1XFXO

Crystal structure of anthrax edema factor (ef) in complex with calmodulin in the presence of 10 millimolar exogenously added calcium chloride
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
146
structure length
146
Chain Sequence
b'QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDQMIREADIDGDGQVNYEEFVQMMTAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin-sensitive adenylate cyclase
molecule tags Lyase/metal binding protein
source organism Bacillus anthracis
publication title Calcium-independent calmodulin binding and two-metal-ion catalytic mechanism of anthrax edema factor.
pubmed doi rcsb
total genus 33
structure length 146
sequence length 146
chains with identical sequence P, Q, R, S, T
ec nomenclature
pdb deposition date 2004-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xfxO01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xfxO02
1KFXL 1MUXA 1J7QA 1KFXS 1KK7Z 4BY4A 1PULA 2LV7A 1B47A 3TDZA 3RM1A 3CWGA 1X02A 2LANA 1OMVA 4FTGA 1F54A 1UHKA 2KAVA 2BBMA 5KTYA 3LCPC 3TUYC 1FW4A 1NPQA 2PASA 1NWDA 2JXCA 2CBLA 2HPSA 3NSIA 1GGWA 3WHUB 2F2OA 2LHIA 4DCKA 1QX2A 3RLZA 1KQVA 2KBIA 3EK8A 1CFFA 2JTTA 3FIAA 1AVSA 3BOWA 4C0JA 1QX5B 2EGDA 2BL0B 1C07A 1J55A 3CZTX 3TS5C 3AKBA 1AP4A 1D1OA 1C7WA 2CCMA 1S5GY 3OB1B 2MA2A 4IL1A 3EVVA 1AUIB 4ETOA 3BYAA 4YBHB 3DVMA 3SIBA 1ZMZA 3NXAA 1OOJA 2BCAA 1ZUZA 3C1VA 5CSNA 2I2RE 1SR6C 3IQQA 3OHMB 1KQMC 3PN7B 1E8AA 2IS9A 3DVEA 4R1EA 2LE9B 1SPYA 1UURA 2HF5A 2LP2A 4DRWA 1GQMA 5I2OA 2GGZA 3TUYB 1B7TY 4OVNF 4QJ5B 2MLEC 5G08A 4P5OE 2F3ZA 1ZOTB 1MXEA 2P6BB 4TNCA 4XYNA 3TDIA 1OZSA 2JTZA 1V1FA 1L2OB 2RGIA 1S36A 2LVVA 3D10A 4L9MA 5DKQA 2JC2A 5HKYA 3PFVA 4MN0A 2K7BA 2KNEA 4AOMA 1B8RA 2BCBA 1GGZA 3I5GC 4D1EA 2LAPA 3DF0A 1RECA 4OCIA 1F8HA 2F33A 2JNFA 1B8CA 3K21A 4MZJA 2O5GA 1EJ3A 2DOQA 3LK1A 1QTXA 1PSBA 1J7PA 1B9AA 5HKZA 4A4CA 2FOTA 1N0YA 1OZOA 2M97A 1LINA 5HLOA 1WDCC 3ICBA 1IKUA 5PALA 1BG1A 5AANA 2Y4QA 1YUTA 3KHEA 4GPLB 4DIRA 1JUOA 5JJGA 1SL7A 1W7JB 3JVTC 2K8MB 2F3YA 1YX7A 1QV0A 1TCFA 4OKHA 2MAZA 2SCPA 5I2LA 4DUQA 1CLLA 2Y5IA 3NSLA 1SYMA 1QIWA 1IQ5A 1QLKA 3DVJA 1QJTA 1AHRA 1KWOC 1IQ3A 2KGBC 1OE9B 3I5FB 1M46A 2GV5A 1SK6D 2I18A 4Q04A 2L2EA 2JXLA 1SNLA 1TNXA 2H2KA 2ZFDA 3I5GB 3CLNA 3SJSA 2K2AA 3DD4A 2OPOA 1U5IA 2CNPA 2WCEA 4A4BA 1BR4B 2QACA 1NCZA 2MRDA 3SG6A 3BQ3A 4QJ3B 5JOLA 4N1FA 1CMGA 2WC8A 1WLZA 1DJXA 2WCFA 4HRHA 3CR4X 2G9BA 2MJWB 5AFPA 2JULA 1DT7B 3IF7A 2K0JA 1UWOA 1PVBA 1A2XA 3OP0A 4C0KA 3FWBA 2M7LA 3VGOA 4I5JA 1Y1AA 4GBAA 4U8DA 3SG3A 2LUXA 2PMYA 1A75A 4MBEA 1EG3A 4MZLA 4MEWA 4OV2A 1DJYA 1OMRA 2BKHB 4WQ2A 3GK2A 3O4YA 2H61C 1RTP1 3BUMB 1LVCD 3PATA 1JFJA 1KQMB 3PN7C 4YRUA 1QS7A 1S6CA 4MVFA 1KSMA 2KQYA 1HQVA 4WQ3A 2L0PA 3EK4A 1S3PA 1CDNA 2BE4A 1K9UA 1WRKA 1JC2A 1BU3A 1JF2A 2LMTA 3HX4A 2BECA 3KPXA 1SCVA 1M63B 1JWDA 1NX2A 2KAYA 1BJFA 1SRAA 1BOCA 1TCOB 2JQ6A 2KSPA 3DF0B 1NIWA 3PSRA 1DMOA 1RJVA 4YGDB 3O6BA 2MHHA 1W7IB 3OX6A 2BL0C 2M1UA 2CTNA 2LUCA 3OX5A 2M7NA 2K7CA 5KSZA 1JSAA 4PE7A 1TNWA 2BCXA 2LCPA 3WXAA 4CIDA 2HQ8A 1SR6B 2KI4C 1NYAA 4FQOA 3DVKA 3VRRA 2LVIA 4YGBB 1YRTB 1CTRA 3WHTB 1DJIA 3CGAA 2K2FA 2Y1NA 2B1UA 2VRGA 4PE1A 2FCDA 2LNKA 2L50A 2MLFC 1EG4A 1Y6WA 1QXPA 1WLMA 4BY5A 1WY9A 2M0RA 1S5GZ 1K90D 3EVRA 3CR2A 3KO0A 1R6PA 4NQGA 4PDZA 1PRWA 1BF5A 1VRKA 5D7FA 1UHJA 2SASA 4HSZA 2AAOA 1NP8A 2E30A 4JQ0D 2ZN8A 3BXKA 1ZFSA 2LC5A 1J7RA 3A8RA 1TN4A 1EH2A 1QASA 4M2QA 1CB1A 3QRXA 2FCEA 2KQ6A 1HT9A 2EHBA 4I5LB 4AQIA 1RFJA 1QIVA 2HQWA 1H4BA 1A4PA 1S6JA 1Y0VH 1A29A 4HREE 1QVIZ 2JOJA 1YRUB 4PHKA 1FF1A 4YGCB 4NDCA 1WRLA 2KDHA 1AJ4A 1YURA 2ZN9A 3HCMA 4JPZB 4MRXA 5HYDA 1FI5A 2LLTA 1DJWA 2ZNDA 1LA0A 2PALA 1NX0A 5J3XA 1XA5A 3BUXB 3EKHA 1CFDA 4USLA 1SBJA 3CS1A 2LP3A 3O78A 2K7DA 1IG5A 1TIZA 1CLBA 2Y1MA 1AK8A 1KSOA 1LA3A 1UHIA 2PSRA 2LLSA 4QJ4B 4GGFA 4YGAA 5KU1A 1XFUO 1MQ1A 2LHLA 1XO5A 4ZCVA 4WRIA 4GAOA 1G4YR 1PALA 5FYXA 5I2QA 1H8BA 1YX8A 2WOSA 3EK7A 1ODBA 4MLWA 2LMUA 2H61A 2CXJA 2KFHA 3VRQA 2AUCA 1F4QA 1KFUL 1BODA 3PALA 2OTGB 2R2IA 1K94A 3EKJA 4F0ZB 1CDLA 1SW8A 1B8LA 1TRFA 1SL8A 1XFVO 3F45A 4MRYA 4ZCUA 1FBVA 1ALWA 1RROA 1IRJA 3JVTB 4PE0A 2JNXA 3I5HB 2HETA 3BUNB 4OR9B 2WNDA 2NLNA 1WRZA 1RWYA 1K93D 1R2UA 1TNQA 2KOTA 4ORAB 5IBWA 2NZ0A 3SG7A 1EXRA 3JTDB 1M31A 1A03A 2KI6D 2WORA 4DS7A 1K95A 1MHOA 5K89A 4YGEB 4NDDA 1CM1A 1QV1A 1YUSA 3AAJA 4YI8A 5B8IB 2KGRA 1SY9A 3CR5X 3CTNA 5CPVA 1JBAA 1NX1A 1J1EA 1SL9A 4GGFC 2I94A 2KAXA 4CFRA 1JFKA 1Y1UA 1WDCB 1GJYA 2JT3A 4P2YB 4GNKB 2TN4A 1IJ6A 2KFGA 1K96A 2M9GA 2LMVA 2KBMA 5TNCA 2O60A 3WNXB 1K9KA 1PK0D 1PSRA 2OS8C 4M2OA 5GQQC 2F2PA 1KK7Y 3I5IC 3PLFB 4N5XA 1UP5A 1YVLA 2GGMA 2LVJA 4PALA 5AEQA 1OSAA 1CMFA 2LVKA 1Q80A 2A4JA 3PM8A 3SIAA 2M3WA 3I5IB 3ZNIA 1KFUS 5DKNA 2ISDA 1M39A 4ORBB 2KI4B 3GK4X 2OS8B 3M0WA 1BR1B 1MF8B 2M8UA 1F4OA 1KCYA 1S1EA 3IQOA 2AMIA 1NSHA 2K7OA 2LM5A 1SCMB 2L5XB 5ER5A 1TOPA 1B1GA 1BLQA 2PRUA 1EL4A 1NUBA 1MR8A 1B4CA 2Q91A 1DGUA 2QPTA 5F6TA 3TZ1A 1K8UA 3VRNA 2JU0A 3VRPA 2F8PA 4C0LA 4NDBA 2FJUB 1KK8C 1TNPA 3BUWB 2KFFA 2COLB 3E3RA 1CLMA 1XYDA 1G8IA 1IWQA 1KK8B 3OB2B 1CDMA 1QATA 1DJHA 1G33A 2LLUA 3KF9A 3NSKA 3JTDC 2M49B 4ICBA 4E68A 1YUUA 3D0YB 4GGNA 4I5KA 4N1GA 2JT0A 1OMDA 5HLVA 2L4HA 2V53A 1CDPA 3TDUA 3O2PA 3TS5B 1J1DA 1QVIY 1ZACA 1DTLA 1QLSA 1DJGA 1SCMC 1U5IB 2JZIA 2MBXA 1DF0A 2L98A 2NCPA 2ZNEA 4M2PA 5CSFA 2NCOA 1J7OA 3FS7A 1XFXO 2M29A 3SG5A 1OQPA 4PCWA 1PVAA 1F70A 1CM4A 1K9PA 1YTZC 3LL8B 4MSPA 2JWWA 5AERA 1RK9A 2K61A 2KYFA 1BMOA 1NCYA 4MZKA 5CSJA 4CPVA 1UUSA 2BE6A 1F55A 4XJKB 2EC6C 2JT8A 1NX3A 2M1KB 1NCXA 2NXQA 4HRGA 1FPWA 1S6IA 2CT9A 2E6WA 3LLEA 3SG4A 3FWCA 4GUKA 1YR5A 2BBNA 5HKWA 1DVIA 3I5HC 3I5FC 1XVJA 1IGVA 1S26D 3GOFA 1KWOB 4AQJA 1CFCA 2ZRSA 4CLNA 1V1GA 1XFWO 5D69A 4UPGA 3SG2A 1IH0A 1TTXA 2OTGC 3H4SE 4PHJA 1YVHA 1SKTA 2KI6C 1CFPA 2JPTA 1N65A 4GFTA 3EVUA 2ZKMX 3BUOB 1BT6A 5I8NA 1XK4C 4YI9A 1QX7A 1MXLC 1UHNA 2KYCA 4JWQA 1F71A 1FI6A 5BPJA 4PHMA 3LK0A 3MSEB 2G2BA 1K2HA 1AJ5A 3A4UB 1LKJA 2JRFA 1DGVA 3VROA 1XFZO 1N2DA 2BKIB 4CFQA 2Q4UA 1M45A 1SMGA 2PVBA 1Y1XA 4I5NB 2EC6B 3GK1A 2WCBA 1L7ZA 1CNPA 1IJ5A 4XJKA 5AXIA 1CKKA 5ER4X 2L51A 3BOWB 4ORCB 1XFYO 5DKRA 3AAKA 1DJZA 3ZWHA 1ALVA 1C7VA 3AKAA 1L2OC 2D8NA 1JF0A 1LXFC 3NSOA 1MWNA 2L4IA 5CSIA 2ZRTA 1B7TZ 1A75B 1XK4A 1UHHA 2KHNA 2I7AA 4PE4A 3D0YA 4PHNA 1DF0B 3KEVA
chains in the Genus database with same CATH superfamily
3L4AA 1KFXL 1MUXA 1J7QA 1KFXS 3IVTA 1KK7Z 4BY4A 1PULA 2LV7A 1B47A 3TDZA 3RM1A 3CWGA 1X02A 2LANA 1OMVA 4FTGA 1F54A 1UHKA 2KAVA 2BBMA 2QEVA 3LCPC 5KTYA 3TUYC 1FW4A 1NPQA 2PASA 2PQLA 1NWDA 2JXCA 2CBLA 2HPSA 3NSIA 1GGWA 2P70A 3WHUB 2F2OA 2LHIA 4DCKA 1QX2A 3RLZA 1KQVA 2KBIA 3B6XA 3EK8A 1CFFA 2JTTA 3FIAA 4F7FA 4OZDA 1AVSA 3BOWA 4C0JA 1QX5B 2EGDA 1TUZA 2BL0B 3O4XA 1C07A 1J55A 3CZTX 3CZ2A 3TS5C 3AKBA 5D3OA 3UO9A 3PJIA 1C7WA 1AP4A 1D1OA 2CCMA 1S5GY 3OB1B 2MA2A 4IL1A 3EVVA 1AUIB 2QEBA 4ETOA 3BYAA 4YBHB 3DVMA 3SIBA 1ZMZA 3NXAA 1OOJA 2WCLA 1C3YA 2BCAA 1ZUZA 3C1VA 2GTEA 2I2RE 5CSNA 3L47A 1ORGA 3S0DA 1SR6C 3IQQA 3OHMB 1KQMC 3PN7B 1E8AA 2IS9A 3DVEA 4R1EA 2LE9B 3BFHA 1SPYA 1UURA 1XFRA 2HF5A 2LP2A 4DRWA 1GQMA 5I2OA 2GGZA 3TUYB 3CDNA 1B7TY 4OVNF 4QJ5B 2MLEC 5G08A 4P5OE 2F3ZA 1ZOTB 2L5YA 3R72A 2KLDA 1MXEA 2P6BB 4TNCA 4XYNA 3TDIA 1OZSA 2JTZA 1V1FA 1DELA 1L2OB 2RGIA 1S36A 2LVVA 2WCHA 3D10A 2WCKA 3Q8IA 4L9MA 5DKQA 2JC2A 5HKYA 3PFVA 4MN0A 2K7BA 2KNEA 4AOMA 1B8RA 2BCBA 1GGZA 3I5GC 4D1EA 2LAPA 3DF0A 1RECA 4OCIA 1F8HA 2F33A 2JNFA 1B8CA 3K21A 4MZJA 2O5GA 1EJ3A 2DOQA 3LK1A 3FE9A 1QTXA 2WCMA 1PSBA 1J7PA 1B9AA 5HKZA 4A4CA 2FOTA 1N0YA 1OZOA 2M97A 1LINA 3R1OA 5HLOA 1WDCC 3ICBA 1IKUA 5PALA 4INWA 5AANA 1BG1A 2Y4QA 1YUTA 3KHEA 4GPLB 3L4LA 4DIRA 1JUOA 5JJGA 1SL7A 1QWVA 1W7JB 3JVTC 2K8MB 3S0FA 4JD9A 2F3YA 1YX7A 1QV0A 1TCFA 4OKHA 2MAZA 2SCPA 5I2LA 4DUQA 1CLLA 2Y5IA 3VB1A 3NSLA 1SYMA 2BAPA 1QIWA 1IQ5A 1OOHA 1QLKA 3DVJA 1Z2CB 1QJTA 1AHRA 1KWOC 1IQ3A 2KGBC 1OE9B 3I5FB 1M46A 2GV5A 1SK6D 2I18A 4Q04A 2L2EA 2JXLA 1SNLA 1TNXA 2H2KA 2ZFDA 3I5GB 3CLNA 3SJSA 2K2AA 3DD4A 2OPOA 1U5IA 2CNPA 1OW4A 2WCEA 4A4BA 1BR4B 2QACA 1NCZA 2MRDA 3SG6A 3BQ3A 4QJ3B 5JOLA 4N1FA 1CMGA 2JPOA 4INXA 3N7HA 2WC8A 1WLZA 1DJXA 2WCFA 4HRHA 3CR4X 2G9BA 2MJWB 5AFPA 2JULA 1DT7B 3IF7A 2K0JA 1UWOA 1PVBA 1A2XA 3OP0A 4C0KA 3FWBA 5I94A 2M7LA 3DZTA 3VGOA 4I5JA 1Y1AA 4GBAA 3D76A 4U8DA 3SG3A 2LUXA 2PMYA 1A75A 4MBEA 1EG3A 3D73A 4MZLA 4MEWA 4OV2A 1DJYA 1OMRA 2BKHB 2H8VA 3GK2A 3O4YA 4WQ2A 2H61C 1RTP1 3BUMB 1LVCD 3D74A 3PATA 1JFJA 1KQMB 3PN7C 4YRUA 1QS7A 1S6CA 4MVFA 1KSMA 2KQYA 1HQVA 4WQ3A 2L0PA 3EK4A 1S3PA 1CDNA 2BE4A 1K9UA 1WRKA 1JC2A 1BU3A 1JF2A 2LMTA 3HX4A 2BECA 3KPXA 1SCVA 1M63B 1JWDA 1NX2A 1P28A 1BJFA 2KAYA 1SRAA 2QDIA 1BOCA 1TCOB 2JQ6A 2KSPA 3DF0B 1NIWA 3PSRA 1DMOA 5FI2A 1RJVA 4YGDB 3O6BA 2MHHA 1W7IB 3SS4A 3OX6A 4FQTA 2BL0C 1TWOA 3R1PA 2M1UA 3V2LA 2CTNA 2LUCA 3OX5A 2M7NA 2K7CA 5KSZA 1JSAA 4PE7A 1TNWA 2BCXA 2LCPA 3WXAA 4CIDA 2HQ8A 1SR6B 2KI4C 1IIOA 1NYAA 4FQOA 2YGUA 3DVKA 3VRRA 2LVIA 4YGBB 3CABA 1YRTB 1CTRA 3WHTB 1DJIA 3B88A 3CGAA 2K2FA 2Y1NA 2B1UA 2VRGA 4PE1A 2FCDA 2LNKA 2L50A 2MLFC 1EG4A 5DICA 1Y6WA 1QXPA 1WLMA 4BY5A 1WY9A 2M0RA 1S5GZ 1K90D 3EVRA 3CR2A 3KO0A 1R6PA 3OGNA 3QMEA 4NQGA 4PDZA 1PRWA 1BF5A 1VRKA 5D7FA 1UHJA 2SASA 4HSZA 2AAOA 1NP8A 2E30A 4JQ0D 2ZN8A 3D78A 3BXKA 1ZFSA 2LC5A 1J7RA 3A8RA 1TN4A 1EH2A 1QASA 1Z4HA 4M2QA 4PT1A 1CB1A 3QRXA 2FCEA 2KQ6A 1HT9A 2EHBA 4I5LB 4AQIA 1OOGA 1RFJA 1QIVA 2HQWA 1H4BA 1A4PA 1S6JA 1Y0VH 1A29A 4HREE 1QVIZ 3NHIA 2JOJA 1YRUB 4PHKA 1FF1A 4YGCB 4NDCA 1OOFA 1WRLA 4IJ7A 2KDHA 1AJ4A 1YURA 1DQEA 2ZN9A 3HCMA 4JPZB 4MRXA 5HYDA 1FI5A 2LLTA 1DJWA 2ZNDA 1LA0A 2PALA 2KLEA 1NX0A 5J3XA 1XA5A 3FE6A 3BUXB 3EKHA 1CFDA 4USLA 1SBJA 3CS1A 2LP3A 2KPHA 3BJHA 3O78A 2K7DA 1IG5A 1TIZA 1CLBA 2Y1MA 1AK8A 1KSOA 1LA3A 1UHIA 2PSRA 2LLSA 4QJ4B 4GGFA 4YGAA 5KU1A 1XFUO 1MQ1A 2LHLA 1XO5A 4ZCVA 4WRIA 4GAOA 3SS3A 1G4YR 1PALA 5FYXA 5I2QA 1H8BA 1YX8A 2WOSA 3B87A 3EK7A 1ODBA 2WCJA 3CZ1A 4MLWA 2LMUA 2H61A 2CXJA 2KFHA 2QEHA 3VRQA 2AUCA 3R1VA 1F4QA 1KFUL 1BODA 3PALA 2OTGB 2R2IA 1K94A 3EKJA 4F0ZB 1CDLA 1SW8A 1B8LA 1TRFA 1SL8A 3DYEA 1XFVO 3F45A 4MRYA 4ZCUA 1FBVA 1ALWA 1RROA 1IRJA 3JVTB 4PE0A 2JNXA 3I5HB 2HETA 3BUNB 4OR9B 2WNDA 2NLNA 1WRZA 1RWYA 1K93D 3BFBA 1R2UA 1TNQA 2KOTA 4ORAB 5IBWA 3S0GA 2NZ0A 3SG7A 2PYQA 1EXRA 3JTDB 3S0BA 1M31A 1A03A 2KI6D 2WORA 4DS7A 1K95A 3SS5A 3DXLA 1MHOA 5K89A 4YGEB 4NDDA 1CM1A 1QV1A 1YUSA 3AAJA 4YI8A 5B8IB 2KGRA 1SY9A 3CR5X 3CTNA 5CPVA 1JBAA 1NX1A 1J1EA 1SL9A 4GGFC 2I94A 2KAXA 4CFRA 1JFKA 1Y1UA 1WDCB 3RZSA 1GJYA 2JT3A 2K60A 3B86A 4GNKB 4P2YB 2TN4A 1IJ6A 2KFGA 1K96A 1LS8A 2LMVA 2M9GA 3CZ0A 1C3ZA 2KBMA 5TNCA 2QEOA 2O60A 3WNXB 1K9KA 1PK0D 1PSRA 1W9ZA 2OS8C 3CYZA 4PHNA 4M2OA 5GQQC 2F2PA 1KK7Y 2BNXA 4JKTA 3I5IC 3PLFB 4N5XA 1UP5A 1YVLA 2GGMA 2LVJA 4PALA 5AEQA 1OSAA 1CMFA 2LVKA 1T14A 5FI6A 1Q80A 2A4JA 3PM8A 3SIAA 2M3WA 3I5IB 3ZNIA 1KFUS 5DKNA 2FJYA 2ISDA 1M39A 4ORBB 2KI4B 3GK4X 2OS8B 3M0WA 1BR1B 1MF8B 2M8UA 1F4OA 1KCYA 5FI7A 1S1EA 3IQOA 2AMIA 1NSHA 2K7OA 2LM5A 3D77A 1SCMB 2L5XB 5ER5A 1TOPA 1B1GA 1BLQA 2PRUA 1EL4A 1NUBA 1MR8A 1B4CA 2Q91A 1DGUA 2QPTA 5F6TA 3TZ1A 1K8UA 3VRNA 2JU0A 3VRPA 2F8PA 4C0LA 4NDBA 2FJUB 1KK8C 1TNPA 3BUWB 2KFFA 2COLB 3E3RA 1CLMA 1XYDA 1G8IA 1IWQA 1KK8B 3K1EA 3OB2B 1CDMA 1QATA 1DJHA 1G33A 2LLUA 3KF9A 3NSKA 3JTDC 2M49B 2WC5A 4ICBA 4E68A 1YUUA 3D0YB 4GGNA 4I5KA 4N1GA 2JT0A 1OMDA 3DY9A 5HLVA 2L4HA 2V53A 1CDPA 3TDUA 3O2PA 3TS5B 1J1DA 1QVIY 1ZACA 1DTLA 1GM0A 1QLSA 3B7AA 1DJGA 1SCMC 1U5IB 2JZIA 2MBXA 1DF0A 2L98A 2NCPA 2ZNEA 4M2PA 5CSFA 2NCOA 1J7OA 3FS7A 1XFXO 2M29A 3SG5A 4KYNA 1OQPA 1SSEB 4PCWA 1PVAA 1F70A 1CM4A 1K9PA 1YTZC 3LL8B 4MSPA 2JWWA 5AERA 2P71A 1RK9A 2K61A 2KYFA 1BMOA 1NCYA 4MZKA 5CSJA 4CPVA 1OOIX 1UUSA 2BE6A 5EL2A 4XJKB 1F55A 2EC6C 2JT8A 1NX3A 2M1KB 1NCXA 2NXQA 4HRGA 1FPWA 1S6IA 2CT9A 2E6WA 3LLEA 3SG4A 3FWCA 4GUKA 1YR5A 5HL1A 2BBNA 5HKWA 3S0EA 3BFAA 1DVIA 3I5HC 3I5FC 1XVJA 1IGVA 1S26D 3GOFA 1KWOB 4AQJA 1CFCA 2ZRSA 3OBVA 1V1GA 4CLNA 1XFWO 5D69A 4UPGA 3S0AA 3NHTA 3SG2A 1IH0A 2WC6A 1TTXA 2OTGC 3H4SE 4PHJA 1YVHA 1SKTA 2KI6C 1CFPA 2JPTA 1N65A 4GFTA 3EVUA 3EG5B 2ZKMX 1DC1A 3BUOB 1BT6A 5I8NA 1XK4C 4YI9A 3UNWA 1QX7A 1MXLC 1UHNA 2KYCA 4JWQA 1F71A 1FI6A 5BPJA 4PHMA 3LK0A 3MSEB 2G2BA 1K2HA 1AJ5A 3A4UB 1LKJA 2JRFA 1DGVA 1TUJA 3VROA 1XFZO 1N2DA 2BKIB 4CFQA 2Q4UA 3D75A 2ERBA 1M45A 1SMGA 2PVBA 1Y1XA 4I5NB 2EC6B 3GK1A 2WCBA 1L7ZA 3NGVA 1IJ5A 4XJKA 5AXIA 1CKKA 5ER4X 1CNPA 2L51A 3BOWB 4ORCB 1XFYO 5DKRA 3AAKA 1DJZA 3ZWHA 1ALVA 1C7VA 3AKAA 1L2OC 2D8NA 1JF0A 1LXFC 3NSOA 1MWNA 2L4IA 5CSIA 2ZRTA 1B7TZ 1DEKA 1A75B 1XK4A 1UHHA 2L2CA 2KHNA 2I7AA 3FE8A 4PE4A 3D0YA 3PM2A 1DF0B 3KEVA
chains in the Genus database with same CATH topology
1KFXL 1MUXA 1J7QA 1KFXS 1KK7Z 4BY4A 1PULA 2LV7A 1B47A 3TDZA 3RM1A 3CWGA 1X02A 2LANA 1OMVA 4FTGA 1F54A 1UHKA 2KAVA 2BBMA 5KTYA 3LCPC 3TUYC 1FW4A 1NPQA 2PASA 1NWDA 2JXCA 2CBLA 2HPSA 3NSIA 1GGWA 3WHUB 2F2OA 2LHIA 4DCKA 1QX2A 3RLZA 1KQVA 2KBIA 3EK8A 1CFFA 2JTTA 3FIAA 1AVSA 3BOWA 4C0JA 1QX5B 2EGDA 2BL0B 1C07A 1J55A 3CZTX 3TS5C 3AKBA 1AP4A 1D1OA 1C7WA 2CCMA 1S5GY 3OB1B 2MA2A 4IL1A 3EVVA 1AUIB 4ETOA 3BYAA 4YBHB 3DVMA 3SIBA 1ZMZA 3NXAA 1OOJA 2BCAA 1ZUZA 3C1VA 5CSNA 2I2RE 1SR6C 3IQQA 3OHMB 1KQMC 3PN7B 1E8AA 2IS9A 3DVEA 4R1EA 2LE9B 1SPYA 1UURA 2HF5A 2LP2A 4DRWA 1GQMA 5I2OA 2GGZA 3TUYB 1B7TY 4OVNF 4QJ5B 2MLEC 5G08A 4P5OE 2F3ZA 1ZOTB 1MXEA 2P6BB 4TNCA 4XYNA 3TDIA 1OZSA 2JTZA 1V1FA 1L2OB 2RGIA 1S36A 2LVVA 3D10A 4L9MA 5DKQA 2JC2A 5HKYA 3PFVA 4MN0A 2K7BA 2KNEA 4AOMA 1B8RA 2BCBA 1GGZA 3I5GC 4D1EA 2LAPA 3DF0A 1RECA 4OCIA 1F8HA 2F33A 2JNFA 1B8CA 3K21A 4MZJA 2O5GA 1EJ3A 2DOQA 3LK1A 1QTXA 1PSBA 1J7PA 1B9AA 5HKZA 4A4CA 2FOTA 1N0YA 1OZOA 2M97A 1LINA 5HLOA 1WDCC 3ICBA 1IKUA 5PALA 1BG1A 5AANA 2Y4QA 1YUTA 3KHEA 4GPLB 4DIRA 1JUOA 5JJGA 1SL7A 1W7JB 3JVTC 2K8MB 2F3YA 1YX7A 1QV0A 1TCFA 4OKHA 2MAZA 2SCPA 5I2LA 4DUQA 1CLLA 2Y5IA 3NSLA 1SYMA 1QIWA 1IQ5A 1QLKA 3DVJA 1QJTA 1AHRA 1KWOC 1IQ3A 2KGBC 1OE9B 3I5FB 1M46A 2GV5A 1SK6D 2I18A 4Q04A 2L2EA 2JXLA 1SNLA 1TNXA 2H2KA 2ZFDA 3I5GB 3CLNA 3SJSA 2K2AA 3DD4A 2OPOA 1U5IA 2CNPA 2WCEA 4A4BA 1BR4B 2QACA 1NCZA 2MRDA 3SG6A 3BQ3A 4QJ3B 5JOLA 4N1FA 1CMGA 2WC8A 1WLZA 1DJXA 2WCFA 4HRHA 3CR4X 2G9BA 2MJWB 5AFPA 2JULA 1DT7B 3IF7A 2K0JA 1UWOA 1PVBA 1A2XA 3OP0A 4C0KA 3FWBA 2M7LA 3VGOA 4I5JA 1Y1AA 4GBAA 4U8DA 3SG3A 2LUXA 2PMYA 1A75A 4MBEA 1EG3A 4MZLA 4MEWA 4OV2A 1DJYA 1OMRA 2BKHB 4WQ2A 3GK2A 3O4YA 2H61C 1RTP1 3BUMB 1LVCD 3PATA 1JFJA 1KQMB 3PN7C 4YRUA 1QS7A 1S6CA 4MVFA 1KSMA 2KQYA 1HQVA 4WQ3A 2L0PA 3EK4A 1S3PA 1CDNA 2BE4A 1K9UA 1WRKA 1JC2A 1BU3A 1JF2A 2LMTA 3HX4A 2BECA 3KPXA 1SCVA 1M63B 1JWDA 1NX2A 2KAYA 1BJFA 1SRAA 1BOCA 1TCOB 2JQ6A 2KSPA 3DF0B 1NIWA 3PSRA 1DMOA 1RJVA 4YGDB 3O6BA 2MHHA 1W7IB 3OX6A 2BL0C 2M1UA 2CTNA 2LUCA 3OX5A 2M7NA 2K7CA 5KSZA 1JSAA 4PE7A 1TNWA 2BCXA 2LCPA 3WXAA 4CIDA 2HQ8A 1SR6B 2KI4C 1NYAA 4FQOA 3DVKA 3VRRA 2LVIA 4YGBB 1YRTB 1CTRA 3WHTB 1DJIA 3CGAA 2K2FA 2Y1NA 2B1UA 2VRGA 4PE1A 2FCDA 2LNKA 2L50A 2MLFC 1EG4A 1Y6WA 1QXPA 1WLMA 4BY5A 1WY9A 2M0RA 1S5GZ 1K90D 3EVRA 3CR2A 3KO0A 1R6PA 4NQGA 4PDZA 1PRWA 1BF5A 1VRKA 5D7FA 1UHJA 2SASA 4HSZA 2AAOA 1NP8A 2E30A 4JQ0D 2ZN8A 3BXKA 1ZFSA 2LC5A 1J7RA 3A8RA 1TN4A 1EH2A 1QASA 4M2QA 1CB1A 3QRXA 2FCEA 2KQ6A 1HT9A 2EHBA 4I5LB 4AQIA 1RFJA 1QIVA 2HQWA 1H4BA 1A4PA 1S6JA 1Y0VH 1A29A 4HREE 1QVIZ 2JOJA 1YRUB 4PHKA 1FF1A 4YGCB 4NDCA 1WRLA 2KDHA 1AJ4A 1YURA 2ZN9A 3HCMA 4JPZB 4MRXA 5HYDA 1FI5A 2LLTA 1DJWA 2ZNDA 1LA0A 2PALA 1NX0A 5J3XA 1XA5A 3BUXB 3EKHA 1CFDA 4USLA 1SBJA 3CS1A 2LP3A 3O78A 2K7DA 1IG5A 1TIZA 1CLBA 2Y1MA 1AK8A 1KSOA 1LA3A 1UHIA 2PSRA 2LLSA 4QJ4B 4GGFA 4YGAA 5KU1A 1XFUO 1MQ1A 2LHLA 1XO5A 4ZCVA 4WRIA 4GAOA 1G4YR 1PALA 5FYXA 5I2QA 1H8BA 1YX8A 2WOSA 3EK7A 1ODBA 4MLWA 2LMUA 2H61A 2CXJA 2KFHA 3VRQA 2AUCA 1F4QA 1KFUL 1BODA 3PALA 2OTGB 2R2IA 1K94A 3EKJA 4F0ZB 1CDLA 1SW8A 1B8LA 1TRFA 1SL8A 1XFVO 3F45A 4MRYA 4ZCUA 1FBVA 1ALWA 1RROA 1IRJA 3JVTB 4PE0A 2JNXA 3I5HB 2HETA 3BUNB 4OR9B 2WNDA 2NLNA 1WRZA 1RWYA 1K93D 1R2UA 1TNQA 2KOTA 4ORAB 5IBWA 2NZ0A 3SG7A 1EXRA 3JTDB 1M31A 1A03A 2KI6D 2WORA 4DS7A 1K95A 1MHOA 5K89A 4YGEB 4NDDA 1CM1A 1QV1A 1YUSA 3AAJA 4YI8A 5B8IB 2KGRA 1SY9A 3CR5X 3CTNA 5CPVA 1JBAA 1NX1A 1J1EA 1SL9A 4GGFC 2I94A 2KAXA 4CFRA 1JFKA 1Y1UA 1WDCB 1GJYA 2JT3A 4P2YB 4GNKB 2TN4A 1IJ6A 2KFGA 1K96A 2M9GA 2LMVA 2KBMA 5TNCA 2O60A 3WNXB 1K9KA 1PK0D 1PSRA 2OS8C 4M2OA 5GQQC 2F2PA 1KK7Y 3I5IC 3PLFB 4N5XA 1UP5A 1YVLA 2GGMA 2LVJA 4PALA 5AEQA 1OSAA 1CMFA 2LVKA 1Q80A 2A4JA 3PM8A 3SIAA 2M3WA 3I5IB 3ZNIA 1KFUS 5DKNA 2ISDA 1M39A 4ORBB 2KI4B 3GK4X 2OS8B 3M0WA 1BR1B 1MF8B 2M8UA 1F4OA 1KCYA 1S1EA 3IQOA 2AMIA 1NSHA 2K7OA 2LM5A 1SCMB 2L5XB 5ER5A 1TOPA 1B1GA 1BLQA 2PRUA 1EL4A 1NUBA 1MR8A 1B4CA 2Q91A 1DGUA 2QPTA 5F6TA 3TZ1A 1K8UA 3VRNA 2JU0A 3VRPA 2F8PA 4C0LA 4NDBA 2FJUB 1KK8C 1TNPA 3BUWB 2KFFA 2COLB 3E3RA 1CLMA 1XYDA 1G8IA 1IWQA 1KK8B 3OB2B 1CDMA 1QATA 1DJHA 1G33A 2LLUA 3KF9A 3NSKA 3JTDC 2M49B 4ICBA 4E68A 1YUUA 3D0YB 4GGNA 4I5KA 4N1GA 2JT0A 1OMDA 5HLVA 2L4HA 2V53A 1CDPA 3TDUA 3O2PA 3TS5B 1J1DA 1QVIY 1ZACA 1DTLA 1QLSA 1DJGA 1SCMC 1U5IB 2JZIA 2MBXA 1DF0A 2L98A 2NCPA 2ZNEA 4M2PA 5CSFA 2NCOA 1J7OA 3FS7A 1XFXO 2M29A 3SG5A 1OQPA 4PCWA 1PVAA 1F70A 1CM4A 1K9PA 1YTZC 3LL8B 4MSPA 2JWWA 5AERA 1RK9A 2K61A 2KYFA 1BMOA 1NCYA 4MZKA 5CSJA 4CPVA 1UUSA 2BE6A 1F55A 4XJKB 2EC6C 2JT8A 1NX3A 2M1KB 1NCXA 2NXQA 4HRGA 1FPWA 1S6IA 2CT9A 2E6WA 3LLEA 3SG4A 3FWCA 4GUKA 1YR5A 2BBNA 5HKWA 1DVIA 3I5HC 3I5FC 1XVJA 1IGVA 1S26D 3GOFA 1KWOB 4AQJA 1CFCA 2ZRSA 4CLNA 1V1GA 1XFWO 5D69A 4UPGA 3SG2A 1IH0A 1TTXA 2OTGC 3H4SE 4PHJA 1YVHA 1SKTA 2KI6C 1CFPA 2JPTA 1N65A 4GFTA 3EVUA 2ZKMX 3BUOB 1BT6A 5I8NA 1XK4C 4YI9A 1QX7A 1MXLC 1UHNA 2KYCA 4JWQA 1F71A 1FI6A 5BPJA 4PHMA 3LK0A 3MSEB 2G2BA 1K2HA 1AJ5A 3A4UB 1LKJA 2JRFA 1DGVA 3VROA 1XFZO 1N2DA 2BKIB 4CFQA 2Q4UA 1M45A 1SMGA 2PVBA 1Y1XA 4I5NB 2EC6B 3GK1A 2WCBA 1L7ZA 1CNPA 1IJ5A 4XJKA 5AXIA 1CKKA 5ER4X 2L51A 3BOWB 4ORCB 1XFYO 5DKRA 3AAKA 1DJZA 3ZWHA 1ALVA 1C7VA 3AKAA 1L2OC 2D8NA 1JF0A 1LXFC 3NSOA 1MWNA 2L4IA 5CSIA 2ZRTA 1B7TZ 1A75B 1XK4A 1UHHA 2KHNA 2I7AA 4PE4A 3D0YA 4PHNA 1DF0B 3KEVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KFX L;  1MUX A;  1J7Q A;  1KFX S;  1KK7 Z;  4BY4 A;  1PUL A;  2LV7 A;  1B47 A;  3TDZ A;  3RM1 A;  3CWG A;  1X02 A;  2LAN A;  1OMV A;  4FTG A;  1F54 A;  1UHK A;  2KAV A;  2BBM A;  5KTY A;  3LCP C;  3TUY C;  1FW4 A;  1NPQ A;  2PAS A;  1NWD A;  2JXC A;  2CBL A;  2HPS A;  3NSI A;  1GGW A;  3WHU B;  2F2O A;  2LHI A;  4DCK A;  1QX2 A;  3RLZ A;  1KQV A;  2KBI A;  3EK8 A;  1CFF A;  2JTT A;  3FIA A;  1AVS A;  3BOW A;  4C0J A;  1QX5 B;  2EGD A;  2BL0 B;  1C07 A;  1J55 A;  3CZT X;  3TS5 C;  3AKB A;  1AP4 A;  1D1O A;  1C7W A;  2CCM A;  1S5G Y;  3OB1 B;  2MA2 A;  4IL1 A;  3EVV A;  1AUI B;  4ETO A;  3BYA A;  4YBH B;  3DVM A;  3SIB A;  1ZMZ A;  3NXA A;  1OOJ A;  2BCA A;  1ZUZ A;  3C1V A;  5CSN A;  2I2R E;  1SR6 C;  3IQQ A;  3OHM B;  1KQM C;  3PN7 B;  1E8A A;  2IS9 A;  3DVE A;  4R1E A;  2LE9 B;  1SPY A;  1UUR A;  2HF5 A;  2LP2 A;  4DRW A;  1GQM A;  5I2O A;  2GGZ A;  3TUY B;  1B7T Y;  4OVN F;  4QJ5 B;  2MLE C;  5G08 A;  4P5O E;  2F3Z A;  1ZOT B;  1MXE A;  2P6B B;  4TNC A;  4XYN A;  3TDI A;  1OZS A;  2JTZ A;  1V1F A;  1L2O B;  2RGI A;  1S36 A;  2LVV A;  3D10 A;  4L9M A;  5DKQ A;  2JC2 A;  5HKY A;  3PFV A;  4MN0 A;  2K7B A;  2KNE A;  4AOM A;  1B8R A;  2BCB A;  1GGZ A;  3I5G C;  4D1E A;  2LAP A;  3DF0 A;  1REC A;  4OCI A;  1F8H A;  2F33 A;  2JNF A;  1B8C A;  3K21 A;  4MZJ A;  2O5G A;  1EJ3 A;  2DOQ A;  3LK1 A;  1QTX A;  1PSB A;  1J7P A;  1B9A A;  5HKZ A;  4A4C A;  2FOT A;  1N0Y A;  1OZO A;  2M97 A;  1LIN A;  5HLO A;  1WDC C;  3ICB A;  1IKU A;  5PAL A;  1BG1 A;  5AAN A;  2Y4Q A;  1YUT A;  3KHE A;  4GPL B;  4DIR A;  1JUO A;  5JJG A;  1SL7 A;  1W7J B;  3JVT C;  2K8M B;  2F3Y A;  1YX7 A;  1QV0 A;  1TCF A;  4OKH A;  2MAZ A;  2SCP A;  5I2L A;  4DUQ A;  1CLL A;  2Y5I A;  3NSL A;  1SYM A;  1QIW A;  1IQ5 A;  1QLK A;  3DVJ A;  1QJT A;  1AHR A;  1KWO C;  1IQ3 A;  2KGB C;  1OE9 B;  3I5F B;  1M46 A;  2GV5 A;  1SK6 D;  2I18 A;  4Q04 A;  2L2E A;  2JXL A;  1SNL A;  1TNX A;  2H2K A;  2ZFD A;  3I5G B;  3CLN A;  3SJS A;  2K2A A;  3DD4 A;  2OPO A;  1U5I A;  2CNP A;  2WCE A;  4A4B A;  1BR4 B;  2QAC A;  1NCZ A;  2MRD A;  3SG6 A;  3BQ3 A;  4QJ3 B;  5JOL A;  4N1F A;  1CMG A;  2WC8 A;  1WLZ A;  1DJX A;  2WCF A;  4HRH A;  3CR4 X;  2G9B A;  2MJW B;  5AFP A;  2JUL A;  1DT7 B;  3IF7 A;  2K0J A;  1UWO A;  1PVB A;  1A2X A;  3OP0 A;  4C0K A;  3FWB A;  2M7L A;  3VGO A;  4I5J A;  1Y1A A;  4GBA A;  4U8D A;  3SG3 A;  2LUX A;  2PMY A;  1A75 A;  4MBE A;  1EG3 A;  4MZL A;  4MEW A;  4OV2 A;  1DJY A;  1OMR A;  2BKH B;  4WQ2 A;  3GK2 A;  3O4Y A;  2H61 C;  1RTP 1;  3BUM B;  1LVC D;  3PAT A;  1JFJ A;  1KQM B;  3PN7 C;  4YRU A;  1QS7 A;  1S6C A;  4MVF A;  1KSM A;  2KQY A;  1HQV A;  4WQ3 A;  2L0P A;  3EK4 A;  1S3P A;  1CDN A;  2BE4 A;  1K9U A;  1WRK A;  1JC2 A;  1BU3 A;  1JF2 A;  2LMT A;  3HX4 A;  2BEC A;  3KPX A;  1SCV A;  1M63 B;  1JWD A;  1NX2 A;  2KAY A;  1BJF A;  1SRA A;  1BOC A;  1TCO B;  2JQ6 A;  2KSP A;  3DF0 B;  1NIW A;  3PSR A;  1DMO A;  1RJV A;  4YGD B;  3O6B A;  2MHH A;  1W7I B;  3OX6 A;  2BL0 C;  2M1U A;  2CTN A;  2LUC A;  3OX5 A;  2M7N A;  2K7C A;  5KSZ A;  1JSA A;  4PE7 A;  1TNW A;  2BCX A;  2LCP A;  3WXA A;  4CID A;  2HQ8 A;  1SR6 B;  2KI4 C;  1NYA A;  4FQO A;  3DVK A;  3VRR A;  2LVI A;  4YGB B;  1YRT B;  1CTR A;  3WHT B;  1DJI A;  3CGA A;  2K2F A;  2Y1N A;  2B1U A;  2VRG A;  4PE1 A;  2FCD A;  2LNK A;  2L50 A;  2MLF C;  1EG4 A;  1Y6W A;  1QXP A;  1WLM A;  4BY5 A;  1WY9 A;  2M0R A;  1S5G Z;  1K90 D;  3EVR A;  3CR2 A;  3KO0 A;  1R6P A;  4NQG A;  4PDZ A;  1PRW A;  1BF5 A;  1VRK A;  5D7F A;  1UHJ A;  2SAS A;  4HSZ A;  2AAO A;  1NP8 A;  2E30 A;  4JQ0 D;  2ZN8 A;  3BXK A;  1ZFS A;  2LC5 A;  1J7R A;  3A8R A;  1TN4 A;  1EH2 A;  1QAS A;  4M2Q A;  1CB1 A;  3QRX A;  2FCE A;  2KQ6 A;  1HT9 A;  2EHB A;  4I5L B;  4AQI A;  1RFJ A;  1QIV A;  2HQW A;  1H4B A;  1A4P A;  1S6J A;  1Y0V H;  1A29 A;  4HRE E;  1QVI Z;  2JOJ A;  1YRU B;  4PHK A;  1FF1 A;  4YGC B;  4NDC A;  1WRL A;  2KDH A;  1AJ4 A;  1YUR A;  2ZN9 A;  3HCM A;  4JPZ B;  4MRX A;  5HYD A;  1FI5 A;  2LLT A;  1DJW A;  2ZND A;  1LA0 A;  2PAL A;  1NX0 A;  5J3X A;  1XA5 A;  3BUX B;  3EKH A;  1CFD A;  4USL A;  1SBJ A;  3CS1 A;  2LP3 A;  3O78 A;  2K7D A;  1IG5 A;  1TIZ A;  1CLB A;  2Y1M A;  1AK8 A;  1KSO A;  1LA3 A;  1UHI A;  2PSR A;  2LLS A;  4QJ4 B;  4GGF A;  4YGA A;  5KU1 A;  1XFU O;  1MQ1 A;  2LHL A;  1XO5 A;  4ZCV A;  4WRI A;  4GAO A;  1G4Y R;  1PAL A;  5FYX A;  5I2Q A;  1H8B A;  1YX8 A;  2WOS A;  3EK7 A;  1ODB A;  4MLW A;  2LMU A;  2H61 A;  2CXJ A;  2KFH A;  3VRQ A;  2AUC A;  1F4Q A;  1KFU L;  1BOD A;  3PAL A;  2OTG B;  2R2I A;  1K94 A;  3EKJ A;  4F0Z B;  1CDL A;  1SW8 A;  1B8L A;  1TRF A;  1SL8 A;  1XFV O;  3F45 A;  4MRY A;  4ZCU A;  1FBV A;  1ALW A;  1RRO A;  1IRJ A;  3JVT B;  4PE0 A;  2JNX A;  3I5H B;  2HET A;  3BUN B;  4OR9 B;  2WND A;  2NLN A;  1WRZ A;  1RWY A;  1K93 D;  1R2U A;  1TNQ A;  2KOT A;  4ORA B;  5IBW A;  2NZ0 A;  3SG7 A;  1EXR A;  3JTD B;  1M31 A;  1A03 A;  2KI6 D;  2WOR A;  4DS7 A;  1K95 A;  1MHO A;  5K89 A;  4YGE B;  4NDD A;  1CM1 A;  1QV1 A;  1YUS A;  3AAJ A;  4YI8 A;  5B8I B;  2KGR A;  1SY9 A;  3CR5 X;  3CTN A;  5CPV A;  1JBA A;  1NX1 A;  1J1E A;  1SL9 A;  4GGF C;  2I94 A;  2KAX A;  4CFR A;  1JFK A;  1Y1U A;  1WDC B;  1GJY A;  2JT3 A;  4P2Y B;  4GNK B;  2TN4 A;  1IJ6 A;  2KFG A;  1K96 A;  2M9G A;  2LMV A;  2KBM A;  5TNC A;  2O60 A;  3WNX B;  1K9K A;  1PK0 D;  1PSR A;  2OS8 C;  4M2O A;  5GQQ C;  2F2P A;  1KK7 Y;  3I5I C;  3PLF B;  4N5X A;  1UP5 A;  1YVL A;  2GGM A;  2LVJ A;  4PAL A;  5AEQ A;  1OSA A;  1CMF A;  2LVK A;  1Q80 A;  2A4J A;  3PM8 A;  3SIA A;  2M3W A;  3I5I B;  3ZNI A;  1KFU S;  5DKN A;  2ISD A;  1M39 A;  4ORB B;  2KI4 B;  3GK4 X;  2OS8 B;  3M0W A;  1BR1 B;  1MF8 B;  2M8U A;  1F4O A;  1KCY A;  1S1E A;  3IQO A;  2AMI A;  1NSH A;  2K7O A;  2LM5 A;  1SCM B;  2L5X B;  5ER5 A;  1TOP A;  1B1G A;  1BLQ A;  2PRU A;  1EL4 A;  1NUB A;  1MR8 A;  1B4C A;  2Q91 A;  1DGU A;  2QPT A;  5F6T A;  3TZ1 A;  1K8U A;  3VRN A;  2JU0 A;  3VRP A;  2F8P A;  4C0L A;  4NDB A;  2FJU B;  1KK8 C;  1TNP A;  3BUW B;  2KFF A;  2COL B;  3E3R A;  1CLM A;  1XYD A;  1G8I A;  1IWQ A;  1KK8 B;  3OB2 B;  1CDM A;  1QAT A;  1DJH A;  1G33 A;  2LLU A;  3KF9 A;  3NSK A;  3JTD C;  2M49 B;  4ICB A;  4E68 A;  1YUU A;  3D0Y B;  4GGN A;  4I5K A;  4N1G A;  2JT0 A;  1OMD A;  5HLV A;  2L4H A;  2V53 A;  1CDP A;  3TDU A;  3O2P A;  3TS5 B;  1J1D A;  1QVI Y;  1ZAC A;  1DTL A;  1QLS A;  1DJG A;  1SCM C;  1U5I B;  2JZI A;  2MBX A;  1DF0 A;  2L98 A;  2NCP A;  2ZNE A;  4M2P A;  5CSF A;  2NCO A;  1J7O A;  3FS7 A;  1XFX O;  2M29 A;  3SG5 A;  1OQP A;  4PCW A;  1PVA A;  1F70 A;  1CM4 A;  1K9P A;  1YTZ C;  3LL8 B;  4MSP A;  2JWW A;  5AER A;  1RK9 A;  2K61 A;  2KYF A;  1BMO A;  1NCY A;  4MZK A;  5CSJ A;  4CPV A;  1UUS A;  2BE6 A;  1F55 A;  4XJK B;  2EC6 C;  2JT8 A;  1NX3 A;  2M1K B;  1NCX A;  2NXQ A;  4HRG A;  1FPW A;  1S6I A;  2CT9 A;  2E6W A;  3LLE A;  3SG4 A;  3FWC A;  4GUK A;  1YR5 A;  2BBN A;  5HKW A;  1DVI A;  3I5H C;  3I5F C;  1XVJ A;  1IGV A;  1S26 D;  3GOF A;  1KWO B;  4AQJ A;  1CFC A;  2ZRS A;  4CLN A;  1V1G A;  1XFW O;  5D69 A;  4UPG A;  3SG2 A;  1IH0 A;  1TTX A;  2OTG C;  3H4S E;  4PHJ A;  1YVH A;  1SKT A;  2KI6 C;  1CFP A;  2JPT A;  1N65 A;  4GFT A;  3EVU A;  2ZKM X;  3BUO B;  1BT6 A;  5I8N A;  1XK4 C;  4YI9 A;  1QX7 A;  1MXL C;  1UHN A;  2KYC A;  4JWQ A;  1F71 A;  1FI6 A;  5BPJ A;  4PHM A;  3LK0 A;  3MSE B;  2G2B A;  1K2H A;  1AJ5 A;  3A4U B;  1LKJ A;  2JRF A;  1DGV A;  3VRO A;  1XFZ O;  1N2D A;  2BKI B;  4CFQ A;  2Q4U A;  1M45 A;  1SMG A;  2PVB A;  1Y1X A;  4I5N B;  2EC6 B;  3GK1 A;  2WCB A;  1L7Z A;  1CNP A;  1IJ5 A;  4XJK A;  5AXI A;  1CKK A;  5ER4 X;  2L51 A;  3BOW B;  4ORC B;  1XFY O;  5DKR A;  3AAK A;  1DJZ A;  3ZWH A;  1ALV A;  1C7V A;  3AKA A;  1L2O C;  2D8N A;  1JF0 A;  1LXF C;  3NSO A;  1MWN A;  2L4I A;  5CSI A;  2ZRT A;  1B7T Z;  1A75 B;  1XK4 A;  1UHH A;  2KHN A;  2I7A A;  4PE4 A;  3D0Y A;  4PHN A;  1DF0 B;  3KEV A; 
#chains in the Genus database with same CATH topology
 3L4A A;  1KFX L;  1MUX A;  1J7Q A;  1KFX S;  3IVT A;  1KK7 Z;  4BY4 A;  1PUL A;  2LV7 A;  1B47 A;  3TDZ A;  3RM1 A;  3CWG A;  1X02 A;  2LAN A;  1OMV A;  4FTG A;  1F54 A;  1UHK A;  2KAV A;  2BBM A;  2QEV A;  3LCP C;  5KTY A;  3TUY C;  1FW4 A;  1NPQ A;  2PAS A;  2PQL A;  1NWD A;  2JXC A;  2CBL A;  2HPS A;  3NSI A;  1GGW A;  2P70 A;  3WHU B;  2F2O A;  2LHI A;  4DCK A;  1QX2 A;  3RLZ A;  1KQV A;  2KBI A;  3B6X A;  3EK8 A;  1CFF A;  2JTT A;  3FIA A;  4F7F A;  4OZD A;  1AVS A;  3BOW A;  4C0J A;  1QX5 B;  2EGD A;  1TUZ A;  2BL0 B;  3O4X A;  1C07 A;  1J55 A;  3CZT X;  3CZ2 A;  3TS5 C;  3AKB A;  5D3O A;  3UO9 A;  3PJI A;  1C7W A;  1AP4 A;  1D1O A;  2CCM A;  1S5G Y;  3OB1 B;  2MA2 A;  4IL1 A;  3EVV A;  1AUI B;  2QEB A;  4ETO A;  3BYA A;  4YBH B;  3DVM A;  3SIB A;  1ZMZ A;  3NXA A;  1OOJ A;  2WCL A;  1C3Y A;  2BCA A;  1ZUZ A;  3C1V A;  2GTE A;  2I2R E;  5CSN A;  3L47 A;  1ORG A;  3S0D A;  1SR6 C;  3IQQ A;  3OHM B;  1KQM C;  3PN7 B;  1E8A A;  2IS9 A;  3DVE A;  4R1E A;  2LE9 B;  3BFH A;  1SPY A;  1UUR A;  1XFR A;  2HF5 A;  2LP2 A;  4DRW A;  1GQM A;  5I2O A;  2GGZ A;  3TUY B;  3CDN A;  1B7T Y;  4OVN F;  4QJ5 B;  2MLE C;  5G08 A;  4P5O E;  2F3Z A;  1ZOT B;  2L5Y A;  3R72 A;  2KLD A;  1MXE A;  2P6B B;  4TNC A;  4XYN A;  3TDI A;  1OZS A;  2JTZ A;  1V1F A;  1DEL A;  1L2O B;  2RGI A;  1S36 A;  2LVV A;  2WCH A;  3D10 A;  2WCK A;  3Q8I A;  4L9M A;  5DKQ A;  2JC2 A;  5HKY A;  3PFV A;  4MN0 A;  2K7B A;  2KNE A;  4AOM A;  1B8R A;  2BCB A;  1GGZ A;  3I5G C;  4D1E A;  2LAP A;  3DF0 A;  1REC A;  4OCI A;  1F8H A;  2F33 A;  2JNF A;  1B8C A;  3K21 A;  4MZJ A;  2O5G A;  1EJ3 A;  2DOQ A;  3LK1 A;  3FE9 A;  1QTX A;  2WCM A;  1PSB A;  1J7P A;  1B9A A;  5HKZ A;  4A4C A;  2FOT A;  1N0Y A;  1OZO A;  2M97 A;  1LIN A;  3R1O A;  5HLO A;  1WDC C;  3ICB A;  1IKU A;  5PAL A;  4INW A;  5AAN A;  1BG1 A;  2Y4Q A;  1YUT A;  3KHE A;  4GPL B;  3L4L A;  4DIR A;  1JUO A;  5JJG A;  1SL7 A;  1QWV A;  1W7J B;  3JVT C;  2K8M B;  3S0F A;  4JD9 A;  2F3Y A;  1YX7 A;  1QV0 A;  1TCF A;  4OKH A;  2MAZ A;  2SCP A;  5I2L A;  4DUQ A;  1CLL A;  2Y5I A;  3VB1 A;  3NSL A;  1SYM A;  2BAP A;  1QIW A;  1IQ5 A;  1OOH A;  1QLK A;  3DVJ A;  1Z2C B;  1QJT A;  1AHR A;  1KWO C;  1IQ3 A;  2KGB C;  1OE9 B;  3I5F B;  1M46 A;  2GV5 A;  1SK6 D;  2I18 A;  4Q04 A;  2L2E A;  2JXL A;  1SNL A;  1TNX A;  2H2K A;  2ZFD A;  3I5G B;  3CLN A;  3SJS A;  2K2A A;  3DD4 A;  2OPO A;  1U5I A;  2CNP A;  1OW4 A;  2WCE A;  4A4B A;  1BR4 B;  2QAC A;  1NCZ A;  2MRD A;  3SG6 A;  3BQ3 A;  4QJ3 B;  5JOL A;  4N1F A;  1CMG A;  2JPO A;  4INX A;  3N7H A;  2WC8 A;  1WLZ A;  1DJX A;  2WCF A;  4HRH A;  3CR4 X;  2G9B A;  2MJW B;  5AFP A;  2JUL A;  1DT7 B;  3IF7 A;  2K0J A;  1UWO A;  1PVB A;  1A2X A;  3OP0 A;  4C0K A;  3FWB A;  5I94 A;  2M7L A;  3DZT A;  3VGO A;  4I5J A;  1Y1A A;  4GBA A;  3D76 A;  4U8D A;  3SG3 A;  2LUX A;  2PMY A;  1A75 A;  4MBE A;  1EG3 A;  3D73 A;  4MZL A;  4MEW A;  4OV2 A;  1DJY A;  1OMR A;  2BKH B;  2H8V A;  3GK2 A;  3O4Y A;  4WQ2 A;  2H61 C;  1RTP 1;  3BUM B;  1LVC D;  3D74 A;  3PAT A;  1JFJ A;  1KQM B;  3PN7 C;  4YRU A;  1QS7 A;  1S6C A;  4MVF A;  1KSM A;  2KQY A;  1HQV A;  4WQ3 A;  2L0P A;  3EK4 A;  1S3P A;  1CDN A;  2BE4 A;  1K9U A;  1WRK A;  1JC2 A;  1BU3 A;  1JF2 A;  2LMT A;  3HX4 A;  2BEC A;  3KPX A;  1SCV A;  1M63 B;  1JWD A;  1NX2 A;  1P28 A;  1BJF A;  2KAY A;  1SRA A;  2QDI A;  1BOC A;  1TCO B;  2JQ6 A;  2KSP A;  3DF0 B;  1NIW A;  3PSR A;  1DMO A;  5FI2 A;  1RJV A;  4YGD B;  3O6B A;  2MHH A;  1W7I B;  3SS4 A;  3OX6 A;  4FQT A;  2BL0 C;  1TWO A;  3R1P A;  2M1U A;  3V2L A;  2CTN A;  2LUC A;  3OX5 A;  2M7N A;  2K7C A;  5KSZ A;  1JSA A;  4PE7 A;  1TNW A;  2BCX A;  2LCP A;  3WXA A;  4CID A;  2HQ8 A;  1SR6 B;  2KI4 C;  1IIO A;  1NYA A;  4FQO A;  2YGU A;  3DVK A;  3VRR A;  2LVI A;  4YGB B;  3CAB A;  1YRT B;  1CTR A;  3WHT B;  1DJI A;  3B88 A;  3CGA A;  2K2F A;  2Y1N A;  2B1U A;  2VRG A;  4PE1 A;  2FCD A;  2LNK A;  2L50 A;  2MLF C;  1EG4 A;  5DIC A;  1Y6W A;  1QXP A;  1WLM A;  4BY5 A;  1WY9 A;  2M0R A;  1S5G Z;  1K90 D;  3EVR A;  3CR2 A;  3KO0 A;  1R6P A;  3OGN A;  3QME A;  4NQG A;  4PDZ A;  1PRW A;  1BF5 A;  1VRK A;  5D7F A;  1UHJ A;  2SAS A;  4HSZ A;  2AAO A;  1NP8 A;  2E30 A;  4JQ0 D;  2ZN8 A;  3D78 A;  3BXK A;  1ZFS A;  2LC5 A;  1J7R A;  3A8R A;  1TN4 A;  1EH2 A;  1QAS A;  1Z4H A;  4M2Q A;  4PT1 A;  1CB1 A;  3QRX A;  2FCE A;  2KQ6 A;  1HT9 A;  2EHB A;  4I5L B;  4AQI A;  1OOG A;  1RFJ A;  1QIV A;  2HQW A;  1H4B A;  1A4P A;  1S6J A;  1Y0V H;  1A29 A;  4HRE E;  1QVI Z;  3NHI A;  2JOJ A;  1YRU B;  4PHK A;  1FF1 A;  4YGC B;  4NDC A;  1OOF A;  1WRL A;  4IJ7 A;  2KDH A;  1AJ4 A;  1YUR A;  1DQE A;  2ZN9 A;  3HCM A;  4JPZ B;  4MRX A;  5HYD A;  1FI5 A;  2LLT A;  1DJW A;  2ZND A;  1LA0 A;  2PAL A;  2KLE A;  1NX0 A;  5J3X A;  1XA5 A;  3FE6 A;  3BUX B;  3EKH A;  1CFD A;  4USL A;  1SBJ A;  3CS1 A;  2LP3 A;  2KPH A;  3BJH A;  3O78 A;  2K7D A;  1IG5 A;  1TIZ A;  1CLB A;  2Y1M A;  1AK8 A;  1KSO A;  1LA3 A;  1UHI A;  2PSR A;  2LLS A;  4QJ4 B;  4GGF A;  4YGA A;  5KU1 A;  1XFU O;  1MQ1 A;  2LHL A;  1XO5 A;  4ZCV A;  4WRI A;  4GAO A;  3SS3 A;  1G4Y R;  1PAL A;  5FYX A;  5I2Q A;  1H8B A;  1YX8 A;  2WOS A;  3B87 A;  3EK7 A;  1ODB A;  2WCJ A;  3CZ1 A;  4MLW A;  2LMU A;  2H61 A;  2CXJ A;  2KFH A;  2QEH A;  3VRQ A;  2AUC A;  3R1V A;  1F4Q A;  1KFU L;  1BOD A;  3PAL A;  2OTG B;  2R2I A;  1K94 A;  3EKJ A;  4F0Z B;  1CDL A;  1SW8 A;  1B8L A;  1TRF A;  1SL8 A;  3DYE A;  1XFV O;  3F45 A;  4MRY A;  4ZCU A;  1FBV A;  1ALW A;  1RRO A;  1IRJ A;  3JVT B;  4PE0 A;  2JNX A;  3I5H B;  2HET A;  3BUN B;  4OR9 B;  2WND A;  2NLN A;  1WRZ A;  1RWY A;  1K93 D;  3BFB A;  1R2U A;  1TNQ A;  2KOT A;  4ORA B;  5IBW A;  3S0G A;  2NZ0 A;  3SG7 A;  2PYQ A;  1EXR A;  3JTD B;  3S0B A;  1M31 A;  1A03 A;  2KI6 D;  2WOR A;  4DS7 A;  1K95 A;  3SS5 A;  3DXL A;  1MHO A;  5K89 A;  4YGE B;  4NDD A;  1CM1 A;  1QV1 A;  1YUS A;  3AAJ A;  4YI8 A;  5B8I B;  2KGR A;  1SY9 A;  3CR5 X;  3CTN A;  5CPV A;  1JBA A;  1NX1 A;  1J1E A;  1SL9 A;  4GGF C;  2I94 A;  2KAX A;  4CFR A;  1JFK A;  1Y1U A;  1WDC B;  3RZS A;  1GJY A;  2JT3 A;  2K60 A;  3B86 A;  4GNK B;  4P2Y B;  2TN4 A;  1IJ6 A;  2KFG A;  1K96 A;  1LS8 A;  2LMV A;  2M9G A;  3CZ0 A;  1C3Z A;  2KBM A;  5TNC A;  2QEO A;  2O60 A;  3WNX B;  1K9K A;  1PK0 D;  1PSR A;  1W9Z A;  2OS8 C;  3CYZ A;  4PHN A;  4M2O A;  5GQQ C;  2F2P A;  1KK7 Y;  2BNX A;  4JKT A;  3I5I C;  3PLF B;  4N5X A;  1UP5 A;  1YVL A;  2GGM A;  2LVJ A;  4PAL A;  5AEQ A;  1OSA A;  1CMF A;  2LVK A;  1T14 A;  5FI6 A;  1Q80 A;  2A4J A;  3PM8 A;  3SIA A;  2M3W A;  3I5I B;  3ZNI A;  1KFU S;  5DKN A;  2FJY A;  2ISD A;  1M39 A;  4ORB B;  2KI4 B;  3GK4 X;  2OS8 B;  3M0W A;  1BR1 B;  1MF8 B;  2M8U A;  1F4O A;  1KCY A;  5FI7 A;  1S1E A;  3IQO A;  2AMI A;  1NSH A;  2K7O A;  2LM5 A;  3D77 A;  1SCM B;  2L5X B;  5ER5 A;  1TOP A;  1B1G A;  1BLQ A;  2PRU A;  1EL4 A;  1NUB A;  1MR8 A;  1B4C A;  2Q91 A;  1DGU A;  2QPT A;  5F6T A;  3TZ1 A;  1K8U A;  3VRN A;  2JU0 A;  3VRP A;  2F8P A;  4C0L A;  4NDB A;  2FJU B;  1KK8 C;  1TNP A;  3BUW B;  2KFF A;  2COL B;  3E3R A;  1CLM A;  1XYD A;  1G8I A;  1IWQ A;  1KK8 B;  3K1E A;  3OB2 B;  1CDM A;  1QAT A;  1DJH A;  1G33 A;  2LLU A;  3KF9 A;  3NSK A;  3JTD C;  2M49 B;  2WC5 A;  4ICB A;  4E68 A;  1YUU A;  3D0Y B;  4GGN A;  4I5K A;  4N1G A;  2JT0 A;  1OMD A;  3DY9 A;  5HLV A;  2L4H A;  2V53 A;  1CDP A;  3TDU A;  3O2P A;  3TS5 B;  1J1D A;  1QVI Y;  1ZAC A;  1DTL A;  1GM0 A;  1QLS A;  3B7A A;  1DJG A;  1SCM C;  1U5I B;  2JZI A;  2MBX A;  1DF0 A;  2L98 A;  2NCP A;  2ZNE A;  4M2P A;  5CSF A;  2NCO A;  1J7O A;  3FS7 A;  1XFX O;  2M29 A;  3SG5 A;  4KYN A;  1OQP A;  1SSE B;  4PCW A;  1PVA A;  1F70 A;  1CM4 A;  1K9P A;  1YTZ C;  3LL8 B;  4MSP A;  2JWW A;  5AER A;  2P71 A;  1RK9 A;  2K61 A;  2KYF A;  1BMO A;  1NCY A;  4MZK A;  5CSJ A;  4CPV A;  1OOI X;  1UUS A;  2BE6 A;  5EL2 A;  4XJK B;  1F55 A;  2EC6 C;  2JT8 A;  1NX3 A;  2M1K B;  1NCX A;  2NXQ A;  4HRG A;  1FPW A;  1S6I A;  2CT9 A;  2E6W A;  3LLE A;  3SG4 A;  3FWC A;  4GUK A;  1YR5 A;  5HL1 A;  2BBN A;  5HKW A;  3S0E A;  3BFA A;  1DVI A;  3I5H C;  3I5F C;  1XVJ A;  1IGV A;  1S26 D;  3GOF A;  1KWO B;  4AQJ A;  1CFC A;  2ZRS A;  3OBV A;  1V1G A;  4CLN A;  1XFW O;  5D69 A;  4UPG A;  3S0A A;  3NHT A;  3SG2 A;  1IH0 A;  2WC6 A;  1TTX A;  2OTG C;  3H4S E;  4PHJ A;  1YVH A;  1SKT A;  2KI6 C;  1CFP A;  2JPT A;  1N65 A;  4GFT A;  3EVU A;  3EG5 B;  2ZKM X;  1DC1 A;  3BUO B;  1BT6 A;  5I8N A;  1XK4 C;  4YI9 A;  3UNW A;  1QX7 A;  1MXL C;  1UHN A;  2KYC A;  4JWQ A;  1F71 A;  1FI6 A;  5BPJ A;  4PHM A;  3LK0 A;  3MSE B;  2G2B A;  1K2H A;  1AJ5 A;  3A4U B;  1LKJ A;  2JRF A;  1DGV A;  1TUJ A;  3VRO A;  1XFZ O;  1N2D A;  2BKI B;  4CFQ A;  2Q4U A;  3D75 A;  2ERB A;  1M45 A;  1SMG A;  2PVB A;  1Y1X A;  4I5N B;  2EC6 B;  3GK1 A;  2WCB A;  1L7Z A;  3NGV A;  1IJ5 A;  4XJK A;  5AXI A;  1CKK A;  5ER4 X;  1CNP A;  2L51 A;  3BOW B;  4ORC B;  1XFY O;  5DKR A;  3AAK A;  1DJZ A;  3ZWH A;  1ALV A;  1C7V A;  3AKA A;  1L2O C;  2D8N A;  1JF0 A;  1LXF C;  3NSO A;  1MWN A;  2L4I A;  5CSI A;  2ZRT A;  1B7T Z;  1DEK A;  1A75 B;  1XK4 A;  1UHH A;  2L2C A;  2KHN A;  2I7A A;  3FE8 A;  4PE4 A;  3D0Y A;  3PM2 A;  1DF0 B;  3KEV A; 
#chains in the Genus database with same CATH homology
 1KFX L;  1MUX A;  1J7Q A;  1KFX S;  1KK7 Z;  4BY4 A;  1PUL A;  2LV7 A;  1B47 A;  3TDZ A;  3RM1 A;  3CWG A;  1X02 A;  2LAN A;  1OMV A;  4FTG A;  1F54 A;  1UHK A;  2KAV A;  2BBM A;  5KTY A;  3LCP C;  3TUY C;  1FW4 A;  1NPQ A;  2PAS A;  1NWD A;  2JXC A;  2CBL A;  2HPS A;  3NSI A;  1GGW A;  3WHU B;  2F2O A;  2LHI A;  4DCK A;  1QX2 A;  3RLZ A;  1KQV A;  2KBI A;  3EK8 A;  1CFF A;  2JTT A;  3FIA A;  1AVS A;  3BOW A;  4C0J A;  1QX5 B;  2EGD A;  2BL0 B;  1C07 A;  1J55 A;  3CZT X;  3TS5 C;  3AKB A;  1AP4 A;  1D1O A;  1C7W A;  2CCM A;  1S5G Y;  3OB1 B;  2MA2 A;  4IL1 A;  3EVV A;  1AUI B;  4ETO A;  3BYA A;  4YBH B;  3DVM A;  3SIB A;  1ZMZ A;  3NXA A;  1OOJ A;  2BCA A;  1ZUZ A;  3C1V A;  5CSN A;  2I2R E;  1SR6 C;  3IQQ A;  3OHM B;  1KQM C;  3PN7 B;  1E8A A;  2IS9 A;  3DVE A;  4R1E A;  2LE9 B;  1SPY A;  1UUR A;  2HF5 A;  2LP2 A;  4DRW A;  1GQM A;  5I2O A;  2GGZ A;  3TUY B;  1B7T Y;  4OVN F;  4QJ5 B;  2MLE C;  5G08 A;  4P5O E;  2F3Z A;  1ZOT B;  1MXE A;  2P6B B;  4TNC A;  4XYN A;  3TDI A;  1OZS A;  2JTZ A;  1V1F A;  1L2O B;  2RGI A;  1S36 A;  2LVV A;  3D10 A;  4L9M A;  5DKQ A;  2JC2 A;  5HKY A;  3PFV A;  4MN0 A;  2K7B A;  2KNE A;  4AOM A;  1B8R A;  2BCB A;  1GGZ A;  3I5G C;  4D1E A;  2LAP A;  3DF0 A;  1REC A;  4OCI A;  1F8H A;  2F33 A;  2JNF A;  1B8C A;  3K21 A;  4MZJ A;  2O5G A;  1EJ3 A;  2DOQ A;  3LK1 A;  1QTX A;  1PSB A;  1J7P A;  1B9A A;  5HKZ A;  4A4C A;  2FOT A;  1N0Y A;  1OZO A;  2M97 A;  1LIN A;  5HLO A;  1WDC C;  3ICB A;  1IKU A;  5PAL A;  1BG1 A;  5AAN A;  2Y4Q A;  1YUT A;  3KHE A;  4GPL B;  4DIR A;  1JUO A;  5JJG A;  1SL7 A;  1W7J B;  3JVT C;  2K8M B;  2F3Y A;  1YX7 A;  1QV0 A;  1TCF A;  4OKH A;  2MAZ A;  2SCP A;  5I2L A;  4DUQ A;  1CLL A;  2Y5I A;  3NSL A;  1SYM A;  1QIW A;  1IQ5 A;  1QLK A;  3DVJ A;  1QJT A;  1AHR A;  1KWO C;  1IQ3 A;  2KGB C;  1OE9 B;  3I5F B;  1M46 A;  2GV5 A;  1SK6 D;  2I18 A;  4Q04 A;  2L2E A;  2JXL A;  1SNL A;  1TNX A;  2H2K A;  2ZFD A;  3I5G B;  3CLN A;  3SJS A;  2K2A A;  3DD4 A;  2OPO A;  1U5I A;  2CNP A;  2WCE A;  4A4B A;  1BR4 B;  2QAC A;  1NCZ A;  2MRD A;  3SG6 A;  3BQ3 A;  4QJ3 B;  5JOL A;  4N1F A;  1CMG A;  2WC8 A;  1WLZ A;  1DJX A;  2WCF A;  4HRH A;  3CR4 X;  2G9B A;  2MJW B;  5AFP A;  2JUL A;  1DT7 B;  3IF7 A;  2K0J A;  1UWO A;  1PVB A;  1A2X A;  3OP0 A;  4C0K A;  3FWB A;  2M7L A;  3VGO A;  4I5J A;  1Y1A A;  4GBA A;  4U8D A;  3SG3 A;  2LUX A;  2PMY A;  1A75 A;  4MBE A;  1EG3 A;  4MZL A;  4MEW A;  4OV2 A;  1DJY A;  1OMR A;  2BKH B;  4WQ2 A;  3GK2 A;  3O4Y A;  2H61 C;  1RTP 1;  3BUM B;  1LVC D;  3PAT A;  1JFJ A;  1KQM B;  3PN7 C;  4YRU A;  1QS7 A;  1S6C A;  4MVF A;  1KSM A;  2KQY A;  1HQV A;  4WQ3 A;  2L0P A;  3EK4 A;  1S3P A;  1CDN A;  2BE4 A;  1K9U A;  1WRK A;  1JC2 A;  1BU3 A;  1JF2 A;  2LMT A;  3HX4 A;  2BEC A;  3KPX A;  1SCV A;  1M63 B;  1JWD A;  1NX2 A;  2KAY A;  1BJF A;  1SRA A;  1BOC A;  1TCO B;  2JQ6 A;  2KSP A;  3DF0 B;  1NIW A;  3PSR A;  1DMO A;  1RJV A;  4YGD B;  3O6B A;  2MHH A;  1W7I B;  3OX6 A;  2BL0 C;  2M1U A;  2CTN A;  2LUC A;  3OX5 A;  2M7N A;  2K7C A;  5KSZ A;  1JSA A;  4PE7 A;  1TNW A;  2BCX A;  2LCP A;  3WXA A;  4CID A;  2HQ8 A;  1SR6 B;  2KI4 C;  1NYA A;  4FQO A;  3DVK A;  3VRR A;  2LVI A;  4YGB B;  1YRT B;  1CTR A;  3WHT B;  1DJI A;  3CGA A;  2K2F A;  2Y1N A;  2B1U A;  2VRG A;  4PE1 A;  2FCD A;  2LNK A;  2L50 A;  2MLF C;  1EG4 A;  1Y6W A;  1QXP A;  1WLM A;  4BY5 A;  1WY9 A;  2M0R A;  1S5G Z;  1K90 D;  3EVR A;  3CR2 A;  3KO0 A;  1R6P A;  4NQG A;  4PDZ A;  1PRW A;  1BF5 A;  1VRK A;  5D7F A;  1UHJ A;  2SAS A;  4HSZ A;  2AAO A;  1NP8 A;  2E30 A;  4JQ0 D;  2ZN8 A;  3BXK A;  1ZFS A;  2LC5 A;  1J7R A;  3A8R A;  1TN4 A;  1EH2 A;  1QAS A;  4M2Q A;  1CB1 A;  3QRX A;  2FCE A;  2KQ6 A;  1HT9 A;  2EHB A;  4I5L B;  4AQI A;  1RFJ A;  1QIV A;  2HQW A;  1H4B A;  1A4P A;  1S6J A;  1Y0V H;  1A29 A;  4HRE E;  1QVI Z;  2JOJ A;  1YRU B;  4PHK A;  1FF1 A;  4YGC B;  4NDC A;  1WRL A;  2KDH A;  1AJ4 A;  1YUR A;  2ZN9 A;  3HCM A;  4JPZ B;  4MRX A;  5HYD A;  1FI5 A;  2LLT A;  1DJW A;  2ZND A;  1LA0 A;  2PAL A;  1NX0 A;  5J3X A;  1XA5 A;  3BUX B;  3EKH A;  1CFD A;  4USL A;  1SBJ A;  3CS1 A;  2LP3 A;  3O78 A;  2K7D A;  1IG5 A;  1TIZ A;  1CLB A;  2Y1M A;  1AK8 A;  1KSO A;  1LA3 A;  1UHI A;  2PSR A;  2LLS A;  4QJ4 B;  4GGF A;  4YGA A;  5KU1 A;  1XFU O;  1MQ1 A;  2LHL A;  1XO5 A;  4ZCV A;  4WRI A;  4GAO A;  1G4Y R;  1PAL A;  5FYX A;  5I2Q A;  1H8B A;  1YX8 A;  2WOS A;  3EK7 A;  1ODB A;  4MLW A;  2LMU A;  2H61 A;  2CXJ A;  2KFH A;  3VRQ A;  2AUC A;  1F4Q A;  1KFU L;  1BOD A;  3PAL A;  2OTG B;  2R2I A;  1K94 A;  3EKJ A;  4F0Z B;  1CDL A;  1SW8 A;  1B8L A;  1TRF A;  1SL8 A;  1XFV O;  3F45 A;  4MRY A;  4ZCU A;  1FBV A;  1ALW A;  1RRO A;  1IRJ A;  3JVT B;  4PE0 A;  2JNX A;  3I5H B;  2HET A;  3BUN B;  4OR9 B;  2WND A;  2NLN A;  1WRZ A;  1RWY A;  1K93 D;  1R2U A;  1TNQ A;  2KOT A;  4ORA B;  5IBW A;  2NZ0 A;  3SG7 A;  1EXR A;  3JTD B;  1M31 A;  1A03 A;  2KI6 D;  2WOR A;  4DS7 A;  1K95 A;  1MHO A;  5K89 A;  4YGE B;  4NDD A;  1CM1 A;  1QV1 A;  1YUS A;  3AAJ A;  4YI8 A;  5B8I B;  2KGR A;  1SY9 A;  3CR5 X;  3CTN A;  5CPV A;  1JBA A;  1NX1 A;  1J1E A;  1SL9 A;  4GGF C;  2I94 A;  2KAX A;  4CFR A;  1JFK A;  1Y1U A;  1WDC B;  1GJY A;  2JT3 A;  4P2Y B;  4GNK B;  2TN4 A;  1IJ6 A;  2KFG A;  1K96 A;  2M9G A;  2LMV A;  2KBM A;  5TNC A;  2O60 A;  3WNX B;  1K9K A;  1PK0 D;  1PSR A;  2OS8 C;  4M2O A;  5GQQ C;  2F2P A;  1KK7 Y;  3I5I C;  3PLF B;  4N5X A;  1UP5 A;  1YVL A;  2GGM A;  2LVJ A;  4PAL A;  5AEQ A;  1OSA A;  1CMF A;  2LVK A;  1Q80 A;  2A4J A;  3PM8 A;  3SIA A;  2M3W A;  3I5I B;  3ZNI A;  1KFU S;  5DKN A;  2ISD A;  1M39 A;  4ORB B;  2KI4 B;  3GK4 X;  2OS8 B;  3M0W A;  1BR1 B;  1MF8 B;  2M8U A;  1F4O A;  1KCY A;  1S1E A;  3IQO A;  2AMI A;  1NSH A;  2K7O A;  2LM5 A;  1SCM B;  2L5X B;  5ER5 A;  1TOP A;  1B1G A;  1BLQ A;  2PRU A;  1EL4 A;  1NUB A;  1MR8 A;  1B4C A;  2Q91 A;  1DGU A;  2QPT A;  5F6T A;  3TZ1 A;  1K8U A;  3VRN A;  2JU0 A;  3VRP A;  2F8P A;  4C0L A;  4NDB A;  2FJU B;  1KK8 C;  1TNP A;  3BUW B;  2KFF A;  2COL B;  3E3R A;  1CLM A;  1XYD A;  1G8I A;  1IWQ A;  1KK8 B;  3OB2 B;  1CDM A;  1QAT A;  1DJH A;  1G33 A;  2LLU A;  3KF9 A;  3NSK A;  3JTD C;  2M49 B;  4ICB A;  4E68 A;  1YUU A;  3D0Y B;  4GGN A;  4I5K A;  4N1G A;  2JT0 A;  1OMD A;  5HLV A;  2L4H A;  2V53 A;  1CDP A;  3TDU A;  3O2P A;  3TS5 B;  1J1D A;  1QVI Y;  1ZAC A;  1DTL A;  1QLS A;  1DJG A;  1SCM C;  1U5I B;  2JZI A;  2MBX A;  1DF0 A;  2L98 A;  2NCP A;  2ZNE A;  4M2P A;  5CSF A;  2NCO A;  1J7O A;  3FS7 A;  1XFX O;  2M29 A;  3SG5 A;  1OQP A;  4PCW A;  1PVA A;  1F70 A;  1CM4 A;  1K9P A;  1YTZ C;  3LL8 B;  4MSP A;  2JWW A;  5AER A;  1RK9 A;  2K61 A;  2KYF A;  1BMO A;  1NCY A;  4MZK A;  5CSJ A;  4CPV A;  1UUS A;  2BE6 A;  1F55 A;  4XJK B;  2EC6 C;  2JT8 A;  1NX3 A;  2M1K B;  1NCX A;  2NXQ A;  4HRG A;  1FPW A;  1S6I A;  2CT9 A;  2E6W A;  3LLE A;  3SG4 A;  3FWC A;  4GUK A;  1YR5 A;  2BBN A;  5HKW A;  1DVI A;  3I5H C;  3I5F C;  1XVJ A;  1IGV A;  1S26 D;  3GOF A;  1KWO B;  4AQJ A;  1CFC A;  2ZRS A;  4CLN A;  1V1G A;  1XFW O;  5D69 A;  4UPG A;  3SG2 A;  1IH0 A;  1TTX A;  2OTG C;  3H4S E;  4PHJ A;  1YVH A;  1SKT A;  2KI6 C;  1CFP A;  2JPT A;  1N65 A;  4GFT A;  3EVU A;  2ZKM X;  3BUO B;  1BT6 A;  5I8N A;  1XK4 C;  4YI9 A;  1QX7 A;  1MXL C;  1UHN A;  2KYC A;  4JWQ A;  1F71 A;  1FI6 A;  5BPJ A;  4PHM A;  3LK0 A;  3MSE B;  2G2B A;  1K2H A;  1AJ5 A;  3A4U B;  1LKJ A;  2JRF A;  1DGV A;  3VRO A;  1XFZ O;  1N2D A;  2BKI B;  4CFQ A;  2Q4U A;  1M45 A;  1SMG A;  2PVB A;  1Y1X A;  4I5N B;  2EC6 B;  3GK1 A;  2WCB A;  1L7Z A;  1CNP A;  1IJ5 A;  4XJK A;  5AXI A;  1CKK A;  5ER4 X;  2L51 A;  3BOW B;  4ORC B;  1XFY O;  5DKR A;  3AAK A;  1DJZ A;  3ZWH A;  1ALV A;  1C7V A;  3AKA A;  1L2O C;  2D8N A;  1JF0 A;  1LXF C;  3NSO A;  1MWN A;  2L4I A;  5CSI A;  2ZRT A;  1B7T Z;  1A75 B;  1XK4 A;  1UHH A;  2KHN A;  2I7A A;  4PE4 A;  3D0Y A;  4PHN A;  1DF0 B;  3KEV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...