1VRKA

The 1.9 angstrom structure of e84k-calmodulin rs20 peptide complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
148
structure length
148
Chain Sequence
ADQLTDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEKLKEAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQVNYEEFVQVMMAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of the functional coupling between calmodulin's calcium binding and peptide recognition properties.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Complex(calcium-binding protein/peptide)
molecule keywords CALMODULIN
total genus 53
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 1997-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1vrkA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1vrkA02
4MRXA 1XFUO 1A03A 1DJXA 1OOJA 4I5KA 3I5GB 2L4IA 3F45A 1SMGA 4PHNA 5CPVA 3C1VA 3BOWA 4AQIA 2KSPA 2EGDA 3CR4X 1TNWA 1BR4B 3NSKA 3I5HC 1RFJA 1R6PA 2HPSA 1A75A 5AXIA 1LA3A 2MRDA 3KO0A 1NX2A 3VROA 2GGMA 2MLFC 2JOJA 3DF0B 1BT6A 1M46A 1SY9A 2JTTA 3I5IC 3LCPC 1BU3A 3D0YB 1YR5A 4PHJA 2LVJA 3AKBA 4OVNF 1YURA 2JTZA 1OE9B 4XJKA 2L5XB 3EVRA 1L2OB 1G33A 1NX3A 1ZFSA 2JZIA 3FWCA 2KBMA 4YI9A 3KEVA 1SCVA 2F8PA 3TUYB 3QRXA 1BOCA 3GK4X 3K21A 1B1GA 3JVTC 1KFXS 1NYAA 2KDHA 3EK4A 3VRRA 1A2XA 3GK2A 4D1EA 3KF9A 1F55A 2OPOA 2WC8A 2VRGA 1XFZO 5CSIA 3TDUA 2MLEC 2LVKA 1AVSA 4ORCB 1DJZA 5AANA 2JULA 3PFVA 1SR6B 1CNPA 1W7JB 1J1DA 2I18A 2F3YA 1H8BA 1G4YR 1V1FA 1ZACA 2EC6C 2F2PA 3PN7C 5CSNA 1UUSA 2SASA 4PE4A 2M1UA 5AFPA 1J55A 5BPJA 1KK7Y 3HX4A 4PHMA 1N2DA 4MRYA 1UHKA 2KQYA 4GGFC 2BKIB 3NXAA 2LC5A 1D1OA 3CLNA 2JT8A 3PLFB 1DMOA 1NX1A 3ZNIA 1AHRA 2HETA 4UPGA 1KSOA 1TN4A 2KI4C 3WHUB 1KCYA 5HKZA 4C0JA 1OZOA 1YRTB 2Y1NA 5KTYA 1BLQA 1S6JA 4ZCUA 2WORA 1NPQA 3PATA 1K9PA 2CXJA 1PVAA 3DVMA 2LANA 2M9GA 3BQ3A 4XJKB 2M1KB 3ZWHA 1JWDA 3CTNA 4A4BA 3LL8B 2LUXA 2FCEA 4AOMA 1RECA 5ER5A 2EC6B 2QACA 5KU1A 1WRZA 1UHJA 2ZFDA 2FJUB 1M31A 5HYDA 2KFFA 2I94A 2ZN9A 5I8NA 2Q91A 4OR9B 4DCKA 4ORAB 1YVHA 2BKHB 2ZKMX 5DKQA 1JC2A 4AQJA 1SCMC 1NWDA 3FWBA 1U5IB 1K9KA 2KFHA 1S36A 1CFPA 1QASA 1M45A 1XK4A 3SG4A 1A75B 2KOTA 1HQVA 2LHLA 1F71A 1Y1UA 1F4OA 2D8NA 1B7TZ 1XFXO 5DKRA 3H4SE 1ALVA 2QPTA 2ISDA 1MF8B 1CM4A 4M2QA 3WHTB 3BXKA 3EKHA 4HSZA 5D69A 1WRLA 1JF0A 4MZJA 1ODBA 2K7CA 2BL0C 1U5IA 3OP0A 4YBHB 2BCXA 1EXRA 1HT9A 2JXLA 2Y5IA 3O2PA 2KAYA 2LLSA 3FIAA 5CSJA 1KWOC 1IG5A 1KFUL 1L7ZA 4I5LB 4NDDA 2L50A 1MXEA 1BJFA 4XYNA 2G9BA 2L98A 1CDLA 2K0JA 3VRQA 2JC2A 4USLA 2JU0A 4DS7A 1K93D 1QXPA 1S26D 3RLZA 1S5GZ 3PM8A 1F70A 2LHIA 5DKNA 1FW4A 4N1FA 3KHEA 4OCIA 3O4YA 2KYCA 1JFJA 1B4CA 2CT9A 2BBNA 4Q04A 1LKJA 1LXFC 2OTGB 2JQ6A 1N65A 3BUNB 5G08A 4R1EA 3SG6A 1LVCD 4JPZB 2LVIA 2CBLA 1B8RA 2M49B 2K61A 3VRNA 2KGBC 1WDCC 2JWWA 1GJYA 4PE1A 1TNXA 1WLZA 5JOLA 1CKKA 2F33A 1RK9A 2BBMA 2CTNA 2EHBA 5ER4X 1ZUZA 2PALA 3OX5A 1NCXA 1F8HA 1UHNA 4JQ0D 2KNEA 2BE4A 4PDZA 4ZCVA 1W7IB 1AJ4A 1DGVA 1Y6WA 2PVBA 3A8RA 5HKWA 5JJGA 2HF5A 3DVKA 4C0KA 3I5GC 3NSIA 1SPYA 1N0YA 1YX7A 1QVIY 4CIDA 3IF7A 3PN7B 4MLWA 4P2YB 2KI6D 4DRWA 1OMVA 1DJIA 4QJ3B 1DT7B 1AUIB 1CDPA 3BUOB 4CLNA 1KK8B 5IBWA 2OS8C 2JRFA 1NIWA 2GV5A 1SNLA 3IQQA 3KPXA 1TIZA 3O78A 3TDIA 4HRGA 2G2BA 1KFUS 2K8MB 3I5HB 1EJ3A 1OZSA 1ALWA 1UHHA 1R2UA 1MQ1A 1YTZC 1IQ3A 3IQOA 1ZMZA 3BUWB 2LMVA 1JFKA 2MJWB 3CZTX 1TOPA 1CM1A 2P6BB 2WNDA 4GGNA 5HKYA 3SG2A 1NSHA 1UHIA 3JTDB 2KAVA 3EKJA 1E8AA 1B9AA 1EG3A 1UWOA 2COLB 1KK8C 1MXLC 3CWGA 3SIAA 4C0LA 2OS8B 1XFYO 1IKUA 1C7VA 3AKAA 2I7AA 5AEQA 3DF0A 1KQVA 1B7TY 3NSLA 3GOFA 2I2RE 1K96A 1XA5A 1WLMA 2F3ZA 1JF2A 1MWNA 5I2LA 1CLBA 1QX5B 1AP4A 5I2OA 1CLLA 1QLKA 2L0PA 3CGAA 4I5JA 4E68A 4U8DA 4MEWA 2M0RA 4PALA 1XFWO 3A4UB 4WQ3A 2JNFA 1YUSA 2LP3A 1K94A 3D10A 1YUUA 1KSMA 1UURA 2DOQA 4WQ2A 1SL8A 1NX0A 1QJTA 1XK4C 3VRPA 2LE9B 1VRKA 4IL1A 4TNCA 4MVFA 2PRUA 2FOTA 1J7PA 1CMFA 2TN4A 3AAJA 2KAXA 2M29A 1CFFA 4OV2A 1FI5A 2L4HA 1QV1A 1IRJA 1YUTA 1CTRA 4JWQA 4HREE 5GQQC 2IS9A 3EK7A 2ZN8A 1J7RA 1BG1A 1QTXA 3VGOA 1TNQA 2KHNA 4N5XA 3TZ1A 2LLTA 4A4CA 5HLOA 4MZKA 1NUBA 3SG5A 1K90D 2JT0A 1KQMC 1J1EA 2M8UA 4MN0A 3FS7A 2A4JA 2BECA 2LMTA 2LMUA 4P5OE 4YGEB 1NCYA 2PSRA 1S1EA 1TCFA 2GGZA 3PALA 5PALA 1BODA 4MZLA 1WDCB 1QS7A 1SCMB 2CNPA 5F6TA 2LUCA 2LP2A 1TNPA 1CFDA 1PSRA 1KQMB 1Y1XA 2JXCA 2KGRA 2NCOA 1SBJA 1SK6D 1QATA 2MHHA 4GGFA 1SL9A 2WCEA 1YRUB 1A4PA 1NP8A 4GPLB 2R2IA 2CCMA 1J7QA 3ICBA 4YRUA 2PMYA 1BF5A 3WNXB 4NQGA 1TTXA 3SG3A 3BYAA 4CFRA 2ZNEA 3M0WA 1AK8A 4ICBA 1SW8A 2ZNDA 5D7FA 2LAPA 2KI4B 5K89A 4BY4A 1PRWA 1S6IA 4DUQA 1J7OA 1MR8A 1PVBA 1OQPA 4PE0A 4I5NB 3EVVA 5HLVA 2BCBA 5J3XA 3SJSA 2V53A 2WCFA 1MUXA 1RROA 3HCMA 1B8LA 3PSRA 1SYMA 4OKHA 1FF1A 1QV0A 1SRAA 2FCDA 4HRHA 4NDBA 3DD4A 3WXAA 2KBIA 1S5GY 4BY5A 1SKTA 4YGDB 3OB2B 1A29A 1K2HA 2E6WA 2HQ8A 1DJGA 2WCBA 3TUYC 1Q80A 1BMOA 2K2AA 3BOWB 1AJ5A 1QX2A 4GAOA 2KYFA 2BCAA 4L9MA 1Y0VH 2JT3A 1M63B 2ZRSA 4QJ4B 3LK0A 4M2OA 2L2EA 2NCPA 1XVJA 1CLMA 4GUKA 1F54A 4MSPA 1UP5A 1PULA 2AMIA 1GGWA 2LCPA 3OX6A 2PASA 4PCWA 5KSZA 1TCOB 3JTDC 1IGVA 1V1GA 3TS5C 1LA0A 3BUXB 2WOSA 1FPWA 1CB1A 2OTGC 1CDNA 1CFCA 2NZ0A 1CDMA 2B1UA 3CR5X 1IJ6A 1IWQA 1FBVA 2LV7A 4ORBB 4YGAA 4CPVA 1QLSA 1JUOA 2K7OA 1DJHA 1K9UA 2Y1MA 1M39A 2O60A 1JSAA 3MSEB 1EL4A 1L2OC 3GK1A 1FI6A 3EK8A 1ZOTB 2MA2A 2M97A 1KWOB 1QIVA 2O5GA 1PALA 2KFGA 1GQMA 3AAKA 5AERA 4ETOA 1NCZA 2H2KA 2LM5A 2SCPA 3DVJA 1PSBA 1XO5A 1B47A 1MHOA 2Y4QA 4YI8A 1EG4A 1DF0B 1X02A 1SL7A 2K7BA 2LNKA 3OHMB 3O6BA 2M7LA 3TS5B 1Y1AA 4M2PA 4YGCB 4GNKB 3E3RA 2Q4UA 1QIWA 1IH0A 2JPTA 1OSAA 3JVTB 2M3WA 4MBEA 4F0ZB 5I2QA 2MAZA 1JBAA 1DVIA 1KK7Z 2AUCA 2LLUA 1S6CA 1G8IA 1C7WA 1YVLA 2AAOA 2E30A 2H61C 5B8IB 1IJ5A 4FTGA 1XFVO 5FYXA 4WRIA 3TDZA 3I5FC 4N1GA 4CFQA 4GFTA 1OMDA 2F2OA 1DGUA 1K95A 3SIBA 1H4BA 4GBAA 1K8UA 2H61A 3CR2A 3DVEA 4NDCA 1QX7A 1C07A 2BE6A 4FQOA 1PK0D 1RTP1 1B8CA 1SR6C 1DF0A 1EH2A 1F4QA 2LVVA 3BUMB 4PE7A 2RGIA 1DJWA 2KI6C 2ZRTA 2HQWA 1IQ5A 1GGZA 3LK1A 1CMGA 1RWYA 1DJYA 1RJVA 2JNXA 1XYDA 5CSFA 1BR1B 1OMRA 1WY9A 3I5FB 3I5IB 1LINA 4PHKA 3OB1B 3RM1A 1DTLA 2NXQA 2M7NA 3LLEA 3NSOA 4QJ5B 1QVIZ 1TRFA 3EVUA 3D0YA 2K7DA 2K2FA 1YX8A 1KFXL 1S3PA 2BL0B 2NLNA 3CS1A 2MBXA 4DIRA 4YGBB 2KQ6A 2L51A 5TNCA 1WRKA 3SG7A
chains in the Genus database with same CATH superfamily
4MRXA 1XFUO 1A03A 1DJXA 1OOJA 4I5KA 3I5GB 3Q8IA 2L4IA 3F45A 1SMGA 4PHNA 5CPVA 3C1VA 3BOWA 4AQIA 2KSPA 2EGDA 3CR4X 1TNWA 1BR4B 3NSKA 3R72A 2YGUA 3I5HC 1RFJA 1R6PA 2HPSA 1A75A 1LS8A 5AXIA 1LA3A 2MRDA 3KO0A 1NX2A 3VROA 2GGMA 2MLFC 3S0FA 1XFRA 2JOJA 1BT6A 1M46A 1SY9A 2JTTA 3DF0B 3I5IC 1BU3A 3D0YB 3LCPC 3VB1A 1YR5A 4PHJA 2LVJA 3AKBA 4OVNF 1YURA 2JTZA 3O4XA 1OE9B 4XJKA 2L5XB 3EVRA 1L2OB 1G33A 1NX3A 1ZFSA 2JZIA 3FWCA 2KBMA 2WC6A 4YI9A 3KEVA 1SCVA 2F8PA 4IJ7A 3TUYB 3QRXA 2WCKA 2JPOA 1BOCA 3GK4X 3K21A 1B1GA 3JVTC 1KFXS 1NYAA 2KDHA 3EK4A 3L4AA 3FE8A 3V2LA 3VRRA 1A2XA 3GK2A 4D1EA 3KF9A 1F55A 4KYNA 4JKTA 2OPOA 2WC8A 2VRGA 1XFZO 5CSIA 3TDUA 2MLEC 2LVKA 1AVSA 1Z2CB 4ORCB 1TUJA 1DJZA 5AANA 2JULA 3S0GA 3DYEA 3PFVA 1SR6B 1CNPA 1W7JB 3B87A 1J1DA 2I18A 2F3YA 2FJYA 1H8BA 1G4YR 1V1FA 1ZACA 2EC6C 2F2PA 3PN7C 5CSNA 1UUSA 2SASA 4PE4A 2M1UA 2WCJA 5AFPA 1J55A 5BPJA 1KK7Y 3HX4A 2KPHA 1QWVA 4PHMA 1N2DA 4MRYA 1UHKA 2KQYA 4GGFC 2BKIB 3NXAA 2LC5A 1D1OA 3CLNA 2JT8A 3PLFB 1DMOA 4OZDA 1NX1A 3ZNIA 1AHRA 2HETA 4UPGA 1KSOA 1TN4A 2KI4C 3UO9A 3WHUB 5HKZA 1KCYA 4C0JA 1OZOA 1YRTB 2Y1NA 5KTYA 1BLQA 1S6JA 4ZCUA 2WORA 5DICA 3PM2A 1NPQA 1Z4HA 3PATA 1K9PA 2CXJA 1PVAA 2P71A 3DVMA 2LANA 2M9GA 3BQ3A 4XJKB 2M1KB 3ZWHA 1JWDA 3CTNA 4A4BA 3LL8B 2GTEA 2LUXA 2FCEA 4AOMA 1RECA 5ER5A 2EC6B 2QACA 5KU1A 1WRZA 1UHJA 2L5YA 2BAPA 2ZFDA 2FJUB 1M31A 5HYDA 2KFFA 2I94A 2ZN9A 3OGNA 5I8NA 2Q91A 2WCLA 4OR9B 4DCKA 4ORAB 1YVHA 2BKHB 2ZKMX 5DKQA 1JC2A 4AQJA 1SCMC 1NWDA 3FWBA 1T14A 1K9KA 1U5IB 2KFHA 5FI7A 1OOIX 5D3OA 1S36A 3S0EA 1CFPA 1QASA 1M45A 1XK4A 3SG4A 1A75B 2KOTA 3D77A 1HQVA 2LHLA 1F71A 1Y1UA 1F4OA 2D8NA 1B7TZ 1XFXO 5DKRA 3H4SE 1ALVA 5FI6A 1DQEA 2QPTA 2ISDA 1MF8B 3L4LA 3NHTA 1CM4A 4M2QA 3WHTB 3BXKA 3EKHA 4HSZA 5D69A 4FQTA 1WRLA 1JF0A 4MZJA 1ODBA 2K7CA 2BL0C 1U5IA 3CZ0A 3OP0A 4YBHB 2BCXA 1EXRA 1HT9A 2JXLA 2Y5IA 3O2PA 2KAYA 2LLSA 3FIAA 5CSJA 3SS4A 1KWOC 1IG5A 1KFUL 1L7ZA 4I5LB 4NDDA 2L50A 1MXEA 1BJFA 3BFHA 3BJHA 4XYNA 2G9BA 2L98A 1CDLA 2K0JA 3VRQA 2JC2A 4USLA 2JU0A 4DS7A 1K93D 1QXPA 2PYQA 1S26D 3RLZA 1S5GZ 3PM8A 1F70A 2LHIA 5DKNA 1FW4A 2K60A 3CABA 4N1FA 3KHEA 4OCIA 3RZSA 3O4YA 2KYCA 1JFJA 1B4CA 2CT9A 2BBNA 4Q04A 1LKJA 1LXFC 2OTGB 2JQ6A 1N65A 1ORGA 2KLEA 3BUNB 4R1EA 5G08A 1LVCD 3SG6A 4JPZB 3D76A 2LVIA 2CBLA 3DXLA 1B8RA 2M49B 2K61A 3VRNA 2KGBC 1WDCC 2JWWA 1GJYA 4PE1A 1TNXA 1WLZA 3D78A 5JOLA 1CKKA 2F33A 1RK9A 2BBMA 2CTNA 2EHBA 5ER4X 1ZUZA 1OOFA 2PALA 3OX5A 3UNWA 1NCXA 4JD9A 1F8HA 1UHNA 4JQ0D 2KNEA 2BE4A 4PDZA 4ZCVA 1W7IB 3B88A 1AJ4A 1DGVA 1Y6WA 2PQLA 2PVBA 1IIOA 3A8RA 5HKWA 5JJGA 2HF5A 3DVKA 3OBVA 4C0KA 3I5GC 3NSIA 1C3YA 1SPYA 3B7AA 3NHIA 1N0YA 1YX7A 3SS5A 1QVIY 4CIDA 3IF7A 3PN7B 4MLWA 4P2YB 2KI6D 4DRWA 1OMVA 1DJIA 4QJ3B 1DT7B 2WCMA 1AUIB 1CDPA 3BUOB 4CLNA 1KK8B 2ERBA 5IBWA 3R1VA 2OS8C 2JRFA 1NIWA 2GV5A 1SNLA 3IQQA 3KPXA 1TIZA 1TWOA 3O78A 3TDIA 4HRGA 2G2BA 1KFUS 2K8MB 3I5HB 1EJ3A 1OZSA 1ALWA 1UHHA 1R2UA 1MQ1A 1YTZC 1IQ3A 3IQOA 1ZMZA 3BUWB 2LMVA 4F7FA 1JFKA 2MJWB 3CZTX 1TOPA 1CM1A 2P6BB 2WNDA 4GGNA 5HKYA 3SG2A 1NSHA 3S0BA 1UHIA 3JTDB 2KAVA 3EKJA 5I94A 1E8AA 1B9AA 1EG3A 1UWOA 2COLB 1KK8C 1MXLC 3CWGA 3SIAA 4C0LA 2OS8B 1XFYO 1IKUA 1C7VA 3AKAA 2I7AA 5AEQA 3B86A 3DF0A 2QEOA 1KQVA 1B7TY 3NSLA 3GOFA 2I2RE 1K96A 1XA5A 1WLMA 2F3ZA 1JF2A 1MWNA 3NGVA 5I2LA 1CLBA 1QX5B 1W9ZA 5EL2A 1CLLA 1QLKA 5I2OA 2L0PA 3CGAA 1AP4A 4I5JA 4E68A 4U8DA 4MEWA 2M0RA 4PALA 1XFWO 3A4UB 1DEKA 4WQ3A 2JNFA 1YUSA 2LP3A 1K94A 3D10A 4PT1A 1YUUA 3PJIA 1KSMA 1UURA 2DOQA 4WQ2A 1SL8A 1NX0A 1QJTA 1XK4C 3VRPA 2LE9B 1VRKA 4IL1A 4TNCA 4MVFA 2PRUA 2FOTA 1J7PA 4INXA 1CMFA 2WCHA 2TN4A 3AAJA 2KAXA 2M29A 1CFFA 4OV2A 1FI5A 2L4HA 1QV1A 1IRJA 2QDIA 1YUTA 1CTRA 3DZTA 4JWQA 4HREE 1OOGA 5GQQC 2IS9A 3S0DA 3EK7A 2ZN8A 1J7RA 1BG1A 3L47A 1QTXA 5HL1A 3VGOA 1TNQA 2KHNA 4N5XA 3TZ1A 2LLTA 4A4CA 5HLOA 4MZKA 1NUBA 3SG5A 1K90D 3R1PA 2JT0A 1KQMC 1J1EA 2M8UA 3D75A 3FS7A 4MN0A 2A4JA 2BECA 2LMTA 2LMUA 4P5OE 4YGEB 1NCYA 2PSRA 1S1EA 1TCFA 2GGZA 3PALA 4INWA 5PALA 1BODA 4MZLA 1WDCB 1QS7A 1SCMB 2CNPA 5F6TA 2LUCA 2LP2A 3FE6A 1TNPA 1CFDA 1PSRA 1KQMB 1Y1XA 2JXCA 2KGRA 2NCOA 1SBJA 1SK6D 1QATA 2MHHA 4GGFA 1SL9A 2WCEA 1YRUB 1A4PA 1NP8A 4GPLB 2R2IA 2CCMA 1J7QA 3ICBA 4YRUA 2PMYA 1BF5A 3WNXB 4NQGA 1TTXA 3SG3A 3R1OA 3BYAA 4CFRA 2ZNEA 3M0WA 1AK8A 4ICBA 1SW8A 2ZNDA 5D7FA 3S0AA 2LAPA 2KI4B 5K89A 4BY4A 1PRWA 1S6IA 2QEVA 4DUQA 1J7OA 1MR8A 1PVBA 1OQPA 4PE0A 4I5NB 3EVVA 5HLVA 2BCBA 5J3XA 3SJSA 2V53A 3DY9A 2WCFA 1MUXA 1RROA 3HCMA 1B8LA 1TUZA 1SYMA 3PSRA 4OKHA 1FF1A 1QV0A 1SRAA 2FCDA 1P28A 3CYZA 2P70A 4HRHA 3DD4A 3EG5B 4NDBA 3WXAA 2KBIA 1S5GY 4BY5A 1SKTA 4YGDB 3OB2B 1A29A 1K2HA 2E6WA 2HQ8A 1DJGA 2WCBA 3TUYC 3N7HA 1Q80A 1BMOA 2K2AA 3B6XA 3BOWB 1AJ5A 1QX2A 4GAOA 2KYFA 2BCAA 4L9MA 3D73A 1Y0VH 2JT3A 1M63B 2ZRSA 4QJ4B 2WC5A 3D74A 3LK0A 4M2OA 2L2EA 2NCPA 1XVJA 1CLMA 4GUKA 1F54A 4MSPA 1UP5A 2L2CA 1PULA 2AMIA 1GGWA 2LCPA 3OX6A 2PASA 4PCWA 5KSZA 1TCOB 3JTDC 1IGVA 1DELA 1V1GA 3TS5C 1LA0A 3BUXB 2WOSA 1FPWA 1CB1A 3BFAA 2OTGC 1DC1A 1CDNA 1CFCA 2NZ0A 1CDMA 2B1UA 3CR5X 1IJ6A 1IWQA 1FBVA 2LV7A 2KLDA 4ORBB 4YGAA 5FI2A 4CPVA 1QLSA 1JUOA 3CDNA 2K7OA 1DJHA 1K9UA 2Y1MA 1M39A 2O60A 1JSAA 3MSEB 1EL4A 1L2OC 3GK1A 1FI6A 1OW4A 3EK8A 1ZOTB 2MA2A 2M97A 1KWOB 1QIVA 2O5GA 1PALA 3SS3A 2KFGA 1GQMA 3AAKA 5AERA 4ETOA 1NCZA 2H2KA 2LM5A 2SCPA 3DVJA 1PSBA 1XO5A 1B47A 1MHOA 2BNXA 2QEHA 2Y4QA 4YI8A 1EG4A 1DF0B 1X02A 1SL7A 2K7BA 2LNKA 3OHMB 3O6BA 2M7LA 3TS5B 1Y1AA 4M2PA 1GM0A 4YGCB 4GNKB 3E3RA 2Q4UA 1QIWA 1IH0A 2JPTA 1OSAA 3JVTB 2M3WA 4MBEA 4F0ZB 5I2QA 2MAZA 1JBAA 1DVIA 1KK7Z 2AUCA 2LLUA 1S6CA 1G8IA 1C7WA 1YVLA 2AAOA 2E30A 2H61C 5B8IB 1IJ5A 4FTGA 1XFVO 3QMEA 5FYXA 4WRIA 3TDZA 3I5FC 4N1GA 4CFQA 4GFTA 1OMDA 2F2OA 1DGUA 1K95A 3SIBA 1H4BA 4GBAA 1SSEB 1C3ZA 1K8UA 2H61A 3CR2A 3DVEA 3FE9A 4NDCA 1QX7A 1C07A 2BE6A 4FQOA 1PK0D 1RTP1 1B8CA 1SR6C 1DF0A 1EH2A 1F4QA 2LVVA 3BUMB 4PE7A 2QEBA 2RGIA 1DJWA 2KI6C 2ZRTA 2HQWA 1IQ5A 1GGZA 3LK1A 1CMGA 1RWYA 1DJYA 1RJVA 2JNXA 1XYDA 3CZ2A 5CSFA 1BR1B 1OMRA 3BFBA 3K1EA 1WY9A 3I5FB 2H8VA 3I5IB 1LINA 4PHKA 3IVTA 3OB1B 3RM1A 1DTLA 2NXQA 2M7NA 3LLEA 4DIRA 3NSOA 4QJ5B 1QVIZ 3CZ1A 1TRFA 3EVUA 3D0YA 2K7DA 2K2FA 2BL0B 1KFXL 1S3PA 1YX8A 1OOHA 2NLNA 3CS1A 2MBXA 4YGBB 2KQ6A 2L51A 5TNCA 1WRKA 3SG7A
chains in the Genus database with same CATH topology
4MRXA 1XFUO 1A03A 1DJXA 1OOJA 4I5KA 3I5GB 2L4IA 3F45A 1SMGA 4PHNA 5CPVA 3C1VA 3BOWA 4AQIA 2KSPA 2EGDA 3CR4X 1TNWA 1BR4B 3NSKA 3I5HC 1RFJA 1R6PA 2HPSA 1A75A 5AXIA 1LA3A 2MRDA 3KO0A 1NX2A 3VROA 2GGMA 2MLFC 2JOJA 3DF0B 1BT6A 1M46A 1SY9A 2JTTA 3I5IC 3LCPC 1BU3A 3D0YB 1YR5A 4PHJA 2LVJA 3AKBA 4OVNF 1YURA 2JTZA 1OE9B 4XJKA 2L5XB 3EVRA 1L2OB 1G33A 1NX3A 1ZFSA 2JZIA 3FWCA 2KBMA 4YI9A 3KEVA 1SCVA 2F8PA 3TUYB 3QRXA 1BOCA 3GK4X 3K21A 1B1GA 3JVTC 1KFXS 1NYAA 2KDHA 3EK4A 3VRRA 1A2XA 3GK2A 4D1EA 3KF9A 1F55A 2OPOA 2WC8A 2VRGA 1XFZO 5CSIA 3TDUA 2MLEC 2LVKA 1AVSA 4ORCB 1DJZA 5AANA 2JULA 3PFVA 1SR6B 1CNPA 1W7JB 1J1DA 2I18A 2F3YA 1H8BA 1G4YR 1V1FA 1ZACA 2EC6C 2F2PA 3PN7C 5CSNA 1UUSA 2SASA 4PE4A 2M1UA 5AFPA 1J55A 5BPJA 1KK7Y 3HX4A 4PHMA 1N2DA 4MRYA 1UHKA 2KQYA 4GGFC 2BKIB 3NXAA 2LC5A 1D1OA 3CLNA 2JT8A 3PLFB 1DMOA 1NX1A 3ZNIA 1AHRA 2HETA 4UPGA 1KSOA 1TN4A 2KI4C 3WHUB 1KCYA 5HKZA 4C0JA 1OZOA 1YRTB 2Y1NA 5KTYA 1BLQA 1S6JA 4ZCUA 2WORA 1NPQA 3PATA 1K9PA 2CXJA 1PVAA 3DVMA 2LANA 2M9GA 3BQ3A 4XJKB 2M1KB 3ZWHA 1JWDA 3CTNA 4A4BA 3LL8B 2LUXA 2FCEA 4AOMA 1RECA 5ER5A 2EC6B 2QACA 5KU1A 1WRZA 1UHJA 2ZFDA 2FJUB 1M31A 5HYDA 2KFFA 2I94A 2ZN9A 5I8NA 2Q91A 4OR9B 4DCKA 4ORAB 1YVHA 2BKHB 2ZKMX 5DKQA 1JC2A 4AQJA 1SCMC 1NWDA 3FWBA 1U5IB 1K9KA 2KFHA 1S36A 1CFPA 1QASA 1M45A 1XK4A 3SG4A 1A75B 2KOTA 1HQVA 2LHLA 1F71A 1Y1UA 1F4OA 2D8NA 1B7TZ 1XFXO 5DKRA 3H4SE 1ALVA 2QPTA 2ISDA 1MF8B 1CM4A 4M2QA 3WHTB 3BXKA 3EKHA 4HSZA 5D69A 1WRLA 1JF0A 4MZJA 1ODBA 2K7CA 2BL0C 1U5IA 3OP0A 4YBHB 2BCXA 1EXRA 1HT9A 2JXLA 2Y5IA 3O2PA 2KAYA 2LLSA 3FIAA 5CSJA 1KWOC 1IG5A 1KFUL 1L7ZA 4I5LB 4NDDA 2L50A 1MXEA 1BJFA 4XYNA 2G9BA 2L98A 1CDLA 2K0JA 3VRQA 2JC2A 4USLA 2JU0A 4DS7A 1K93D 1QXPA 1S26D 3RLZA 1S5GZ 3PM8A 1F70A 2LHIA 5DKNA 1FW4A 4N1FA 3KHEA 4OCIA 3O4YA 2KYCA 1JFJA 1B4CA 2CT9A 2BBNA 4Q04A 1LKJA 1LXFC 2OTGB 2JQ6A 1N65A 3BUNB 5G08A 4R1EA 3SG6A 1LVCD 4JPZB 2LVIA 2CBLA 1B8RA 2M49B 2K61A 3VRNA 2KGBC 1WDCC 2JWWA 1GJYA 4PE1A 1TNXA 1WLZA 5JOLA 1CKKA 2F33A 1RK9A 2BBMA 2CTNA 2EHBA 5ER4X 1ZUZA 2PALA 3OX5A 1NCXA 1F8HA 1UHNA 4JQ0D 2KNEA 2BE4A 4PDZA 4ZCVA 1W7IB 1AJ4A 1DGVA 1Y6WA 2PVBA 3A8RA 5HKWA 5JJGA 2HF5A 3DVKA 4C0KA 3I5GC 3NSIA 1SPYA 1N0YA 1YX7A 1QVIY 4CIDA 3IF7A 3PN7B 4MLWA 4P2YB 2KI6D 4DRWA 1OMVA 1DJIA 4QJ3B 1DT7B 1AUIB 1CDPA 3BUOB 4CLNA 1KK8B 5IBWA 2OS8C 2JRFA 1NIWA 2GV5A 1SNLA 3IQQA 3KPXA 1TIZA 3O78A 3TDIA 4HRGA 2G2BA 1KFUS 2K8MB 3I5HB 1EJ3A 1OZSA 1ALWA 1UHHA 1R2UA 1MQ1A 1YTZC 1IQ3A 3IQOA 1ZMZA 3BUWB 2LMVA 1JFKA 2MJWB 3CZTX 1TOPA 1CM1A 2P6BB 2WNDA 4GGNA 5HKYA 3SG2A 1NSHA 1UHIA 3JTDB 2KAVA 3EKJA 1E8AA 1B9AA 1EG3A 1UWOA 2COLB 1KK8C 1MXLC 3CWGA 3SIAA 4C0LA 2OS8B 1XFYO 1IKUA 1C7VA 3AKAA 2I7AA 5AEQA 3DF0A 1KQVA 1B7TY 3NSLA 3GOFA 2I2RE 1K96A 1XA5A 1WLMA 2F3ZA 1JF2A 1MWNA 5I2LA 1CLBA 1QX5B 1AP4A 5I2OA 1CLLA 1QLKA 2L0PA 3CGAA 4I5JA 4E68A 4U8DA 4MEWA 2M0RA 4PALA 1XFWO 3A4UB 4WQ3A 2JNFA 1YUSA 2LP3A 1K94A 3D10A 1YUUA 1KSMA 1UURA 2DOQA 4WQ2A 1SL8A 1NX0A 1QJTA 1XK4C 3VRPA 2LE9B 1VRKA 4IL1A 4TNCA 4MVFA 2PRUA 2FOTA 1J7PA 1CMFA 2TN4A 3AAJA 2KAXA 2M29A 1CFFA 4OV2A 1FI5A 2L4HA 1QV1A 1IRJA 1YUTA 1CTRA 4JWQA 4HREE 5GQQC 2IS9A 3EK7A 2ZN8A 1J7RA 1BG1A 1QTXA 3VGOA 1TNQA 2KHNA 4N5XA 3TZ1A 2LLTA 4A4CA 5HLOA 4MZKA 1NUBA 3SG5A 1K90D 2JT0A 1KQMC 1J1EA 2M8UA 4MN0A 3FS7A 2A4JA 2BECA 2LMTA 2LMUA 4P5OE 4YGEB 1NCYA 2PSRA 1S1EA 1TCFA 2GGZA 3PALA 5PALA 1BODA 4MZLA 1WDCB 1QS7A 1SCMB 2CNPA 5F6TA 2LUCA 2LP2A 1TNPA 1CFDA 1PSRA 1KQMB 1Y1XA 2JXCA 2KGRA 2NCOA 1SBJA 1SK6D 1QATA 2MHHA 4GGFA 1SL9A 2WCEA 1YRUB 1A4PA 1NP8A 4GPLB 2R2IA 2CCMA 1J7QA 3ICBA 4YRUA 2PMYA 1BF5A 3WNXB 4NQGA 1TTXA 3SG3A 3BYAA 4CFRA 2ZNEA 3M0WA 1AK8A 4ICBA 1SW8A 2ZNDA 5D7FA 2LAPA 2KI4B 5K89A 4BY4A 1PRWA 1S6IA 4DUQA 1J7OA 1MR8A 1PVBA 1OQPA 4PE0A 4I5NB 3EVVA 5HLVA 2BCBA 5J3XA 3SJSA 2V53A 2WCFA 1MUXA 1RROA 3HCMA 1B8LA 3PSRA 1SYMA 4OKHA 1FF1A 1QV0A 1SRAA 2FCDA 4HRHA 4NDBA 3DD4A 3WXAA 2KBIA 1S5GY 4BY5A 1SKTA 4YGDB 3OB2B 1A29A 1K2HA 2E6WA 2HQ8A 1DJGA 2WCBA 3TUYC 1Q80A 1BMOA 2K2AA 3BOWB 1AJ5A 1QX2A 4GAOA 2KYFA 2BCAA 4L9MA 1Y0VH 2JT3A 1M63B 2ZRSA 4QJ4B 3LK0A 4M2OA 2L2EA 2NCPA 1XVJA 1CLMA 4GUKA 1F54A 4MSPA 1UP5A 1PULA 2AMIA 1GGWA 2LCPA 3OX6A 2PASA 4PCWA 5KSZA 1TCOB 3JTDC 1IGVA 1V1GA 3TS5C 1LA0A 3BUXB 2WOSA 1FPWA 1CB1A 2OTGC 1CDNA 1CFCA 2NZ0A 1CDMA 2B1UA 3CR5X 1IJ6A 1IWQA 1FBVA 2LV7A 4ORBB 4YGAA 4CPVA 1QLSA 1JUOA 2K7OA 1DJHA 1K9UA 2Y1MA 1M39A 2O60A 1JSAA 3MSEB 1EL4A 1L2OC 3GK1A 1FI6A 3EK8A 1ZOTB 2MA2A 2M97A 1KWOB 1QIVA 2O5GA 1PALA 2KFGA 1GQMA 3AAKA 5AERA 4ETOA 1NCZA 2H2KA 2LM5A 2SCPA 3DVJA 1PSBA 1XO5A 1B47A 1MHOA 2Y4QA 4YI8A 1EG4A 1DF0B 1X02A 1SL7A 2K7BA 2LNKA 3OHMB 3O6BA 2M7LA 3TS5B 1Y1AA 4M2PA 4YGCB 4GNKB 3E3RA 2Q4UA 1QIWA 1IH0A 2JPTA 1OSAA 3JVTB 2M3WA 4MBEA 4F0ZB 5I2QA 2MAZA 1JBAA 1DVIA 1KK7Z 2AUCA 2LLUA 1S6CA 1G8IA 1C7WA 1YVLA 2AAOA 2E30A 2H61C 5B8IB 1IJ5A 4FTGA 1XFVO 5FYXA 4WRIA 3TDZA 3I5FC 4N1GA 4CFQA 4GFTA 1OMDA 2F2OA 1DGUA 1K95A 3SIBA 1H4BA 4GBAA 1K8UA 2H61A 3CR2A 3DVEA 4NDCA 1QX7A 1C07A 2BE6A 4FQOA 1PK0D 1RTP1 1B8CA 1SR6C 1DF0A 1EH2A 1F4QA 2LVVA 3BUMB 4PE7A 2RGIA 1DJWA 2KI6C 2ZRTA 2HQWA 1IQ5A 1GGZA 3LK1A 1CMGA 1RWYA 1DJYA 1RJVA 2JNXA 1XYDA 5CSFA 1BR1B 1OMRA 1WY9A 3I5FB 3I5IB 1LINA 4PHKA 3OB1B 3RM1A 1DTLA 2NXQA 2M7NA 3LLEA 3NSOA 4QJ5B 1QVIZ 1TRFA 3EVUA 3D0YA 2K7DA 2K2FA 1YX8A 1KFXL 1S3PA 2BL0B 2NLNA 3CS1A 2MBXA 4DIRA 4YGBB 2KQ6A 2L51A 5TNCA 1WRKA 3SG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MRX A;  1XFU O;  1A03 A;  1DJX A;  1OOJ A;  4I5K A;  3I5G B;  2L4I A;  3F45 A;  1SMG A;  4PHN A;  5CPV A;  3C1V A;  3BOW A;  4AQI A;  2KSP A;  2EGD A;  3CR4 X;  1TNW A;  1BR4 B;  3NSK A;  3I5H C;  1RFJ A;  1R6P A;  2HPS A;  1A75 A;  5AXI A;  1LA3 A;  2MRD A;  3KO0 A;  1NX2 A;  3VRO A;  2GGM A;  2MLF C;  2JOJ A;  3DF0 B;  1BT6 A;  1M46 A;  1SY9 A;  2JTT A;  3I5I C;  3LCP C;  1BU3 A;  3D0Y B;  1YR5 A;  4PHJ A;  2LVJ A;  3AKB A;  4OVN F;  1YUR A;  2JTZ A;  1OE9 B;  4XJK A;  2L5X B;  3EVR A;  1L2O B;  1G33 A;  1NX3 A;  1ZFS A;  2JZI A;  3FWC A;  2KBM A;  4YI9 A;  3KEV A;  1SCV A;  2F8P A;  3TUY B;  3QRX A;  1BOC A;  3GK4 X;  3K21 A;  1B1G A;  3JVT C;  1KFX S;  1NYA A;  2KDH A;  3EK4 A;  3VRR A;  1A2X A;  3GK2 A;  4D1E A;  3KF9 A;  1F55 A;  2OPO A;  2WC8 A;  2VRG A;  1XFZ O;  5CSI A;  3TDU A;  2MLE C;  2LVK A;  1AVS A;  4ORC B;  1DJZ A;  5AAN A;  2JUL A;  3PFV A;  1SR6 B;  1CNP A;  1W7J B;  1J1D A;  2I18 A;  2F3Y A;  1H8B A;  1G4Y R;  1V1F A;  1ZAC A;  2EC6 C;  2F2P A;  3PN7 C;  5CSN A;  1UUS A;  2SAS A;  4PE4 A;  2M1U A;  5AFP A;  1J55 A;  5BPJ A;  1KK7 Y;  3HX4 A;  4PHM A;  1N2D A;  4MRY A;  1UHK A;  2KQY A;  4GGF C;  2BKI B;  3NXA A;  2LC5 A;  1D1O A;  3CLN A;  2JT8 A;  3PLF B;  1DMO A;  1NX1 A;  3ZNI A;  1AHR A;  2HET A;  4UPG A;  1KSO A;  1TN4 A;  2KI4 C;  3WHU B;  1KCY A;  5HKZ A;  4C0J A;  1OZO A;  1YRT B;  2Y1N A;  5KTY A;  1BLQ A;  1S6J A;  4ZCU A;  2WOR A;  1NPQ A;  3PAT A;  1K9P A;  2CXJ A;  1PVA A;  3DVM A;  2LAN A;  2M9G A;  3BQ3 A;  4XJK B;  2M1K B;  3ZWH A;  1JWD A;  3CTN A;  4A4B A;  3LL8 B;  2LUX A;  2FCE A;  4AOM A;  1REC A;  5ER5 A;  2EC6 B;  2QAC A;  5KU1 A;  1WRZ A;  1UHJ A;  2ZFD A;  2FJU B;  1M31 A;  5HYD A;  2KFF A;  2I94 A;  2ZN9 A;  5I8N A;  2Q91 A;  4OR9 B;  4DCK A;  4ORA B;  1YVH A;  2BKH B;  2ZKM X;  5DKQ A;  1JC2 A;  4AQJ A;  1SCM C;  1NWD A;  3FWB A;  1U5I B;  1K9K A;  2KFH A;  1S36 A;  1CFP A;  1QAS A;  1M45 A;  1XK4 A;  3SG4 A;  1A75 B;  2KOT A;  1HQV A;  2LHL A;  1F71 A;  1Y1U A;  1F4O A;  2D8N A;  1B7T Z;  1XFX O;  5DKR A;  3H4S E;  1ALV A;  2QPT A;  2ISD A;  1MF8 B;  1CM4 A;  4M2Q A;  3WHT B;  3BXK A;  3EKH A;  4HSZ A;  5D69 A;  1WRL A;  1JF0 A;  4MZJ A;  1ODB A;  2K7C A;  2BL0 C;  1U5I A;  3OP0 A;  4YBH B;  2BCX A;  1EXR A;  1HT9 A;  2JXL A;  2Y5I A;  3O2P A;  2KAY A;  2LLS A;  3FIA A;  5CSJ A;  1KWO C;  1IG5 A;  1KFU L;  1L7Z A;  4I5L B;  4NDD A;  2L50 A;  1MXE A;  1BJF A;  4XYN A;  2G9B A;  2L98 A;  1CDL A;  2K0J A;  3VRQ A;  2JC2 A;  4USL A;  2JU0 A;  4DS7 A;  1K93 D;  1QXP A;  1S26 D;  3RLZ A;  1S5G Z;  3PM8 A;  1F70 A;  2LHI A;  5DKN A;  1FW4 A;  4N1F A;  3KHE A;  4OCI A;  3O4Y A;  2KYC A;  1JFJ A;  1B4C A;  2CT9 A;  2BBN A;  4Q04 A;  1LKJ A;  1LXF C;  2OTG B;  2JQ6 A;  1N65 A;  3BUN B;  5G08 A;  4R1E A;  3SG6 A;  1LVC D;  4JPZ B;  2LVI A;  2CBL A;  1B8R A;  2M49 B;  2K61 A;  3VRN A;  2KGB C;  1WDC C;  2JWW A;  1GJY A;  4PE1 A;  1TNX A;  1WLZ A;  5JOL A;  1CKK A;  2F33 A;  1RK9 A;  2BBM A;  2CTN A;  2EHB A;  5ER4 X;  1ZUZ A;  2PAL A;  3OX5 A;  1NCX A;  1F8H A;  1UHN A;  4JQ0 D;  2KNE A;  2BE4 A;  4PDZ A;  4ZCV A;  1W7I B;  1AJ4 A;  1DGV A;  1Y6W A;  2PVB A;  3A8R A;  5HKW A;  5JJG A;  2HF5 A;  3DVK A;  4C0K A;  3I5G C;  3NSI A;  1SPY A;  1N0Y A;  1YX7 A;  1QVI Y;  4CID A;  3IF7 A;  3PN7 B;  4MLW A;  4P2Y B;  2KI6 D;  4DRW A;  1OMV A;  1DJI A;  4QJ3 B;  1DT7 B;  1AUI B;  1CDP A;  3BUO B;  4CLN A;  1KK8 B;  5IBW A;  2OS8 C;  2JRF A;  1NIW A;  2GV5 A;  1SNL A;  3IQQ A;  3KPX A;  1TIZ A;  3O78 A;  3TDI A;  4HRG A;  2G2B A;  1KFU S;  2K8M B;  3I5H B;  1EJ3 A;  1OZS A;  1ALW A;  1UHH A;  1R2U A;  1MQ1 A;  1YTZ C;  1IQ3 A;  3IQO A;  1ZMZ A;  3BUW B;  2LMV A;  1JFK A;  2MJW B;  3CZT X;  1TOP A;  1CM1 A;  2P6B B;  2WND A;  4GGN A;  5HKY A;  3SG2 A;  1NSH A;  1UHI A;  3JTD B;  2KAV A;  3EKJ A;  1E8A A;  1B9A A;  1EG3 A;  1UWO A;  2COL B;  1KK8 C;  1MXL C;  3CWG A;  3SIA A;  4C0L A;  2OS8 B;  1XFY O;  1IKU A;  1C7V A;  3AKA A;  2I7A A;  5AEQ A;  3DF0 A;  1KQV A;  1B7T Y;  3NSL A;  3GOF A;  2I2R E;  1K96 A;  1XA5 A;  1WLM A;  2F3Z A;  1JF2 A;  1MWN A;  5I2L A;  1CLB A;  1QX5 B;  1AP4 A;  5I2O A;  1CLL A;  1QLK A;  2L0P A;  3CGA A;  4I5J A;  4E68 A;  4U8D A;  4MEW A;  2M0R A;  4PAL A;  1XFW O;  3A4U B;  4WQ3 A;  2JNF A;  1YUS A;  2LP3 A;  1K94 A;  3D10 A;  1YUU A;  1KSM A;  1UUR A;  2DOQ A;  4WQ2 A;  1SL8 A;  1NX0 A;  1QJT A;  1XK4 C;  3VRP A;  2LE9 B;  1VRK A;  4IL1 A;  4TNC A;  4MVF A;  2PRU A;  2FOT A;  1J7P A;  1CMF A;  2TN4 A;  3AAJ A;  2KAX A;  2M29 A;  1CFF A;  4OV2 A;  1FI5 A;  2L4H A;  1QV1 A;  1IRJ A;  1YUT A;  1CTR A;  4JWQ A;  4HRE E;  5GQQ C;  2IS9 A;  3EK7 A;  2ZN8 A;  1J7R A;  1BG1 A;  1QTX A;  3VGO A;  1TNQ A;  2KHN A;  4N5X A;  3TZ1 A;  2LLT A;  4A4C A;  5HLO A;  4MZK A;  1NUB A;  3SG5 A;  1K90 D;  2JT0 A;  1KQM C;  1J1E A;  2M8U A;  4MN0 A;  3FS7 A;  2A4J A;  2BEC A;  2LMT A;  2LMU A;  4P5O E;  4YGE B;  1NCY A;  2PSR A;  1S1E A;  1TCF A;  2GGZ A;  3PAL A;  5PAL A;  1BOD A;  4MZL A;  1WDC B;  1QS7 A;  1SCM B;  2CNP A;  5F6T A;  2LUC A;  2LP2 A;  1TNP A;  1CFD A;  1PSR A;  1KQM B;  1Y1X A;  2JXC A;  2KGR A;  2NCO A;  1SBJ A;  1SK6 D;  1QAT A;  2MHH A;  4GGF A;  1SL9 A;  2WCE A;  1YRU B;  1A4P A;  1NP8 A;  4GPL B;  2R2I A;  2CCM A;  1J7Q A;  3ICB A;  4YRU A;  2PMY A;  1BF5 A;  3WNX B;  4NQG A;  1TTX A;  3SG3 A;  3BYA A;  4CFR A;  2ZNE A;  3M0W A;  1AK8 A;  4ICB A;  1SW8 A;  2ZND A;  5D7F A;  2LAP A;  2KI4 B;  5K89 A;  4BY4 A;  1PRW A;  1S6I A;  4DUQ A;  1J7O A;  1MR8 A;  1PVB A;  1OQP A;  4PE0 A;  4I5N B;  3EVV A;  5HLV A;  2BCB A;  5J3X A;  3SJS A;  2V53 A;  2WCF A;  1MUX A;  1RRO A;  3HCM A;  1B8L A;  3PSR A;  1SYM A;  4OKH A;  1FF1 A;  1QV0 A;  1SRA A;  2FCD A;  4HRH A;  4NDB A;  3DD4 A;  3WXA A;  2KBI A;  1S5G Y;  4BY5 A;  1SKT A;  4YGD B;  3OB2 B;  1A29 A;  1K2H A;  2E6W A;  2HQ8 A;  1DJG A;  2WCB A;  3TUY C;  1Q80 A;  1BMO A;  2K2A A;  3BOW B;  1AJ5 A;  1QX2 A;  4GAO A;  2KYF A;  2BCA A;  4L9M A;  1Y0V H;  2JT3 A;  1M63 B;  2ZRS A;  4QJ4 B;  3LK0 A;  4M2O A;  2L2E A;  2NCP A;  1XVJ A;  1CLM A;  4GUK A;  1F54 A;  4MSP A;  1UP5 A;  1PUL A;  2AMI A;  1GGW A;  2LCP A;  3OX6 A;  2PAS A;  4PCW A;  5KSZ A;  1TCO B;  3JTD C;  1IGV A;  1V1G A;  3TS5 C;  1LA0 A;  3BUX B;  2WOS A;  1FPW A;  1CB1 A;  2OTG C;  1CDN A;  1CFC A;  2NZ0 A;  1CDM A;  2B1U A;  3CR5 X;  1IJ6 A;  1IWQ A;  1FBV A;  2LV7 A;  4ORB B;  4YGA A;  4CPV A;  1QLS A;  1JUO A;  2K7O A;  1DJH A;  1K9U A;  2Y1M A;  1M39 A;  2O60 A;  1JSA A;  3MSE B;  1EL4 A;  1L2O C;  3GK1 A;  1FI6 A;  3EK8 A;  1ZOT B;  2MA2 A;  2M97 A;  1KWO B;  1QIV A;  2O5G A;  1PAL A;  2KFG A;  1GQM A;  3AAK A;  5AER A;  4ETO A;  1NCZ A;  2H2K A;  2LM5 A;  2SCP A;  3DVJ A;  1PSB A;  1XO5 A;  1B47 A;  1MHO A;  2Y4Q A;  4YI8 A;  1EG4 A;  1DF0 B;  1X02 A;  1SL7 A;  2K7B A;  2LNK A;  3OHM B;  3O6B A;  2M7L A;  3TS5 B;  1Y1A A;  4M2P A;  4YGC B;  4GNK B;  3E3R A;  2Q4U A;  1QIW A;  1IH0 A;  2JPT A;  1OSA A;  3JVT B;  2M3W A;  4MBE A;  4F0Z B;  5I2Q A;  2MAZ A;  1JBA A;  1DVI A;  1KK7 Z;  2AUC A;  2LLU A;  1S6C A;  1G8I A;  1C7W A;  1YVL A;  2AAO A;  2E30 A;  2H61 C;  5B8I B;  1IJ5 A;  4FTG A;  1XFV O;  5FYX A;  4WRI A;  3TDZ A;  3I5F C;  4N1G A;  4CFQ A;  4GFT A;  1OMD A;  2F2O A;  1DGU A;  1K95 A;  3SIB A;  1H4B A;  4GBA A;  1K8U A;  2H61 A;  3CR2 A;  3DVE A;  4NDC A;  1QX7 A;  1C07 A;  2BE6 A;  4FQO A;  1PK0 D;  1RTP 1;  1B8C A;  1SR6 C;  1DF0 A;  1EH2 A;  1F4Q A;  2LVV A;  3BUM B;  4PE7 A;  2RGI A;  1DJW A;  2KI6 C;  2ZRT A;  2HQW A;  1IQ5 A;  1GGZ A;  3LK1 A;  1CMG A;  1RWY A;  1DJY A;  1RJV A;  2JNX A;  1XYD A;  5CSF A;  1BR1 B;  1OMR A;  1WY9 A;  3I5F B;  3I5I B;  1LIN A;  4PHK A;  3OB1 B;  3RM1 A;  1DTL A;  2NXQ A;  2M7N A;  3LLE A;  3NSO A;  4QJ5 B;  1QVI Z;  1TRF A;  3EVU A;  3D0Y A;  2K7D A;  2K2F A;  1YX8 A;  1KFX L;  1S3P A;  2BL0 B;  2NLN A;  3CS1 A;  2MBX A;  4DIR A;  4YGB B;  2KQ6 A;  2L51 A;  5TNC A;  1WRK A;  3SG7 A; 
#chains in the Genus database with same CATH topology
 4MRX A;  1XFU O;  1A03 A;  1DJX A;  1OOJ A;  4I5K A;  3I5G B;  3Q8I A;  2L4I A;  3F45 A;  1SMG A;  4PHN A;  5CPV A;  3C1V A;  3BOW A;  4AQI A;  2KSP A;  2EGD A;  3CR4 X;  1TNW A;  1BR4 B;  3NSK A;  3R72 A;  2YGU A;  3I5H C;  1RFJ A;  1R6P A;  2HPS A;  1A75 A;  1LS8 A;  5AXI A;  1LA3 A;  2MRD A;  3KO0 A;  1NX2 A;  3VRO A;  2GGM A;  2MLF C;  3S0F A;  1XFR A;  2JOJ A;  1BT6 A;  1M46 A;  1SY9 A;  2JTT A;  3DF0 B;  3I5I C;  1BU3 A;  3D0Y B;  3LCP C;  3VB1 A;  1YR5 A;  4PHJ A;  2LVJ A;  3AKB A;  4OVN F;  1YUR A;  2JTZ A;  3O4X A;  1OE9 B;  4XJK A;  2L5X B;  3EVR A;  1L2O B;  1G33 A;  1NX3 A;  1ZFS A;  2JZI A;  3FWC A;  2KBM A;  2WC6 A;  4YI9 A;  3KEV A;  1SCV A;  2F8P A;  4IJ7 A;  3TUY B;  3QRX A;  2WCK A;  2JPO A;  1BOC A;  3GK4 X;  3K21 A;  1B1G A;  3JVT C;  1KFX S;  1NYA A;  2KDH A;  3EK4 A;  3L4A A;  3FE8 A;  3V2L A;  3VRR A;  1A2X A;  3GK2 A;  4D1E A;  3KF9 A;  1F55 A;  4KYN A;  4JKT A;  2OPO A;  2WC8 A;  2VRG A;  1XFZ O;  5CSI A;  3TDU A;  2MLE C;  2LVK A;  1AVS A;  1Z2C B;  4ORC B;  1TUJ A;  1DJZ A;  5AAN A;  2JUL A;  3S0G A;  3DYE A;  3PFV A;  1SR6 B;  1CNP A;  1W7J B;  3B87 A;  1J1D A;  2I18 A;  2F3Y A;  2FJY A;  1H8B A;  1G4Y R;  1V1F A;  1ZAC A;  2EC6 C;  2F2P A;  3PN7 C;  5CSN A;  1UUS A;  2SAS A;  4PE4 A;  2M1U A;  2WCJ A;  5AFP A;  1J55 A;  5BPJ A;  1KK7 Y;  3HX4 A;  2KPH A;  1QWV A;  4PHM A;  1N2D A;  4MRY A;  1UHK A;  2KQY A;  4GGF C;  2BKI B;  3NXA A;  2LC5 A;  1D1O A;  3CLN A;  2JT8 A;  3PLF B;  1DMO A;  4OZD A;  1NX1 A;  3ZNI A;  1AHR A;  2HET A;  4UPG A;  1KSO A;  1TN4 A;  2KI4 C;  3UO9 A;  3WHU B;  5HKZ A;  1KCY A;  4C0J A;  1OZO A;  1YRT B;  2Y1N A;  5KTY A;  1BLQ A;  1S6J A;  4ZCU A;  2WOR A;  5DIC A;  3PM2 A;  1NPQ A;  1Z4H A;  3PAT A;  1K9P A;  2CXJ A;  1PVA A;  2P71 A;  3DVM A;  2LAN A;  2M9G A;  3BQ3 A;  4XJK B;  2M1K B;  3ZWH A;  1JWD A;  3CTN A;  4A4B A;  3LL8 B;  2GTE A;  2LUX A;  2FCE A;  4AOM A;  1REC A;  5ER5 A;  2EC6 B;  2QAC A;  5KU1 A;  1WRZ A;  1UHJ A;  2L5Y A;  2BAP A;  2ZFD A;  2FJU B;  1M31 A;  5HYD A;  2KFF A;  2I94 A;  2ZN9 A;  3OGN A;  5I8N A;  2Q91 A;  2WCL A;  4OR9 B;  4DCK A;  4ORA B;  1YVH A;  2BKH B;  2ZKM X;  5DKQ A;  1JC2 A;  4AQJ A;  1SCM C;  1NWD A;  3FWB A;  1T14 A;  1K9K A;  1U5I B;  2KFH A;  5FI7 A;  1OOI X;  5D3O A;  1S36 A;  3S0E A;  1CFP A;  1QAS A;  1M45 A;  1XK4 A;  3SG4 A;  1A75 B;  2KOT A;  3D77 A;  1HQV A;  2LHL A;  1F71 A;  1Y1U A;  1F4O A;  2D8N A;  1B7T Z;  1XFX O;  5DKR A;  3H4S E;  1ALV A;  5FI6 A;  1DQE A;  2QPT A;  2ISD A;  1MF8 B;  3L4L A;  3NHT A;  1CM4 A;  4M2Q A;  3WHT B;  3BXK A;  3EKH A;  4HSZ A;  5D69 A;  4FQT A;  1WRL A;  1JF0 A;  4MZJ A;  1ODB A;  2K7C A;  2BL0 C;  1U5I A;  3CZ0 A;  3OP0 A;  4YBH B;  2BCX A;  1EXR A;  1HT9 A;  2JXL A;  2Y5I A;  3O2P A;  2KAY A;  2LLS A;  3FIA A;  5CSJ A;  3SS4 A;  1KWO C;  1IG5 A;  1KFU L;  1L7Z A;  4I5L B;  4NDD A;  2L50 A;  1MXE A;  1BJF A;  3BFH A;  3BJH A;  4XYN A;  2G9B A;  2L98 A;  1CDL A;  2K0J A;  3VRQ A;  2JC2 A;  4USL A;  2JU0 A;  4DS7 A;  1K93 D;  1QXP A;  2PYQ A;  1S26 D;  3RLZ A;  1S5G Z;  3PM8 A;  1F70 A;  2LHI A;  5DKN A;  1FW4 A;  2K60 A;  3CAB A;  4N1F A;  3KHE A;  4OCI A;  3RZS A;  3O4Y A;  2KYC A;  1JFJ A;  1B4C A;  2CT9 A;  2BBN A;  4Q04 A;  1LKJ A;  1LXF C;  2OTG B;  2JQ6 A;  1N65 A;  1ORG A;  2KLE A;  3BUN B;  4R1E A;  5G08 A;  1LVC D;  3SG6 A;  4JPZ B;  3D76 A;  2LVI A;  2CBL A;  3DXL A;  1B8R A;  2M49 B;  2K61 A;  3VRN A;  2KGB C;  1WDC C;  2JWW A;  1GJY A;  4PE1 A;  1TNX A;  1WLZ A;  3D78 A;  5JOL A;  1CKK A;  2F33 A;  1RK9 A;  2BBM A;  2CTN A;  2EHB A;  5ER4 X;  1ZUZ A;  1OOF A;  2PAL A;  3OX5 A;  3UNW A;  1NCX A;  4JD9 A;  1F8H A;  1UHN A;  4JQ0 D;  2KNE A;  2BE4 A;  4PDZ A;  4ZCV A;  1W7I B;  3B88 A;  1AJ4 A;  1DGV A;  1Y6W A;  2PQL A;  2PVB A;  1IIO A;  3A8R A;  5HKW A;  5JJG A;  2HF5 A;  3DVK A;  3OBV A;  4C0K A;  3I5G C;  3NSI A;  1C3Y A;  1SPY A;  3B7A A;  3NHI A;  1N0Y A;  1YX7 A;  3SS5 A;  1QVI Y;  4CID A;  3IF7 A;  3PN7 B;  4MLW A;  4P2Y B;  2KI6 D;  4DRW A;  1OMV A;  1DJI A;  4QJ3 B;  1DT7 B;  2WCM A;  1AUI B;  1CDP A;  3BUO B;  4CLN A;  1KK8 B;  2ERB A;  5IBW A;  3R1V A;  2OS8 C;  2JRF A;  1NIW A;  2GV5 A;  1SNL A;  3IQQ A;  3KPX A;  1TIZ A;  1TWO A;  3O78 A;  3TDI A;  4HRG A;  2G2B A;  1KFU S;  2K8M B;  3I5H B;  1EJ3 A;  1OZS A;  1ALW A;  1UHH A;  1R2U A;  1MQ1 A;  1YTZ C;  1IQ3 A;  3IQO A;  1ZMZ A;  3BUW B;  2LMV A;  4F7F A;  1JFK A;  2MJW B;  3CZT X;  1TOP A;  1CM1 A;  2P6B B;  2WND A;  4GGN A;  5HKY A;  3SG2 A;  1NSH A;  3S0B A;  1UHI A;  3JTD B;  2KAV A;  3EKJ A;  5I94 A;  1E8A A;  1B9A A;  1EG3 A;  1UWO A;  2COL B;  1KK8 C;  1MXL C;  3CWG A;  3SIA A;  4C0L A;  2OS8 B;  1XFY O;  1IKU A;  1C7V A;  3AKA A;  2I7A A;  5AEQ A;  3B86 A;  3DF0 A;  2QEO A;  1KQV A;  1B7T Y;  3NSL A;  3GOF A;  2I2R E;  1K96 A;  1XA5 A;  1WLM A;  2F3Z A;  1JF2 A;  1MWN A;  3NGV A;  5I2L A;  1CLB A;  1QX5 B;  1W9Z A;  5EL2 A;  1CLL A;  1QLK A;  5I2O A;  2L0P A;  3CGA A;  1AP4 A;  4I5J A;  4E68 A;  4U8D A;  4MEW A;  2M0R A;  4PAL A;  1XFW O;  3A4U B;  1DEK A;  4WQ3 A;  2JNF A;  1YUS A;  2LP3 A;  1K94 A;  3D10 A;  4PT1 A;  1YUU A;  3PJI A;  1KSM A;  1UUR A;  2DOQ A;  4WQ2 A;  1SL8 A;  1NX0 A;  1QJT A;  1XK4 C;  3VRP A;  2LE9 B;  1VRK A;  4IL1 A;  4TNC A;  4MVF A;  2PRU A;  2FOT A;  1J7P A;  4INX A;  1CMF A;  2WCH A;  2TN4 A;  3AAJ A;  2KAX A;  2M29 A;  1CFF A;  4OV2 A;  1FI5 A;  2L4H A;  1QV1 A;  1IRJ A;  2QDI A;  1YUT A;  1CTR A;  3DZT A;  4JWQ A;  4HRE E;  1OOG A;  5GQQ C;  2IS9 A;  3S0D A;  3EK7 A;  2ZN8 A;  1J7R A;  1BG1 A;  3L47 A;  1QTX A;  5HL1 A;  3VGO A;  1TNQ A;  2KHN A;  4N5X A;  3TZ1 A;  2LLT A;  4A4C A;  5HLO A;  4MZK A;  1NUB A;  3SG5 A;  1K90 D;  3R1P A;  2JT0 A;  1KQM C;  1J1E A;  2M8U A;  3D75 A;  3FS7 A;  4MN0 A;  2A4J A;  2BEC A;  2LMT A;  2LMU A;  4P5O E;  4YGE B;  1NCY A;  2PSR A;  1S1E A;  1TCF A;  2GGZ A;  3PAL A;  4INW A;  5PAL A;  1BOD A;  4MZL A;  1WDC B;  1QS7 A;  1SCM B;  2CNP A;  5F6T A;  2LUC A;  2LP2 A;  3FE6 A;  1TNP A;  1CFD A;  1PSR A;  1KQM B;  1Y1X A;  2JXC A;  2KGR A;  2NCO A;  1SBJ A;  1SK6 D;  1QAT A;  2MHH A;  4GGF A;  1SL9 A;  2WCE A;  1YRU B;  1A4P A;  1NP8 A;  4GPL B;  2R2I A;  2CCM A;  1J7Q A;  3ICB A;  4YRU A;  2PMY A;  1BF5 A;  3WNX B;  4NQG A;  1TTX A;  3SG3 A;  3R1O A;  3BYA A;  4CFR A;  2ZNE A;  3M0W A;  1AK8 A;  4ICB A;  1SW8 A;  2ZND A;  5D7F A;  3S0A A;  2LAP A;  2KI4 B;  5K89 A;  4BY4 A;  1PRW A;  1S6I A;  2QEV A;  4DUQ A;  1J7O A;  1MR8 A;  1PVB A;  1OQP A;  4PE0 A;  4I5N B;  3EVV A;  5HLV A;  2BCB A;  5J3X A;  3SJS A;  2V53 A;  3DY9 A;  2WCF A;  1MUX A;  1RRO A;  3HCM A;  1B8L A;  1TUZ A;  1SYM A;  3PSR A;  4OKH A;  1FF1 A;  1QV0 A;  1SRA A;  2FCD A;  1P28 A;  3CYZ A;  2P70 A;  4HRH A;  3DD4 A;  3EG5 B;  4NDB A;  3WXA A;  2KBI A;  1S5G Y;  4BY5 A;  1SKT A;  4YGD B;  3OB2 B;  1A29 A;  1K2H A;  2E6W A;  2HQ8 A;  1DJG A;  2WCB A;  3TUY C;  3N7H A;  1Q80 A;  1BMO A;  2K2A A;  3B6X A;  3BOW B;  1AJ5 A;  1QX2 A;  4GAO A;  2KYF A;  2BCA A;  4L9M A;  3D73 A;  1Y0V H;  2JT3 A;  1M63 B;  2ZRS A;  4QJ4 B;  2WC5 A;  3D74 A;  3LK0 A;  4M2O A;  2L2E A;  2NCP A;  1XVJ A;  1CLM A;  4GUK A;  1F54 A;  4MSP A;  1UP5 A;  2L2C A;  1PUL A;  2AMI A;  1GGW A;  2LCP A;  3OX6 A;  2PAS A;  4PCW A;  5KSZ A;  1TCO B;  3JTD C;  1IGV A;  1DEL A;  1V1G A;  3TS5 C;  1LA0 A;  3BUX B;  2WOS A;  1FPW A;  1CB1 A;  3BFA A;  2OTG C;  1DC1 A;  1CDN A;  1CFC A;  2NZ0 A;  1CDM A;  2B1U A;  3CR5 X;  1IJ6 A;  1IWQ A;  1FBV A;  2LV7 A;  2KLD A;  4ORB B;  4YGA A;  5FI2 A;  4CPV A;  1QLS A;  1JUO A;  3CDN A;  2K7O A;  1DJH A;  1K9U A;  2Y1M A;  1M39 A;  2O60 A;  1JSA A;  3MSE B;  1EL4 A;  1L2O C;  3GK1 A;  1FI6 A;  1OW4 A;  3EK8 A;  1ZOT B;  2MA2 A;  2M97 A;  1KWO B;  1QIV A;  2O5G A;  1PAL A;  3SS3 A;  2KFG A;  1GQM A;  3AAK A;  5AER A;  4ETO A;  1NCZ A;  2H2K A;  2LM5 A;  2SCP A;  3DVJ A;  1PSB A;  1XO5 A;  1B47 A;  1MHO A;  2BNX A;  2QEH A;  2Y4Q A;  4YI8 A;  1EG4 A;  1DF0 B;  1X02 A;  1SL7 A;  2K7B A;  2LNK A;  3OHM B;  3O6B A;  2M7L A;  3TS5 B;  1Y1A A;  4M2P A;  1GM0 A;  4YGC B;  4GNK B;  3E3R A;  2Q4U A;  1QIW A;  1IH0 A;  2JPT A;  1OSA A;  3JVT B;  2M3W A;  4MBE A;  4F0Z B;  5I2Q A;  2MAZ A;  1JBA A;  1DVI A;  1KK7 Z;  2AUC A;  2LLU A;  1S6C A;  1G8I A;  1C7W A;  1YVL A;  2AAO A;  2E30 A;  2H61 C;  5B8I B;  1IJ5 A;  4FTG A;  1XFV O;  3QME A;  5FYX A;  4WRI A;  3TDZ A;  3I5F C;  4N1G A;  4CFQ A;  4GFT A;  1OMD A;  2F2O A;  1DGU A;  1K95 A;  3SIB A;  1H4B A;  4GBA A;  1SSE B;  1C3Z A;  1K8U A;  2H61 A;  3CR2 A;  3DVE A;  3FE9 A;  4NDC A;  1QX7 A;  1C07 A;  2BE6 A;  4FQO A;  1PK0 D;  1RTP 1;  1B8C A;  1SR6 C;  1DF0 A;  1EH2 A;  1F4Q A;  2LVV A;  3BUM B;  4PE7 A;  2QEB A;  2RGI A;  1DJW A;  2KI6 C;  2ZRT A;  2HQW A;  1IQ5 A;  1GGZ A;  3LK1 A;  1CMG A;  1RWY A;  1DJY A;  1RJV A;  2JNX A;  1XYD A;  3CZ2 A;  5CSF A;  1BR1 B;  1OMR A;  3BFB A;  3K1E A;  1WY9 A;  3I5F B;  2H8V A;  3I5I B;  1LIN A;  4PHK A;  3IVT A;  3OB1 B;  3RM1 A;  1DTL A;  2NXQ A;  2M7N A;  3LLE A;  4DIR A;  3NSO A;  4QJ5 B;  1QVI Z;  3CZ1 A;  1TRF A;  3EVU A;  3D0Y A;  2K7D A;  2K2F A;  2BL0 B;  1KFX L;  1S3P A;  1YX8 A;  1OOH A;  2NLN A;  3CS1 A;  2MBX A;  4YGB B;  2KQ6 A;  2L51 A;  5TNC A;  1WRK A;  3SG7 A; 
#chains in the Genus database with same CATH homology
 4MRX A;  1XFU O;  1A03 A;  1DJX A;  1OOJ A;  4I5K A;  3I5G B;  2L4I A;  3F45 A;  1SMG A;  4PHN A;  5CPV A;  3C1V A;  3BOW A;  4AQI A;  2KSP A;  2EGD A;  3CR4 X;  1TNW A;  1BR4 B;  3NSK A;  3I5H C;  1RFJ A;  1R6P A;  2HPS A;  1A75 A;  5AXI A;  1LA3 A;  2MRD A;  3KO0 A;  1NX2 A;  3VRO A;  2GGM A;  2MLF C;  2JOJ A;  3DF0 B;  1BT6 A;  1M46 A;  1SY9 A;  2JTT A;  3I5I C;  3LCP C;  1BU3 A;  3D0Y B;  1YR5 A;  4PHJ A;  2LVJ A;  3AKB A;  4OVN F;  1YUR A;  2JTZ A;  1OE9 B;  4XJK A;  2L5X B;  3EVR A;  1L2O B;  1G33 A;  1NX3 A;  1ZFS A;  2JZI A;  3FWC A;  2KBM A;  4YI9 A;  3KEV A;  1SCV A;  2F8P A;  3TUY B;  3QRX A;  1BOC A;  3GK4 X;  3K21 A;  1B1G A;  3JVT C;  1KFX S;  1NYA A;  2KDH A;  3EK4 A;  3VRR A;  1A2X A;  3GK2 A;  4D1E A;  3KF9 A;  1F55 A;  2OPO A;  2WC8 A;  2VRG A;  1XFZ O;  5CSI A;  3TDU A;  2MLE C;  2LVK A;  1AVS A;  4ORC B;  1DJZ A;  5AAN A;  2JUL A;  3PFV A;  1SR6 B;  1CNP A;  1W7J B;  1J1D A;  2I18 A;  2F3Y A;  1H8B A;  1G4Y R;  1V1F A;  1ZAC A;  2EC6 C;  2F2P A;  3PN7 C;  5CSN A;  1UUS A;  2SAS A;  4PE4 A;  2M1U A;  5AFP A;  1J55 A;  5BPJ A;  1KK7 Y;  3HX4 A;  4PHM A;  1N2D A;  4MRY A;  1UHK A;  2KQY A;  4GGF C;  2BKI B;  3NXA A;  2LC5 A;  1D1O A;  3CLN A;  2JT8 A;  3PLF B;  1DMO A;  1NX1 A;  3ZNI A;  1AHR A;  2HET A;  4UPG A;  1KSO A;  1TN4 A;  2KI4 C;  3WHU B;  1KCY A;  5HKZ A;  4C0J A;  1OZO A;  1YRT B;  2Y1N A;  5KTY A;  1BLQ A;  1S6J A;  4ZCU A;  2WOR A;  1NPQ A;  3PAT A;  1K9P A;  2CXJ A;  1PVA A;  3DVM A;  2LAN A;  2M9G A;  3BQ3 A;  4XJK B;  2M1K B;  3ZWH A;  1JWD A;  3CTN A;  4A4B A;  3LL8 B;  2LUX A;  2FCE A;  4AOM A;  1REC A;  5ER5 A;  2EC6 B;  2QAC A;  5KU1 A;  1WRZ A;  1UHJ A;  2ZFD A;  2FJU B;  1M31 A;  5HYD A;  2KFF A;  2I94 A;  2ZN9 A;  5I8N A;  2Q91 A;  4OR9 B;  4DCK A;  4ORA B;  1YVH A;  2BKH B;  2ZKM X;  5DKQ A;  1JC2 A;  4AQJ A;  1SCM C;  1NWD A;  3FWB A;  1U5I B;  1K9K A;  2KFH A;  1S36 A;  1CFP A;  1QAS A;  1M45 A;  1XK4 A;  3SG4 A;  1A75 B;  2KOT A;  1HQV A;  2LHL A;  1F71 A;  1Y1U A;  1F4O A;  2D8N A;  1B7T Z;  1XFX O;  5DKR A;  3H4S E;  1ALV A;  2QPT A;  2ISD A;  1MF8 B;  1CM4 A;  4M2Q A;  3WHT B;  3BXK A;  3EKH A;  4HSZ A;  5D69 A;  1WRL A;  1JF0 A;  4MZJ A;  1ODB A;  2K7C A;  2BL0 C;  1U5I A;  3OP0 A;  4YBH B;  2BCX A;  1EXR A;  1HT9 A;  2JXL A;  2Y5I A;  3O2P A;  2KAY A;  2LLS A;  3FIA A;  5CSJ A;  1KWO C;  1IG5 A;  1KFU L;  1L7Z A;  4I5L B;  4NDD A;  2L50 A;  1MXE A;  1BJF A;  4XYN A;  2G9B A;  2L98 A;  1CDL A;  2K0J A;  3VRQ A;  2JC2 A;  4USL A;  2JU0 A;  4DS7 A;  1K93 D;  1QXP A;  1S26 D;  3RLZ A;  1S5G Z;  3PM8 A;  1F70 A;  2LHI A;  5DKN A;  1FW4 A;  4N1F A;  3KHE A;  4OCI A;  3O4Y A;  2KYC A;  1JFJ A;  1B4C A;  2CT9 A;  2BBN A;  4Q04 A;  1LKJ A;  1LXF C;  2OTG B;  2JQ6 A;  1N65 A;  3BUN B;  5G08 A;  4R1E A;  3SG6 A;  1LVC D;  4JPZ B;  2LVI A;  2CBL A;  1B8R A;  2M49 B;  2K61 A;  3VRN A;  2KGB C;  1WDC C;  2JWW A;  1GJY A;  4PE1 A;  1TNX A;  1WLZ A;  5JOL A;  1CKK A;  2F33 A;  1RK9 A;  2BBM A;  2CTN A;  2EHB A;  5ER4 X;  1ZUZ A;  2PAL A;  3OX5 A;  1NCX A;  1F8H A;  1UHN A;  4JQ0 D;  2KNE A;  2BE4 A;  4PDZ A;  4ZCV A;  1W7I B;  1AJ4 A;  1DGV A;  1Y6W A;  2PVB A;  3A8R A;  5HKW A;  5JJG A;  2HF5 A;  3DVK A;  4C0K A;  3I5G C;  3NSI A;  1SPY A;  1N0Y A;  1YX7 A;  1QVI Y;  4CID A;  3IF7 A;  3PN7 B;  4MLW A;  4P2Y B;  2KI6 D;  4DRW A;  1OMV A;  1DJI A;  4QJ3 B;  1DT7 B;  1AUI B;  1CDP A;  3BUO B;  4CLN A;  1KK8 B;  5IBW A;  2OS8 C;  2JRF A;  1NIW A;  2GV5 A;  1SNL A;  3IQQ A;  3KPX A;  1TIZ A;  3O78 A;  3TDI A;  4HRG A;  2G2B A;  1KFU S;  2K8M B;  3I5H B;  1EJ3 A;  1OZS A;  1ALW A;  1UHH A;  1R2U A;  1MQ1 A;  1YTZ C;  1IQ3 A;  3IQO A;  1ZMZ A;  3BUW B;  2LMV A;  1JFK A;  2MJW B;  3CZT X;  1TOP A;  1CM1 A;  2P6B B;  2WND A;  4GGN A;  5HKY A;  3SG2 A;  1NSH A;  1UHI A;  3JTD B;  2KAV A;  3EKJ A;  1E8A A;  1B9A A;  1EG3 A;  1UWO A;  2COL B;  1KK8 C;  1MXL C;  3CWG A;  3SIA A;  4C0L A;  2OS8 B;  1XFY O;  1IKU A;  1C7V A;  3AKA A;  2I7A A;  5AEQ A;  3DF0 A;  1KQV A;  1B7T Y;  3NSL A;  3GOF A;  2I2R E;  1K96 A;  1XA5 A;  1WLM A;  2F3Z A;  1JF2 A;  1MWN A;  5I2L A;  1CLB A;  1QX5 B;  1AP4 A;  5I2O A;  1CLL A;  1QLK A;  2L0P A;  3CGA A;  4I5J A;  4E68 A;  4U8D A;  4MEW A;  2M0R A;  4PAL A;  1XFW O;  3A4U B;  4WQ3 A;  2JNF A;  1YUS A;  2LP3 A;  1K94 A;  3D10 A;  1YUU A;  1KSM A;  1UUR A;  2DOQ A;  4WQ2 A;  1SL8 A;  1NX0 A;  1QJT A;  1XK4 C;  3VRP A;  2LE9 B;  1VRK A;  4IL1 A;  4TNC A;  4MVF A;  2PRU A;  2FOT A;  1J7P A;  1CMF A;  2TN4 A;  3AAJ A;  2KAX A;  2M29 A;  1CFF A;  4OV2 A;  1FI5 A;  2L4H A;  1QV1 A;  1IRJ A;  1YUT A;  1CTR A;  4JWQ A;  4HRE E;  5GQQ C;  2IS9 A;  3EK7 A;  2ZN8 A;  1J7R A;  1BG1 A;  1QTX A;  3VGO A;  1TNQ A;  2KHN A;  4N5X A;  3TZ1 A;  2LLT A;  4A4C A;  5HLO A;  4MZK A;  1NUB A;  3SG5 A;  1K90 D;  2JT0 A;  1KQM C;  1J1E A;  2M8U A;  4MN0 A;  3FS7 A;  2A4J A;  2BEC A;  2LMT A;  2LMU A;  4P5O E;  4YGE B;  1NCY A;  2PSR A;  1S1E A;  1TCF A;  2GGZ A;  3PAL A;  5PAL A;  1BOD A;  4MZL A;  1WDC B;  1QS7 A;  1SCM B;  2CNP A;  5F6T A;  2LUC A;  2LP2 A;  1TNP A;  1CFD A;  1PSR A;  1KQM B;  1Y1X A;  2JXC A;  2KGR A;  2NCO A;  1SBJ A;  1SK6 D;  1QAT A;  2MHH A;  4GGF A;  1SL9 A;  2WCE A;  1YRU B;  1A4P A;  1NP8 A;  4GPL B;  2R2I A;  2CCM A;  1J7Q A;  3ICB A;  4YRU A;  2PMY A;  1BF5 A;  3WNX B;  4NQG A;  1TTX A;  3SG3 A;  3BYA A;  4CFR A;  2ZNE A;  3M0W A;  1AK8 A;  4ICB A;  1SW8 A;  2ZND A;  5D7F A;  2LAP A;  2KI4 B;  5K89 A;  4BY4 A;  1PRW A;  1S6I A;  4DUQ A;  1J7O A;  1MR8 A;  1PVB A;  1OQP A;  4PE0 A;  4I5N B;  3EVV A;  5HLV A;  2BCB A;  5J3X A;  3SJS A;  2V53 A;  2WCF A;  1MUX A;  1RRO A;  3HCM A;  1B8L A;  3PSR A;  1SYM A;  4OKH A;  1FF1 A;  1QV0 A;  1SRA A;  2FCD A;  4HRH A;  4NDB A;  3DD4 A;  3WXA A;  2KBI A;  1S5G Y;  4BY5 A;  1SKT A;  4YGD B;  3OB2 B;  1A29 A;  1K2H A;  2E6W A;  2HQ8 A;  1DJG A;  2WCB A;  3TUY C;  1Q80 A;  1BMO A;  2K2A A;  3BOW B;  1AJ5 A;  1QX2 A;  4GAO A;  2KYF A;  2BCA A;  4L9M A;  1Y0V H;  2JT3 A;  1M63 B;  2ZRS A;  4QJ4 B;  3LK0 A;  4M2O A;  2L2E A;  2NCP A;  1XVJ A;  1CLM A;  4GUK A;  1F54 A;  4MSP A;  1UP5 A;  1PUL A;  2AMI A;  1GGW A;  2LCP A;  3OX6 A;  2PAS A;  4PCW A;  5KSZ A;  1TCO B;  3JTD C;  1IGV A;  1V1G A;  3TS5 C;  1LA0 A;  3BUX B;  2WOS A;  1FPW A;  1CB1 A;  2OTG C;  1CDN A;  1CFC A;  2NZ0 A;  1CDM A;  2B1U A;  3CR5 X;  1IJ6 A;  1IWQ A;  1FBV A;  2LV7 A;  4ORB B;  4YGA A;  4CPV A;  1QLS A;  1JUO A;  2K7O A;  1DJH A;  1K9U A;  2Y1M A;  1M39 A;  2O60 A;  1JSA A;  3MSE B;  1EL4 A;  1L2O C;  3GK1 A;  1FI6 A;  3EK8 A;  1ZOT B;  2MA2 A;  2M97 A;  1KWO B;  1QIV A;  2O5G A;  1PAL A;  2KFG A;  1GQM A;  3AAK A;  5AER A;  4ETO A;  1NCZ A;  2H2K A;  2LM5 A;  2SCP A;  3DVJ A;  1PSB A;  1XO5 A;  1B47 A;  1MHO A;  2Y4Q A;  4YI8 A;  1EG4 A;  1DF0 B;  1X02 A;  1SL7 A;  2K7B A;  2LNK A;  3OHM B;  3O6B A;  2M7L A;  3TS5 B;  1Y1A A;  4M2P A;  4YGC B;  4GNK B;  3E3R A;  2Q4U A;  1QIW A;  1IH0 A;  2JPT A;  1OSA A;  3JVT B;  2M3W A;  4MBE A;  4F0Z B;  5I2Q A;  2MAZ A;  1JBA A;  1DVI A;  1KK7 Z;  2AUC A;  2LLU A;  1S6C A;  1G8I A;  1C7W A;  1YVL A;  2AAO A;  2E30 A;  2H61 C;  5B8I B;  1IJ5 A;  4FTG A;  1XFV O;  5FYX A;  4WRI A;  3TDZ A;  3I5F C;  4N1G A;  4CFQ A;  4GFT A;  1OMD A;  2F2O A;  1DGU A;  1K95 A;  3SIB A;  1H4B A;  4GBA A;  1K8U A;  2H61 A;  3CR2 A;  3DVE A;  4NDC A;  1QX7 A;  1C07 A;  2BE6 A;  4FQO A;  1PK0 D;  1RTP 1;  1B8C A;  1SR6 C;  1DF0 A;  1EH2 A;  1F4Q A;  2LVV A;  3BUM B;  4PE7 A;  2RGI A;  1DJW A;  2KI6 C;  2ZRT A;  2HQW A;  1IQ5 A;  1GGZ A;  3LK1 A;  1CMG A;  1RWY A;  1DJY A;  1RJV A;  2JNX A;  1XYD A;  5CSF A;  1BR1 B;  1OMR A;  1WY9 A;  3I5F B;  3I5I B;  1LIN A;  4PHK A;  3OB1 B;  3RM1 A;  1DTL A;  2NXQ A;  2M7N A;  3LLE A;  3NSO A;  4QJ5 B;  1QVI Z;  1TRF A;  3EVU A;  3D0Y A;  2K7D A;  2K2F A;  1YX8 A;  1KFX L;  1S3P A;  2BL0 B;  2NLN A;  3CS1 A;  2MBX A;  4DIR A;  4YGB B;  2KQ6 A;  2L51 A;  5TNC A;  1WRK A;  3SG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...