2QEBA

Crystal structure of anopheles gambiae d7r4-histamine complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
145
structure length
145
Chain Sequence
METVQDCENKLPPSLKSRLCEIRRYEIIEGPEMDKHIHCVMRALDFVYEDGRGDYHKLYDPLNIIELDKRHDVNLEKCIGECVQVPTSERAHVFYKCLLKSTTGRTFKKVFDLMELKKAGKVPQHQRYTAEFVQIMKDYDKALNC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D7R4 Protein
publication title The Crystal Structure of D7r4, a Salivary Biogenic Amine-binding Protein from the Malaria Mosquito Anopheles gambiae
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Ligand binding protein
total genus 58
structure length 145
sequence length 145
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2qebA00
3K1EA 2QDIA 1C3YA 3S0GA 1OOGA 3CDNA 5EL2A 3L4AA 3VB1A 3BFHA 3OGNA 1OW4A 2H8VA 3Q8IA 3DY9A 4INWA 3D78A 2WCLA 3S0BA 3D76A 3V2LA 3BFAA 2ERBA 3B86A 1XFRA 3B88A 3FE8A 2WC5A 1T14A 2QEVA 3S0AA 2GTEA 4OZDA 1LS8A 3D77A 3B7AA 3L4LA 3BFBA 3R1OA 3S0FA 1OOHA 2P70A 3S0DA 3CZ2A 2QEBA 3R1VA 2QEHA 1TUJA 2WCMA 1ORGA 4INXA 2P71A 1OOIX 3D73A 3CYZA 5DICA 3BJHA 2WCKA 3DXLA 3CZ0A 3B6XA 3DYEA 3S0EA 2L2CA 3D74A 1QWVA 1TWOA 3NGVA 3NHTA 1DQEA 1GM0A 3B87A 1C3ZA 4JD9A 2PQLA 4PT1A 4FQTA 2JPOA 3D75A 2WCJA 4F7FA 1P28A 3DZTA 2KPHA 3L47A 1OOFA 3PJIA 3NHIA 3R1PA 3QMEA 3R72A 3RZSA 3FE9A 2QEOA 3FE6A 3CABA 3N7HA 3CZ1A 2FJYA 2WC6A 2WCHA
chains in the Genus database with same CATH superfamily
1KCYA 2K2FA 2K60A 3I5GC 1K94A 1CFFA 3CWGA 2KFGA 2F3YA 1B8RA 4YGAA 1EG4A 1JUOA 1YURA 1IGVA 1CLLA 1JF2A 1NIWA 2Y1MA 3TDUA 1XFUO 4QJ4B 1KQMB 1NX1A 1XFWO 2E6WA 3CLNA 3L4AA 1SL8A 4PE1A 2LP2A 5HKZA 1C7WA 3VB1A 3OGNA 4NQGA 2KDHA 2JNFA 1TOPA 1MWNA 1Z4HA 3F45A 3DF0A 3Q8IA 4MZLA 3PM2A 1KFXL 2BE6A 1EG3A 4MRYA 4P2YB 1TNPA 3D78A 3I5FB 4UPGA 1MXLC 3BUMB 2E30A 3GK1A 2LLSA 2WCFA 4OR9B 1DJGA 4DCKA 3NXAA 3AAKA 1B8LA 3SG5A 2Q91A 3ZWHA 3B86A 2KI4C 2LUXA 3AAJA 3CTNA 5DKQA 4CPVA 1CM4A 2LVKA 3TDIA 2PVBA 5FYXA 2KQ6A 4HRHA 5FI6A 3S0AA 1KFUS 1M46A 5D69A 2V53A 4AQJA 1TNXA 4OZDA 2WCEA 1AJ4A 2LV7A 3B7AA 3D0YB 4ZCVA 1JFKA 1YUTA 2WNDA 3BFBA 4WQ3A 4ZCUA 2KLEA 2SCPA 3DVMA 1OOHA 3GK2A 4N5XA 1PVBA 1H8BA 3OB1B 4AQIA 4D1EA 2BECA 1ZUZA 1J7QA 2KFHA 4N1FA 1G33A 2F2OA 1MHOA 1A29A 1W7JB 1XFXO 1AP4A 3VGOA 1ORGA 2HQWA 1BU3A 2JNXA 1JWDA 1U5IB 2L5YA 2NCPA 3SG4A 1OMDA 2JTTA 2K8MB 2M1KB 2MAZA 1M39A 3CYZA 1UHJA 3LL8B 1XYDA 2WCKA 3DXLA 3CZ0A 2JXLA 1CFPA 2ZN8A 1OSAA 3DYEA 5CSFA 1SY9A 1CDMA 4JQ0D 3MSEB 2L2CA 3RLZA 3D74A 4P5OE 1GJYA 1QWVA 3NGVA 1CDNA 3NHTA 2ZN9A 2FCDA 1S5GY 2L4HA 2K7DA 1A03A 3B87A 1ZOTB 1C3ZA 3WHTB 1DJWA 2HETA 1GGZA 2PQLA 1ALVA 1LVCD 1RWYA 2OTGB 4YGDB 3I5IC 4DRWA 3TUYC 1YR5A 4C0KA 2MA2A 1QV1A 1TNWA 3D75A 1FI5A 1SCMC 3GK4X 3LLEA 1R6PA 1JBAA 1QV0A 1CLMA 4CFRA 1HT9A 3O78A 2GGZA 1QLSA 1EL4A 3PJIA 1B7TY 1AJ5A 1K8UA 2R2IA 4M2PA 1DF0A 1UHIA 3O4YA 2P6BB 3BUNB 1DC1A 1L2OC 4PHJA 2BL0C 2MBXA 1ZFSA 2M9GA 3UO9A 5AFPA 2LMVA 3FE9A 1R2UA 1C7VA 4YGEB 3ZNIA 3CABA 1PSBA 1TUZA 1NX0A 2TN4A 4FQOA 4YGBB 3TS5B 2WC6A 1CMGA 1UUSA 5AXIA 1DMOA 2MRDA 4FTGA 2WCHA 4NDCA 4PCWA 1SK6D 2JZIA 5AANA 2GV5A 1BT6A 2JT0A 3DVEA 1E8AA 1PRWA 3K1EA 2QDIA 4I5LB 2M7LA 2ZRTA 1AK8A 1C3YA 3S0GA 1OOGA 4JPZB 5EL2A 5IBWA 1FW4A 4TNCA 2BE4A 1WRZA 4PHNA 4M2QA 1YVLA 2M3WA 4MBEA 3LK0A 4AOMA 5PALA 5JOLA 3BUXB 1OE9B 3K21A 3KO0A 2NLNA 3OHMB 1AHRA 4MEWA 1M63B 4XJKA 1NWDA 1DGUA 3RM1A 1KK7Y 1SKTA 2PYQA 1DJYA 1EXRA 1NYAA 2LP3A 3PN7B 1K2HA 1WLZA 1CM1A 1ODBA 4YI9A 1YRUB 1PULA 2ERBA 3DVKA 2L4IA 4QJ5B 1KWOB 1BJFA 1XFRA 1TNQA 2I2RE 2F8PA 4DIRA 3FE8A 1JC2A 2LE9B 3VROA 2Y5IA 1DTLA 3SS5A 2LNKA 1ALWA 3SG6A 2JC2A 2ZNDA 1WLMA 1S5GZ 4PE4A 1B1GA 2Q4UA 2ZNEA 3JTDC 5HYDA 3EK7A 2JOJA 3DF0B 1NSHA 1F71A 1YUSA 3S0FA 1FPWA 1YTZC 1J7PA 2COLB 4OKHA 3BOWA 3BYAA 2JT3A 3WHUB 1RJVA 1L7ZA 1YRTB 2Y1NA 1KK8C 1UHNA 4PDZA 3S0DA 1BODA 2I18A 2KBMA 2LLUA 2LVJA 4USLA 3PM8A 1ZACA 1CFCA 3ICBA 5I2OA 2KGBC 1IWQA 1SNLA 3JVTB 3O2PA 4YI8A 1XVJA 2BKIB 4OVNF 2WCMA 5GQQC 1OQPA 4INXA 4A4CA 5I8NA 2NXQA 4GNKB 1LA3A 2YGUA 4MRXA 1AVSA 1S26D 1WDCB 1X02A 2K0JA 4NDDA 1F70A 1GGWA 1OZOA 3PLFB 1F4QA 1SYMA 3SG3A 2LLTA 4CIDA 3S0EA 2I7AA 3PALA 1F55A 1QASA 2MJWB 3PFVA 3UNWA 1S1EA 2H2KA 3DVJA 5F6TA 2LUCA 1RECA 1FI6A 1A4PA 2M29A 4JD9A 4YRUA 1JF0A 2O5GA 1J7OA 5TNCA 1IQ5A 1DELA 4FQTA 1G4YR 2L98A 2JPOA 4GBAA 4NDBA 4F7FA 4F0ZB 3H4SE 3NSLA 4MZJA 3CZTX 1OOFA 1BMOA 3VRRA 1KQVA 2WCBA 2OS8B 4I5JA 4QJ3B 2EGDA 2JXCA 2BBNA 3FWCA 5HKWA 1SL9A 3VRNA 4GFTA 3KEVA 1QLKA 3PSRA 2JRFA 1KK7Z 1QJTA 2KYCA 3D0YA 1QVIY 4MN0A 1IJ5A 1LXFC 4JWQA 1OOJA 3CR4X 4GPLB 2KOTA 2EC6B 2G9BA 5BPJA 2M1UA 1NPQA 2LHIA 2JWWA 2FJYA 1SR6C 2JPTA 5DKRA 1Y1UA 1BR1B 1G8IA 4IL1A 3TDZA 3D10A 2JT8A 2KNEA 2MHHA 4PHMA 4C0LA 3HCMA 1U5IA 3CDNA 1F54A 1DF0B 1LA0A 2AUCA 1BF5A 4XYNA 1S3PA 4DS7A 5KTYA 1NX2A 1N0YA 1OW4A 3IF7A 5AEQA 1CDLA 1SBJA 1XFVO 5G08A 3NSOA 4R1EA 1WY9A 3DY9A 4INWA 1DT7B 3AKAA 3TZ1A 5FI7A 3CS1A 1DGVA 2Y4QA 2WCLA 2NZ0A 4ORAB 4BY4A 2KAXA 3D76A 2MLFC 3KF9A 1DJXA 2VRGA 1IJ6A 1W7IB 3BFAA 1YX8A 4Q04A 3HX4A 1KFUL 3B88A 2WC5A 2QEVA 2PRUA 3BXKA 1DJHA 3EK8A 1SCVA 1SSEB 3SG7A 3I5HB 1WRLA 1B8CA 2GTEA 1QX7A 1QTXA 1UHKA 3OX5A 3L4LA 1XFYO 5K89A 5I94A 3R1OA 1DJZA 5CSIA 2FCEA 3CR2A 3OBVA 4ORCB 4XJKB 4C0JA 2P70A 3A4UB 2ZKMX 5FI2A 4GAOA 2AMIA 1CFDA 4CFQA 3EKJA 5JJGA 1K96A 2BBMA 1IQ3A 3TS5C 1RTP1 4OV2A 1FBVA 1A75B 1M31A 5CSJA 3I5GB 2FOTA 1VRKA 1M45A 3BUOB 1AUIB 3DD4A 3EKHA 5HLOA 5HLVA 1CB1A 1OMVA 3FS7A 2P71A 1OOIX 2AAOA 3GOFA 1DEKA 5J3XA 2JTZA 1B4CA 1LINA 2ISDA 5DICA 3BJHA 4PE7A 1UWOA 2LM5A 3OP0A 4YBHB 3B6XA 2B1UA 2CTNA 1NX3A 3PATA 1UURA 1CNPA 1TWOA 1XO5A 1LKJA 1S6IA 3CR5X 2WOSA 4I5KA 2I94A 2M49B 2LC5A 2ZRSA 5CSNA 2L2EA 2KHNA 2KBIA 4WRIA 1K9KA 2BNXA 2L50A 5HL1A 3SIAA 1NCXA 1K93D 2L51A 4YGCB 3PN7C 1KSMA 2DOQA 4HSZA 1B7TZ 1C07A 4HRGA 2KI4B 1P28A 3DZTA 2KPHA 1HQVA 3L47A 3CGAA 2K7OA 1IIOA 1KWOC 1Y6WA 5I2QA 2M8UA 3R1PA 1QIVA 4MZKA 3QMEA 2HF5A 2O60A 1QX2A 3SIBA 1BLQA 1KQMC 1XFZO 1JFJA 2KQYA 4KYNA 1Q80A 3SS4A 2LHLA 1TIZA 3FE6A 2GGMA 3CZ1A 4A4BA 2HQ8A 3LCPC 1BR4B 1NUBA 2RGIA 4ETOA 2KAYA 2PASA 5AERA 2LVVA 1OZSA 2CT9A 1OMRA 3I5FC 2LMUA 4IJ7A 5HKYA 1V1GA 2M97A 2EHBA 1CTRA 1MR8A 1EJ3A 4I5NB 1S6CA 3JVTC 3EK4A 1K90D 1D1OA 3M0WA 1RROA 1UHHA 1J1EA 2K7CA 5CPVA 3SS3A 3O4XA 4DUQA 3BQ3A 1XK4A 2JQ6A 2D8NA 3KHEA 1WDCC 1PSRA 1XK4C 2BKHB 3BFHA 1MXEA 1RK9A 5I2LA 1MQ1A 2KSPA 3WNXB 2KGRA 1J55A 2KYFA 4MLWA 2H8VA 5KU1A 1B47A 2MLEC 1SW8A 2QPTA 2SASA 2JU0A 1KSOA 1N2DA 3LK1A 1IRJA 5B8IB 1SR6B 1QS7A 2KFFA 3AKBA 4L9MA 2BCBA 3IQQA 4BY5A 1QIWA 1CDPA 2NCOA 2A4JA 3S0BA 1SPYA 1UP5A 1XA5A 2KI6D 3I5IB 3TUYB 1SCMB 1QATA 2KAVA 1DVIA 3FIAA 3V2LA 1PVAA 1CLBA 1K9PA 2QACA 5KSZA 2LVIA 3FWBA 1Y0VH 2HPSA 1CMFA 3OB2B 2M0RA 1T14A 1BG1A 1YX7A 1NCZA 1L2OB 2OS8C 2F2PA 2BL0B 1PALA 1MUXA 1LS8A 1W9ZA 3D77A 4PALA 1V1FA 5ER5A 1J1DA 3A8RA 2G2BA 3E3RA 3WXAA 3SJSA 4E68A 3CZ2A 2QEBA 3NSKA 1QX5B 1RFJA 2EC6C 2LAPA 4MVFA 4ICBA 1IG5A 3R1VA 5D7FA 1PK0D 2JULA 3EG5B 1KFXS 2K7BA 3EVRA 1NCYA 1IH0A 2F33A 1SRAA 4OCIA 2QEHA 2K2AA 2OTGC 1B9AA 1K95A 1TUJA 4ORBB 4U8DA 1Y1XA 2F3ZA 2WORA 3IVTA 5DKNA 2K61A 3D73A 3NSIA 1NP8A 2CBLA 2BCAA 1K9UA 2M7NA 4MSPA 4JKTA 2PSRA 2LANA 5D3OA 2L0PA 2H61A 3OX6A 3BUWB 4PE0A 2PMYA 2KLDA 3SG2A 1H4BA 1BOCA 2H61C 4N1GA 2KI6C 4M2OA 1N65A 1A2XA 1DQEA 2PALA 3EVUA 3IQOA 2ZFDA 1Y1AA 2CNPA 2CCMA 1GM0A 3O6BA 1J7RA 1S36A 2CXJA 4GUKA 3EVVA 4GGFA 2FJUB 4PT1A 2LCPA 1TRFA 3QRXA 2OPOA 4GGFC 1ZMZA 4PHKA 2WCJA 1MF8B 3VRQA 3C1VA 1YUUA 1TCFA 2IS9A 1QXPA 2LMTA 2BCXA 1QVIZ 3NHIA 1WRKA 1CKKA 1TTXA 3JTDB 3VRPA 3I5HC 1S6JA 1Z2CB 5ER4X 4WQ2A 1YVHA 2BAPA 1EH2A 3R72A 3RZSA 1FF1A 1TCOB 1F8HA 4CLNA 1DJIA 2L5XB 4HREE 1GQMA 1KK8B 2QEOA 3BOWB 4GGNA 1SL7A 3N7HA 1TN4A 1F4OA 1SMGA 1JSAA 1A75A 2WC8A 3KPXA 1IKUA
chains in the Genus database with same CATH topology
3K1EA 2QDIA 1C3YA 3S0GA 1OOGA 3CDNA 5EL2A 3L4AA 3VB1A 3BFHA 3OGNA 1OW4A 2H8VA 3Q8IA 3DY9A 4INWA 3D78A 2WCLA 3S0BA 3D76A 3V2LA 3BFAA 2ERBA 3B86A 1XFRA 3B88A 3FE8A 2WC5A 1T14A 2QEVA 3S0AA 2GTEA 4OZDA 1LS8A 3D77A 3B7AA 3L4LA 3BFBA 3R1OA 3S0FA 1OOHA 2P70A 3S0DA 3CZ2A 2QEBA 3R1VA 2QEHA 1TUJA 2WCMA 1ORGA 4INXA 2P71A 1OOIX 3D73A 3CYZA 5DICA 3BJHA 2WCKA 3DXLA 3CZ0A 3B6XA 3DYEA 3S0EA 2L2CA 3D74A 1QWVA 1TWOA 3NGVA 3NHTA 1DQEA 1GM0A 3B87A 1C3ZA 4JD9A 2PQLA 4PT1A 4FQTA 2JPOA 3D75A 2WCJA 4F7FA 1P28A 3DZTA 2KPHA 3L47A 1OOFA 3PJIA 3NHIA 3R1PA 3QMEA 3R72A 3RZSA 3FE9A 2QEOA 3FE6A 3CABA 3N7HA 3CZ1A 2FJYA 2WC6A 2WCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K1E A;  2QDI A;  1C3Y A;  3S0G A;  1OOG A;  3CDN A;  5EL2 A;  3L4A A;  3VB1 A;  3BFH A;  3OGN A;  1OW4 A;  2H8V A;  3Q8I A;  3DY9 A;  4INW A;  3D78 A;  2WCL A;  3S0B A;  3D76 A;  3V2L A;  3BFA A;  2ERB A;  3B86 A;  1XFR A;  3B88 A;  3FE8 A;  2WC5 A;  1T14 A;  2QEV A;  3S0A A;  2GTE A;  4OZD A;  1LS8 A;  3D77 A;  3B7A A;  3L4L A;  3BFB A;  3R1O A;  3S0F A;  1OOH A;  2P70 A;  3S0D A;  3CZ2 A;  2QEB A;  3R1V A;  2QEH A;  1TUJ A;  2WCM A;  1ORG A;  4INX A;  2P71 A;  1OOI X;  3D73 A;  3CYZ A;  5DIC A;  3BJH A;  2WCK A;  3DXL A;  3CZ0 A;  3B6X A;  3DYE A;  3S0E A;  2L2C A;  3D74 A;  1QWV A;  1TWO A;  3NGV A;  3NHT A;  1DQE A;  1GM0 A;  3B87 A;  1C3Z A;  4JD9 A;  2PQL A;  4PT1 A;  4FQT A;  2JPO A;  3D75 A;  2WCJ A;  4F7F A;  1P28 A;  3DZT A;  2KPH A;  3L47 A;  1OOF A;  3PJI A;  3NHI A;  3R1P A;  3QME A;  3R72 A;  3RZS A;  3FE9 A;  2QEO A;  3FE6 A;  3CAB A;  3N7H A;  3CZ1 A;  2FJY A;  2WC6 A;  2WCH A; 
#chains in the Genus database with same CATH topology
 1KCY A;  2K2F A;  2K60 A;  3I5G C;  1K94 A;  1CFF A;  3CWG A;  2KFG A;  2F3Y A;  1B8R A;  4YGA A;  1EG4 A;  1JUO A;  1YUR A;  1IGV A;  1CLL A;  1JF2 A;  1NIW A;  2Y1M A;  3TDU A;  1XFU O;  4QJ4 B;  1KQM B;  1NX1 A;  1XFW O;  2E6W A;  3CLN A;  3L4A A;  1SL8 A;  4PE1 A;  2LP2 A;  5HKZ A;  1C7W A;  3VB1 A;  3OGN A;  4NQG A;  2KDH A;  2JNF A;  1TOP A;  1MWN A;  1Z4H A;  3F45 A;  3DF0 A;  3Q8I A;  4MZL A;  3PM2 A;  1KFX L;  2BE6 A;  1EG3 A;  4MRY A;  4P2Y B;  1TNP A;  3D78 A;  3I5F B;  4UPG A;  1MXL C;  3BUM B;  2E30 A;  3GK1 A;  2LLS A;  2WCF A;  4OR9 B;  1DJG A;  4DCK A;  3NXA A;  3AAK A;  1B8L A;  3SG5 A;  2Q91 A;  3ZWH A;  3B86 A;  2KI4 C;  2LUX A;  3AAJ A;  3CTN A;  5DKQ A;  4CPV A;  1CM4 A;  2LVK A;  3TDI A;  2PVB A;  5FYX A;  2KQ6 A;  4HRH A;  5FI6 A;  3S0A A;  1KFU S;  1M46 A;  5D69 A;  2V53 A;  4AQJ A;  1TNX A;  4OZD A;  2WCE A;  1AJ4 A;  2LV7 A;  3B7A A;  3D0Y B;  4ZCV A;  1JFK A;  1YUT A;  2WND A;  3BFB A;  4WQ3 A;  4ZCU A;  2KLE A;  2SCP A;  3DVM A;  1OOH A;  3GK2 A;  4N5X A;  1PVB A;  1H8B A;  3OB1 B;  4AQI A;  4D1E A;  2BEC A;  1ZUZ A;  1J7Q A;  2KFH A;  4N1F A;  1G33 A;  2F2O A;  1MHO A;  1A29 A;  1W7J B;  1XFX O;  1AP4 A;  3VGO A;  1ORG A;  2HQW A;  1BU3 A;  2JNX A;  1JWD A;  1U5I B;  2L5Y A;  2NCP A;  3SG4 A;  1OMD A;  2JTT A;  2K8M B;  2M1K B;  2MAZ A;  1M39 A;  3CYZ A;  1UHJ A;  3LL8 B;  1XYD A;  2WCK A;  3DXL A;  3CZ0 A;  2JXL A;  1CFP A;  2ZN8 A;  1OSA A;  3DYE A;  5CSF A;  1SY9 A;  1CDM A;  4JQ0 D;  3MSE B;  2L2C A;  3RLZ A;  3D74 A;  4P5O E;  1GJY A;  1QWV A;  3NGV A;  1CDN A;  3NHT A;  2ZN9 A;  2FCD A;  1S5G Y;  2L4H A;  2K7D A;  1A03 A;  3B87 A;  1ZOT B;  1C3Z A;  3WHT B;  1DJW A;  2HET A;  1GGZ A;  2PQL A;  1ALV A;  1LVC D;  1RWY A;  2OTG B;  4YGD B;  3I5I C;  4DRW A;  3TUY C;  1YR5 A;  4C0K A;  2MA2 A;  1QV1 A;  1TNW A;  3D75 A;  1FI5 A;  1SCM C;  3GK4 X;  3LLE A;  1R6P A;  1JBA A;  1QV0 A;  1CLM A;  4CFR A;  1HT9 A;  3O78 A;  2GGZ A;  1QLS A;  1EL4 A;  3PJI A;  1B7T Y;  1AJ5 A;  1K8U A;  2R2I A;  4M2P A;  1DF0 A;  1UHI A;  3O4Y A;  2P6B B;  3BUN B;  1DC1 A;  1L2O C;  4PHJ A;  2BL0 C;  2MBX A;  1ZFS A;  2M9G A;  3UO9 A;  5AFP A;  2LMV A;  3FE9 A;  1R2U A;  1C7V A;  4YGE B;  3ZNI A;  3CAB A;  1PSB A;  1TUZ A;  1NX0 A;  2TN4 A;  4FQO A;  4YGB B;  3TS5 B;  2WC6 A;  1CMG A;  1UUS A;  5AXI A;  1DMO A;  2MRD A;  4FTG A;  2WCH A;  4NDC A;  4PCW A;  1SK6 D;  2JZI A;  5AAN A;  2GV5 A;  1BT6 A;  2JT0 A;  3DVE A;  1E8A A;  1PRW A;  3K1E A;  2QDI A;  4I5L B;  2M7L A;  2ZRT A;  1AK8 A;  1C3Y A;  3S0G A;  1OOG A;  4JPZ B;  5EL2 A;  5IBW A;  1FW4 A;  4TNC A;  2BE4 A;  1WRZ A;  4PHN A;  4M2Q A;  1YVL A;  2M3W A;  4MBE A;  3LK0 A;  4AOM A;  5PAL A;  5JOL A;  3BUX B;  1OE9 B;  3K21 A;  3KO0 A;  2NLN A;  3OHM B;  1AHR A;  4MEW A;  1M63 B;  4XJK A;  1NWD A;  1DGU A;  3RM1 A;  1KK7 Y;  1SKT A;  2PYQ A;  1DJY A;  1EXR A;  1NYA A;  2LP3 A;  3PN7 B;  1K2H A;  1WLZ A;  1CM1 A;  1ODB A;  4YI9 A;  1YRU B;  1PUL A;  2ERB A;  3DVK A;  2L4I A;  4QJ5 B;  1KWO B;  1BJF A;  1XFR A;  1TNQ A;  2I2R E;  2F8P A;  4DIR A;  3FE8 A;  1JC2 A;  2LE9 B;  3VRO A;  2Y5I A;  1DTL A;  3SS5 A;  2LNK A;  1ALW A;  3SG6 A;  2JC2 A;  2ZND A;  1WLM A;  1S5G Z;  4PE4 A;  1B1G A;  2Q4U A;  2ZNE A;  3JTD C;  5HYD A;  3EK7 A;  2JOJ A;  3DF0 B;  1NSH A;  1F71 A;  1YUS A;  3S0F A;  1FPW A;  1YTZ C;  1J7P A;  2COL B;  4OKH A;  3BOW A;  3BYA A;  2JT3 A;  3WHU B;  1RJV A;  1L7Z A;  1YRT B;  2Y1N A;  1KK8 C;  1UHN A;  4PDZ A;  3S0D A;  1BOD A;  2I18 A;  2KBM A;  2LLU A;  2LVJ A;  4USL A;  3PM8 A;  1ZAC A;  1CFC A;  3ICB A;  5I2O A;  2KGB C;  1IWQ A;  1SNL A;  3JVT B;  3O2P A;  4YI8 A;  1XVJ A;  2BKI B;  4OVN F;  2WCM A;  5GQQ C;  1OQP A;  4INX A;  4A4C A;  5I8N A;  2NXQ A;  4GNK B;  1LA3 A;  2YGU A;  4MRX A;  1AVS A;  1S26 D;  1WDC B;  1X02 A;  2K0J A;  4NDD A;  1F70 A;  1GGW A;  1OZO A;  3PLF B;  1F4Q A;  1SYM A;  3SG3 A;  2LLT A;  4CID A;  3S0E A;  2I7A A;  3PAL A;  1F55 A;  1QAS A;  2MJW B;  3PFV A;  3UNW A;  1S1E A;  2H2K A;  3DVJ A;  5F6T A;  2LUC A;  1REC A;  1FI6 A;  1A4P A;  2M29 A;  4JD9 A;  4YRU A;  1JF0 A;  2O5G A;  1J7O A;  5TNC A;  1IQ5 A;  1DEL A;  4FQT A;  1G4Y R;  2L98 A;  2JPO A;  4GBA A;  4NDB A;  4F7F A;  4F0Z B;  3H4S E;  3NSL A;  4MZJ A;  3CZT X;  1OOF A;  1BMO A;  3VRR A;  1KQV A;  2WCB A;  2OS8 B;  4I5J A;  4QJ3 B;  2EGD A;  2JXC A;  2BBN A;  3FWC A;  5HKW A;  1SL9 A;  3VRN A;  4GFT A;  3KEV A;  1QLK A;  3PSR A;  2JRF A;  1KK7 Z;  1QJT A;  2KYC A;  3D0Y A;  1QVI Y;  4MN0 A;  1IJ5 A;  1LXF C;  4JWQ A;  1OOJ A;  3CR4 X;  4GPL B;  2KOT A;  2EC6 B;  2G9B A;  5BPJ A;  2M1U A;  1NPQ A;  2LHI A;  2JWW A;  2FJY A;  1SR6 C;  2JPT A;  5DKR A;  1Y1U A;  1BR1 B;  1G8I A;  4IL1 A;  3TDZ A;  3D10 A;  2JT8 A;  2KNE A;  2MHH A;  4PHM A;  4C0L A;  3HCM A;  1U5I A;  3CDN A;  1F54 A;  1DF0 B;  1LA0 A;  2AUC A;  1BF5 A;  4XYN A;  1S3P A;  4DS7 A;  5KTY A;  1NX2 A;  1N0Y A;  1OW4 A;  3IF7 A;  5AEQ A;  1CDL A;  1SBJ A;  1XFV O;  5G08 A;  3NSO A;  4R1E A;  1WY9 A;  3DY9 A;  4INW A;  1DT7 B;  3AKA A;  3TZ1 A;  5FI7 A;  3CS1 A;  1DGV A;  2Y4Q A;  2WCL A;  2NZ0 A;  4ORA B;  4BY4 A;  2KAX A;  3D76 A;  2MLF C;  3KF9 A;  1DJX A;  2VRG A;  1IJ6 A;  1W7I B;  3BFA A;  1YX8 A;  4Q04 A;  3HX4 A;  1KFU L;  3B88 A;  2WC5 A;  2QEV A;  2PRU A;  3BXK A;  1DJH A;  3EK8 A;  1SCV A;  1SSE B;  3SG7 A;  3I5H B;  1WRL A;  1B8C A;  2GTE A;  1QX7 A;  1QTX A;  1UHK A;  3OX5 A;  3L4L A;  1XFY O;  5K89 A;  5I94 A;  3R1O A;  1DJZ A;  5CSI A;  2FCE A;  3CR2 A;  3OBV A;  4ORC B;  4XJK B;  4C0J A;  2P70 A;  3A4U B;  2ZKM X;  5FI2 A;  4GAO A;  2AMI A;  1CFD A;  4CFQ A;  3EKJ A;  5JJG A;  1K96 A;  2BBM A;  1IQ3 A;  3TS5 C;  1RTP 1;  4OV2 A;  1FBV A;  1A75 B;  1M31 A;  5CSJ A;  3I5G B;  2FOT A;  1VRK A;  1M45 A;  3BUO B;  1AUI B;  3DD4 A;  3EKH A;  5HLO A;  5HLV A;  1CB1 A;  1OMV A;  3FS7 A;  2P71 A;  1OOI X;  2AAO A;  3GOF A;  1DEK A;  5J3X A;  2JTZ A;  1B4C A;  1LIN A;  2ISD A;  5DIC A;  3BJH A;  4PE7 A;  1UWO A;  2LM5 A;  3OP0 A;  4YBH B;  3B6X A;  2B1U A;  2CTN A;  1NX3 A;  3PAT A;  1UUR A;  1CNP A;  1TWO A;  1XO5 A;  1LKJ A;  1S6I A;  3CR5 X;  2WOS A;  4I5K A;  2I94 A;  2M49 B;  2LC5 A;  2ZRS A;  5CSN A;  2L2E A;  2KHN A;  2KBI A;  4WRI A;  1K9K A;  2BNX A;  2L50 A;  5HL1 A;  3SIA A;  1NCX A;  1K93 D;  2L51 A;  4YGC B;  3PN7 C;  1KSM A;  2DOQ A;  4HSZ A;  1B7T Z;  1C07 A;  4HRG A;  2KI4 B;  1P28 A;  3DZT A;  2KPH A;  1HQV A;  3L47 A;  3CGA A;  2K7O A;  1IIO A;  1KWO C;  1Y6W A;  5I2Q A;  2M8U A;  3R1P A;  1QIV A;  4MZK A;  3QME A;  2HF5 A;  2O60 A;  1QX2 A;  3SIB A;  1BLQ A;  1KQM C;  1XFZ O;  1JFJ A;  2KQY A;  4KYN A;  1Q80 A;  3SS4 A;  2LHL A;  1TIZ A;  3FE6 A;  2GGM A;  3CZ1 A;  4A4B A;  2HQ8 A;  3LCP C;  1BR4 B;  1NUB A;  2RGI A;  4ETO A;  2KAY A;  2PAS A;  5AER A;  2LVV A;  1OZS A;  2CT9 A;  1OMR A;  3I5F C;  2LMU A;  4IJ7 A;  5HKY A;  1V1G A;  2M97 A;  2EHB A;  1CTR A;  1MR8 A;  1EJ3 A;  4I5N B;  1S6C A;  3JVT C;  3EK4 A;  1K90 D;  1D1O A;  3M0W A;  1RRO A;  1UHH A;  1J1E A;  2K7C A;  5CPV A;  3SS3 A;  3O4X A;  4DUQ A;  3BQ3 A;  1XK4 A;  2JQ6 A;  2D8N A;  3KHE A;  1WDC C;  1PSR A;  1XK4 C;  2BKH B;  3BFH A;  1MXE A;  1RK9 A;  5I2L A;  1MQ1 A;  2KSP A;  3WNX B;  2KGR A;  1J55 A;  2KYF A;  4MLW A;  2H8V A;  5KU1 A;  1B47 A;  2MLE C;  1SW8 A;  2QPT A;  2SAS A;  2JU0 A;  1KSO A;  1N2D A;  3LK1 A;  1IRJ A;  5B8I B;  1SR6 B;  1QS7 A;  2KFF A;  3AKB A;  4L9M A;  2BCB A;  3IQQ A;  4BY5 A;  1QIW A;  1CDP A;  2NCO A;  2A4J A;  3S0B A;  1SPY A;  1UP5 A;  1XA5 A;  2KI6 D;  3I5I B;  3TUY B;  1SCM B;  1QAT A;  2KAV A;  1DVI A;  3FIA A;  3V2L A;  1PVA A;  1CLB A;  1K9P A;  2QAC A;  5KSZ A;  2LVI A;  3FWB A;  1Y0V H;  2HPS A;  1CMF A;  3OB2 B;  2M0R A;  1T14 A;  1BG1 A;  1YX7 A;  1NCZ A;  1L2O B;  2OS8 C;  2F2P A;  2BL0 B;  1PAL A;  1MUX A;  1LS8 A;  1W9Z A;  3D77 A;  4PAL A;  1V1F A;  5ER5 A;  1J1D A;  3A8R A;  2G2B A;  3E3R A;  3WXA A;  3SJS A;  4E68 A;  3CZ2 A;  2QEB A;  3NSK A;  1QX5 B;  1RFJ A;  2EC6 C;  2LAP A;  4MVF A;  4ICB A;  1IG5 A;  3R1V A;  5D7F A;  1PK0 D;  2JUL A;  3EG5 B;  1KFX S;  2K7B A;  3EVR A;  1NCY A;  1IH0 A;  2F33 A;  1SRA A;  4OCI A;  2QEH A;  2K2A A;  2OTG C;  1B9A A;  1K95 A;  1TUJ A;  4ORB B;  4U8D A;  1Y1X A;  2F3Z A;  2WOR A;  3IVT A;  5DKN A;  2K61 A;  3D73 A;  3NSI A;  1NP8 A;  2CBL A;  2BCA A;  1K9U A;  2M7N A;  4MSP A;  4JKT A;  2PSR A;  2LAN A;  5D3O A;  2L0P A;  2H61 A;  3OX6 A;  3BUW B;  4PE0 A;  2PMY A;  2KLD A;  3SG2 A;  1H4B A;  1BOC A;  2H61 C;  4N1G A;  2KI6 C;  4M2O A;  1N65 A;  1A2X A;  1DQE A;  2PAL A;  3EVU A;  3IQO A;  2ZFD A;  1Y1A A;  2CNP A;  2CCM A;  1GM0 A;  3O6B A;  1J7R A;  1S36 A;  2CXJ A;  4GUK A;  3EVV A;  4GGF A;  2FJU B;  4PT1 A;  2LCP A;  1TRF A;  3QRX A;  2OPO A;  4GGF C;  1ZMZ A;  4PHK A;  2WCJ A;  1MF8 B;  3VRQ A;  3C1V A;  1YUU A;  1TCF A;  2IS9 A;  1QXP A;  2LMT A;  2BCX A;  1QVI Z;  3NHI A;  1WRK A;  1CKK A;  1TTX A;  3JTD B;  3VRP A;  3I5H C;  1S6J A;  1Z2C B;  5ER4 X;  4WQ2 A;  1YVH A;  2BAP A;  1EH2 A;  3R72 A;  3RZS A;  1FF1 A;  1TCO B;  1F8H A;  4CLN A;  1DJI A;  2L5X B;  4HRE E;  1GQM A;  1KK8 B;  2QEO A;  3BOW B;  4GGN A;  1SL7 A;  3N7H A;  1TN4 A;  1F4O A;  1SMG A;  1JSA A;  1A75 A;  2WC8 A;  3KPX A;  1IKU A; 
#chains in the Genus database with same CATH homology
 3K1E A;  2QDI A;  1C3Y A;  3S0G A;  1OOG A;  3CDN A;  5EL2 A;  3L4A A;  3VB1 A;  3BFH A;  3OGN A;  1OW4 A;  2H8V A;  3Q8I A;  3DY9 A;  4INW A;  3D78 A;  2WCL A;  3S0B A;  3D76 A;  3V2L A;  3BFA A;  2ERB A;  3B86 A;  1XFR A;  3B88 A;  3FE8 A;  2WC5 A;  1T14 A;  2QEV A;  3S0A A;  2GTE A;  4OZD A;  1LS8 A;  3D77 A;  3B7A A;  3L4L A;  3BFB A;  3R1O A;  3S0F A;  1OOH A;  2P70 A;  3S0D A;  3CZ2 A;  2QEB A;  3R1V A;  2QEH A;  1TUJ A;  2WCM A;  1ORG A;  4INX A;  2P71 A;  1OOI X;  3D73 A;  3CYZ A;  5DIC A;  3BJH A;  2WCK A;  3DXL A;  3CZ0 A;  3B6X A;  3DYE A;  3S0E A;  2L2C A;  3D74 A;  1QWV A;  1TWO A;  3NGV A;  3NHT A;  1DQE A;  1GM0 A;  3B87 A;  1C3Z A;  4JD9 A;  2PQL A;  4PT1 A;  4FQT A;  2JPO A;  3D75 A;  2WCJ A;  4F7F A;  1P28 A;  3DZT A;  2KPH A;  3L47 A;  1OOF A;  3PJI A;  3NHI A;  3R1P A;  3QME A;  3R72 A;  3RZS A;  3FE9 A;  2QEO A;  3FE6 A;  3CAB A;  3N7H A;  3CZ1 A;  2FJY A;  2WC6 A;  2WCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...