCYA 3NSLA 1SPYA 1MF8B 2K7BA 4OCIA 4DRWA 2MLFC 4PHNA 2G9BA 2HETA 2IS9A 1CFFA 1C7WA 5ER4X 1BR1B 4WQ3A 3CR2A 1CMGA 1NIWA 2JNFA 1CFDA 3SG4A 1DJHA 2K61A 3NSIA 5TNCA 1RFJA 4YI9A 2NXQA 1SW8A 5KTYA 4BY5A 3PALA 1J7OA 2OS8C 3D0YA 3A4UB 1J7PA 1F54A 2DOQA 4DCKA 4I5JA 4M2PA 4DS7A 2JXLA 2KYCA 1XA5A 2OTGB 2K0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B9A A;  3M0W A;  4YRU A;  1BJF A;  2AMI A;  3I5F C;  2EGD A;  1TN4 A;  3ZNI A;  1LXF C;  1QLS A;  2H2K A;  1XFY O;  2GGZ A;  2M29 A;  1MXE A;  3MSE B;  1ZUZ A;  3PM8 A;  4GGF C;  4IL1 A;  1CKK A;  1LA0 A;  2EC6 B;  1YR5 A;  4Q04 A;  1AUI B;  3SG5 A;  1ALV A;  1YX7 A;  1WY9 A;  1A2X A;  2Y5I A;  1YVH A;  2BBM A;  2L5X B;  3O4Y A;  2JNX A;  2L4H A;  1IH0 A;  2LVV A;  3PLF B;  5IBW A;  1A75 A;  1OMD A;  1BU3 A;  2MJW B;  1Y6W A;  1CDL A;  1S6I A;  1SRA A;  1CB1 A;  2KQY A;  3CR4 X;  2L50 A;  1K9K A;  2JWW A;  4ZCV A;  1GGW A;  2LE9 B;  1TOP A;  5JOL A;  3OB1 B;  3KEV A;  1B8R A;  1L7Z A;  3DVM A;  2LUC A;  1AHR A;  3BUX B;  3CTN A;  4YBH B;  1QLK A;  1X02 A;  2BBN A;  5FYX A;  1TCO B;  2F2O A;  2FOT A;  2L51 A;  5AXI A;  2JXC A;  3TS5 B;  3WHU B;  2JT3 A;  1TTX A;  3SG6 A;  3I5I B;  1OQP A;  2V53 A;  4M2Q A;  2I7A A;  4C0K A;  1YUT A;  1M46 A;  1QX5 B;  2PSR A;  4PE7 A;  1AJ4 A;  1UHI A;  3JTD C;  2JOJ A;  2LLU A;  2O60 A;  5G08 A;  5GQQ C;  1Y1U A;  1MUX A;  4A4C A;  3LL8 B;  2M7N A;  1DGU A;  2LVK A;  2MHH A;  2M97 A;  1K2H A;  3JVT B;  2JPT A;  1WLM A;  1CM1 A;  1CDM A;  1YVL A;  1NYA A;  1G8I A;  2JT8 A;  1TNW A;  4YGA A;  1DJI A;  1IQ5 A;  3AAK A;  1B7T Y;  2CNP A;  5HKZ A;  1KQM B;  4DUQ A;  2PMY A;  2WC8 A;  1OE9 B;  4MN0 A;  2NCO A;  1BT6 A;  1J55 A;  4MZL A;  2M7L A;  1QAS A;  2KFH A;  2LMU A;  2LUX A;  4P2Y B;  2CT9 A;  1Y0V H;  2A4J A;  2H61 C;  2KGR A;  1BMO A;  5AAN A;  3TZ1 A;  5JJG A;  3JVT C;  2LP3 A;  2MAZ A;  2F33 A;  3TDU A;  2FCD A;  4XJK B;  1NUB A;  4MZJ A;  1CTR A;  2BKH B;  1BF5 A;  1YUU A;  3EK8 A;  4OV2 A;  1N2D A;  3F45 A;  3CGA A;  1EG4 A;  2ISD A;  3OX6 A;  3SJS A;  2LNK A;  1UP5 A;  1B7T Z;  5HLV A;  2ZRT A;  1DJW A;  2LP2 A;  4HRG A;  4GAO A;  2Y1M A;  3O2P A;  1OSA A;  3AKB A;  1BLQ A;  2E30 A;  5CPV A;  3VGO A;  3H4S E;  1IJ5 A;  4PE1 A;  4WQ2 A;  2E6W A;  3SG3 A;  2I94 A;  2BCX A;  1KK8 C;  1WRK A;  3GK1 A;  1XVJ A;  1ZMZ A;  1QS7 A;  1S3P A;  1WRZ A;  2JT0 A;  3A8R A;  3NXA A;  5DKN A;  2HQW A;  2QPT A;  1W7J B;  1SK6 D;  3AKA A;  2GGM A;  5AFP A;  2LHL A;  3HX4 A;  2KDH A;  3BYA A;  1MR8 A;  4YGC B;  4D1E A;  1S1E A;  3TS5 C;  1SCV A;  3D0Y B;  1PSR A;  3KPX A;  5I8N A;  5DKR A;  1M63 B;  1TCF A;  2SAS A;  3KF9 A;  4CFQ A;  1A4P A;  2KI6 D;  3BOW B;  2KI6 C;  2AUC A;  1DJY A;  3DF0 A;  1CFP A;  3GOF A;  1KWO B;  1CM4 A;  3DD4 A;  4A4B A;  3I5G C;  3D10 A;  1K9U A;  1V1F A;  1YX8 A;  2F8P A;  1UHH A;  2K7C A;  4FQO A;  4JQ0 D;  1NX0 A;  1U5I A;  4P5O E;  4QJ3 B;  1FI5 A;  1F70 A;  4HRH A;  4HSZ A;  2M3W A;  4ICB A;  3OB2 B;  5HYD A;  2GV5 A;  3SG7 A;  2LMT A;  2R2I A;  1SBJ A;  3GK4 X;  1PUL A;  3KO0 A;  5KU1 A;  3PAT A;  4MSP A;  2KQ6 A;  2D8N A;  4R1E A;  1KK7 Z;  4MLW A;  1OMV A;  1QX7 A;  3LK1 A;  2M8U A;  1UUR A;  2K7D A;  1LA3 A;  3BXK A;  2JUL A;  4GBA A;  1JC2 A;  5HLO A;  1TNQ A;  2BL0 C;  1K90 D;  1EL4 A;  1L2O B;  4GFT A;  1QXP A;  1B8C A;  1GGZ A;  1QAT A;  2WCF A;  3VRR A;  2LHI A;  5J3X A;  1DT7 B;  1XK4 A;  3DVJ A;  1DF0 B;  3O78 A;  2KAV A;  2CXJ A;  4OKH A;  2L4I A;  1YRT B;  2M1K B;  1NX1 A;  2KAX A;  3PN7 B;  1MHO A;  3LCP C;  1KQM C;  1LVC D;  1M39 A;  1MWN A;  4MRY A;  5BPJ A;  3QRX A;  1KK8 B;  2JTZ A;  1S6C A;  5CSF A;  2MLE C;  4UPG A;  3DF0 B;  1KK7 Y;  1NSH A;  2PAL A;  1C7V A;  1SL9 A;  1CDN A;  3RLZ A;  4NDB A;  4I5K A;  3IQO A;  2LLT A;  3PN7 C;  1RJV A;  3ZWH A;  2VRG A;  1GQM A;  1NWD A;  1CNP A;  2MRD A;  2BE6 A;  3BUN B;  1D1O A;  2PAS A;  4GGN A;  5F6T A;  2BE4 A;  3DVE A;  2WCB A;  2KAY A;  5KSZ A;  1NPQ A;  2PVB A;  1PVB A;  3VRN A;  2BKI B;  1ODB A;  1S6J A;  2ZN9 A;  2F2P A;  1TNP A;  2KNE A;  2WOS A;  2KSP A;  2NLN A;  2L0P A;  1YTZ C;  4N5X A;  2AAO A;  4PDZ A;  1EJ3 A;  3KHE A;  1NX3 A;  2MBX A;  1SR6 C;  1CFC A;  4HRE E;  2KBM A;  1J1D A;  1DJG A;  2JC2 A;  2NCP A;  3HCM A;  1ZAC A;  2MA2 A;  1IWQ A;  2LMV A;  1NCZ A;  1A75 B;  4JWQ A;  1YUS A;  2KOT A;  2M9G A;  4CFR A;  1LIN A;  1KFX S;  1UUS A;  3BUW B;  2Q4U A;  4ORB B;  2OPO A;  4QJ5 B;  2ZNE A;  2TN4 A;  4ORA B;  4MBE A;  1TRF A;  1WRL A;  3E3R A;  4PHM A;  1SL7 A;  2KI4 B;  2Y1N A;  4USL A;  1WDC B;  1ZFS A;  1Q80 A;  2L2E A;  4I5N B;  4MZK A;  1PVA A;  1R2U A;  1K8U A;  1IJ6 A;  2L98 A;  2OTG C;  2P6B B;  1IKU A;  1N65 A;  4YGB B;  1VRK A;  1WLZ A;  1CLM A;  5I2Q A;  1QVI Z;  1YRU B;  5PAL A;  1OOJ A;  1SNL A;  5I2L A;  3CR5 X;  4PE0 A;  4E68 A;  2G2B A;  4AQI A;  1A29 A;  1BG1 A;  4BY4 A;  1C07 A;  2HF5 A;  1KFU S;  2LV7 A;  1JFJ A;  2KHN A;  1KFX L;  4XJK A;  1KWO C;  3LLE A;  5CSN A;  1SR6 B;  1BOD A;  4GUK A;  1BR4 B;  1K9P A;  2BCA A;  2EHB A;  4YGD B;  1DMO A;  1FPW A;  3C1V A;  1UHN A;  1EG3 A;  1QJT A;  2LVI A;  4TNC A;  1RTP 1;  1BOC A;  1S26 D;  2Q91 A;  3IQQ A;  1Y1X A;  4I5L B;  1LKJ A;  1J7R A;  2Y4Q A;  1QIV A;  1U5I B;  1DJX A;  1S36 A;  2M49 B;  1UWO A;  4PAL A;  5I2O A;  2CCM A;  1CDP A;  1FBV A;  1KFU L;  3O6B A;  3VRP A;  1DTL A;  3VRQ A;  1HT9 A;  2LAN A;  2ZFD A;  1H8B A;  1XFZ O;  2BCB A;  4PHK A;  3EK4 A;  4DIR A;  3CLN A;  3SG2 A;  3I5H B;  3K21 A;  1JWD A;  2B1U A;  3I5G B;  5DKQ A;  1AP4 A;  2M1U A;  1GJY A;  4N1F A;  4CPV A;  1W7I B;  1L2O C;  1AK8 A;  2CTN A;  4ETO A;  4GPL B;  1IQ3 A;  2LVJ A;  1AVS A;  4ORC B;  2OS8 B;  3EK7 A;  4CID A;  4L9M A;  3NSO A;  1K93 D;  1JF0 A;  1J1E A;  1JFK A;  3EVR A;  4PCW A;  4U8D A;  3TDI A;  2K2A A;  2FCE A;  1PAL A;  1TIZ A;  3AAJ A;  1NP8 A;  5ER5 A;  1M45 A;  2F3Y A;  4PE4 A;  1NCY A;  3OX5 A;  3WHT B;  1PRW A;  2KYF A;  1EH2 A;  2WCE A;  2KI4 C;  4NDD A;  1V1G A;  2K8M B;  1QVI Y;  4N1G A;  2FJU B;  1WDC C;  1JUO A;  3WNX B;  3I5I C;  4OR9 B;  2JTT A;  1UHK A;  5CSI A;  1F8H A;  1K94 A;  2LAP A;  3PSR A;  4WRI A;  4ZCU A;  1S5G Y;  4GGF A;  3OP0 A;  2RGI A;  1A03 A;  1DVI A;  3WXA A;  1XYD A;  4OVN F;  2ZRS A;  5K89 A;  1QTX A;  1DGV A;  2K7O A;  1OMR A;  1SY9 A;  1XFU O;  1JF2 A;  1QV0 A;  1XFV O;  3BUO B;  1MQ1 A;  2JU0 A;  3CS1 A;  4AQJ A;  3NSK A;  4GNK B;  3BQ3 A;  2ZN8 A;  2LC5 A;  1H4B A;  5D7F A;  2I18 A;  4C0J A;  3TDZ A;  3TUY C;  1RRO A;  5CSJ A;  2HPS A;  2PRU A;  1FW4 A;  2CBL A;  1K96 A;  1F55 A;  1G4Y R;  1F4O A;  1K95 A;  2ZND A;  1PK0 D;  2KGB C;  1CMF A;  1ZOT B;  4NDC A;  2COL B;  4NQG A;  1IG5 A;  1SKT A;  3I5F B;  4PHJ A;  3VRO A;  1XFX O;  1ALW A;  2LCP A;  4M2O A;  1F71 A;  1REC A;  3OHM B;  1B8L A;  2ZKM X;  3FWB A;  3PFV A;  3RM1 A;  2I2R E;  3FS7 A;  1SMG A;  1SYM A;  5B8I B;  3IF7 A;  1JBA A;  4C0L A;  2KBI A;  4XYN A;  1PSB A;  1CLB A;  1IRJ A;  1N0Y A;  3TUY B;  1RWY A;  3FIA A;  5D69 A;  1FF1 A;  1IGV A;  3EVU A;  3I5H C;  2NZ0 A;  1XO5 A;  3SIB A;  4QJ4 B;  1B4C A;  5HKY A;  2LM5 A;  3EKH A;  1QIW A;  1EXR A;  1MXL C;  1KSM A;  2KFF A;  5AER A;  3SIA A;  1QV1 A;  1E8A A;  1SL8 A;  1F4Q A;  3FWC A;  1RK9 A;  4MEW A;  4FTG A;  1J7Q A;  3DVK A;  3CWG A;  2O5G A;  1HQV A;  1M31 A;  1B1G A;  1OZS A;  3BOW A;  1FI6 A;  3CZT X;  2JQ6 A;  2JRF A;  4F0Z B;  2WND A;  1TNX A;  1SCM B;  2H61 A;  2F3Z A;  3EKJ A;  1QX2 A;  2M0R A;  3GK2 A;  1DJZ A;  1XFW O;  5AEQ A;  4MVF A;  2SCP A;  3JTD B;  1KQV A;  3LK0 A;  5HKW A;  1KSO A;  1XK4 C;  1UHJ A;  1R6P A;  2K2F A;  3BUM B;  1B47 A;  1OZO A;  4AOM A;  1NX2 A;  4MRX A;  2JZI A;  2EC6 C;  1YUR A;  2BEC A;  1S5G Z;  4CLN A;  1DF0 A;  4YI8 A;  3ICB A;  1AJ5 A;  1SCM C;  1Y1A A;  4JPZ B;  4YGE B;  2KFG A;  2QAC A;  2BL0 B;  1NCX A;  2WOR A;  3EVV A;  1JSA A;  2LLS A;  2HQ8 A;  1G33 A;  1CLL A;  1KCY A;  3NSL A;  1SPY A;  1MF8 B;  2K7B A;  4OCI A;  4DRW A;  2MLF C;  4PHN A;  2G9B A;  2HET A;  2IS9 A;  1CFF A;  1C7W A;  5ER4 X;  1BR1 B;  4WQ3 A;  3CR2 A;  1CMG A;  1NIW A;  2JNF A;  1CFD A;  3SG4 A;  1DJH A;  2K61 A;  3NSI A;  5TNC A;  1RFJ A;  4YI9 A;  2NXQ A;  1SW8 A;  5KTY A;  4BY5 A;  3PAL A;  1J7O A;  2OS8 C;  3D0Y A;  3A4U B;  1J7P A;  1F54 A;  2DOQ A;  4DCK A;  4I5J A;  4M2P A;  4DS7 A;  2JXL A;  2KYC A;  1XA5 A;  2OTG B;  2K0J A; 
#chains in the Genus database with same CATH topology
 1B9A A;  3M0W A;  4YRU A;  1BJF A;  2AMI A;  3R1V A;  3I5F C;  2EGD A;  1TN4 A;  3ZNI A;  1LXF C;  1QLS A;  2H2K A;  1XFY O;  2GGZ A;  2M29 A;  1MXE A;  3MSE B;  1ZUZ A;  3BFB A;  3PM8 A;  4GGF C;  4IL1 A;  3V2L A;  1LA0 A;  2EC6 B;  1CKK A;  1YR5 A;  4Q04 A;  2JPO A;  1AUI B;  3SG5 A;  3D74 A;  1ALV A;  1YX7 A;  1WY9 A;  1A2X A;  2Y5I A;  1YVH A;  2BBM A;  2L5X B;  3O4Y A;  2JNX A;  2L4H A;  1IH0 A;  1OOH A;  2LVV A;  2PQL A;  3PLF B;  5IBW A;  1A75 A;  1OMD A;  1BU3 A;  2MJW B;  1Y6W A;  1CDL A;  1S6I A;  1SRA A;  1CB1 A;  2KQY A;  3CR4 X;  2L50 A;  1K9K A;  2JWW A;  3OBV A;  4ZCV A;  1GGW A;  2LE9 B;  1TOP A;  5JOL A;  3OB1 B;  3KEV A;  1B8R A;  1L7Z A;  3DVM A;  2LUC A;  3FE8 A;  1AHR A;  3BUX B;  3CTN A;  4YBH B;  1QLK A;  1X02 A;  2BBN A;  5FYX A;  5I94 A;  1TCO B;  2F2O A;  2FOT A;  2L51 A;  4INW A;  3BJH A;  5AXI A;  2JXC A;  3TS5 B;  3IVT A;  2JT3 A;  5FI7 A;  3WHU B;  1TTX A;  3SG6 A;  3I5I B;  1OQP A;  2V53 A;  4M2Q A;  2I7A A;  4C0K A;  1YUT A;  1M46 A;  1QX5 B;  2PSR A;  4PE7 A;  1AJ4 A;  1UHI A;  3JTD C;  2JOJ A;  2LLU A;  2O60 A;  5G08 A;  5GQQ C;  1Y1U A;  1MUX A;  4A4C A;  3CAB A;  3LL8 B;  2M7N A;  3RZS A;  1DGU A;  2LVK A;  2MHH A;  2M97 A;  1K2H A;  3JVT B;  2JPT A;  1WLM A;  1CM1 A;  1CDM A;  1YVL A;  1NYA A;  1G8I A;  2JT8 A;  1TNW A;  1IIO A;  4YGA A;  1DJI A;  1IQ5 A;  3AAK A;  1B7T Y;  2CNP A;  5HKZ A;  1KQM B;  4DUQ A;  2PMY A;  2WC8 A;  1OE9 B;  4MN0 A;  2NCO A;  1BT6 A;  1J55 A;  4MZL A;  2M7L A;  1QAS A;  3NGV A;  2KFH A;  2LMU A;  3PM2 A;  2LUX A;  3CZ1 A;  4P2Y B;  2CT9 A;  1Y0V H;  2A4J A;  2H61 C;  2KGR A;  3D75 A;  1BMO A;  4IJ7 A;  5AAN A;  3TZ1 A;  5EL2 A;  5JJG A;  2WC6 A;  3JVT C;  2LP3 A;  2MAZ A;  3FE9 A;  4F7F A;  2F33 A;  3TDU A;  2FCD A;  4XJK B;  1NUB A;  3SS5 A;  4MZJ A;  1CTR A;  2BKH B;  1BF5 A;  1YUU A;  3EK8 A;  4OV2 A;  1N2D A;  3F45 A;  1DEK A;  3CGA A;  1EG4 A;  2KLD A;  4INX A;  2ISD A;  3S0D A;  3OX6 A;  3SJS A;  2LNK A;  1W9Z A;  1UP5 A;  3BFH A;  1B7T Z;  5HLV A;  2ZRT A;  1DJW A;  2LP2 A;  4HRG A;  4GAO A;  2Y1M A;  3O2P A;  1OSA A;  3Q8I A;  3AKB A;  1BLQ A;  2E30 A;  5CPV A;  3VGO A;  3H4S E;  1IJ5 A;  4PE1 A;  4WQ2 A;  2E6W A;  3SG3 A;  2I94 A;  2BCX A;  1KK8 C;  1WRK A;  3GK1 A;  1XVJ A;  1LS8 A;  4KYN A;  1ZMZ A;  1QS7 A;  1S3P A;  1WRZ A;  2JT0 A;  3A8R A;  3NXA A;  5DKN A;  2HQW A;  2QPT A;  1W7J B;  3DZT A;  3R72 A;  1SK6 D;  3AKA A;  2GGM A;  3UNW A;  5AFP A;  4OZD A;  2LHL A;  3DY9 A;  3HX4 A;  1QWV A;  2KDH A;  3BYA A;  1MR8 A;  1DQE A;  4YGC B;  4D1E A;  1S1E A;  3TS5 C;  1SCV A;  3D0Y B;  1PSR A;  4FQT A;  3KPX A;  5I8N A;  5DKR A;  1M63 B;  1TCF A;  2SAS A;  3KF9 A;  4CFQ A;  1A4P A;  2FJY A;  2KI6 D;  3BOW B;  2KI6 C;  2AUC A;  1DJY A;  3DF0 A;  1CFP A;  3GOF A;  1KWO B;  1CM4 A;  3DD4 A;  4A4B A;  1DEL A;  3I5G C;  5D3O A;  3D10 A;  1K9U A;  1V1F A;  1YX8 A;  2F8P A;  3BFA A;  1UHH A;  2K7C A;  1TUZ A;  4FQO A;  1C3Y A;  4JQ0 D;  1NX0 A;  1U5I A;  4P5O E;  4QJ3 B;  1FI5 A;  1F70 A;  4HRH A;  2WCM A;  4HSZ A;  2M3W A;  4ICB A;  3OB2 B;  5HYD A;  2GV5 A;  3SG7 A;  2LMT A;  2R2I A;  1SBJ A;  3GK4 X;  1PUL A;  3KO0 A;  5KU1 A;  3PAT A;  4MSP A;  2KQ6 A;  2D8N A;  2BAP A;  4R1E A;  1KK7 Z;  3L47 A;  4MLW A;  1OMV A;  1QX7 A;  3D77 A;  3LK1 A;  2M8U A;  1UUR A;  2K7D A;  1LA3 A;  3BXK A;  2JUL A;  3OGN A;  4GBA A;  1JC2 A;  5HLO A;  1TNQ A;  2BL0 C;  1K90 D;  1EL4 A;  1L2O B;  4GFT A;  1QXP A;  1B8C A;  1GGZ A;  1QAT A;  2WCF A;  3VRR A;  2LHI A;  5J3X A;  1DT7 B;  1XK4 A;  3DVJ A;  1DF0 B;  3O4X A;  3O78 A;  2KAV A;  2CXJ A;  4OKH A;  2L4I A;  1YRT B;  2M1K B;  1NX1 A;  2KAX A;  3PN7 B;  1MHO A;  3DYE A;  3S0G A;  3LCP C;  1KQM C;  1TWO A;  1LVC D;  1M39 A;  1MWN A;  4MRY A;  5BPJ A;  3QRX A;  1KK8 B;  2JTZ A;  1S6C A;  1C3Z A;  5CSF A;  2MLE C;  3CZ2 A;  4UPG A;  3DF0 B;  1KK7 Y;  3K1E A;  1NSH A;  2PAL A;  1C7V A;  1SL9 A;  1CDN A;  3RLZ A;  4NDB A;  4I5K A;  2QEO A;  3IQO A;  1Z4H A;  2LLT A;  3PN7 C;  1RJV A;  3ZWH A;  2VRG A;  1GQM A;  1NWD A;  1CNP A;  2MRD A;  2BE6 A;  3BUN B;  1D1O A;  2PAS A;  4GGN A;  5F6T A;  2BE4 A;  3DVE A;  2WCB A;  2KAY A;  5KSZ A;  1NPQ A;  2PVB A;  2QEV A;  1PVB A;  3VRN A;  2BKI B;  1ODB A;  1S6J A;  2ZN9 A;  2F2P A;  1TNP A;  2KNE A;  2WOS A;  1T14 A;  2KSP A;  2NLN A;  2L0P A;  1YTZ C;  4N5X A;  2AAO A;  4PDZ A;  1EJ3 A;  2ERB A;  3KHE A;  1NX3 A;  2MBX A;  2WCJ A;  5FI2 A;  1SR6 C;  1CFC A;  4HRE E;  2KBM A;  1J1D A;  1DJG A;  1OOI X;  2JC2 A;  2NCP A;  3HCM A;  1ZAC A;  2MA2 A;  1IWQ A;  2LMV A;  1NCZ A;  1A75 B;  3B88 A;  4JWQ A;  1YUS A;  2KOT A;  2M9G A;  4CFR A;  1TUJ A;  1LIN A;  3CZ0 A;  1KFX S;  2QEB A;  1UUS A;  3BUW B;  2Q4U A;  4ORB B;  2OPO A;  4QJ5 B;  3L4A A;  2ZNE A;  2TN4 A;  4ORA B;  4MBE A;  1TRF A;  1WRL A;  3E3R A;  4PHM A;  1SL7 A;  2KI4 B;  2KLE A;  2Y1N A;  1WDC B;  1ZFS A;  1Q80 A;  4USL A;  2L2E A;  4I5N B;  4MZK A;  1PVA A;  1R2U A;  1K8U A;  1IJ6 A;  1OOG A;  2L98 A;  2OTG C;  2P6B B;  1IKU A;  1N65 A;  4YGB B;  1VRK A;  1WLZ A;  1CLM A;  5DIC A;  2WCK A;  4JD9 A;  5I2Q A;  1QVI Z;  1YRU B;  5PAL A;  1GM0 A;  1OOJ A;  5FI6 A;  1SNL A;  5I2L A;  5HL1 A;  3CR5 X;  4PE0 A;  4E68 A;  2G2B A;  4AQI A;  1A29 A;  1BG1 A;  4BY4 A;  1C07 A;  2HF5 A;  1KFU S;  2LV7 A;  1JFJ A;  2KHN A;  3DXL A;  1KFX L;  4XJK A;  1KWO C;  3LLE A;  5CSN A;  1SR6 B;  1BOD A;  4GUK A;  1BR4 B;  1K9P A;  2BCA A;  2EHB A;  4YGD B;  1DMO A;  1FPW A;  3C1V A;  1UHN A;  1EG3 A;  1QJT A;  2H8V A;  2LVI A;  1P28 A;  1RTP 1;  4TNC A;  1BOC A;  1S26 D;  2Q91 A;  3IQQ A;  1Y1X A;  4I5L B;  1LKJ A;  1J7R A;  2Y4Q A;  1QIV A;  1U5I B;  1DJX A;  1S36 A;  2M49 B;  1UWO A;  2P71 A;  4PAL A;  5I2O A;  2CCM A;  1CDP A;  1FBV A;  1KFU L;  3O6B A;  3VRP A;  1DTL A;  2P70 A;  3VRQ A;  1HT9 A;  2LAN A;  2ZFD A;  1H8B A;  1XFZ O;  2BCB A;  4PHK A;  3EK4 A;  4DIR A;  3CLN A;  2WCL A;  1OW4 A;  3SG2 A;  3I5H B;  3K21 A;  1JWD A;  2B1U A;  3SS4 A;  3I5G B;  4JKT A;  5DKQ A;  1AP4 A;  3N7H A;  2M1U A;  1GJY A;  3EG5 B;  4N1F A;  4CPV A;  1W7I B;  1L2O C;  1AK8 A;  2CTN A;  4ETO A;  3B86 A;  4GPL B;  1IQ3 A;  2LVJ A;  1AVS A;  4ORC B;  3L4L A;  2OS8 B;  3CYZ A;  3EK7 A;  4CID A;  4L9M A;  3NSO A;  3B6X A;  1K93 D;  1ORG A;  1JF0 A;  1J1E A;  3R1O A;  1JFK A;  3CDN A;  3EVR A;  4PCW A;  4U8D A;  3TDI A;  2K2A A;  2FCE A;  1PAL A;  1TIZ A;  1XFR A;  1NP8 A;  3AAJ A;  5ER5 A;  1M45 A;  2F3Y A;  4PE4 A;  1NCY A;  3OX5 A;  3WHT B;  1PRW A;  2KYF A;  2WC5 A;  1EH2 A;  2WCE A;  2KI4 C;  4NDD A;  1V1G A;  2K8M B;  1QVI Y;  4N1G A;  2FJU B;  1WDC C;  1JUO A;  3WNX B;  3I5I C;  4OR9 B;  2JTT A;  1UHK A;  5CSI A;  1F8H A;  1K94 A;  2LAP A;  3PSR A;  4WRI A;  2K60 A;  1S5G Y;  4ZCU A;  4GGF A;  3OP0 A;  2RGI A;  3D76 A;  1A03 A;  1DVI A;  3WXA A;  1XYD A;  4OVN F;  2ZRS A;  5K89 A;  1QTX A;  1DGV A;  2K7O A;  1OMR A;  1SY9 A;  3S0E A;  1XFU O;  1JF2 A;  1QV0 A;  1XFV O;  2QEH A;  3BUO B;  1MQ1 A;  2JU0 A;  3CS1 A;  3D78 A;  4AQJ A;  2QDI A;  3NSK A;  4GNK B;  2KPH A;  2ZN8 A;  3BQ3 A;  2LC5 A;  1H4B A;  5D7F A;  2I18 A;  4C0J A;  3TDZ A;  3TUY C;  1RRO A;  5CSJ A;  2HPS A;  2PRU A;  1FW4 A;  2CBL A;  1K96 A;  1F55 A;  1G4Y R;  1F4O A;  1K95 A;  2ZND A;  1PK0 D;  2KGB C;  1CMF A;  1ZOT B;  4NDC A;  2COL B;  4NQG A;  1IG5 A;  1SKT A;  3B87 A;  3I5F B;  2GTE A;  4PHJ A;  1OOF A;  1XFX O;  3VRO A;  1ALW A;  2LCP A;  3QME A;  4M2O A;  1F71 A;  1REC A;  2L2C A;  3OHM B;  1B8L A;  2ZKM X;  3FWB A;  3PFV A;  3S0B A;  3RM1 A;  2I2R E;  3FS7 A;  1SMG A;  1SYM A;  3UO9 A;  5B8I B;  3IF7 A;  1JBA A;  4C0L A;  2KBI A;  4XYN A;  1PSB A;  1CLB A;  1IRJ A;  1N0Y A;  3TUY B;  1RWY A;  3S0F A;  3FIA A;  5D69 A;  1FF1 A;  1IGV A;  3EVU A;  3I5H C;  2NZ0 A;  3PJI A;  1XO5 A;  3SIB A;  4QJ4 B;  1B4C A;  5HKY A;  2LM5 A;  3EKH A;  1QIW A;  3R1P A;  1EXR A;  1MXL C;  1KSM A;  2KFF A;  5AER A;  3SIA A;  1QV1 A;  1E8A A;  1SL8 A;  1F4Q A;  3FWC A;  1RK9 A;  4MEW A;  4FTG A;  3VB1 A;  1J7Q A;  3DVK A;  3CWG A;  2O5G A;  1HQV A;  1M31 A;  1DC1 A;  1B1G A;  1OZS A;  3BOW A;  1FI6 A;  3S0A A;  3CZT X;  2JQ6 A;  2JRF A;  4F0Z B;  2WND A;  1TNX A;  1SCM B;  2H61 A;  2F3Z A;  3EKJ A;  3NHI A;  1QX2 A;  2M0R A;  3GK2 A;  1DJZ A;  1XFW O;  5AEQ A;  4MVF A;  2SCP A;  3JTD B;  1KQV A;  3LK0 A;  5HKW A;  1KSO A;  1XK4 C;  1UHJ A;  1R6P A;  2K2F A;  3BUM B;  1B47 A;  1OZO A;  2PYQ A;  4AOM A;  1NX2 A;  4MRX A;  2JZI A;  2L5Y A;  2EC6 C;  1YUR A;  2BEC A;  1S5G Z;  1Z2C B;  3B7A A;  1DF0 A;  4YI8 A;  3FE6 A;  1AJ5 A;  3ICB A;  4CLN A;  1SCM C;  1Y1A A;  4JPZ B;  4YGE B;  2KFG A;  2QAC A;  2BL0 B;  1NCX A;  2WOR A;  3EVV A;  4PT1 A;  2LLS A;  2HQ8 A;  1G33 A;  3SS3 A;  1JSA A;  1CLL A;  1KCY A;  3NSL A;  1SPY A;  1MF8 B;  2K7B A;  4OCI A;  4DRW A;  2MLF C;  4PHN A;  2G9B A;  2HET A;  3D73 A;  2IS9 A;  1CFF A;  1C7W A;  5ER4 X;  1BR1 B;  4WQ3 A;  3CR2 A;  1CMG A;  1NIW A;  2JNF A;  1CFD A;  3SG4 A;  1DJH A;  2K61 A;  3NSI A;  5TNC A;  1RFJ A;  4YI9 A;  2NXQ A;  1SW8 A;  5KTY A;  2WCH A;  4BY5 A;  3PAL A;  1J7O A;  2OS8 C;  3D0Y A;  3A4U B;  1J7P A;  3NHT A;  1F54 A;  2DOQ A;  4DCK A;  4I5J A;  4M2P A;  2BNX A;  4DS7 A;  1SSE B;  2JXL A;  2KYC A;  1XA5 A;  2YGU A;  2OTG B;  2K0J A; 
#chains in the Genus database with same CATH homology
 1B9A A;  3M0W A;  4YRU A;  1BJF A;  2AMI A;  3I5F C;  2EGD A;  1TN4 A;  3ZNI A;  1LXF C;  1QLS A;  2H2K A;  1XFY O;  2GGZ A;  2M29 A;  1MXE A;  3MSE B;  1ZUZ A;  3PM8 A;  4GGF C;  4IL1 A;  1CKK A;  1LA0 A;  2EC6 B;  1YR5 A;  4Q04 A;  1AUI B;  3SG5 A;  1ALV A;  1YX7 A;  1WY9 A;  1A2X A;  2Y5I A;  1YVH A;  2BBM A;  2L5X B;  3O4Y A;  2JNX A;  2L4H A;  1IH0 A;  2LVV A;  3PLF B;  5IBW A;  1A75 A;  1OMD A;  1BU3 A;  2MJW B;  1Y6W A;  1CDL A;  1S6I A;  1SRA A;  1CB1 A;  2KQY A;  3CR4 X;  2L50 A;  1K9K A;  2JWW A;  4ZCV A;  1GGW A;  2LE9 B;  1TOP A;  5JOL A;  3OB1 B;  3KEV A;  1B8R A;  1L7Z A;  3DVM A;  2LUC A;  1AHR A;  3BUX B;  3CTN A;  4YBH B;  1QLK A;  1X02 A;  2BBN A;  5FYX A;  1TCO B;  2F2O A;  2FOT A;  2L51 A;  5AXI A;  2JXC A;  3TS5 B;  3WHU B;  2JT3 A;  1TTX A;  3SG6 A;  3I5I B;  1OQP A;  2V53 A;  4M2Q A;  2I7A A;  4C0K A;  1YUT A;  1M46 A;  1QX5 B;  2PSR A;  4PE7 A;  1AJ4 A;  1UHI A;  3JTD C;  2JOJ A;  2LLU A;  2O60 A;  5G08 A;  5GQQ C;  1Y1U A;  1MUX A;  4A4C A;  3LL8 B;  2M7N A;  1DGU A;  2LVK A;  2MHH A;  2M97 A;  1K2H A;  3JVT B;  2JPT A;  1WLM A;  1CM1 A;  1CDM A;  1YVL A;  1NYA A;  1G8I A;  2JT8 A;  1TNW A;  4YGA A;  1DJI A;  1IQ5 A;  3AAK A;  1B7T Y;  2CNP A;  5HKZ A;  1KQM B;  4DUQ A;  2PMY A;  2WC8 A;  1OE9 B;  4MN0 A;  2NCO A;  1BT6 A;  1J55 A;  4MZL A;  2M7L A;  1QAS A;  2KFH A;  2LMU A;  2LUX A;  4P2Y B;  2CT9 A;  1Y0V H;  2A4J A;  2H61 C;  2KGR A;  1BMO A;  5AAN A;  3TZ1 A;  5JJG A;  3JVT C;  2LP3 A;  2MAZ A;  2F33 A;  3TDU A;  2FCD A;  4XJK B;  1NUB A;  4MZJ A;  1CTR A;  2BKH B;  1BF5 A;  1YUU A;  3EK8 A;  4OV2 A;  1N2D A;  3F45 A;  3CGA A;  1EG4 A;  2ISD A;  3OX6 A;  3SJS A;  2LNK A;  1UP5 A;  1B7T Z;  5HLV A;  2ZRT A;  1DJW A;  2LP2 A;  4HRG A;  4GAO A;  2Y1M A;  3O2P A;  1OSA A;  3AKB A;  1BLQ A;  2E30 A;  5CPV A;  3VGO A;  3H4S E;  1IJ5 A;  4PE1 A;  4WQ2 A;  2E6W A;  3SG3 A;  2I94 A;  2BCX A;  1KK8 C;  1WRK A;  3GK1 A;  1XVJ A;  1ZMZ A;  1QS7 A;  1S3P A;  1WRZ A;  2JT0 A;  3A8R A;  3NXA A;  5DKN A;  2HQW A;  2QPT A;  1W7J B;  1SK6 D;  3AKA A;  2GGM A;  5AFP A;  2LHL A;  3HX4 A;  2KDH A;  3BYA A;  1MR8 A;  4YGC B;  4D1E A;  1S1E A;  3TS5 C;  1SCV A;  3D0Y B;  1PSR A;  3KPX A;  5I8N A;  5DKR A;  1M63 B;  1TCF A;  2SAS A;  3KF9 A;  4CFQ A;  1A4P A;  2KI6 D;  3BOW B;  2KI6 C;  2AUC A;  1DJY A;  3DF0 A;  1CFP A;  3GOF A;  1KWO B;  1CM4 A;  3DD4 A;  4A4B A;  3I5G C;  3D10 A;  1K9U A;  1V1F A;  1YX8 A;  2F8P A;  1UHH A;  2K7C A;  4FQO A;  4JQ0 D;  1NX0 A;  1U5I A;  4P5O E;  4QJ3 B;  1FI5 A;  1F70 A;  4HRH A;  4HSZ A;  2M3W A;  4ICB A;  3OB2 B;  5HYD A;  2GV5 A;  3SG7 A;  2LMT A;  2R2I A;  1SBJ A;  3GK4 X;  1PUL A;  3KO0 A;  5KU1 A;  3PAT A;  4MSP A;  2KQ6 A;  2D8N A;  4R1E A;  1KK7 Z;  4MLW A;  1OMV A;  1QX7 A;  3LK1 A;  2M8U A;  1UUR A;  2K7D A;  1LA3 A;  3BXK A;  2JUL A;  4GBA A;  1JC2 A;  5HLO A;  1TNQ A;  2BL0 C;  1K90 D;  1EL4 A;  1L2O B;  4GFT A;  1QXP A;  1B8C A;  1GGZ A;  1QAT A;  2WCF A;  3VRR A;  2LHI A;  5J3X A;  1DT7 B;  1XK4 A;  3DVJ A;  1DF0 B;  3O78 A;  2KAV A;  2CXJ A;  4OKH A;  2L4I A;  1YRT B;  2M1K B;  1NX1 A;  2KAX A;  3PN7 B;  1MHO A;  3LCP C;  1KQM C;  1LVC D;  1M39 A;  1MWN A;  4MRY A;  5BPJ A;  3QRX A;  1KK8 B;  2JTZ A;  1S6C A;  5CSF A;  2MLE C;  4UPG A;  3DF0 B;  1KK7 Y;  1NSH A;  2PAL A;  1C7V A;  1SL9 A;  1CDN A;  3RLZ A;  4NDB A;  4I5K A;  3IQO A;  2LLT A;  3PN7 C;  1RJV A;  3ZWH A;  2VRG A;  1GQM A;  1NWD A;  1CNP A;  2MRD A;  2BE6 A;  3BUN B;  1D1O A;  2PAS A;  4GGN A;  5F6T A;  2BE4 A;  3DVE A;  2WCB A;  2KAY A;  5KSZ A;  1NPQ A;  2PVB A;  1PVB A;  3VRN A;  2BKI B;  1ODB A;  1S6J A;  2ZN9 A;  2F2P A;  1TNP A;  2KNE A;  2WOS A;  2KSP A;  2NLN A;  2L0P A;  1YTZ C;  4N5X A;  2AAO A;  4PDZ A;  1EJ3 A;  3KHE A;  1NX3 A;  2MBX A;  1SR6 C;  1CFC A;  4HRE E;  2KBM A;  1J1D A;  1DJG A;  2JC2 A;  2NCP A;  3HCM A;  1ZAC A;  2MA2 A;  1IWQ A;  2LMV A;  1NCZ A;  1A75 B;  4JWQ A;  1YUS A;  2KOT A;  2M9G A;  4CFR A;  1LIN A;  1KFX S;  1UUS A;  3BUW B;  2Q4U A;  4ORB B;  2OPO A;  4QJ5 B;  2ZNE A;  2TN4 A;  4ORA B;  4MBE A;  1TRF A;  1WRL A;  3E3R A;  4PHM A;  1SL7 A;  2KI4 B;  2Y1N A;  4USL A;  1WDC B;  1ZFS A;  1Q80 A;  2L2E A;  4I5N B;  4MZK A;  1PVA A;  1R2U A;  1K8U A;  1IJ6 A;  2L98 A;  2OTG C;  2P6B B;  1IKU A;  1N65 A;  4YGB B;  1VRK A;  1WLZ A;  1CLM A;  5I2Q A;  1QVI Z;  1YRU B;  5PAL A;  1OOJ A;  1SNL A;  5I2L A;  3CR5 X;  4PE0 A;  4E68 A;  2G2B A;  4AQI A;  1A29 A;  1BG1 A;  4BY4 A;  1C07 A;  2HF5 A;  1KFU S;  2LV7 A;  1JFJ A;  2KHN A;  1KFX L;  4XJK A;  1KWO C;  3LLE A;  5CSN A;  1SR6 B;  1BOD A;  4GUK A;  1BR4 B;  1K9P A;  2BCA A;  2EHB A;  4YGD B;  1DMO A;  1FPW A;  3C1V A;  1UHN A;  1EG3 A;  1QJT A;  2LVI A;  4TNC A;  1RTP 1;  1BOC A;  1S26 D;  2Q91 A;  3IQQ A;  1Y1X A;  4I5L B;  1LKJ A;  1J7R A;  2Y4Q A;  1QIV A;  1U5I B;  1DJX A;  1S36 A;  2M49 B;  1UWO A;  4PAL A;  5I2O A;  2CCM A;  1CDP A;  1FBV A;  1KFU L;  3O6B A;  3VRP A;  1DTL A;  3VRQ A;  1HT9 A;  2LAN A;  2ZFD A;  1H8B A;  1XFZ O;  2BCB A;  4PHK A;  3EK4 A;  4DIR A;  3CLN A;  3SG2 A;  3I5H B;  3K21 A;  1JWD A;  2B1U A;  3I5G B;  5DKQ A;  1AP4 A;  2M1U A;  1GJY A;  4N1F A;  4CPV A;  1W7I B;  1L2O C;  1AK8 A;  2CTN A;  4ETO A;  4GPL B;  1IQ3 A;  2LVJ A;  1AVS A;  4ORC B;  2OS8 B;  3EK7 A;  4CID A;  4L9M A;  3NSO A;  1K93 D;  1JF0 A;  1J1E A;  1JFK A;  3EVR A;  4PCW A;  4U8D A;  3TDI A;  2K2A A;  2FCE A;  1PAL A;  1TIZ A;  3AAJ A;  1NP8 A;  5ER5 A;  1M45 A;  2F3Y A;  4PE4 A;  1NCY A;  3OX5 A;  3WHT B;  1PRW A;  2KYF A;  1EH2 A;  2WCE A;  2KI4 C;  4NDD A;  1V1G A;  2K8M B;  1QVI Y;  4N1G A;  2FJU B;  1WDC C;  1JUO A;  3WNX B;  3I5I C;  4OR9 B;  2JTT A;  1UHK A;  5CSI A;  1F8H A;  1K94 A;  2LAP A;  3PSR A;  4WRI A;  4ZCU A;  1S5G Y;  4GGF A;  3OP0 A;  2RGI A;  1A03 A;  1DVI A;  3WXA A;  1XYD A;  4OVN F;  2ZRS A;  5K89 A;  1QTX A;  1DGV A;  2K7O A;  1OMR A;  1SY9 A;  1XFU O;  1JF2 A;  1QV0 A;  1XFV O;  3BUO B;  1MQ1 A;  2JU0 A;  3CS1 A;  4AQJ A;  3NSK A;  4GNK B;  3BQ3 A;  2ZN8 A;  2LC5 A;  1H4B A;  5D7F A;  2I18 A;  4C0J A;  3TDZ A;  3TUY C;  1RRO A;  5CSJ A;  2HPS A;  2PRU A;  1FW4 A;  2CBL A;  1K96 A;  1F55 A;  1G4Y R;  1F4O A;  1K95 A;  2ZND A;  1PK0 D;  2KGB C;  1CMF A;  1ZOT B;  4NDC A;  2COL B;  4NQG A;  1IG5 A;  1SKT A;  3I5F B;  4PHJ A;  3VRO A;  1XFX O;  1ALW A;  2LCP A;  4M2O A;  1F71 A;  1REC A;  3OHM B;  1B8L A;  2ZKM X;  3FWB A;  3PFV A;  3RM1 A;  2I2R E;  3FS7 A;  1SMG A;  1SYM A;  5B8I B;  3IF7 A;  1JBA A;  4C0L A;  2KBI A;  4XYN A;  1PSB A;  1CLB A;  1IRJ A;  1N0Y A;  3TUY B;  1RWY A;  3FIA A;  5D69 A;  1FF1 A;  1IGV A;  3EVU A;  3I5H C;  2NZ0 A;  1XO5 A;  3SIB A;  4QJ4 B;  1B4C A;  5HKY A;  2LM5 A;  3EKH A;  1QIW A;  1EXR A;  1MXL C;  1KSM A;  2KFF A;  5AER A;  3SIA A;  1QV1 A;  1E8A A;  1SL8 A;  1F4Q A;  3FWC A;  1RK9 A;  4MEW A;  4FTG A;  1J7Q A;  3DVK A;  3CWG A;  2O5G A;  1HQV A;  1M31 A;  1B1G A;  1OZS A;  3BOW A;  1FI6 A;  3CZT X;  2JQ6 A;  2JRF A;  4F0Z B;  2WND A;  1TNX A;  1SCM B;  2H61 A;  2F3Z A;  3EKJ A;  1QX2 A;  2M0R A;  3GK2 A;  1DJZ A;  1XFW O;  5AEQ A;  4MVF A;  2SCP A;  3JTD B;  1KQV A;  3LK0 A;  5HKW A;  1KSO A;  1XK4 C;  1UHJ A;  1R6P A;  2K2F A;  3BUM B;  1B47 A;  1OZO A;  4AOM A;  1NX2 A;  4MRX A;  2JZI A;  2EC6 C;  1YUR A;  2BEC A;  1S5G Z;  4CLN A;  1DF0 A;  4YI8 A;  3ICB A;  1AJ5 A;  1SCM C;  1Y1A A;  4JPZ B;  4YGE B;  2KFG A;  2QAC A;  2BL0 B;  1NCX A;  2WOR A;  3EVV A;  1JSA A;  2LLS A;  2HQ8 A;  1G33 A;  1CLL A;  1KCY A;  3NSL A;  1SPY A;  1MF8 B;  2K7B A;  4OCI A;  4DRW A;  2MLF C;  4PHN A;  2G9B A;  2HET A;  2IS9 A;  1CFF A;  1C7W A;  5ER4 X;  1BR1 B;  4WQ3 A;  3CR2 A;  1CMG A;  1NIW A;  2JNF A;  1CFD A;  3SG4 A;  1DJH A;  2K61 A;  3NSI A;  5TNC A;  1RFJ A;  4YI9 A;  2NXQ A;  1SW8 A;  5KTY A;  4BY5 A;  3PAL A;  1J7O A;  2OS8 C;  3D0Y A;  3A4U B;  1J7P A;  1F54 A;  2DOQ A;  4DCK A;  4I5J A;  4M2P A;  4DS7 A;  2JXL A;  2KYC A;  1XA5 A;  2OTG B;  2K0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...