4JD9A

Contact pathway inhibitor from a sand fly
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
122
structure length
118
Chain Sequence
ETPSQKCEEKYKRKACIHHCKYQYYGFIDVNYNIAQPEIRKFSNVLMDYGVVDRSKKRELKKVMHDCAKKIKKEARTGDHWLNCRTSIDYYRCVLTSKLIGPQRFDKAIQDYDKTISV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords 14.5 kDa salivary protein
publication title Novel family of insect salivary inhibitors blocks contact pathway activation by binding to polyphosphate, heparin, and dextran sulfate.
pubmed doi rcsb
source organism Phlebotomus duboscqi
total genus 45
structure length 118
sequence length 122
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2013-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 4jd9A00
2QEOA 1QWVA 3D78A 3L47A 2P71A 3D74A 3S0DA 3L4AA 3CZ1A 2WC6A 1T14A 3S0FA 3NHIA 2QEHA 2WC5A 3FE8A 5EL2A 1ORGA 3Q8IA 3BFBA 2WCHA 3FE6A 3D77A 3R72A 2P70A 4PT1A 1TWOA 3V2LA 3CYZA 2QEVA 1TUJA 3D75A 3PJIA 3R1PA 3N7HA 3BFHA 3S0GA 3FE9A 2H8VA 1OOFA 3VB1A 2WCLA 3B87A 3B86A 4JD9A 4FQTA 2JPOA 3BJHA 3R1OA 1OOGA 2L2CA 3K1EA 4OZDA 3D76A 2WCMA 1C3ZA 3S0EA 3DY9A 5DICA 1OOHA 2QEBA 3OGNA 2WCJA 1OOIX 3DXLA 1OW4A 1LS8A 1DQEA 3NGVA 2GTEA 1P28A 1GM0A 3BFAA 3L4LA 1XFRA 3CABA 2KPHA 3RZSA 3DYEA 3CZ2A 3B7AA 2FJYA 3B6XA 3CDNA 3S0BA 3NHTA 3QMEA 2WCKA 1C3YA 3R1VA 4F7FA 4INWA 3S0AA 2QDIA 3D73A 3CZ0A 4INXA 2PQLA 3B88A 3DZTA 2ERBA
chains in the Genus database with same CATH superfamily
3AAJA 1KQVA 2G9BA 4F0ZB 1F4QA 3L47A 1A2XA 4MRYA 2P71A 1XFWO 1TN4A 2H61C 2K2AA 2M29A 3CR5X 2B1UA 3D74A 1C7VA 1CNPA 1ZOTB 2KAXA 4DS7A 1Y1UA 1XFUO 1T14A 1FI5A 3NSIA 1MQ1A 3IQQA 1WLZA 2M3WA 2SCPA 3I5GC 2I94A 3M0WA 2QEHA 4Q04A 4JQ0D 4P5OE 3F45A 1CDPA 1SK6D 1ZFSA 1SL8A 1TUZA 3C1VA 5AERA 3VRPA 1D1OA 1ODBA 2NCOA 2KAVA 3D77A 4N1GA 1LA3A 1IQ3A 1C7WA 1K8UA 3EVVA 2BCAA 5TNCA 3EK8A 3KO0A 5FI7A 1XK4A 3TZ1A 2Q91A 4QJ3B 3PN7B 2HQ8A 2QEVA 1X02A 1NIWA 4QJ4B 1QX5B 1BLQA 1WRKA 3TUYB 4GFTA 2JRFA 2IS9A 1G8IA 3EKJA 2K8MB 1LA0A 1DJWA 2KAYA 3BOWA 1RROA 3DVEA 3BYAA 3OX6A 1FI6A 2HQWA 1PSRA 1OZSA 4GBAA 1TNQA 4JD9A 1WLMA 3CTNA 3H4SE 3SG3A 1SR6B 2LM5A 1NX1A 1MF8B 1L2OB 1OSAA 2M7LA 2KDHA 3IF7A 1B8RA 4XJKA 1MXLC 2Q4UA 1U5IA 3VGOA 4ZCVA 2L2EA 2KBIA 1TNXA 2ZRTA 3D76A 1ZACA 4YBHB 1QATA 1LXFC 2OTGB 1KK8B 1UHHA 3KHEA 1IRJA 3DY9A 4HREE 3TS5B 1J55A 2KLDA 3BUNB 1MHOA 4PHMA 2KFHA 2KQYA 1KSMA 1PVBA 3EVUA 1QASA 1UWOA 2F33A 4XJKB 2L5YA 1FPWA 2JXCA 2KFGA 1S5GY 2BBNA 2H61A 3KPXA 1TNPA 1QVIY 2ZRSA 1UHIA 1YRTB 2I2RE 3DF0A 3LL8B 1KCYA 2V53A 1EXRA 4MEWA 4YI9A 4AQIA 1BU3A 1OW4A 2LUCA 1LS8A 2KGBC 1KSOA 4YGCB 4C0KA 1DGVA 2L4HA 1GGWA 3SG7A 4DCKA 2CT9A 1XFRA 1Q80A 1SNLA 5G08A 1HT9A 2LMVA 1NX3A 1YX7A 4PDZA 3RZSA 1M63B 2SASA 2LC5A 2PVBA 2KI4C 2ZNEA 2FCEA 3DF0B 1R6PA 1OZOA 1S6IA 3CDNA 3WHUB 1NCZA 3D0YA 5F6TA 4GGFC 1QIVA 2F3ZA 1TRFA 2BNXA 5KSZA 2WORA 1KK7Z 2WCKA 4YGAA 4OVNF 2CXJA 1PK0D 1S26D 3CLNA 2CNPA 5DKQA 1TNWA 5IBWA 2EHBA 1J1EA 1MR8A 2QDIA 4N5XA 4KYNA 5KTYA 2JXLA 1F55A 2ERBA 1W7IB 2QEOA 3AKBA 3LK0A 1N2DA 2BKIB 3D78A 1YVLA 2PMYA 1CKKA 1OOJA 2ZNDA 4AQJA 5HKZA 3TDIA 3OB1B 4CPVA 1SBJA 1SPYA 3NHIA 4IJ7A 3O78A 3RM1A 1LVCD 4PHNA 4ZCUA 1CDLA 2MLFC 4CFRA 3K21A 3Q8IA 4PE7A 1NSHA 1IQ5A 3R72A 5ER5A 2BECA 5I2OA 2P70A 1K96A 1M46A 4JPZB 2O5GA 1JC2A 1XO5A 3V2LA 3WHTB 3BUOB 1TUJA 3D75A 3PJIA 5HYDA 1M39A 3SIBA 1JSAA 3N7HA 1ALVA 2KI6D 4MLWA 1K2HA 1JF2A 2L5XB 5D3OA 1CFPA 3BFHA 2WCEA 1YVHA 3D10A 2JWWA 2LMTA 1AHRA 1J1DA 1OMRA 2Y1MA 4MZLA 5I2LA 4XYNA 1OOFA 1G33A 1HQVA 1S1EA 1SKTA 4GPLB 4MN0A 1MUXA 1S6JA 2LHLA 1J7OA 3I5IC 1PULA 2MRDA 5J3XA 2LCPA 2KFFA 1NX2A 4BY4A 1BOCA 1WDCC 1YUSA 2NLNA 1B9AA 3BJHA 3KEVA 3BUXB 4CIDA 4GGFA 1OOGA 5AFPA 5I2QA 3K1EA 2NZ0A 2KYFA 4JKTA 1AJ4A 1DJIA 2BE4A 2LNKA 5FI2A 1A75A 4I5JA 4YGBB 3A4UB 3S0EA 4HRHA 2Y4QA 5DICA 3GK1A 3IQOA 3LK1A 1AJ5A 5JJGA 4GGNA 1BR1B 4CFQA 4M2PA 4QJ5B 1OMDA 1OOHA 3PALA 1FF1A 3OGNA 1Z4HA 1CMGA 1SW8A 1NYAA 1K93D 2F8PA 2WCJA 1YX8A 3HCMA 3WNXB 1OOIX 1GQMA 3JVTC 4FTGA 3OP0A 2MHHA 2WC8A 1W9ZA 1H8BA 1NX0A 1A75B 4BY5A 1XFXO 2KI6C 4OV2A 1DQEA 1S36A 2K2FA 4MRXA 2L98A 3BQ3A 3CGAA 3NGVA 3OHMB 2M9GA 4DRWA 3BXKA 3SIAA 3FWCA 2ZFDA 1DMOA 3I5FC 2VRGA 3BOWB 3PM2A 4PCWA 3PATA 2K7BA 1MXEA 2JNXA 2LVJA 1TTXA 1BT6A 1A4PA 2EC6C 3PM8A 3B6XA 1CB1A 3S0BA 2M1UA 3QMEA 2KHNA 1IJ5A 1U5IB 1NCYA 5AEQA 2GGMA 1C3YA 2E6WA 4TNCA 3TDUA 1BODA 1CDMA 2WCBA 3UNWA 1DELA 2K0JA 2DOQA 3FIAA 2NCPA 1QS7A 1N65A 2MJWB 1SCMC 1Y1AA 2I18A 2M97A 4PE4A 5I8NA 1QWVA 4C0LA 3EG5B 5HLVA 1A29A 3S0DA 3L4AA 1K9PA 1W7JB 2HF5A 2WC6A 4USLA 3S0FA 4PHKA 1DTLA 2KOTA 1DEKA 1RFJA 1SYMA 2WC5A 3PSRA 4AOMA 2QACA 3I5GB 2LVVA 2JULA 2M1KB 2JT0A 3BFBA 3I5IB 2KBMA 1QLKA 2WCHA 1UP5A 1GGZA 2M7NA 1YUTA 1WDCB 4N1FA 4PT1A 1WRLA 3WXAA 1Z2CB 1RECA 1UHNA 2KLEA 3CWGA 3SG6A 1J7RA 3AKAA 1VRKA 4ORBB 1JF0A 3R1PA 2L51A 5BPJA 2I7AA 3O2PA 1KQMC 1XA5A 1BF5A 4MBEA 2BAPA 3D0YB 3BUMB 3PLFB 3DVMA 4PHJA 3GK4X 1DJXA 1IKUA 3FE9A 3CR4X 2YGUA 3TDZA 3VROA 1EH2A 2H8VA 5HL1A 5KU1A 3VB1A 2WCLA 1CFDA 3QRXA 1SR6C 3B86A 3O4YA 2PSRA 3DVJA 2LANA 3JVTB 4FQTA 1TIZA 2MBXA 1JFJA 2JPOA 4ORAB 2D8NA 1JWDA 1BJFA 2L50A 5DKNA 1V1GA 3R1OA 4GAOA 1C07A 5DKRA 2JTZA 4FQOA 1B47A 2JU0A 1IWQA 4ORCB 3VRNA 4OZDA 2K60A 1DF0A 2K7DA 2OTGC 5HKYA 3EVRA 1OMVA 1C3ZA 2K7CA 2KQ6A 1GM0A 1K95A 1S6CA 2FJUB 1EL4A 1ALWA 1CFCA 1M31A 1OE9B 1SSEB 4IL1A 4NDBA 1Y0VH 2P6BB 5CSIA 1QLSA 1TCFA 1YTZC 4A4BA 1WRZA 2JC2A 2EC6B 1BR4B 1EG4A 1IGVA 3PFVA 1QJTA 2LP2A 3JTDC 3EK7A 3DXLA 2WCFA 1IG5A 2EGDA 4DIRA 1DF0B 4DUQA 1E8AA 1V1FA 3O6BA 3CZTX 1LKJA 4YGEB 4WRIA 2LLUA 5HLOA 2BL0C 1CM1A 2GTEA 1P28A 3OBVA 1S5GZ 4PE1A 1CMFA 1YUUA 2OPOA 1AUIB 2G2BA 4JWQA 2HETA 3KF9A 3CABA 1SCMB 2WOSA 3ICBA 1J7PA 1XYDA 1QV0A 2FCDA 2PRUA 2TN4A 3MSEB 1KK7Y 2LVIA 2LV7A 1F70A 1SY9A 3I5HC 4OCIA 3EKHA 4I5KA 3B7AA 4R1EA 2KI4B 5GQQC 3ZWHA 4YRUA 1ZMZA 1KWOC 1B7TZ 5AXIA 2KGRA 3NHTA 1M45A 3IVTA 2FOTA 2KNEA 4NQGA 2F2PA 4OR9B 1QV1A 1AP4A 1CDNA 2GV5A 4HSZA 5ER4X 5AANA 3R1VA 4NDCA 4F7FA 5CSJA 3S0AA 3D73A 2Y5IA 3CZ0A 4INXA 1TCOB 2M0RA 4GNKB 1DVIA 1SMGA 2PQLA 4OKHA 2A4JA 2M49B 2BBMA 3LLEA 4A4CA 1IJ6A 1KQMB 1YR5A 5CPVA 4U8DA 1AK8A 1DJZA 3ZNIA 1PRWA 3HX4A 1CLBA 3CZ1A 2WNDA 3RLZA 2JPTA 1DJHA 1BMOA 1KFUL 1R2UA 4C0JA 3SG2A 3FE8A 1PSBA 5B8IB 5EL2A 1CM4A 1YURA 1ORGA 2BKHB 1CFFA 2LHIA 3FE6A 2R2IA 1EJ3A 4MVFA 1NCXA 4M2OA 2OS8C 3SJSA 1QIWA 3FS7A 2GGZA 1DJGA 1TWOA 4PALA 4ETOA 1IH0A 1IIOA 1L7ZA 3NSKA 2NXQA 3NXAA 4E68A 3CYZA 2BCXA 4CLNA 4MZJA 2ZN8A 3SS3A 3A8RA 2KYCA 1G4YR 1SL7A 2JT8A 1S3PA 2LVKA 5K89A 3E3RA 1BG1A 4M2QA 1F71A 2LLSA 3NSLA 1XFZO 3S0GA 1K9UA 3DD4A 3B88A 2JNFA 4ICBA 2COLB 3FWBA 2ZKMX 4WQ3A 1FW4A 4L9MA 1XFYO 2LAPA 3B87A 3JTDB 3SS5A 2F3YA 3UO9A 3VRQA 1CTRA 5CSFA 2KSPA 4HRGA 1NPQA 3GOFA 1A03A 2MLEC 1QTXA 2K61A 1DT7B 2AAOA 1RJVA 2L2CA 1YRUB 2BL0B 3CR2A 1B7TY 3PN7C 1NUBA 2CBLA 1KFXS 2WCMA 1JUOA 2Y1NA 4YGDB 2AMIA 3TUYC 2ISDA 2JTTA 3BUWB 4P2YB 1QXPA 4PE0A 5FI6A 4NDDA 2QPTA 3I5HB 5FYXA 1UHKA 1EG3A 5CSNA 5HKWA 1AVSA 1LINA 1RK9A 2L0PA 2QEBA 4D1EA 1H4BA 1KWOB 4YI8A 1XVJA 1K9KA 3AAKA 1GJYA 1XK4C 2LP3A 3NSOA 1Y1XA 5PALA 1QX7A 1L2OC 1JBAA 2LUXA 1K90D 2HPSA 3CS1A 1UUSA 1B8LA 2PALA 1PALA 1UURA 3DVKA 1NWDA 2LMUA 2M8UA 5D7FA 1DGUA 3O4XA 4GUKA 1B1GA 2PASA 3SG5A 1SRAA 1XFVO 2JZIA 3BFAA 3L4LA 1KK8C 2RGIA 5I94A 5D69A 5JOLA 4I5NB 1CLMA 2LLTA 3LCPC 2L4IA 4MZKA 3TS5C 1QX2A 2JT3A 2KPHA 3DYEA 3EK4A 1JFKA 2MA2A 3CZ2A 3SG4A 3VRRA 3I5FB 1N0YA 2MAZA 1F4OA 1MWNA 2PYQA 3SS4A 2O60A 2FJYA 1J7QA 1ZUZA 1CLLA 1UHJA 1WY9A 1TOPA 2BE6A 4WQ2A 1F54A 1OQPA 1FBVA 2JOJA 2K7OA 2LE9B 1B8CA 1KFUS 4I5LB 2CTNA 3OB2B 1PVAA 1B4CA 2AUCA 1SCVA 2CCMA 3OX5A 1RWYA 1SL9A 2OS8B 1Y6WA 4UPGA 1KFXL 2H2KA 1K94A 1NP8A 2ZN9A 3GK2A 4INWA 1RTP1 1DC1A 1F8HA 1DJYA 2E30A 2F2OA 2JQ6A 2BCBA 1QVIZ 3DZTA 4MSPA
chains in the Genus database with same CATH topology
2QEOA 1QWVA 3D78A 3L47A 2P71A 3D74A 3S0DA 3L4AA 3CZ1A 2WC6A 1T14A 3S0FA 3NHIA 2QEHA 2WC5A 3FE8A 5EL2A 1ORGA 3Q8IA 3BFBA 2WCHA 3FE6A 3D77A 3R72A 2P70A 4PT1A 1TWOA 3V2LA 3CYZA 2QEVA 1TUJA 3D75A 3PJIA 3R1PA 3N7HA 3BFHA 3S0GA 3FE9A 2H8VA 1OOFA 3VB1A 2WCLA 3B87A 3B86A 4JD9A 4FQTA 2JPOA 3BJHA 3R1OA 1OOGA 2L2CA 3K1EA 4OZDA 3D76A 2WCMA 1C3ZA 3S0EA 3DY9A 5DICA 1OOHA 2QEBA 3OGNA 2WCJA 1OOIX 3DXLA 1OW4A 1LS8A 1DQEA 3NGVA 2GTEA 1P28A 1GM0A 3BFAA 3L4LA 1XFRA 3CABA 2KPHA 3RZSA 3DYEA 3CZ2A 3B7AA 2FJYA 3B6XA 3CDNA 3S0BA 3NHTA 3QMEA 2WCKA 1C3YA 3R1VA 4F7FA 4INWA 3S0AA 2QDIA 3D73A 3CZ0A 4INXA 2PQLA 3B88A 3DZTA 2ERBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEO A;  1QWV A;  3D78 A;  3L47 A;  2P71 A;  3D74 A;  3S0D A;  3L4A A;  3CZ1 A;  2WC6 A;  1T14 A;  3S0F A;  3NHI A;  2QEH A;  2WC5 A;  3FE8 A;  5EL2 A;  1ORG A;  3Q8I A;  3BFB A;  2WCH A;  3FE6 A;  3D77 A;  3R72 A;  2P70 A;  4PT1 A;  1TWO A;  3V2L A;  3CYZ A;  2QEV A;  1TUJ A;  3D75 A;  3PJI A;  3R1P A;  3N7H A;  3BFH A;  3S0G A;  3FE9 A;  2H8V A;  1OOF A;  3VB1 A;  2WCL A;  3B87 A;  3B86 A;  4JD9 A;  4FQT A;  2JPO A;  3BJH A;  3R1O A;  1OOG A;  2L2C A;  3K1E A;  4OZD A;  3D76 A;  2WCM A;  1C3Z A;  3S0E A;  3DY9 A;  5DIC A;  1OOH A;  2QEB A;  3OGN A;  2WCJ A;  1OOI X;  3DXL A;  1OW4 A;  1LS8 A;  1DQE A;  3NGV A;  2GTE A;  1P28 A;  1GM0 A;  3BFA A;  3L4L A;  1XFR A;  3CAB A;  2KPH A;  3RZS A;  3DYE A;  3CZ2 A;  3B7A A;  2FJY A;  3B6X A;  3CDN A;  3S0B A;  3NHT A;  3QME A;  2WCK A;  1C3Y A;  3R1V A;  4F7F A;  4INW A;  3S0A A;  2QDI A;  3D73 A;  3CZ0 A;  4INX A;  2PQL A;  3B88 A;  3DZT A;  2ERB A; 
#chains in the Genus database with same CATH topology
 3AAJ A;  1KQV A;  2G9B A;  4F0Z B;  1F4Q A;  3L47 A;  1A2X A;  4MRY A;  2P71 A;  1XFW O;  1TN4 A;  2H61 C;  2K2A A;  2M29 A;  3CR5 X;  2B1U A;  3D74 A;  1C7V A;  1CNP A;  1ZOT B;  2KAX A;  4DS7 A;  1Y1U A;  1XFU O;  1T14 A;  1FI5 A;  3NSI A;  1MQ1 A;  3IQQ A;  1WLZ A;  2M3W A;  2SCP A;  3I5G C;  2I94 A;  3M0W A;  2QEH A;  4Q04 A;  4JQ0 D;  4P5O E;  3F45 A;  1CDP A;  1SK6 D;  1ZFS A;  1SL8 A;  1TUZ A;  3C1V A;  5AER A;  3VRP A;  1D1O A;  1ODB A;  2NCO A;  2KAV A;  3D77 A;  4N1G A;  1LA3 A;  1IQ3 A;  1C7W A;  1K8U A;  3EVV A;  2BCA A;  5TNC A;  3EK8 A;  3KO0 A;  5FI7 A;  1XK4 A;  3TZ1 A;  2Q91 A;  4QJ3 B;  3PN7 B;  2HQ8 A;  2QEV A;  1X02 A;  1NIW A;  4QJ4 B;  1QX5 B;  1BLQ A;  1WRK A;  3TUY B;  4GFT A;  2JRF A;  2IS9 A;  1G8I A;  3EKJ A;  2K8M B;  1LA0 A;  1DJW A;  2KAY A;  3BOW A;  1RRO A;  3DVE A;  3BYA A;  3OX6 A;  1FI6 A;  2HQW A;  1PSR A;  1OZS A;  4GBA A;  1TNQ A;  4JD9 A;  1WLM A;  3CTN A;  3H4S E;  3SG3 A;  1SR6 B;  2LM5 A;  1NX1 A;  1MF8 B;  1L2O B;  1OSA A;  2M7L A;  2KDH A;  3IF7 A;  1B8R A;  4XJK A;  1MXL C;  2Q4U A;  1U5I A;  3VGO A;  4ZCV A;  2L2E A;  2KBI A;  1TNX A;  2ZRT A;  3D76 A;  1ZAC A;  4YBH B;  1QAT A;  1LXF C;  2OTG B;  1KK8 B;  1UHH A;  3KHE A;  1IRJ A;  3DY9 A;  4HRE E;  3TS5 B;  1J55 A;  2KLD A;  3BUN B;  1MHO A;  4PHM A;  2KFH A;  2KQY A;  1KSM A;  1PVB A;  3EVU A;  1QAS A;  1UWO A;  2F33 A;  4XJK B;  2L5Y A;  1FPW A;  2JXC A;  2KFG A;  1S5G Y;  2BBN A;  2H61 A;  3KPX A;  1TNP A;  1QVI Y;  2ZRS A;  1UHI A;  1YRT B;  2I2R E;  3DF0 A;  3LL8 B;  1KCY A;  2V53 A;  1EXR A;  4MEW A;  4YI9 A;  4AQI A;  1BU3 A;  1OW4 A;  2LUC A;  1LS8 A;  2KGB C;  1KSO A;  4YGC B;  4C0K A;  1DGV A;  2L4H A;  1GGW A;  3SG7 A;  4DCK A;  2CT9 A;  1XFR A;  1Q80 A;  1SNL A;  5G08 A;  1HT9 A;  2LMV A;  1NX3 A;  1YX7 A;  4PDZ A;  3RZS A;  1M63 B;  2SAS A;  2LC5 A;  2PVB A;  2KI4 C;  2ZNE A;  2FCE A;  3DF0 B;  1R6P A;  1OZO A;  1S6I A;  3CDN A;  3WHU B;  1NCZ A;  3D0Y A;  5F6T A;  4GGF C;  1QIV A;  2F3Z A;  1TRF A;  2BNX A;  5KSZ A;  2WOR A;  1KK7 Z;  2WCK A;  4YGA A;  4OVN F;  2CXJ A;  1PK0 D;  1S26 D;  3CLN A;  2CNP A;  5DKQ A;  1TNW A;  5IBW A;  2EHB A;  1J1E A;  1MR8 A;  2QDI A;  4N5X A;  4KYN A;  5KTY A;  2JXL A;  1F55 A;  2ERB A;  1W7I B;  2QEO A;  3AKB A;  3LK0 A;  1N2D A;  2BKI B;  3D78 A;  1YVL A;  2PMY A;  1CKK A;  1OOJ A;  2ZND A;  4AQJ A;  5HKZ A;  3TDI A;  3OB1 B;  4CPV A;  1SBJ A;  1SPY A;  3NHI A;  4IJ7 A;  3O78 A;  3RM1 A;  1LVC D;  4PHN A;  4ZCU A;  1CDL A;  2MLF C;  4CFR A;  3K21 A;  3Q8I A;  4PE7 A;  1NSH A;  1IQ5 A;  3R72 A;  5ER5 A;  2BEC A;  5I2O A;  2P70 A;  1K96 A;  1M46 A;  4JPZ B;  2O5G A;  1JC2 A;  1XO5 A;  3V2L A;  3WHT B;  3BUO B;  1TUJ A;  3D75 A;  3PJI A;  5HYD A;  1M39 A;  3SIB A;  1JSA A;  3N7H A;  1ALV A;  2KI6 D;  4MLW A;  1K2H A;  1JF2 A;  2L5X B;  5D3O A;  1CFP A;  3BFH A;  2WCE A;  1YVH A;  3D10 A;  2JWW A;  2LMT A;  1AHR A;  1J1D A;  1OMR A;  2Y1M A;  4MZL A;  5I2L A;  4XYN A;  1OOF A;  1G33 A;  1HQV A;  1S1E A;  1SKT A;  4GPL B;  4MN0 A;  1MUX A;  1S6J A;  2LHL A;  1J7O A;  3I5I C;  1PUL A;  2MRD A;  5J3X A;  2LCP A;  2KFF A;  1NX2 A;  4BY4 A;  1BOC A;  1WDC C;  1YUS A;  2NLN A;  1B9A A;  3BJH A;  3KEV A;  3BUX B;  4CID A;  4GGF A;  1OOG A;  5AFP A;  5I2Q A;  3K1E A;  2NZ0 A;  2KYF A;  4JKT A;  1AJ4 A;  1DJI A;  2BE4 A;  2LNK A;  5FI2 A;  1A75 A;  4I5J A;  4YGB B;  3A4U B;  3S0E A;  4HRH A;  2Y4Q A;  5DIC A;  3GK1 A;  3IQO A;  3LK1 A;  1AJ5 A;  5JJG A;  4GGN A;  1BR1 B;  4CFQ A;  4M2P A;  4QJ5 B;  1OMD A;  1OOH A;  3PAL A;  1FF1 A;  3OGN A;  1Z4H A;  1CMG A;  1SW8 A;  1NYA A;  1K93 D;  2F8P A;  2WCJ A;  1YX8 A;  3HCM A;  3WNX B;  1OOI X;  1GQM A;  3JVT C;  4FTG A;  3OP0 A;  2MHH A;  2WC8 A;  1W9Z A;  1H8B A;  1NX0 A;  1A75 B;  4BY5 A;  1XFX O;  2KI6 C;  4OV2 A;  1DQE A;  1S36 A;  2K2F A;  4MRX A;  2L98 A;  3BQ3 A;  3CGA A;  3NGV A;  3OHM B;  2M9G A;  4DRW A;  3BXK A;  3SIA A;  3FWC A;  2ZFD A;  1DMO A;  3I5F C;  2VRG A;  3BOW B;  3PM2 A;  4PCW A;  3PAT A;  2K7B A;  1MXE A;  2JNX A;  2LVJ A;  1TTX A;  1BT6 A;  1A4P A;  2EC6 C;  3PM8 A;  3B6X A;  1CB1 A;  3S0B A;  2M1U A;  3QME A;  2KHN A;  1IJ5 A;  1U5I B;  1NCY A;  5AEQ A;  2GGM A;  1C3Y A;  2E6W A;  4TNC A;  3TDU A;  1BOD A;  1CDM A;  2WCB A;  3UNW A;  1DEL A;  2K0J A;  2DOQ A;  3FIA A;  2NCP A;  1QS7 A;  1N65 A;  2MJW B;  1SCM C;  1Y1A A;  2I18 A;  2M97 A;  4PE4 A;  5I8N A;  1QWV A;  4C0L A;  3EG5 B;  5HLV A;  1A29 A;  3S0D A;  3L4A A;  1K9P A;  1W7J B;  2HF5 A;  2WC6 A;  4USL A;  3S0F A;  4PHK A;  1DTL A;  2KOT A;  1DEK A;  1RFJ A;  1SYM A;  2WC5 A;  3PSR A;  4AOM A;  2QAC A;  3I5G B;  2LVV A;  2JUL A;  2M1K B;  2JT0 A;  3BFB A;  3I5I B;  2KBM A;  1QLK A;  2WCH A;  1UP5 A;  1GGZ A;  2M7N A;  1YUT A;  1WDC B;  4N1F A;  4PT1 A;  1WRL A;  3WXA A;  1Z2C B;  1REC A;  1UHN A;  2KLE A;  3CWG A;  3SG6 A;  1J7R A;  3AKA A;  1VRK A;  4ORB B;  1JF0 A;  3R1P A;  2L51 A;  5BPJ A;  2I7A A;  3O2P A;  1KQM C;  1XA5 A;  1BF5 A;  4MBE A;  2BAP A;  3D0Y B;  3BUM B;  3PLF B;  3DVM A;  4PHJ A;  3GK4 X;  1DJX A;  1IKU A;  3FE9 A;  3CR4 X;  2YGU A;  3TDZ A;  3VRO A;  1EH2 A;  2H8V A;  5HL1 A;  5KU1 A;  3VB1 A;  2WCL A;  1CFD A;  3QRX A;  1SR6 C;  3B86 A;  3O4Y A;  2PSR A;  3DVJ A;  2LAN A;  3JVT B;  4FQT A;  1TIZ A;  2MBX A;  1JFJ A;  2JPO A;  4ORA B;  2D8N A;  1JWD A;  1BJF A;  2L50 A;  5DKN A;  1V1G A;  3R1O A;  4GAO A;  1C07 A;  5DKR A;  2JTZ A;  4FQO A;  1B47 A;  2JU0 A;  1IWQ A;  4ORC B;  3VRN A;  4OZD A;  2K60 A;  1DF0 A;  2K7D A;  2OTG C;  5HKY A;  3EVR A;  1OMV A;  1C3Z A;  2K7C A;  2KQ6 A;  1GM0 A;  1K95 A;  1S6C A;  2FJU B;  1EL4 A;  1ALW A;  1CFC A;  1M31 A;  1OE9 B;  1SSE B;  4IL1 A;  4NDB A;  1Y0V H;  2P6B B;  5CSI A;  1QLS A;  1TCF A;  1YTZ C;  4A4B A;  1WRZ A;  2JC2 A;  2EC6 B;  1BR4 B;  1EG4 A;  1IGV A;  3PFV A;  1QJT A;  2LP2 A;  3JTD C;  3EK7 A;  3DXL A;  2WCF A;  1IG5 A;  2EGD A;  4DIR A;  1DF0 B;  4DUQ A;  1E8A A;  1V1F A;  3O6B A;  3CZT X;  1LKJ A;  4YGE B;  4WRI A;  2LLU A;  5HLO A;  2BL0 C;  1CM1 A;  2GTE A;  1P28 A;  3OBV A;  1S5G Z;  4PE1 A;  1CMF A;  1YUU A;  2OPO A;  1AUI B;  2G2B A;  4JWQ A;  2HET A;  3KF9 A;  3CAB A;  1SCM B;  2WOS A;  3ICB A;  1J7P A;  1XYD A;  1QV0 A;  2FCD A;  2PRU A;  2TN4 A;  3MSE B;  1KK7 Y;  2LVI A;  2LV7 A;  1F70 A;  1SY9 A;  3I5H C;  4OCI A;  3EKH A;  4I5K A;  3B7A A;  4R1E A;  2KI4 B;  5GQQ C;  3ZWH A;  4YRU A;  1ZMZ A;  1KWO C;  1B7T Z;  5AXI A;  2KGR A;  3NHT A;  1M45 A;  3IVT A;  2FOT A;  2KNE A;  4NQG A;  2F2P A;  4OR9 B;  1QV1 A;  1AP4 A;  1CDN A;  2GV5 A;  4HSZ A;  5ER4 X;  5AAN A;  3R1V A;  4NDC A;  4F7F A;  5CSJ A;  3S0A A;  3D73 A;  2Y5I A;  3CZ0 A;  4INX A;  1TCO B;  2M0R A;  4GNK B;  1DVI A;  1SMG A;  2PQL A;  4OKH A;  2A4J A;  2M49 B;  2BBM A;  3LLE A;  4A4C A;  1IJ6 A;  1KQM B;  1YR5 A;  5CPV A;  4U8D A;  1AK8 A;  1DJZ A;  3ZNI A;  1PRW A;  3HX4 A;  1CLB A;  3CZ1 A;  2WND A;  3RLZ A;  2JPT A;  1DJH A;  1BMO A;  1KFU L;  1R2U A;  4C0J A;  3SG2 A;  3FE8 A;  1PSB A;  5B8I B;  5EL2 A;  1CM4 A;  1YUR A;  1ORG A;  2BKH B;  1CFF A;  2LHI A;  3FE6 A;  2R2I A;  1EJ3 A;  4MVF A;  1NCX A;  4M2O A;  2OS8 C;  3SJS A;  1QIW A;  3FS7 A;  2GGZ A;  1DJG A;  1TWO A;  4PAL A;  4ETO A;  1IH0 A;  1IIO A;  1L7Z A;  3NSK A;  2NXQ A;  3NXA A;  4E68 A;  3CYZ A;  2BCX A;  4CLN A;  4MZJ A;  2ZN8 A;  3SS3 A;  3A8R A;  2KYC A;  1G4Y R;  1SL7 A;  2JT8 A;  1S3P A;  2LVK A;  5K89 A;  3E3R A;  1BG1 A;  4M2Q A;  1F71 A;  2LLS A;  3NSL A;  1XFZ O;  3S0G A;  1K9U A;  3DD4 A;  3B88 A;  2JNF A;  4ICB A;  2COL B;  3FWB A;  2ZKM X;  4WQ3 A;  1FW4 A;  4L9M A;  1XFY O;  2LAP A;  3B87 A;  3JTD B;  3SS5 A;  2F3Y A;  3UO9 A;  3VRQ A;  1CTR A;  5CSF A;  2KSP A;  4HRG A;  1NPQ A;  3GOF A;  1A03 A;  2MLE C;  1QTX A;  2K61 A;  1DT7 B;  2AAO A;  1RJV A;  2L2C A;  1YRU B;  2BL0 B;  3CR2 A;  1B7T Y;  3PN7 C;  1NUB A;  2CBL A;  1KFX S;  2WCM A;  1JUO A;  2Y1N A;  4YGD B;  2AMI A;  3TUY C;  2ISD A;  2JTT A;  3BUW B;  4P2Y B;  1QXP A;  4PE0 A;  5FI6 A;  4NDD A;  2QPT A;  3I5H B;  5FYX A;  1UHK A;  1EG3 A;  5CSN A;  5HKW A;  1AVS A;  1LIN A;  1RK9 A;  2L0P A;  2QEB A;  4D1E A;  1H4B A;  1KWO B;  4YI8 A;  1XVJ A;  1K9K A;  3AAK A;  1GJY A;  1XK4 C;  2LP3 A;  3NSO A;  1Y1X A;  5PAL A;  1QX7 A;  1L2O C;  1JBA A;  2LUX A;  1K90 D;  2HPS A;  3CS1 A;  1UUS A;  1B8L A;  2PAL A;  1PAL A;  1UUR A;  3DVK A;  1NWD A;  2LMU A;  2M8U A;  5D7F A;  1DGU A;  3O4X A;  4GUK A;  1B1G A;  2PAS A;  3SG5 A;  1SRA A;  1XFV O;  2JZI A;  3BFA A;  3L4L A;  1KK8 C;  2RGI A;  5I94 A;  5D69 A;  5JOL A;  4I5N B;  1CLM A;  2LLT A;  3LCP C;  2L4I A;  4MZK A;  3TS5 C;  1QX2 A;  2JT3 A;  2KPH A;  3DYE A;  3EK4 A;  1JFK A;  2MA2 A;  3CZ2 A;  3SG4 A;  3VRR A;  3I5F B;  1N0Y A;  2MAZ A;  1F4O A;  1MWN A;  2PYQ A;  3SS4 A;  2O60 A;  2FJY A;  1J7Q A;  1ZUZ A;  1CLL A;  1UHJ A;  1WY9 A;  1TOP A;  2BE6 A;  4WQ2 A;  1F54 A;  1OQP A;  1FBV A;  2JOJ A;  2K7O A;  2LE9 B;  1B8C A;  1KFU S;  4I5L B;  2CTN A;  3OB2 B;  1PVA A;  1B4C A;  2AUC A;  1SCV A;  2CCM A;  3OX5 A;  1RWY A;  1SL9 A;  2OS8 B;  1Y6W A;  4UPG A;  1KFX L;  2H2K A;  1K94 A;  1NP8 A;  2ZN9 A;  3GK2 A;  4INW A;  1RTP 1;  1DC1 A;  1F8H A;  1DJY A;  2E30 A;  2F2O A;  2JQ6 A;  2BCB A;  1QVI Z;  3DZT A;  4MSP A; 
#chains in the Genus database with same CATH homology
 2QEO A;  1QWV A;  3D78 A;  3L47 A;  2P71 A;  3D74 A;  3S0D A;  3L4A A;  3CZ1 A;  2WC6 A;  1T14 A;  3S0F A;  3NHI A;  2QEH A;  2WC5 A;  3FE8 A;  5EL2 A;  1ORG A;  3Q8I A;  3BFB A;  2WCH A;  3FE6 A;  3D77 A;  3R72 A;  2P70 A;  4PT1 A;  1TWO A;  3V2L A;  3CYZ A;  2QEV A;  1TUJ A;  3D75 A;  3PJI A;  3R1P A;  3N7H A;  3BFH A;  3S0G A;  3FE9 A;  2H8V A;  1OOF A;  3VB1 A;  2WCL A;  3B87 A;  3B86 A;  4JD9 A;  4FQT A;  2JPO A;  3BJH A;  3R1O A;  1OOG A;  2L2C A;  3K1E A;  4OZD A;  3D76 A;  2WCM A;  1C3Z A;  3S0E A;  3DY9 A;  5DIC A;  1OOH A;  2QEB A;  3OGN A;  2WCJ A;  1OOI X;  3DXL A;  1OW4 A;  1LS8 A;  1DQE A;  3NGV A;  2GTE A;  1P28 A;  1GM0 A;  3BFA A;  3L4L A;  1XFR A;  3CAB A;  2KPH A;  3RZS A;  3DYE A;  3CZ2 A;  3B7A A;  2FJY A;  3B6X A;  3CDN A;  3S0B A;  3NHT A;  3QME A;  2WCK A;  1C3Y A;  3R1V A;  4F7F A;  4INW A;  3S0A A;  2QDI A;  3D73 A;  3CZ0 A;  4INX A;  2PQL A;  3B88 A;  3DZT A;  2ERB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...