2QEBA

Crystal structure of anopheles gambiae d7r4-histamine complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
145
structure length
145
Chain Sequence
METVQDCENKLPPSLKSRLCEIRRYEIIEGPEMDKHIHCVMRALDFVYEDGRGDYHKLYDPLNIIELDKRHDVNLEKCIGECVQVPTSERAHVFYKCLLKSTTGRTFKKVFDLMELKKAGKVPQHQRYTAEFVQIMKDYDKALNC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D7R4 Protein
publication title The Crystal Structure of D7r4, a Salivary Biogenic Amine-binding Protein from the Malaria Mosquito Anopheles gambiae
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Ligand binding protein
total genus 58
structure length 145
sequence length 145
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2qebA00
5DICA 2WC6A 3BFAA 3R1OA 2L2CA 3S0EA 1OOGA 3B86A 3B87A 3D73A 2WCKA 3S0BA 4F7FA 2QEVA 3NHTA 1GM0A 5EL2A 3CDNA 1P28A 2P70A 2GTEA 3B6XA 3DXLA 3L47A 2KPHA 3B7AA 3CZ2A 1OW4A 3S0DA 4FQTA 2JPOA 3OGNA 1XFRA 1OOIX 3D77A 3S0GA 3FE8A 2WCLA 1C3YA 2QEOA 2WCJA 3NHIA 3FE6A 3S0FA 1TWOA 4JD9A 2QDIA 3VB1A 1LS8A 2WCMA 3BFBA 1DQEA 3NGVA 3CZ1A 3CZ0A 4INXA 3V2LA 1ORGA 2H8VA 2QEHA 3D74A 3D75A 1C3ZA 1TUJA 2PQLA 3B88A 1T14A 3DY9A 3Q8IA 4OZDA 1OOHA 2WC5A 3DZTA 2QEBA 3K1EA 3CYZA 3CABA 2WCHA 3RZSA 3PJIA 3BFHA 2FJYA 1OOFA 3BJHA 3DYEA 3S0AA 3D76A 3R72A 3D78A 2ERBA 3R1VA 3R1PA 4PT1A 3FE9A 3L4AA 3N7HA 3QMEA 3L4LA 2P71A 4INWA 1QWVA
chains in the Genus database with same CATH superfamily
1PALA 1NX2A 2LMTA 3K21A 5ER5A 3PM8A 1N2DA 3NSIA 2KDHA 3IVTA 2MBXA 3CR2A 1K93D 1OMVA 2V53A 3C1VA 3FS7A 3S0EA 1J1DA 2OS8C 1SPYA 1TOPA 1LA0A 5IBWA 3I5GC 2SCPA 3VRNA 2MJWB 4PHNA 1XFUO 2FOTA 5CSNA 1QVIZ 1M31A 1TNPA 1NX3A 1SL7A 3EK7A 1K9PA 1OMRA 1S6JA 1F4QA 1A29A 2L0PA 2L4HA 2H61C 3A4UB 1NWDA 4FQOA 2LP3A 3I5HC 4BY5A 3CZTX 1DJYA 2JRFA 4GFTA 4NDCA 2EHBA 3UO9A 3PLFB 1G4YR 2WNDA 2JZIA 2RGIA 1QX7A 1DJGA 2K8MB 5AEQA 1C07A 1J1EA 1EG3A 1KQMC 3GK1A 3JVTC 3WXAA 2JC2A 4PE1A 5CPVA 2OS8B 3DF0B 4L9MA 1QS7A 3DF0A 2JPOA 3I5GB 4YGBB 1CNPA 1DEKA 2EC6C 1NX0A 1XFRA 1OOIX 1S6CA 3HX4A 1XK4A 3D77A 1EG4A 2K60A 3VGOA 2JT0A 1S5GZ 2OTGC 1C3YA 1H4BA 1E8AA 1CB1A 1DF0B 1Q80A 3TDUA 3I5HB 1DF0A 2WCJA 2ZNDA 1B8LA 2ISDA 4JQ0D 3WHUB 5D3OA 3PFVA 5I2LA 3BOWA 3EK4A 5K89A 3D10A 3CGAA 2JPTA 3OB2B 2F3YA 3CR4X 1RK9A 1KQMB 1SR6B 2LLTA 1LXFC 3IQOA 1LVCD 1QASA 3PALA 3SG7A 2MRDA 1R6PA 3GK2A 1KK7Z 3TZ1A 4CPVA 4JPZB 3BFBA 3D0YB 1SRAA 3VRRA 2EC6B 1SL9A 1DTLA 2KI4B 4N5XA 1BODA 1YX8A 4C0LA 1A03A 5PALA 3ZNIA 1DJWA 1U5IB 2CT9A 1YUTA 1ORGA 1U5IA 2OTGB 4OKHA 3I5FB 4XYNA 3SG5A 1K2HA 3EK8A 1TUJA 3VRQA 1J55A 1T14A 2KBMA 1QJTA 1FPWA 2ZNEA 1K94A 3TDIA 3SG4A 1BT6A 1B8RA 2WOSA 4YGEB 1PRWA 1X02A 1OOHA 1EH2A 2LVJA 3FIAA 3CYZA 1SCVA 2JWWA 2HPSA 1BF5A 1IQ3A 4MZKA 1CDNA 1TNWA 2M29A 3BFHA 3O6BA 1S5GY 2F2OA 4ORBB 2B1UA 3BJHA 2ZRTA 1N0YA 4MZJA 3DYEA 1CFFA 1WLZA 2KLEA 4IJ7A 3LCPC 2M1KB 3MSEB 1BR4B 1MF8B 2BE6A 3R1VA 3AAKA 1CMGA 2G9BA 1EXRA 3L4AA 3CS1A 5AFPA 2JTTA 5GQQC 3O2PA 1B8CA 2L98A 3LLEA 1AP4A 3AAJA 1IG5A 1Y6WA 2LLSA 4JKTA 2KFHA 1DELA 1LKJA 1FF1A 1PVAA 1WRZA 2K7BA 2M8UA 3CR5X 5D7FA 1ZACA 5DICA 2K2AA 5HLOA 2WC6A 1RTP1 2E30A 5I8NA 2I18A 1QLKA 1GQMA 1R2UA 1MUXA 3BFAA 3R1OA 4QJ3B 4YI9A 1F4OA 3WNXB 2LHIA 3PSRA 2D8NA 1MXEA 2ZN8A 1UP5A 3B87A 4ICBA 5FYXA 1DVIA 3BQ3A 4GPLB 1FI6A 2WCKA 1UHIA 4F7FA 2QACA 2BL0B 1FI5A 1AJ4A 2QEVA 2GV5A 1J7QA 2ZKMX 5ER4X 3CDNA 2BBNA 1PSRA 2ZFDA 5HKYA 2LANA 1J7RA 2NZ0A 4M2OA 3TS5B 1Y0VH 2I94A 1MQ1A 1RECA 2LV7A 1QATA 3B6XA 4GGFC 3DXLA 1NCXA 1XFXO 2K2FA 2A4JA 2NXQA 2MA2A 1JWDA 3AKBA 4PALA 3TDZA 1V1FA 1CM1A 1W7JB 3O78A 2BCXA 1K96A 1ZOTB 4WRIA 1B4CA 3CZ2A 3S0DA 3H4SE 2JXCA 2CCMA 2LP2A 1LINA 2BE4A 1ZFSA 4PE0A 3KHEA 1CTRA 2MAZA 2FJUB 1NX1A 1C7WA 1TTXA 3OX5A 4OV2A 1QIWA 1JC2A 4ETOA 1B7TZ 1SCMC 3BUWB 1M39A 4JWQA 1SY9A 2LUXA 1TWOA 1JFKA 1PULA 1IQ5A 2KGRA 2LNKA 5HYDA 2QDIA 2K61A 1DJIA 3NXAA 1DT7B 5I2QA 1QV0A 2WCEA 3E3RA 2EGDA 4TNCA 1K9KA 4Q04A 1WDCC 4C0KA 2HF5A 1DQEA 1D1OA 3HCMA 1OZSA 3NGVA 2Y1NA 1MXLC 3EVVA 3SIBA 2BCBA 1SSEB 1Y1UA 1K8UA 2KSPA 3ZWHA 1A2XA 1DJHA 1XA5A 5AERA 3V2LA 1NCYA 5FI2A 4I5KA 2H8VA 1L7ZA 1HQVA 1Z2CB 2BKIB 2M3WA 2F33A 4I5JA 1SCMB 3B88A 2KNEA 2H61A 4YGAA 2JOJA 1L2OC 2KQYA 1SNLA 5FI7A 2F2PA 5HKWA 4CFRA 2WC5A 3DZTA 1NIWA 2JULA 2KQ6A 4ORCB 2BECA 1IGVA 1WDCB 3CABA 2LM5A 1UHKA 2M49B 3JVTB 3RZSA 1IRJA 1G8IA 1QVIY 1FW4A 1KWOC 2FJYA 5DKNA 1IJ5A 2FCEA 1OOFA 3RLZA 3SJSA 2NCOA 2BAPA 3D0YA 3S0AA 5KTYA 5J3XA 3D76A 1YVLA 4ZCVA 1YRTB 2E6WA 3D78A 3R1PA 5DKRA 3FE9A 1NPQA 1KQVA 3EVUA 1J7OA 5B8IB 1DGUA 1JUOA 3BUNB 3OB1B 4N1GA 1IH0A 2M97A 4P5OE 2P6BB 4GGNA 1CFDA 2KI6D 4INWA 5F6TA 2OPOA 1KWOB 3O4XA 4U8DA 1CDPA 1JSAA 2K7CA 2BCAA 5FI6A 4GUKA 4PE7A 1YUSA 2L2CA 5DKQA 3GOFA 3OP0A 2KYCA 4A4BA 1DJZA 1W9ZA 1ALWA 4PHKA 1XFYO 4YGCB 3D73A 4MRXA 5CSFA 1AHRA 3NHTA 1MR8A 3LK0A 3SG3A 4DIRA 3BXKA 2CBLA 1QXPA 2LLUA 3DVKA 1Y1XA 3PN7C 1F8HA 1KK7Y 2IS9A 1OQPA 3JTDC 1C7VA 1P28A 4PDZA 1CLMA 1TUZA 3QRXA 4F0ZB 3VROA 3L47A 2AAOA 3KO0A 2L5XB 3B7AA 2L4IA 3OBVA 4PHMA 1AJ5A 1OW4A 3BUXB 3CLNA 4FQTA 1CKKA 1TCFA 1DC1A 1GGZA 2Y4QA 2L51A 1M63B 3OGNA 4GBAA 5JJGA 3IF7A 1CM4A 2K7OA 2GGMA 1CFPA 4BY4A 4YI8A 3FE8A 2WCLA 2KAYA 4KYNA 3PN7B 1BMOA 3NHIA 2LVIA 1S36A 3NSOA 4OR9B 1WRKA 2BBMA 1B47A 4YBHB 2BNXA 1OSAA 2Q4UA 3SS5A 4JD9A 3DVJA 5KU1A 1JF2A 1JFJA 2LE9B 1BLQA 2LVVA 3VB1A 4HRHA 3KF9A 1JBAA 2COLB 1W7IB 2LCPA 1KFUS 2WCBA 1F54A 1QV1A 1NSHA 1SYMA 3O4YA 1OOJA 4A4CA 3CZ1A 1K90D 2JNFA 1WY9A 3CZ0A 1Y1AA 1DGVA 2NLNA 2WCFA 1UWOA 3EKHA 3VRPA 1F71A 1KFUL 2QEHA 4AQIA 1C3ZA 1MHOA 1SMGA 2PQLA 4D1EA 3DY9A 1M46A 2PALA 1TRFA 5CSJA 1XYDA 4AOMA 1RFJA 4DUQA 4E68A 1EL4A 1KK8C 1ZUZA 2BKHB 1KSMA 2LUCA 4GGFA 1RROA 5G08A 1YX7A 1BR1B 2PSRA 3NSLA 4GNKB 4YGDB 2L50A 5I94A 2I2RE 3PJIA 2PMYA 5D69A 4CIDA 1CDLA 2Y5IA 1A4PA 4QJ4B 2KAVA 1CLBA 4NDDA 2M1UA 1OMDA 1RWYA 5AANA 1XO5A 1BU3A 4HREE 4CFQA 2L2EA 1SL8A 3R72A 3SS3A 2HQWA 1XK4C 2ERBA 1YR5A 2JQ6A 1FBVA 1AUIB 2MLFC 3SIAA 2PASA 4PT1A 1PVBA 3DVMA 3N7HA 2LVKA 2G2BA 2M7LA 4AQJA 3FWCA 3QMEA 2JU0A 3CTNA 4WQ2A 2CNPA 1YVHA 2DOQA 1KK8B 2KAXA 1XVJA 2K7DA 4MRYA 5HKZA 2P71A 4I5NB 1OE9B 1XFZO 2LMUA 1AVSA 1SR6C 4R1EA 1F55A 1NCZA 2PVBA 1CLLA 1SW8A 3OHMB 4NQGA 1AK8A 1V1GA 1QIVA 1QTXA 2VRGA 2GGZA 2KBIA 2PRUA 2JXLA 1TIZA 1UHHA 2L5YA 1BG1A 1UUSA 1WLMA 2KI4C 1OOGA 3B86A 1B7TY 1CMFA 1UHJA 3EKJA 4DRWA 3S0BA 1B1GA 1NYAA 3I5FC 1QX5B 3M0WA 2R2IA 1B9AA 1MWNA 5EL2A 1GM0A 1TNXA 3WHTB 1F70A 3BOWB 2JTZA 2KI6C 1L2OB 4MVFA 1UURA 5BPJA 2NCPA 2LC5A 2P70A 2GTEA 1UHNA 1SBJA 2ZRSA 3FWBA 2KPHA 1YUUA 2CXJA 2KGBC 4HSZA 5HL1A 1VRKA 3CWGA 1IKUA 1RJVA 5AXIA 4M2PA 2LHLA 1S6IA 1SK6D 1WRLA 3BUOB 1KFXS 3TUYC 2SASA 2LAPA 4ZCUA 2KOTA 4NDBA 1BJFA 1JF0A 1M45A 2TN4A 3S0GA 3I5IC 4USLA 2QEOA 1BOCA 4DS7A 3DVEA 1S1EA 3FE6A 4PHJA 1KFXL 4M2QA 3S0FA 2F3ZA 3A8RA 2JT8A 1QLSA 1TNQA 1PSBA 2YGUA 2FCDA 1LS8A 1GJYA 1S26D 1YTZC 2KYFA 2O5GA 2WCMA 2HQ8A 1DJXA 2F8PA 1EJ3A 4CLNA 4MN0A 4OCIA 3AKAA 1XFWO 4HRGA 1IJ6A 3RM1A 1G33A 3TUYB 1LA3A 4ORAB 4MBEA 1NUBA 2MHHA 1KSOA 4OVNF 3EVRA 2WORA 2KLDA 2M7NA 2ZN9A 3PM2A 3NSKA 4INXA 3BYAA 3SG6A 1K95A 2WC8A 3I5IB 2BL0C 2O60A 2H2KA 1A75B 1YURA 3DD4A 5I2OA 2JT3A 3D74A 1A75A 1CDMA 3D75A 4N1FA 2KFGA 4MSPA 4C0JA 1PK0D 1IIOA 1QX2A 3Q8IA 3GK4X 2K0JA 1CFCA 3JTDB 4OZDA 3PATA 4P2YB 5JOLA 3KEVA 1OZOA 2QEBA 3K1EA 4WQ3A 3TS5C 1Z4HA 1J7PA 3KPXA 2WCHA 2KFFA 1GGWA 1IWQA 5CSIA 3SS4A 2Q91A 4QJ5B 2AUCA 3F45A 2MLEC 3IQQA 1N65A 1XFVO 3OX6A 4MEWA 4MZLA 4I5LB 4PE4A 3EG5B 5HLVA 4DCKA 4XJKB 4UPGA 3LK1A 1DMOA 4XJKA 1NP8A 1YRUB 2KHNA 2HETA 1K9UA 4MLWA 2M0RA 5TNCA 4YRUA 4GAOA 1HT9A 3SG2A 1ALVA 2Y1MA 5KSZA 1H8BA 4IL1A 2JNXA 4FTGA 3LL8B 1KCYA 2PYQA 1TCOB 3L4LA 4PCWA 1ODBA 2QPTA 3UNWA 2LMVA 2CTNA 1SKTA 1ZMZA 1S3PA 2M9GA 2I7AA 2AMIA 3BUMB 1TN4A 3ICBA 1QWVA
chains in the Genus database with same CATH topology
5DICA 2WC6A 3BFAA 3R1OA 2L2CA 3S0EA 1OOGA 3B86A 3B87A 3D73A 2WCKA 3S0BA 4F7FA 2QEVA 3NHTA 1GM0A 5EL2A 3CDNA 1P28A 2P70A 2GTEA 3B6XA 3DXLA 3L47A 2KPHA 3B7AA 3CZ2A 1OW4A 3S0DA 4FQTA 2JPOA 3OGNA 1XFRA 1OOIX 3D77A 3S0GA 3FE8A 2WCLA 1C3YA 2QEOA 2WCJA 3NHIA 3FE6A 3S0FA 1TWOA 4JD9A 2QDIA 3VB1A 1LS8A 2WCMA 3BFBA 1DQEA 3NGVA 3CZ1A 3CZ0A 4INXA 3V2LA 1ORGA 2H8VA 2QEHA 3D74A 3D75A 1C3ZA 1TUJA 2PQLA 3B88A 1T14A 3DY9A 3Q8IA 4OZDA 1OOHA 2WC5A 3DZTA 2QEBA 3K1EA 3CYZA 3CABA 2WCHA 3RZSA 3PJIA 3BFHA 2FJYA 1OOFA 3BJHA 3DYEA 3S0AA 3D76A 3R72A 3D78A 2ERBA 3R1VA 3R1PA 4PT1A 3FE9A 3L4AA 3N7HA 3QMEA 3L4LA 2P71A 4INWA 1QWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DIC A;  2WC6 A;  3BFA A;  3R1O A;  2L2C A;  3S0E A;  1OOG A;  3B86 A;  3B87 A;  3D73 A;  2WCK A;  3S0B A;  4F7F A;  2QEV A;  3NHT A;  1GM0 A;  5EL2 A;  3CDN A;  1P28 A;  2P70 A;  2GTE A;  3B6X A;  3DXL A;  3L47 A;  2KPH A;  3B7A A;  3CZ2 A;  1OW4 A;  3S0D A;  4FQT A;  2JPO A;  3OGN A;  1XFR A;  1OOI X;  3D77 A;  3S0G A;  3FE8 A;  2WCL A;  1C3Y A;  2QEO A;  2WCJ A;  3NHI A;  3FE6 A;  3S0F A;  1TWO A;  4JD9 A;  2QDI A;  3VB1 A;  1LS8 A;  2WCM A;  3BFB A;  1DQE A;  3NGV A;  3CZ1 A;  3CZ0 A;  4INX A;  3V2L A;  1ORG A;  2H8V A;  2QEH A;  3D74 A;  3D75 A;  1C3Z A;  1TUJ A;  2PQL A;  3B88 A;  1T14 A;  3DY9 A;  3Q8I A;  4OZD A;  1OOH A;  2WC5 A;  3DZT A;  2QEB A;  3K1E A;  3CYZ A;  3CAB A;  2WCH A;  3RZS A;  3PJI A;  3BFH A;  2FJY A;  1OOF A;  3BJH A;  3DYE A;  3S0A A;  3D76 A;  3R72 A;  3D78 A;  2ERB A;  3R1V A;  3R1P A;  4PT1 A;  3FE9 A;  3L4A A;  3N7H A;  3QME A;  3L4L A;  2P71 A;  4INW A;  1QWV A; 
#chains in the Genus database with same CATH topology
 1PAL A;  1NX2 A;  2LMT A;  3K21 A;  5ER5 A;  3PM8 A;  1N2D A;  3NSI A;  2KDH A;  3IVT A;  2MBX A;  3CR2 A;  1K93 D;  1OMV A;  2V53 A;  3C1V A;  3FS7 A;  3S0E A;  1J1D A;  2OS8 C;  1SPY A;  1TOP A;  1LA0 A;  5IBW A;  3I5G C;  2SCP A;  3VRN A;  2MJW B;  4PHN A;  1XFU O;  2FOT A;  5CSN A;  1QVI Z;  1M31 A;  1TNP A;  1NX3 A;  1SL7 A;  3EK7 A;  1K9P A;  1OMR A;  1S6J A;  1F4Q A;  1A29 A;  2L0P A;  2L4H A;  2H61 C;  3A4U B;  1NWD A;  4FQO A;  2LP3 A;  3I5H C;  4BY5 A;  3CZT X;  1DJY A;  2JRF A;  4GFT A;  4NDC A;  2EHB A;  3UO9 A;  3PLF B;  1G4Y R;  2WND A;  2JZI A;  2RGI A;  1QX7 A;  1DJG A;  2K8M B;  5AEQ A;  1C07 A;  1J1E A;  1EG3 A;  1KQM C;  3GK1 A;  3JVT C;  3WXA A;  2JC2 A;  4PE1 A;  5CPV A;  2OS8 B;  3DF0 B;  4L9M A;  1QS7 A;  3DF0 A;  2JPO A;  3I5G B;  4YGB B;  1CNP A;  1DEK A;  2EC6 C;  1NX0 A;  1XFR A;  1OOI X;  1S6C A;  3HX4 A;  1XK4 A;  3D77 A;  1EG4 A;  2K60 A;  3VGO A;  2JT0 A;  1S5G Z;  2OTG C;  1C3Y A;  1H4B A;  1E8A A;  1CB1 A;  1DF0 B;  1Q80 A;  3TDU A;  3I5H B;  1DF0 A;  2WCJ A;  2ZND A;  1B8L A;  2ISD A;  4JQ0 D;  3WHU B;  5D3O A;  3PFV A;  5I2L A;  3BOW A;  3EK4 A;  5K89 A;  3D10 A;  3CGA A;  2JPT A;  3OB2 B;  2F3Y A;  3CR4 X;  1RK9 A;  1KQM B;  1SR6 B;  2LLT A;  1LXF C;  3IQO A;  1LVC D;  1QAS A;  3PAL A;  3SG7 A;  2MRD A;  1R6P A;  3GK2 A;  1KK7 Z;  3TZ1 A;  4CPV A;  4JPZ B;  3BFB A;  3D0Y B;  1SRA A;  3VRR A;  2EC6 B;  1SL9 A;  1DTL A;  2KI4 B;  4N5X A;  1BOD A;  1YX8 A;  4C0L A;  1A03 A;  5PAL A;  3ZNI A;  1DJW A;  1U5I B;  2CT9 A;  1YUT A;  1ORG A;  1U5I A;  2OTG B;  4OKH A;  3I5F B;  4XYN A;  3SG5 A;  1K2H A;  3EK8 A;  1TUJ A;  3VRQ A;  1J55 A;  1T14 A;  2KBM A;  1QJT A;  1FPW A;  2ZNE A;  1K94 A;  3TDI A;  3SG4 A;  1BT6 A;  1B8R A;  2WOS A;  4YGE B;  1PRW A;  1X02 A;  1OOH A;  1EH2 A;  2LVJ A;  3FIA A;  3CYZ A;  1SCV A;  2JWW A;  2HPS A;  1BF5 A;  1IQ3 A;  4MZK A;  1CDN A;  1TNW A;  2M29 A;  3BFH A;  3O6B A;  1S5G Y;  2F2O A;  4ORB B;  2B1U A;  3BJH A;  2ZRT A;  1N0Y A;  4MZJ A;  3DYE A;  1CFF A;  1WLZ A;  2KLE A;  4IJ7 A;  3LCP C;  2M1K B;  3MSE B;  1BR4 B;  1MF8 B;  2BE6 A;  3R1V A;  3AAK A;  1CMG A;  2G9B A;  1EXR A;  3L4A A;  3CS1 A;  5AFP A;  2JTT A;  5GQQ C;  3O2P A;  1B8C A;  2L98 A;  3LLE A;  1AP4 A;  3AAJ A;  1IG5 A;  1Y6W A;  2LLS A;  4JKT A;  2KFH A;  1DEL A;  1LKJ A;  1FF1 A;  1PVA A;  1WRZ A;  2K7B A;  2M8U A;  3CR5 X;  5D7F A;  1ZAC A;  5DIC A;  2K2A A;  5HLO A;  2WC6 A;  1RTP 1;  2E30 A;  5I8N A;  2I18 A;  1QLK A;  1GQM A;  1R2U A;  1MUX A;  3BFA A;  3R1O A;  4QJ3 B;  4YI9 A;  1F4O A;  3WNX B;  2LHI A;  3PSR A;  2D8N A;  1MXE A;  2ZN8 A;  1UP5 A;  3B87 A;  4ICB A;  5FYX A;  1DVI A;  3BQ3 A;  4GPL B;  1FI6 A;  2WCK A;  1UHI A;  4F7F A;  2QAC A;  2BL0 B;  1FI5 A;  1AJ4 A;  2QEV A;  2GV5 A;  1J7Q A;  2ZKM X;  5ER4 X;  3CDN A;  2BBN A;  1PSR A;  2ZFD A;  5HKY A;  2LAN A;  1J7R A;  2NZ0 A;  4M2O A;  3TS5 B;  1Y0V H;  2I94 A;  1MQ1 A;  1REC A;  2LV7 A;  1QAT A;  3B6X A;  4GGF C;  3DXL A;  1NCX A;  1XFX O;  2K2F A;  2A4J A;  2NXQ A;  2MA2 A;  1JWD A;  3AKB A;  4PAL A;  3TDZ A;  1V1F A;  1CM1 A;  1W7J B;  3O78 A;  2BCX A;  1K96 A;  1ZOT B;  4WRI A;  1B4C A;  3CZ2 A;  3S0D A;  3H4S E;  2JXC A;  2CCM A;  2LP2 A;  1LIN A;  2BE4 A;  1ZFS A;  4PE0 A;  3KHE A;  1CTR A;  2MAZ A;  2FJU B;  1NX1 A;  1C7W A;  1TTX A;  3OX5 A;  4OV2 A;  1QIW A;  1JC2 A;  4ETO A;  1B7T Z;  1SCM C;  3BUW B;  1M39 A;  4JWQ A;  1SY9 A;  2LUX A;  1TWO A;  1JFK A;  1PUL A;  1IQ5 A;  2KGR A;  2LNK A;  5HYD A;  2QDI A;  2K61 A;  1DJI A;  3NXA A;  1DT7 B;  5I2Q A;  1QV0 A;  2WCE A;  3E3R A;  2EGD A;  4TNC A;  1K9K A;  4Q04 A;  1WDC C;  4C0K A;  2HF5 A;  1DQE A;  1D1O A;  3HCM A;  1OZS A;  3NGV A;  2Y1N A;  1MXL C;  3EVV A;  3SIB A;  2BCB A;  1SSE B;  1Y1U A;  1K8U A;  2KSP A;  3ZWH A;  1A2X A;  1DJH A;  1XA5 A;  5AER A;  3V2L A;  1NCY A;  5FI2 A;  4I5K A;  2H8V A;  1L7Z A;  1HQV A;  1Z2C B;  2BKI B;  2M3W A;  2F33 A;  4I5J A;  1SCM B;  3B88 A;  2KNE A;  2H61 A;  4YGA A;  2JOJ A;  1L2O C;  2KQY A;  1SNL A;  5FI7 A;  2F2P A;  5HKW A;  4CFR A;  2WC5 A;  3DZT A;  1NIW A;  2JUL A;  2KQ6 A;  4ORC B;  2BEC A;  1IGV A;  1WDC B;  3CAB A;  2LM5 A;  1UHK A;  2M49 B;  3JVT B;  3RZS A;  1IRJ A;  1G8I A;  1QVI Y;  1FW4 A;  1KWO C;  2FJY A;  5DKN A;  1IJ5 A;  2FCE A;  1OOF A;  3RLZ A;  3SJS A;  2NCO A;  2BAP A;  3D0Y A;  3S0A A;  5KTY A;  5J3X A;  3D76 A;  1YVL A;  4ZCV A;  1YRT B;  2E6W A;  3D78 A;  3R1P A;  5DKR A;  3FE9 A;  1NPQ A;  1KQV A;  3EVU A;  1J7O A;  5B8I B;  1DGU A;  1JUO A;  3BUN B;  3OB1 B;  4N1G A;  1IH0 A;  2M97 A;  4P5O E;  2P6B B;  4GGN A;  1CFD A;  2KI6 D;  4INW A;  5F6T A;  2OPO A;  1KWO B;  3O4X A;  4U8D A;  1CDP A;  1JSA A;  2K7C A;  2BCA A;  5FI6 A;  4GUK A;  4PE7 A;  1YUS A;  2L2C A;  5DKQ A;  3GOF A;  3OP0 A;  2KYC A;  4A4B A;  1DJZ A;  1W9Z A;  1ALW A;  4PHK A;  1XFY O;  4YGC B;  3D73 A;  4MRX A;  5CSF A;  1AHR A;  3NHT A;  1MR8 A;  3LK0 A;  3SG3 A;  4DIR A;  3BXK A;  2CBL A;  1QXP A;  2LLU A;  3DVK A;  1Y1X A;  3PN7 C;  1F8H A;  1KK7 Y;  2IS9 A;  1OQP A;  3JTD C;  1C7V A;  1P28 A;  4PDZ A;  1CLM A;  1TUZ A;  3QRX A;  4F0Z B;  3VRO A;  3L47 A;  2AAO A;  3KO0 A;  2L5X B;  3B7A A;  2L4I A;  3OBV A;  4PHM A;  1AJ5 A;  1OW4 A;  3BUX B;  3CLN A;  4FQT A;  1CKK A;  1TCF A;  1DC1 A;  1GGZ A;  2Y4Q A;  2L51 A;  1M63 B;  3OGN A;  4GBA A;  5JJG A;  3IF7 A;  1CM4 A;  2K7O A;  2GGM A;  1CFP A;  4BY4 A;  4YI8 A;  3FE8 A;  2WCL A;  2KAY A;  4KYN A;  3PN7 B;  1BMO A;  3NHI A;  2LVI A;  1S36 A;  3NSO A;  4OR9 B;  1WRK A;  2BBM A;  1B47 A;  4YBH B;  2BNX A;  1OSA A;  2Q4U A;  3SS5 A;  4JD9 A;  3DVJ A;  5KU1 A;  1JF2 A;  1JFJ A;  2LE9 B;  1BLQ A;  2LVV A;  3VB1 A;  4HRH A;  3KF9 A;  1JBA A;  2COL B;  1W7I B;  2LCP A;  1KFU S;  2WCB A;  1F54 A;  1QV1 A;  1NSH A;  1SYM A;  3O4Y A;  1OOJ A;  4A4C A;  3CZ1 A;  1K90 D;  2JNF A;  1WY9 A;  3CZ0 A;  1Y1A A;  1DGV A;  2NLN A;  2WCF A;  1UWO A;  3EKH A;  3VRP A;  1F71 A;  1KFU L;  2QEH A;  4AQI A;  1C3Z A;  1MHO A;  1SMG A;  2PQL A;  4D1E A;  3DY9 A;  1M46 A;  2PAL A;  1TRF A;  5CSJ A;  1XYD A;  4AOM A;  1RFJ A;  4DUQ A;  4E68 A;  1EL4 A;  1KK8 C;  1ZUZ A;  2BKH B;  1KSM A;  2LUC A;  4GGF A;  1RRO A;  5G08 A;  1YX7 A;  1BR1 B;  2PSR A;  3NSL A;  4GNK B;  4YGD B;  2L50 A;  5I94 A;  2I2R E;  3PJI A;  2PMY A;  5D69 A;  4CID A;  1CDL A;  2Y5I A;  1A4P A;  4QJ4 B;  2KAV A;  1CLB A;  4NDD A;  2M1U A;  1OMD A;  1RWY A;  5AAN A;  1XO5 A;  1BU3 A;  4HRE E;  4CFQ A;  2L2E A;  1SL8 A;  3R72 A;  3SS3 A;  2HQW A;  1XK4 C;  2ERB A;  1YR5 A;  2JQ6 A;  1FBV A;  1AUI B;  2MLF C;  3SIA A;  2PAS A;  4PT1 A;  1PVB A;  3DVM A;  3N7H A;  2LVK A;  2G2B A;  2M7L A;  4AQJ A;  3FWC A;  3QME A;  2JU0 A;  3CTN A;  4WQ2 A;  2CNP A;  1YVH A;  2DOQ A;  1KK8 B;  2KAX A;  1XVJ A;  2K7D A;  4MRY A;  5HKZ A;  2P71 A;  4I5N B;  1OE9 B;  1XFZ O;  2LMU A;  1AVS A;  1SR6 C;  4R1E A;  1F55 A;  1NCZ A;  2PVB A;  1CLL A;  1SW8 A;  3OHM B;  4NQG A;  1AK8 A;  1V1G A;  1QIV A;  1QTX A;  2VRG A;  2GGZ A;  2KBI A;  2PRU A;  2JXL A;  1TIZ A;  1UHH A;  2L5Y A;  1BG1 A;  1UUS A;  1WLM A;  2KI4 C;  1OOG A;  3B86 A;  1B7T Y;  1CMF A;  1UHJ A;  3EKJ A;  4DRW A;  3S0B A;  1B1G A;  1NYA A;  3I5F C;  1QX5 B;  3M0W A;  2R2I A;  1B9A A;  1MWN A;  5EL2 A;  1GM0 A;  1TNX A;  3WHT B;  1F70 A;  3BOW B;  2JTZ A;  2KI6 C;  1L2O B;  4MVF A;  1UUR A;  5BPJ A;  2NCP A;  2LC5 A;  2P70 A;  2GTE A;  1UHN A;  1SBJ A;  2ZRS A;  3FWB A;  2KPH A;  1YUU A;  2CXJ A;  2KGB C;  4HSZ A;  5HL1 A;  1VRK A;  3CWG A;  1IKU A;  1RJV A;  5AXI A;  4M2P A;  2LHL A;  1S6I A;  1SK6 D;  1WRL A;  3BUO B;  1KFX S;  3TUY C;  2SAS A;  2LAP A;  4ZCU A;  2KOT A;  4NDB A;  1BJF A;  1JF0 A;  1M45 A;  2TN4 A;  3S0G A;  3I5I C;  4USL A;  2QEO A;  1BOC A;  4DS7 A;  3DVE A;  1S1E A;  3FE6 A;  4PHJ A;  1KFX L;  4M2Q A;  3S0F A;  2F3Z A;  3A8R A;  2JT8 A;  1QLS A;  1TNQ A;  1PSB A;  2YGU A;  2FCD A;  1LS8 A;  1GJY A;  1S26 D;  1YTZ C;  2KYF A;  2O5G A;  2WCM A;  2HQ8 A;  1DJX A;  2F8P A;  1EJ3 A;  4CLN A;  4MN0 A;  4OCI A;  3AKA A;  1XFW O;  4HRG A;  1IJ6 A;  3RM1 A;  1G33 A;  3TUY B;  1LA3 A;  4ORA B;  4MBE A;  1NUB A;  2MHH A;  1KSO A;  4OVN F;  3EVR A;  2WOR A;  2KLD A;  2M7N A;  2ZN9 A;  3PM2 A;  3NSK A;  4INX A;  3BYA A;  3SG6 A;  1K95 A;  2WC8 A;  3I5I B;  2BL0 C;  2O60 A;  2H2K A;  1A75 B;  1YUR A;  3DD4 A;  5I2O A;  2JT3 A;  3D74 A;  1A75 A;  1CDM A;  3D75 A;  4N1F A;  2KFG A;  4MSP A;  4C0J A;  1PK0 D;  1IIO A;  1QX2 A;  3Q8I A;  3GK4 X;  2K0J A;  1CFC A;  3JTD B;  4OZD A;  3PAT A;  4P2Y B;  5JOL A;  3KEV A;  1OZO A;  2QEB A;  3K1E A;  4WQ3 A;  3TS5 C;  1Z4H A;  1J7P A;  3KPX A;  2WCH A;  2KFF A;  1GGW A;  1IWQ A;  5CSI A;  3SS4 A;  2Q91 A;  4QJ5 B;  2AUC A;  3F45 A;  2MLE C;  3IQQ A;  1N65 A;  1XFV O;  3OX6 A;  4MEW A;  4MZL A;  4I5L B;  4PE4 A;  3EG5 B;  5HLV A;  4DCK A;  4XJK B;  4UPG A;  3LK1 A;  1DMO A;  4XJK A;  1NP8 A;  1YRU B;  2KHN A;  2HET A;  1K9U A;  4MLW A;  2M0R A;  5TNC A;  4YRU A;  4GAO A;  1HT9 A;  3SG2 A;  1ALV A;  2Y1M A;  5KSZ A;  1H8B A;  4IL1 A;  2JNX A;  4FTG A;  3LL8 B;  1KCY A;  2PYQ A;  1TCO B;  3L4L A;  4PCW A;  1ODB A;  2QPT A;  3UNW A;  2LMV A;  2CTN A;  1SKT A;  1ZMZ A;  1S3P A;  2M9G A;  2I7A A;  2AMI A;  3BUM B;  1TN4 A;  3ICB A;  1QWV A; 
#chains in the Genus database with same CATH homology
 5DIC A;  2WC6 A;  3BFA A;  3R1O A;  2L2C A;  3S0E A;  1OOG A;  3B86 A;  3B87 A;  3D73 A;  2WCK A;  3S0B A;  4F7F A;  2QEV A;  3NHT A;  1GM0 A;  5EL2 A;  3CDN A;  1P28 A;  2P70 A;  2GTE A;  3B6X A;  3DXL A;  3L47 A;  2KPH A;  3B7A A;  3CZ2 A;  1OW4 A;  3S0D A;  4FQT A;  2JPO A;  3OGN A;  1XFR A;  1OOI X;  3D77 A;  3S0G A;  3FE8 A;  2WCL A;  1C3Y A;  2QEO A;  2WCJ A;  3NHI A;  3FE6 A;  3S0F A;  1TWO A;  4JD9 A;  2QDI A;  3VB1 A;  1LS8 A;  2WCM A;  3BFB A;  1DQE A;  3NGV A;  3CZ1 A;  3CZ0 A;  4INX A;  3V2L A;  1ORG A;  2H8V A;  2QEH A;  3D74 A;  3D75 A;  1C3Z A;  1TUJ A;  2PQL A;  3B88 A;  1T14 A;  3DY9 A;  3Q8I A;  4OZD A;  1OOH A;  2WC5 A;  3DZT A;  2QEB A;  3K1E A;  3CYZ A;  3CAB A;  2WCH A;  3RZS A;  3PJI A;  3BFH A;  2FJY A;  1OOF A;  3BJH A;  3DYE A;  3S0A A;  3D76 A;  3R72 A;  3D78 A;  2ERB A;  3R1V A;  3R1P A;  4PT1 A;  3FE9 A;  3L4A A;  3N7H A;  3QME A;  3L4L A;  2P71 A;  4INW A;  1QWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...