2QEBA

Crystal structure of anopheles gambiae d7r4-histamine complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
145
structure length
145
Chain Sequence
METVQDCENKLPPSLKSRLCEIRRYEIIEGPEMDKHIHCVMRALDFVYEDGRGDYHKLYDPLNIIELDKRHDVNLEKCIGECVQVPTSERAHVFYKCLLKSTTGRTFKKVFDLMELKKAGKVPQHQRYTAEFVQIMKDYDKALNC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligand binding protein
molecule keywords D7R4 Protein
publication title The Crystal Structure of D7r4, a Salivary Biogenic Amine-binding Protein from the Malaria Mosquito Anopheles gambiae
pubmed doi rcsb
source organism Anopheles gambiae
total genus 58
structure length 145
sequence length 145
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2qebA00
3D75A 3L4LA 3D77A 4F7FA 3S0FA 1OOFA 3B6XA 3R1OA 3S0GA 2QEOA 3R72A 1TUJA 2WCHA 2L2CA 4INWA 2WC5A 4INXA 2QEHA 3S0EA 1T14A 2PQLA 3DZTA 1XFRA 2ERBA 3B88A 3BJHA 3BFAA 2WC6A 3CZ0A 4PT1A 3CZ2A 1QWVA 3NGVA 3FE9A 3CDNA 3NHIA 1OOGA 3N7HA 2QEBA 3V2LA 3D73A 4OZDA 3PJIA 3S0BA 2GTEA 3S0AA 1TWOA 3R1VA 2QEVA 2KPHA 3CABA 3B86A 5DICA 3FE8A 3B87A 1LS8A 3B7AA 3BFHA 1OOIX 2QDIA 4FQTA 3CYZA 3VB1A 3DXLA 5EL2A 2FJYA 3L47A 3CZ1A 3K1EA 2WCLA 1C3ZA 2P70A 2WCKA 2JPOA 4JD9A 3DYEA 3D78A 3NHTA 2P71A 3OGNA 2H8VA 3QMEA 3S0DA 3RZSA 1OW4A 3BFBA 3Q8IA 1P28A 2WCJA 1ORGA 1DQEA 3R1PA 1OOHA 1C3YA 3DY9A 3L4AA 1GM0A 2WCMA 3D76A 3D74A 3FE6A
chains in the Genus database with same CATH superfamily
1R6PA 2E6WA 5I2QA 3WXAA 3D75A 1FPWA 1SCVA 1CFFA 2M1UA 3O4YA 2DOQA 5I2OA 2KHNA 1G8IA 1R2UA 1QASA 2KBMA 2M0RA 1DGVA 3ZNIA 3B6XA 1LA0A 2AUCA 1NCZA 1TTXA 2JRFA 2LP2A 2Q4UA 4IL1A 1J7PA 3D10A 1DTLA 3R72A 1BJFA 2ZKMX 2LMTA 3NSIA 4TNCA 1N0YA 4INXA 3I5GC 5HLVA 4MVFA 2HF5A 2QEHA 5CSJA 3S0EA 3PLFB 1RK9A 1K8UA 4OCIA 2GGZA 3TS5B 1CFDA 1A75A 4MBEA 1SW8A 5CSFA 4A4CA 2BCBA 4BY5A 2NCOA 1QLKA 4HSZA 1C7VA 1GJYA 1LA3A 1JFKA 1IRJA 4PE7A 2D8NA 2O5GA 4PE0A 1KFUL 4MZKA 4C0LA 1F54A 1RFJA 3CZ0A 2KFGA 3NXAA 1EH2A 2BKHB 1MHOA 1PRWA 2V53A 3IVTA 1UHIA 1N2DA 2ZRSA 4WQ2A 1BR1B 4DUQA 2KNEA 3FE9A 5IBWA 5I2LA 1QXPA 2I18A 1IQ5A 1OOGA 4PDZA 2L0PA 4CFQA 3LL8B 2TN4A 1YRTB 2LANA 3VRRA 4YGDB 1NPQA 2L51A 3BOWB 4NDCA 1FBVA 1DJZA 1QIVA 3SS4A 2H2KA 1JFJA 1IH0A 1IIOA 3TUYB 2F3YA 1TWOA 3CLNA 1EJ3A 3R1VA 2NXQA 2K7CA 3RLZA 3AAKA 3B86A 1PULA 2L2EA 1JC2A 2M7NA 2MLFC 1OOJA 1YR5A 1DF0A 1QX7A 1DJXA 2FJUB 2OS8B 1ALWA 1PALA 2GGMA 1KWOC 4NQGA 4PHNA 1QJTA 2I2RE 1S6JA 2KYFA 5AEQA 4MN0A 1FI5A 1U5IA 1ZFSA 3AKAA 2JNFA 3UO9A 3VRQA 1SYMA 5HKWA 1OZSA 1A75B 2LUXA 4YGAA 1XK4A 1KCYA 1IWQA 1QX5B 1S26D 2Y1NA 2O60A 3IQQA 1J7RA 1W7IB 2BE6A 2KGRA 2LHIA 4U8DA 1BODA 5AXIA 5AFPA 1XFZO 1YRUB 1FF1A 5CPVA 3EVVA 5G08A 1RTP1 3SG5A 3BUOB 2ZFDA 2F2OA 4JQ0D 4N1FA 5D7FA 1ZMZA 3D78A 1QVIY 1F4OA 3OBVA 3O4XA 3JTDC 4ORCB 3I5GB 2JPTA 2P71A 2JTTA 1AP4A 3OGNA 3CS1A 1S6IA 3DVJA 4KYNA 2BBMA 1YVHA 1YVLA 1UHNA 2MBXA 2LHLA 3PATA 1KQVA 2KOTA 3Q8IA 2L4HA 4PHJA 2WCJA 2H61A 4PALA 1DQEA 1Z4HA 4Q04A 4HRGA 3CR4X 3SIBA 3CTNA 3DY9A 2CTNA 4GGFA 2JT3A 1BR4B 1Y0VH 1GM0A 1IJ5A 1UWOA 1KFXS 2WCEA 1QIWA 1K94A 1JBAA 3D76A 3PM8A 1SBJA 4XJKA 2WNDA 3D74A 2KYCA 4JPZB 3KF9A 3SS5A 2I7AA 4CLNA 3D0YB 1L7ZA 1BU3A 1QV1A 1RECA 1AVSA 1PSRA 1SK6D 4MSPA 3S0FA 3FS7A 4I5LB 1WRKA 1M39A 1SR6B 1U5IB 1BMOA 1AHRA 1IGVA 1SPYA 5KTYA 2K60A 1DJIA 1PVBA 3R1OA 3IF7A 4YI9A 1CDPA 1TUJA 1J7OA 3D0YA 1SRAA 3EVRA 1CB1A 2OPOA 1OMDA 3IQOA 2LV7A 3OX5A 1MWNA 1L2OC 3NSOA 1W7JB 2JQ6A 1FI6A 3AKBA 3BUWB 1NIWA 1XFUO 1LKJA 3SIAA 5DKQA 1KSMA 2LCPA 2BCXA 1KFXL 1BF5A 2KFHA 3B88A 3BFAA 1DELA 1ZOTB 2KI4C 1WLMA 2HPSA 2NCPA 5JOLA 2HQWA 1YURA 2WORA 2KDHA 2ZNDA 3DVKA 5BPJA 3SG7A 1KFUS 2KBIA 1J1EA 2M29A 2L98A 3O78A 4I5KA 1SSEB 2KSPA 1CLLA 2EC6B 2L5YA 3JVTB 1QWVA 1M31A 2MJWB 2SCPA 3SG3A 1K90D 2K8MB 1DGUA 2ZRTA 3NHIA 2KQYA 1TCFA 2K7BA 2MHHA 3N7HA 4ICBA 1KQMB 2QEBA 4YGBB 1YUUA 1BT6A 1OMVA 1B8LA 2CCMA 2LP3A 4GAOA 4XJKB 3H4SE 1MR8A 3V2LA 4OZDA 4DIRA 3PN7C 1BG1A 1NX3A 1GQMA 4YGCB 1CDNA 1PSBA 3A8RA 1B8CA 3CABA 2Y1MA 2BL0C 2KAVA 3KHEA 1H8BA 1SMGA 1DEKA 2PSRA 4AQIA 1SL8A 2E30A 2QACA 5GQQC 3BFHA 3OB1B 5ER5A 3C1VA 3O2PA 3BXKA 2CNPA 3SG2A 2LE9B 1BOCA 2MA2A 4FQTA 3EK4A 4HRHA 2ISDA 1CM1A 2ZN8A 1SNLA 1UURA 3VRNA 5B8IB 1LXFC 1DJYA 5HYDA 2MLEC 3SG6A 5I94A 2OTGB 2KI6C 1OZOA 2FJYA 1XFXO 4UPGA 2JULA 5CSIA 3K1EA 4PCWA 1JSAA 1TCOB 1M63B 2WCLA 2FCDA 2JU0A 2LAPA 4BY4A 3I5IC 2JPOA 4JD9A 4MEWA 1MUXA 2KLDA 2MAZA 1S36A 1UHKA 4PHKA 4GNKB 3BYAA 4OKHA 1SCMC 3QMEA 2A4JA 4M2QA 5K89A 5HLOA 1H4BA 2PASA 3RZSA 1VRKA 3BFBA 5KSZA 1P28A 1IJ6A 2I94A 3HCMA 1OOHA 5I8NA 2M49B 1C3YA 1OSAA 2F3ZA 1YX7A 1K96A 2L50A 5CSNA 5AERA 2KI6D 5TNCA 1XK4C 1TNWA 2BE4A 2LLUA 1CDMA 2M1KB 2VRGA 3SJSA 1KSOA 3EKJA 3AAJA 2K2FA 3K21A 3KEVA 4INWA 4I5JA 5JJGA 5AANA 2KFFA 3L4LA 1CKKA 3PFVA 2LLSA 5F6TA 1TN4A 1Y1UA 1TIZA 4P2YB 3WHUB 1J7QA 1XO5A 2QEOA 3RM1A 2JZIA 2WCBA 3DVEA 4MRYA 2JT8A 3PN7B 1KK7Y 2L2CA 3LLEA 3QRXA 1NX2A 1QTXA 1TNXA 1T14A 1A2XA 1IQ3A 3GOFA 3DVMA 1C07A 3I5HC 3DZTA 3OP0A 4AQJA 2SASA 1DJHA 1AUIB 1EXRA 2LLTA 3DD4A 1QX2A 1M46A 3WNXB 2K2AA 4PHMA 3TZ1A 3TS5C 1SKTA 1NWDA 1TNPA 2HQ8A 4DS7A 1C7WA 1K93D 2WC6A 4GGNA 4PE4A 2JXLA 1Y6WA 4PT1A 2JXCA 4QJ5B 3EG5B 4MLWA 4CPVA 3TDIA 4OR9B 1XFWO 1K2HA 5FI6A 1F71A 1F55A 1B8RA 4NDDA 1FW4A 1QLSA 1F8HA 1CNPA 1CTRA 1GGZA 3VGOA 4ORAB 4PE1A 1K95A 1XFVO 1S6CA 1XA5A 2M8UA 3CR5X 3LCPC 3PSRA 1MXEA 3I5IB 1CFPA 1XVJA 3D73A 1CDLA 1OMRA 1DMOA 1CLBA 2ZN9A 1JF2A 1YUTA 2IS9A 1RJVA 3S0BA 5PALA 1JF0A 1KWOB 2GTEA 2K61A 3S0AA 2PRUA 1TOPA 4M2PA 1Y1AA 2K0JA 1F4QA 2LVVA 3HX4A 3WHTB 4CFRA 2BAPA 3I5FC 1NUBA 1V1FA 1TUZA 5DICA 4MRXA 2BECA 4JKTA 4WQ3A 3FE8A 2K7OA 4YBHB 2RGIA 3TUYC 2BKIB 1XYDA 1IG5A 2KAXA 1NP8A 1DJGA 1OOIX 2KLEA 1JUOA 2B1UA 4MZLA 2OS8C 1KK8C 5HKYA 1X02A 1WRZA 3CYZA 4R1EA 3UNWA 2WCFA 3VB1A 4XYNA 3BUNB 1RROA 5DKRA 2M9GA 2MRDA 3M0WA 4YRUA 5EL2A 1YUSA 2KQ6A 2QPTA 3JTDB 1OQPA 3L47A 3CZ1A 3BUXB 4ZCUA 2P70A 2AMIA 5D3OA 5DKNA 2WCKA 2P6BB 4A4BA 2EGDA 3DYEA 3E3RA 2FOTA 1K9PA 3EKHA 4AOMA 1J1DA 2LVIA 4FQOA 4C0KA 1WY9A 1UHJA 2H8VA 1WRLA 1AJ5A 1D1OA 2KGBC 3GK2A 2PYQA 1SL7A 3I5HB 3CWGA 1OW4A 1YX8A 3GK4X 3O6BA 4USLA 1HT9A 2G9BA 1DT7B 1EL4A 1IKUA 5FI2A 1ODBA 1S5GZ 1Z2CB 2JTZA 3L4AA 4JWQA 5HL1A 1NYAA 1S1EA 2WCMA 3DF0A 2JOJA 1NX1A 2F8PA 4GUKA 4QJ3B 1A29A 2F33A 1M45A 3CR2A 4ZCVA 5ER4X 3FE6A 2K7DA 2LMUA 2R2IA 3PALA 2JC2A 4HREE 1B7TZ 4OV2A 3SG4A 3OHMB 2NLNA 4F7FA 3D77A 2M7LA 2AAOA 1OOFA 3LK0A 2KAYA 3F45A 1CM4A 2ZNEA 1CLMA 1L2OB 1DJWA 1G33A 1MXLC 1TNQA 3EVUA 1PK0D 1WDCC 1ZUZA 3S0GA 5D69A 1DVIA 1NCXA 2WCHA 1SR6C 2NZ0A 4DCKA 4D1EA 1AK8A 4GBAA 2M97A 2WC5A 3CZTX 4M2OA 2CT9A 2KI4B 1GGWA 1V1GA 2HETA 1HQVA 2JT0A 3BUMB 2LVJA 2PQLA 1OE9B 1XFRA 2ERBA 3I5FB 1F70A 2JNXA 3BJHA 2BNXA 4L9MA 4MZJA 4YI8A 1A03A 4YGEB 1LINA 2Y4QA 2PVBA 3ICBA 1S3PA 1DC1A 1KK8B 2LNKA 3NSLA 1ALVA 3LK1A 1K9UA 1RWYA 1SL9A 2Q91A 1EG3A 3CZ2A 4DRWA 3NGVA 4GFTA 3TDUA 2COLB 1YTZC 2LUCA 2WC8A 3CDNA 3TDZA 2PALA 2BCAA 1MQ1A 2EC6C 3JVTC 1CMFA 1TRFA 2PMYA 3DF0B 3EK8A 2H61C 1NSHA 3MSEB 3KO0A 1QATA 2GV5A 2M3WA 2G2BA 2BL0B 2F2PA 3BQ3A 4GGFC 1Y1XA 2LM5A 2LC5A 3PJIA 2LMVA 4F0ZB 5J3XA 1KQMC 5FI7A 4NDBA 4GPLB 4E68A 4OVNF 1J55A 1QS7A 1EG4A 2KPHA 2QEVA 5FYXA 5HKZA 2FCEA 2EHBA 3KPXA 1Q80A 2LVKA 1NX0A 3B87A 1LS8A 4FTGA 3B7AA 1UHHA 4ETOA 2Y5IA 2QDIA 1LVCD 4P5OE 1MF8B 2WOSA 1B47A 3DXLA 1PVAA 4C0JA 2L4IA 3VRPA 1CMGA 1W9ZA 3FWCA 4WRIA 1UP5A 1NCYA 3FWBA 3FIAA 4N1GA 1C3ZA 1K9KA 3CGAA 1WDCB 3GK1A 1DF0B 3NSKA 4N5XA 1SCMB 1CFCA 4IJ7A 1B9AA 2OTGC 2JWWA 3EK7A 3VROA 3NHTA 4I5NB 1XFYO 1BLQA 4QJ4B 1QVIZ 2CBLA 1B4CA 3PM2A 2L5XB 3OX6A 2BBNA 3SS3A 1SY9A 3S0DA 2CXJA 1S5GY 2YGUA 4ORBB 1ORGA 3R1PA 1KK7Z 1B1GA 1QV0A 1WLZA 3ZWHA 1E8AA 1G4YR 1JWDA 1ZACA 1N65A 1A4PA 4CIDA 1UUSA 1B7TY 5KU1A 3OB2B 3A4UB 1AJ4A 3BOWA
chains in the Genus database with same CATH topology
3D75A 3L4LA 3D77A 4F7FA 3S0FA 1OOFA 3B6XA 3R1OA 3S0GA 2QEOA 3R72A 1TUJA 2WCHA 2L2CA 4INWA 2WC5A 4INXA 2QEHA 3S0EA 1T14A 2PQLA 3DZTA 1XFRA 2ERBA 3B88A 3BJHA 3BFAA 2WC6A 3CZ0A 4PT1A 3CZ2A 1QWVA 3NGVA 3FE9A 3CDNA 3NHIA 1OOGA 3N7HA 2QEBA 3V2LA 3D73A 4OZDA 3PJIA 3S0BA 2GTEA 3S0AA 1TWOA 3R1VA 2QEVA 2KPHA 3CABA 3B86A 5DICA 3FE8A 3B87A 1LS8A 3B7AA 3BFHA 1OOIX 2QDIA 4FQTA 3CYZA 3VB1A 3DXLA 5EL2A 2FJYA 3L47A 3CZ1A 3K1EA 2WCLA 1C3ZA 2P70A 2WCKA 2JPOA 4JD9A 3DYEA 3D78A 3NHTA 2P71A 3OGNA 2H8VA 3QMEA 3S0DA 3RZSA 1OW4A 3BFBA 3Q8IA 1P28A 2WCJA 1ORGA 1DQEA 3R1PA 1OOHA 1C3YA 3DY9A 3L4AA 1GM0A 2WCMA 3D76A 3D74A 3FE6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D75 A;  3L4L A;  3D77 A;  4F7F A;  3S0F A;  1OOF A;  3B6X A;  3R1O A;  3S0G A;  2QEO A;  3R72 A;  1TUJ A;  2WCH A;  2L2C A;  4INW A;  2WC5 A;  4INX A;  2QEH A;  3S0E A;  1T14 A;  2PQL A;  3DZT A;  1XFR A;  2ERB A;  3B88 A;  3BJH A;  3BFA A;  2WC6 A;  3CZ0 A;  4PT1 A;  3CZ2 A;  1QWV A;  3NGV A;  3FE9 A;  3CDN A;  3NHI A;  1OOG A;  3N7H A;  2QEB A;  3V2L A;  3D73 A;  4OZD A;  3PJI A;  3S0B A;  2GTE A;  3S0A A;  1TWO A;  3R1V A;  2QEV A;  2KPH A;  3CAB A;  3B86 A;  5DIC A;  3FE8 A;  3B87 A;  1LS8 A;  3B7A A;  3BFH A;  1OOI X;  2QDI A;  4FQT A;  3CYZ A;  3VB1 A;  3DXL A;  5EL2 A;  2FJY A;  3L47 A;  3CZ1 A;  3K1E A;  2WCL A;  1C3Z A;  2P70 A;  2WCK A;  2JPO A;  4JD9 A;  3DYE A;  3D78 A;  3NHT A;  2P71 A;  3OGN A;  2H8V A;  3QME A;  3S0D A;  3RZS A;  1OW4 A;  3BFB A;  3Q8I A;  1P28 A;  2WCJ A;  1ORG A;  1DQE A;  3R1P A;  1OOH A;  1C3Y A;  3DY9 A;  3L4A A;  1GM0 A;  2WCM A;  3D76 A;  3D74 A;  3FE6 A; 
#chains in the Genus database with same CATH topology
 1R6P A;  2E6W A;  5I2Q A;  3WXA A;  3D75 A;  1FPW A;  1SCV A;  1CFF A;  2M1U A;  3O4Y A;  2DOQ A;  5I2O A;  2KHN A;  1G8I A;  1R2U A;  1QAS A;  2KBM A;  2M0R A;  1DGV A;  3ZNI A;  3B6X A;  1LA0 A;  2AUC A;  1NCZ A;  1TTX A;  2JRF A;  2LP2 A;  2Q4U A;  4IL1 A;  1J7P A;  3D10 A;  1DTL A;  3R72 A;  1BJF A;  2ZKM X;  2LMT A;  3NSI A;  4TNC A;  1N0Y A;  4INX A;  3I5G C;  5HLV A;  4MVF A;  2HF5 A;  2QEH A;  5CSJ A;  3S0E A;  3PLF B;  1RK9 A;  1K8U A;  4OCI A;  2GGZ A;  3TS5 B;  1CFD A;  1A75 A;  4MBE A;  1SW8 A;  5CSF A;  4A4C A;  2BCB A;  4BY5 A;  2NCO A;  1QLK A;  4HSZ A;  1C7V A;  1GJY A;  1LA3 A;  1JFK A;  1IRJ A;  4PE7 A;  2D8N A;  2O5G A;  4PE0 A;  1KFU L;  4MZK A;  4C0L A;  1F54 A;  1RFJ A;  3CZ0 A;  2KFG A;  3NXA A;  1EH2 A;  2BKH B;  1MHO A;  1PRW A;  2V53 A;  3IVT A;  1UHI A;  1N2D A;  2ZRS A;  4WQ2 A;  1BR1 B;  4DUQ A;  2KNE A;  3FE9 A;  5IBW A;  5I2L A;  1QXP A;  2I18 A;  1IQ5 A;  1OOG A;  4PDZ A;  2L0P A;  4CFQ A;  3LL8 B;  2TN4 A;  1YRT B;  2LAN A;  3VRR A;  4YGD B;  1NPQ A;  2L51 A;  3BOW B;  4NDC A;  1FBV A;  1DJZ A;  1QIV A;  3SS4 A;  2H2K A;  1JFJ A;  1IH0 A;  1IIO A;  3TUY B;  2F3Y A;  1TWO A;  3CLN A;  1EJ3 A;  3R1V A;  2NXQ A;  2K7C A;  3RLZ A;  3AAK A;  3B86 A;  1PUL A;  2L2E A;  1JC2 A;  2M7N A;  2MLF C;  1OOJ A;  1YR5 A;  1DF0 A;  1QX7 A;  1DJX A;  2FJU B;  2OS8 B;  1ALW A;  1PAL A;  2GGM A;  1KWO C;  4NQG A;  4PHN A;  1QJT A;  2I2R E;  1S6J A;  2KYF A;  5AEQ A;  4MN0 A;  1FI5 A;  1U5I A;  1ZFS A;  3AKA A;  2JNF A;  3UO9 A;  3VRQ A;  1SYM A;  5HKW A;  1OZS A;  1A75 B;  2LUX A;  4YGA A;  1XK4 A;  1KCY A;  1IWQ A;  1QX5 B;  1S26 D;  2Y1N A;  2O60 A;  3IQQ A;  1J7R A;  1W7I B;  2BE6 A;  2KGR A;  2LHI A;  4U8D A;  1BOD A;  5AXI A;  5AFP A;  1XFZ O;  1YRU B;  1FF1 A;  5CPV A;  3EVV A;  5G08 A;  1RTP 1;  3SG5 A;  3BUO B;  2ZFD A;  2F2O A;  4JQ0 D;  4N1F A;  5D7F A;  1ZMZ A;  3D78 A;  1QVI Y;  1F4O A;  3OBV A;  3O4X A;  3JTD C;  4ORC B;  3I5G B;  2JPT A;  2P71 A;  2JTT A;  1AP4 A;  3OGN A;  3CS1 A;  1S6I A;  3DVJ A;  4KYN A;  2BBM A;  1YVH A;  1YVL A;  1UHN A;  2MBX A;  2LHL A;  3PAT A;  1KQV A;  2KOT A;  3Q8I A;  2L4H A;  4PHJ A;  2WCJ A;  2H61 A;  4PAL A;  1DQE A;  1Z4H A;  4Q04 A;  4HRG A;  3CR4 X;  3SIB A;  3CTN A;  3DY9 A;  2CTN A;  4GGF A;  2JT3 A;  1BR4 B;  1Y0V H;  1GM0 A;  1IJ5 A;  1UWO A;  1KFX S;  2WCE A;  1QIW A;  1K94 A;  1JBA A;  3D76 A;  3PM8 A;  1SBJ A;  4XJK A;  2WND A;  3D74 A;  2KYC A;  4JPZ B;  3KF9 A;  3SS5 A;  2I7A A;  4CLN A;  3D0Y B;  1L7Z A;  1BU3 A;  1QV1 A;  1REC A;  1AVS A;  1PSR A;  1SK6 D;  4MSP A;  3S0F A;  3FS7 A;  4I5L B;  1WRK A;  1M39 A;  1SR6 B;  1U5I B;  1BMO A;  1AHR A;  1IGV A;  1SPY A;  5KTY A;  2K60 A;  1DJI A;  1PVB A;  3R1O A;  3IF7 A;  4YI9 A;  1CDP A;  1TUJ A;  1J7O A;  3D0Y A;  1SRA A;  3EVR A;  1CB1 A;  2OPO A;  1OMD A;  3IQO A;  2LV7 A;  3OX5 A;  1MWN A;  1L2O C;  3NSO A;  1W7J B;  2JQ6 A;  1FI6 A;  3AKB A;  3BUW B;  1NIW A;  1XFU O;  1LKJ A;  3SIA A;  5DKQ A;  1KSM A;  2LCP A;  2BCX A;  1KFX L;  1BF5 A;  2KFH A;  3B88 A;  3BFA A;  1DEL A;  1ZOT B;  2KI4 C;  1WLM A;  2HPS A;  2NCP A;  5JOL A;  2HQW A;  1YUR A;  2WOR A;  2KDH A;  2ZND A;  3DVK A;  5BPJ A;  3SG7 A;  1KFU S;  2KBI A;  1J1E A;  2M29 A;  2L98 A;  3O78 A;  4I5K A;  1SSE B;  2KSP A;  1CLL A;  2EC6 B;  2L5Y A;  3JVT B;  1QWV A;  1M31 A;  2MJW B;  2SCP A;  3SG3 A;  1K90 D;  2K8M B;  1DGU A;  2ZRT A;  3NHI A;  2KQY A;  1TCF A;  2K7B A;  2MHH A;  3N7H A;  4ICB A;  1KQM B;  2QEB A;  4YGB B;  1YUU A;  1BT6 A;  1OMV A;  1B8L A;  2CCM A;  2LP3 A;  4GAO A;  4XJK B;  3H4S E;  1MR8 A;  3V2L A;  4OZD A;  4DIR A;  3PN7 C;  1BG1 A;  1NX3 A;  1GQM A;  4YGC B;  1CDN A;  1PSB A;  3A8R A;  1B8C A;  3CAB A;  2Y1M A;  2BL0 C;  2KAV A;  3KHE A;  1H8B A;  1SMG A;  1DEK A;  2PSR A;  4AQI A;  1SL8 A;  2E30 A;  2QAC A;  5GQQ C;  3BFH A;  3OB1 B;  5ER5 A;  3C1V A;  3O2P A;  3BXK A;  2CNP A;  3SG2 A;  2LE9 B;  1BOC A;  2MA2 A;  4FQT A;  3EK4 A;  4HRH A;  2ISD A;  1CM1 A;  2ZN8 A;  1SNL A;  1UUR A;  3VRN A;  5B8I B;  1LXF C;  1DJY A;  5HYD A;  2MLE C;  3SG6 A;  5I94 A;  2OTG B;  2KI6 C;  1OZO A;  2FJY A;  1XFX O;  4UPG A;  2JUL A;  5CSI A;  3K1E A;  4PCW A;  1JSA A;  1TCO B;  1M63 B;  2WCL A;  2FCD A;  2JU0 A;  2LAP A;  4BY4 A;  3I5I C;  2JPO A;  4JD9 A;  4MEW A;  1MUX A;  2KLD A;  2MAZ A;  1S36 A;  1UHK A;  4PHK A;  4GNK B;  3BYA A;  4OKH A;  1SCM C;  3QME A;  2A4J A;  4M2Q A;  5K89 A;  5HLO A;  1H4B A;  2PAS A;  3RZS A;  1VRK A;  3BFB A;  5KSZ A;  1P28 A;  1IJ6 A;  2I94 A;  3HCM A;  1OOH A;  5I8N A;  2M49 B;  1C3Y A;  1OSA A;  2F3Z A;  1YX7 A;  1K96 A;  2L50 A;  5CSN A;  5AER A;  2KI6 D;  5TNC A;  1XK4 C;  1TNW A;  2BE4 A;  2LLU A;  1CDM A;  2M1K B;  2VRG A;  3SJS A;  1KSO A;  3EKJ A;  3AAJ A;  2K2F A;  3K21 A;  3KEV A;  4INW A;  4I5J A;  5JJG A;  5AAN A;  2KFF A;  3L4L A;  1CKK A;  3PFV A;  2LLS A;  5F6T A;  1TN4 A;  1Y1U A;  1TIZ A;  4P2Y B;  3WHU B;  1J7Q A;  1XO5 A;  2QEO A;  3RM1 A;  2JZI A;  2WCB A;  3DVE A;  4MRY A;  2JT8 A;  3PN7 B;  1KK7 Y;  2L2C A;  3LLE A;  3QRX A;  1NX2 A;  1QTX A;  1TNX A;  1T14 A;  1A2X A;  1IQ3 A;  3GOF A;  3DVM A;  1C07 A;  3I5H C;  3DZT A;  3OP0 A;  4AQJ A;  2SAS A;  1DJH A;  1AUI B;  1EXR A;  2LLT A;  3DD4 A;  1QX2 A;  1M46 A;  3WNX B;  2K2A A;  4PHM A;  3TZ1 A;  3TS5 C;  1SKT A;  1NWD A;  1TNP A;  2HQ8 A;  4DS7 A;  1C7W A;  1K93 D;  2WC6 A;  4GGN A;  4PE4 A;  2JXL A;  1Y6W A;  4PT1 A;  2JXC A;  4QJ5 B;  3EG5 B;  4MLW A;  4CPV A;  3TDI A;  4OR9 B;  1XFW O;  1K2H A;  5FI6 A;  1F71 A;  1F55 A;  1B8R A;  4NDD A;  1FW4 A;  1QLS A;  1F8H A;  1CNP A;  1CTR A;  1GGZ A;  3VGO A;  4ORA B;  4PE1 A;  1K95 A;  1XFV O;  1S6C A;  1XA5 A;  2M8U A;  3CR5 X;  3LCP C;  3PSR A;  1MXE A;  3I5I B;  1CFP A;  1XVJ A;  3D73 A;  1CDL A;  1OMR A;  1DMO A;  1CLB A;  2ZN9 A;  1JF2 A;  1YUT A;  2IS9 A;  1RJV A;  3S0B A;  5PAL A;  1JF0 A;  1KWO B;  2GTE A;  2K61 A;  3S0A A;  2PRU A;  1TOP A;  4M2P A;  1Y1A A;  2K0J A;  1F4Q A;  2LVV A;  3HX4 A;  3WHT B;  4CFR A;  2BAP A;  3I5F C;  1NUB A;  1V1F A;  1TUZ A;  5DIC A;  4MRX A;  2BEC A;  4JKT A;  4WQ3 A;  3FE8 A;  2K7O A;  4YBH B;  2RGI A;  3TUY C;  2BKI B;  1XYD A;  1IG5 A;  2KAX A;  1NP8 A;  1DJG A;  1OOI X;  2KLE A;  1JUO A;  2B1U A;  4MZL A;  2OS8 C;  1KK8 C;  5HKY A;  1X02 A;  1WRZ A;  3CYZ A;  4R1E A;  3UNW A;  2WCF A;  3VB1 A;  4XYN A;  3BUN B;  1RRO A;  5DKR A;  2M9G A;  2MRD A;  3M0W A;  4YRU A;  5EL2 A;  1YUS A;  2KQ6 A;  2QPT A;  3JTD B;  1OQP A;  3L47 A;  3CZ1 A;  3BUX B;  4ZCU A;  2P70 A;  2AMI A;  5D3O A;  5DKN A;  2WCK A;  2P6B B;  4A4B A;  2EGD A;  3DYE A;  3E3R A;  2FOT A;  1K9P A;  3EKH A;  4AOM A;  1J1D A;  2LVI A;  4FQO A;  4C0K A;  1WY9 A;  1UHJ A;  2H8V A;  1WRL A;  1AJ5 A;  1D1O A;  2KGB C;  3GK2 A;  2PYQ A;  1SL7 A;  3I5H B;  3CWG A;  1OW4 A;  1YX8 A;  3GK4 X;  3O6B A;  4USL A;  1HT9 A;  2G9B A;  1DT7 B;  1EL4 A;  1IKU A;  5FI2 A;  1ODB A;  1S5G Z;  1Z2C B;  2JTZ A;  3L4A A;  4JWQ A;  5HL1 A;  1NYA A;  1S1E A;  2WCM A;  3DF0 A;  2JOJ A;  1NX1 A;  2F8P A;  4GUK A;  4QJ3 B;  1A29 A;  2F33 A;  1M45 A;  3CR2 A;  4ZCV A;  5ER4 X;  3FE6 A;  2K7D A;  2LMU A;  2R2I A;  3PAL A;  2JC2 A;  4HRE E;  1B7T Z;  4OV2 A;  3SG4 A;  3OHM B;  2NLN A;  4F7F A;  3D77 A;  2M7L A;  2AAO A;  1OOF A;  3LK0 A;  2KAY A;  3F45 A;  1CM4 A;  2ZNE A;  1CLM A;  1L2O B;  1DJW A;  1G33 A;  1MXL C;  1TNQ A;  3EVU A;  1PK0 D;  1WDC C;  1ZUZ A;  3S0G A;  5D69 A;  1DVI A;  1NCX A;  2WCH A;  1SR6 C;  2NZ0 A;  4DCK A;  4D1E A;  1AK8 A;  4GBA A;  2M97 A;  2WC5 A;  3CZT X;  4M2O A;  2CT9 A;  2KI4 B;  1GGW A;  1V1G A;  2HET A;  1HQV A;  2JT0 A;  3BUM B;  2LVJ A;  2PQL A;  1OE9 B;  1XFR A;  2ERB A;  3I5F B;  1F70 A;  2JNX A;  3BJH A;  2BNX A;  4L9M A;  4MZJ A;  4YI8 A;  1A03 A;  4YGE B;  1LIN A;  2Y4Q A;  2PVB A;  3ICB A;  1S3P A;  1DC1 A;  1KK8 B;  2LNK A;  3NSL A;  1ALV A;  3LK1 A;  1K9U A;  1RWY A;  1SL9 A;  2Q91 A;  1EG3 A;  3CZ2 A;  4DRW A;  3NGV A;  4GFT A;  3TDU A;  2COL B;  1YTZ C;  2LUC A;  2WC8 A;  3CDN A;  3TDZ A;  2PAL A;  2BCA A;  1MQ1 A;  2EC6 C;  3JVT C;  1CMF A;  1TRF A;  2PMY A;  3DF0 B;  3EK8 A;  2H61 C;  1NSH A;  3MSE B;  3KO0 A;  1QAT A;  2GV5 A;  2M3W A;  2G2B A;  2BL0 B;  2F2P A;  3BQ3 A;  4GGF C;  1Y1X A;  2LM5 A;  2LC5 A;  3PJI A;  2LMV A;  4F0Z B;  5J3X A;  1KQM C;  5FI7 A;  4NDB A;  4GPL B;  4E68 A;  4OVN F;  1J55 A;  1QS7 A;  1EG4 A;  2KPH A;  2QEV A;  5FYX A;  5HKZ A;  2FCE A;  2EHB A;  3KPX A;  1Q80 A;  2LVK A;  1NX0 A;  3B87 A;  1LS8 A;  4FTG A;  3B7A A;  1UHH A;  4ETO A;  2Y5I A;  2QDI A;  1LVC D;  4P5O E;  1MF8 B;  2WOS A;  1B47 A;  3DXL A;  1PVA A;  4C0J A;  2L4I A;  3VRP A;  1CMG A;  1W9Z A;  3FWC A;  4WRI A;  1UP5 A;  1NCY A;  3FWB A;  3FIA A;  4N1G A;  1C3Z A;  1K9K A;  3CGA A;  1WDC B;  3GK1 A;  1DF0 B;  3NSK A;  4N5X A;  1SCM B;  1CFC A;  4IJ7 A;  1B9A A;  2OTG C;  2JWW A;  3EK7 A;  3VRO A;  3NHT A;  4I5N B;  1XFY O;  1BLQ A;  4QJ4 B;  1QVI Z;  2CBL A;  1B4C A;  3PM2 A;  2L5X B;  3OX6 A;  2BBN A;  3SS3 A;  1SY9 A;  3S0D A;  2CXJ A;  1S5G Y;  2YGU A;  4ORB B;  1ORG A;  3R1P A;  1KK7 Z;  1B1G A;  1QV0 A;  1WLZ A;  3ZWH A;  1E8A A;  1G4Y R;  1JWD A;  1ZAC A;  1N65 A;  1A4P A;  4CID A;  1UUS A;  1B7T Y;  5KU1 A;  3OB2 B;  3A4U B;  1AJ4 A;  3BOW A; 
#chains in the Genus database with same CATH homology
 3D75 A;  3L4L A;  3D77 A;  4F7F A;  3S0F A;  1OOF A;  3B6X A;  3R1O A;  3S0G A;  2QEO A;  3R72 A;  1TUJ A;  2WCH A;  2L2C A;  4INW A;  2WC5 A;  4INX A;  2QEH A;  3S0E A;  1T14 A;  2PQL A;  3DZT A;  1XFR A;  2ERB A;  3B88 A;  3BJH A;  3BFA A;  2WC6 A;  3CZ0 A;  4PT1 A;  3CZ2 A;  1QWV A;  3NGV A;  3FE9 A;  3CDN A;  3NHI A;  1OOG A;  3N7H A;  2QEB A;  3V2L A;  3D73 A;  4OZD A;  3PJI A;  3S0B A;  2GTE A;  3S0A A;  1TWO A;  3R1V A;  2QEV A;  2KPH A;  3CAB A;  3B86 A;  5DIC A;  3FE8 A;  3B87 A;  1LS8 A;  3B7A A;  3BFH A;  1OOI X;  2QDI A;  4FQT A;  3CYZ A;  3VB1 A;  3DXL A;  5EL2 A;  2FJY A;  3L47 A;  3CZ1 A;  3K1E A;  2WCL A;  1C3Z A;  2P70 A;  2WCK A;  2JPO A;  4JD9 A;  3DYE A;  3D78 A;  3NHT A;  2P71 A;  3OGN A;  2H8V A;  3QME A;  3S0D A;  3RZS A;  1OW4 A;  3BFB A;  3Q8I A;  1P28 A;  2WCJ A;  1ORG A;  1DQE A;  3R1P A;  1OOH A;  1C3Y A;  3DY9 A;  3L4A A;  1GM0 A;  2WCM A;  3D76 A;  3D74 A;  3FE6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...