1XFXO

Crystal structure of anthrax edema factor (ef) in complex with calmodulin in the presence of 10 millimolar exogenously added calcium chloride
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
146
structure length
146
Chain Sequence
QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDQMIREADIDGDGQVNYEEFVQMMTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase/metal binding protein
molecule keywords Calmodulin-sensitive adenylate cyclase
publication title Calcium-independent calmodulin binding and two-metal-ion catalytic mechanism of anthrax edema factor.
pubmed doi rcsb
source organism Bacillus anthracis
total genus 33
structure length 146
sequence length 146
chains with identical sequence P, Q, R, S, T
ec nomenclature
pdb deposition date 2004-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xfxO01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xfxO02
1EL4A 1DJGA 5CSFA 4PE0A 1B9AA 4FTGA 5AEQA 3SG3A 1W7IB 2O60A 1QXPA 2LC5A 2LP3A 4PHJA 3JTDB 1A75B 2JOJA 3AAKA 1R2UA 3M0WA 2AMIA 3LL8B 4MVFA 4OVNF 1WRZA 4UPGA 1NIWA 1YR5A 2HPSA 3O2PA 2MA2A 3BUWB 1KQVA 3GK4X 1ODBA 1QLSA 1A4PA 2GV5A 3WXAA 3KEVA 1VRKA 3CS1A 1YRUB 4ZCVA 1OZSA 1F4OA 1N65A 2FCEA 2OS8C 3EKJA 3EVUA 3IQOA 2OTGC 3OP0A 4MEWA 1CLBA 1NX2A 2L2EA 1ZMZA 2IS9A 1K2HA 3NSOA 4I5KA 4YGDB 1DJXA 2CT9A 4L9MA 1TTXA 1S5GY 1XFZO 1HQVA 1DJHA 1SR6C 2ISDA 3AKBA 1YUUA 1QX7A 5DKRA 1JBAA 1LINA 2MLEC 1QX5B 2LLUA 4CFRA 3OB2B 4P2YB 1SL7A 1A29A 2I94A 3TDZA 3SG4A 1RECA 1Y1XA 5KTYA 1G8IA 1NX0A 3TS5B 3NSIA 1BR4B 1JF2A 4R1EA 2HF5A 1DJYA 1KWOB 2KQ6A 2JTZA 3ICBA 3VRNA 2KI6D 1DMOA 1ALVA 1K8UA 1EXRA 1S36A 1Y1AA 3DF0A 3BUMB 4BY4A 3A8RA 4MLWA 5PALA 1JF0A 1QLKA 2BKHB 1G33A 1MXEA 2BL0C 1LXFC 2K2AA 2KSPA 1OE9B 5KSZA 1XFYO 4GAOA 1SMGA 2WORA 4E68A 4P5OE 1YX8A 3CR4X 4GGNA 3CTNA 1DJZA 1F71A 1IQ5A 1CLMA 3DVKA 1PALA 2KYFA 2HQWA 3I5HC 1ZFSA 1JUOA 1ZACA 3LK1A 1WLZA 4QJ4B 1F4QA 2L98A 1J7QA 1WRKA 1FI5A 4MBEA 4HRGA 4WRIA 3I5GB 2RGIA 2PALA 4M2OA 1ZUZA 3GK2A 1QIWA 2MHHA 1L2OC 2KOTA 2KFFA 2Q91A 1RROA 3AKAA 2KFHA 3KO0A 4ORAB 4M2PA 4PE4A 4ORBB 5JOLA 2LUCA 1DF0B 3PATA 3SG6A 1XFUO 2TN4A 4WQ2A 5K89A 4XJKA 1MQ1A 1A03A 2I7AA 2FOTA 3JVTC 4XYNA 3BOWB 1FPWA 1YURA 2H61A 1YUSA 2EC6C 2F3YA 2AAOA 1SRAA 2FJUB 3QRXA 1U5IB 3PN7B 4USLA 5D69A 1TNQA 2K7BA 2M1UA 3RLZA 2WNDA 2OPOA 3GOFA 1F70A 1IG5A 1PVBA 1KCYA 3BUXB 4QJ3B 2ZNEA 1QATA 3A4UB 1KK8C 3H4SE 1GJYA 3OX5A 1CFPA 2H61C 4PHKA 1YTZC 4F0ZB 4MRXA 4PE1A 2LCPA 3DVEA 1WDCB 4IL1A 1XVJA 1GGWA 4C0LA 2E30A 1B8LA 3LK0A 2KHNA 2LUXA 2MRDA 5J3XA 3VRQA 2JT3A 2JZIA 3FS7A 4JPZB 3WHUB 2KI6C 1OQPA 1PK0D 1CDLA 2JC2A 5CSJA 1NSHA 2BECA 1K95A 2F33A 1NPQA 5B8IB 2I2RE 1FF1A 1CLLA 4I5NB 2JNFA 2K0JA 2LMVA 1EJ3A 3VRPA 2V53A 3TUYC 2JRFA 1FI6A 1S6JA 3PFVA 3VGOA 1PVAA 2KI4B 4NDDA 2K2FA 1H4BA 2LP2A 1RJVA 4YBHB 1YX7A 5FYXA 1CFDA 1MHOA 1Y0VH 1Y1UA 2WCBA 4Q04A 2DOQA 2BE6A 1SL9A 4YI8A 1AJ4A 4ORCB 1CTRA 1CMFA 1TIZA 1BJFA 2VRGA 4N1FA 3AAJA 5I2OA 4GBAA 1EH2A 1PSRA 3PLFB 2F2OA 2KGRA 4PHMA 1V1FA 1H8BA 1K94A 3SG2A 2AUCA 2F2PA 1DJWA 2BKIB 1D1OA 3TDIA 1SK6D 1J1DA 2E6WA 2KBMA 3LLEA 4MZLA 4DCKA 1RWYA 4N1GA 3EK7A 1QV0A 1PSBA 1CDPA 2JT8A 1J1EA 2KAVA 2LVKA 4CPVA 1BR1B 1AJ5A 1RFJA 1CKKA 1YUTA 4MZKA 2LHLA 1NYAA 1KQMB 1J55A 3OHMB 2Y1MA 2JWWA 1V1GA 3TZ1A 3JTDC 4OR9B 1TCOB 1KFXS 2ZN8A 1Y6WA 1SY9A 3EKHA 3CR2A 2QPTA 2ZNDA 2SASA 1E8AA 3DF0B 4ZCUA 1RK9A 3I5HB 3KF9A 5ER5A 5CPVA 2Y4QA 4YGEB 2JU0A 1TRFA 1C7VA 4ICBA 3BXKA 4GNKB 2L51A 3SIAA 1IH0A 3I5FB 1F54A 2ZKMX 1JWDA 1SYMA 4CIDA 3CR5X 4BY5A 1KFXL 4DUQA 1CM1A 1QV1A 4DS7A 5BPJA 4PHNA 1CFFA 2ZFDA 1JC2A 2GGMA 1SCMB 1XYDA 4OCIA 1C7WA 2JTTA 5HKYA 2K7DA 3TS5C 3ZNIA 1PRWA 1B7TZ 4GPLB 3PSRA 3BQ3A 1K90D 1KWOC 3WNXB 2K8MB 4GGFA 1NCYA 5GQQC 2LLTA 1BG1A 4JWQA 1M39A 1OZOA 4M2QA 1CNPA 1BU3A 4ETOA 5DKQA 2M9GA 1CDNA 1M31A 1B47A 3K21A 4PDZA 3D10A 1SW8A 2PSRA 4XJKB 4NDCA 3O78A 3I5IB 4NDBA 4OKHA 1IRJA 2LANA 2A4JA 2KAYA 2LVIA 1TOPA 3DVJA 1J7PA 1XFXO 1TNPA 4GGFC 2L5XB 2BE4A 2COLB 4C0KA 4YRUA 3KHEA 1S26D 1TNXA 1UWOA 2LHIA 2ZN9A 1MXLC 4HRHA 2NZ0A 3I5GC 1XK4A 5AXIA 1LA3A 1XA5A 2FCDA 5I8NA 1TCFA 1NX3A 1OMRA 2HQ8A 4I5JA 1UUSA 4MN0A 1U5IA 3EVVA 2JQ6A 3D0YA 1SL8A 2K7CA 1K93D 4AQJA 2CNPA 1MR8A 5F6TA 1CB1A 2LNKA 3VRRA 2L4HA 2LVJA 2JXLA 4AQIA 1K96A 1XK4C 2JPTA 4PCWA 2M8UA 1S6CA 1J7OA 1SBJA 1DGVA 4TNCA 3IF7A 1DTLA 1KK7Z 1C07A 1DJIA 3PN7C 4WQ3A 1MF8B 2M29A 1WLMA 1B8RA 1IKUA 1AHRA 3CWGA 1BLQA 2OS8B 2B1UA 2OTGB 3MSEB 1QS7A 3SG7A 3FWBA 1A2XA 1DVIA 1QVIZ 5JJGA 2ZRSA 3NXAA 1RTP1 4CLNA 1B7TY 1SR6B 4C0JA 1MWNA 1WDCC 2SCPA 3EK4A 1N0YA 1UHHA 1ALWA 2Q4UA 2BCBA 2PMYA 5G08A 2LE9B 4MSPA 2CBLA 3VROA 3SIBA 2F3ZA 4NQGA 2NXQA 5KU1A 2BCXA 1A75A 4QJ5B 1NUBA 2H2KA 2O5GA 1GGZA 5I2LA 2M7LA 1LKJA 1N2DA 4MZJA 1PULA 2BBMA 2JXCA 1X02A 1UHIA 5HYDA 1CFCA 1S3PA 1SNLA 2KI4C 2M49B 2Y5IA 4N5XA 4JQ0D 1DT7B 1M46A 2PVBA 4A4BA 2GGZA 1OMVA 1S6IA 2MAZA 3WHTB 1UHKA 3SG5A 5HKZA 2CXJA 1QX2A 4MRYA 1EG3A 2KDHA 2BL0B 1QIVA 4D1EA 2JNXA 1CDMA 2LM5A 2KBIA 2LMTA 1FBVA 2L50A 2M3WA 1IQ3A 4PALA 1EG4A 4AOMA 1AVSA 2M7NA 2EGDA 1GQMA 2KQYA 2Y1NA 2MBXA 1J7RA 1QASA 1B1GA 1NX1A 1QTXA 2KAXA 1B4CA 1QJTA 3DD4A 4U8DA 1DGUA 1WRLA 1NWDA 1F55A 5HLVA 5D7FA 3IQQA 2NCPA 3HX4A 1SKTA 4HSZA 1L2OB 1L7ZA 1YRTB 2BBNA 2I18A 3O6BA 1KK7Y 1FW4A 5AERA 2M1KB 1LA0A 5DKNA 1IJ6A 1IWQA 1KQMC 2R2IA 2WC8A 2M0RA 3CZTX 4YGBB 1OSAA 1M63B 1UURA 4GFTA 1JFJA 3OB1B 3JVTB 2P6BB 2L4IA 1QVIY 4CFQA 1NP8A 1AUIB 4OV2A 3TDUA 2K7OA 2EC6B 1AK8A 4YI9A 2M97A 1LVCD 2QACA 2LV7A 1B8CA 3BUNB 2CCMA 1XO5A 2LLSA 2CTNA 2MJWB 5TNCA 3SJSA 5HLOA 4YGAA 2WCFA 1K9KA 1S1EA 1IGVA 1SPYA 3EVRA 3KPXA 4DIRA 2LVVA 2KFGA 5IBWA 1KK8B 4FQOA 5CSNA 2JULA 3ZWHA 1KSOA 2L0PA 3I5FC 2F8PA 1ZOTB 4I5LB 1MUXA 3DVMA 2BCAA 2EHBA 1F8HA 4PE7A 1DF0A 1BOCA 1KFUS 1BT6A 4A4CA 1HT9A 2ZRTA 4GUKA 1TNWA 2KYCA 2D8NA 2PRUA 5ER4X 1SCMC 3BUOB 3BYAA 4DRWA 3BOWA 5I2QA 1S5GZ 1IJ5A 3TUYB 2WOSA 2G2BA 4YGCB 1G4YR 3EK8A 1SCVA 2G9BA 5AFPA 3OX6A 1UP5A 1TN4A 3F45A 3LCPC 3CLNA 3D0YB 1OMDA 2KGBC 3E3RA 2WCEA 1JSAA 1XFVO 1YVHA 1WY9A 3I5IC 1KFUL 1NCZA 2HETA 3RM1A 1BF5A 1M45A 2JT0A 5AANA 3FIAA 2K61A 3CGAA 1YVLA 1UHNA 1OOJA 2PASA 1XFWO 5CSIA 1W7JB 1KSMA 2LAPA 1CM4A 3NSLA 3HCMA 3PM8A 1K9UA 3FWCA 2NLNA 1R6PA 1Q80A 2NCOA 1AP4A 3C1VA 3O4YA 1NCXA 5HKWA 3PALA 2LMUA 1K9PA 3GK1A 2KNEA 1JFKA 1UHJA 4HREE 1BODA 2MLFC 1BMOA 1CMGA 3NSKA
chains in the Genus database with same CATH superfamily
1EL4A 1DJGA 5CSFA 4PE0A 2P71A 5I94A 1B9AA 4FTGA 5AEQA 3B87A 3SG3A 1W7IB 2O60A 1QXPA 2LC5A 4INWA 2LP3A 4PHJA 3JTDB 1A75B 2JOJA 3AAKA 1R2UA 3M0WA 2AMIA 3LL8B 4MVFA 4OVNF 1WRZA 4UPGA 1NIWA 1YR5A 2HPSA 1XFRA 3O2PA 2MA2A 1OOFA 3BUWB 1KQVA 3GK4X 1ODBA 1QLSA 1A4PA 2GV5A 3WXAA 3KEVA 1VRKA 3CS1A 1YRUB 4ZCVA 1OZSA 1F4OA 1N65A 2FCEA 2OS8C 3EKJA 3EVUA 3IQOA 2OTGC 3OP0A 4MEWA 1CLBA 1NX2A 4KYNA 2L2EA 1ZMZA 2IS9A 1K2HA 3NSOA 4I5KA 4YGDB 1DJXA 2CT9A 4L9MA 1TTXA 1S5GY 1XFZO 1HQVA 1DJHA 2QEVA 1SR6C 2ISDA 3SS5A 3AKBA 1YUUA 1QX7A 5DKRA 1JBAA 3EG5B 1LINA 1ORGA 2MLEC 1QX5B 2LLUA 4CFRA 1DQEA 3OB2B 4P2YB 2PYQA 1SL7A 1A29A 2I94A 3TDZA 3SG4A 1RECA 1Y1XA 5KTYA 1G8IA 1NX0A 3TS5B 3NSIA 1BR4B 1JF2A 4R1EA 2HF5A 1DJYA 1KWOB 3OBVA 2KQ6A 2JTZA 3ICBA 3VRNA 2KI6D 1DMOA 1ALVA 1K8UA 1EXRA 1S36A 1Y1AA 3DF0A 3BUMB 1TUZA 4BY4A 3A8RA 4MLWA 5PALA 1JF0A 1QLKA 2BKHB 1G33A 1MXEA 2BL0C 1LXFC 2K2AA 2KSPA 1OE9B 5KSZA 3CZ2A 1XFYO 3FE9A 4GAOA 1SMGA 2WORA 4E68A 4P5OE 1YX8A 3CR4X 4GGNA 3CTNA 3SS3A 1DJZA 1F71A 1IQ5A 1CLMA 3DVKA 1PALA 2KYFA 2WCLA 2HQWA 3I5HC 4F7FA 2QDIA 5D3OA 1ZFSA 1JUOA 1ZACA 3LK1A 1WLZA 3PJIA 1F4QA 2L98A 4QJ4B 1J7QA 1WRKA 1FI5A 2L2CA 4HRGA 4MBEA 3I5GB 4WRIA 2RGIA 2PALA 1TWOA 3R1OA 4M2OA 1ZUZA 3GK2A 1DC1A 1QIWA 2MHHA 1L2OC 2KOTA 2KFFA 2Q91A 1RROA 3AKAA 2KFHA 3KO0A 4ORAB 4M2PA 4PE4A 4ORBB 2WC6A 5JOLA 2LUCA 1DF0B 3PATA 3SG6A 3UNWA 1XFUO 2TN4A 4WQ2A 1SSEB 3V2LA 5K89A 4XJKA 1MQ1A 3D78A 1A03A 2I7AA 2FOTA 3JVTC 3D76A 3BOWB 4XYNA 1FPWA 1YURA 2H61A 1YUSA 2EC6C 3S0BA 2ERBA 2F3YA 2AAOA 1SRAA 2FJUB 3QRXA 1U5IB 3PN7B 4USLA 5D69A 1TNQA 2K7BA 2M1UA 3RLZA 2WNDA 5FI6A 2OPOA 3GOFA 1F70A 1IG5A 1PVBA 1GM0A 3BUXB 4QJ3B 2ZNEA 1KCYA 1QATA 3A4UB 1KK8C 3D75A 1GJYA 3H4SE 3OX5A 1CFPA 2H61C 4PHKA 1YTZC 4F0ZB 4MRXA 4PE1A 2LCPA 3DVEA 1WDCB 4IL1A 1XVJA 1GGWA 3D74A 4C0LA 2E30A 1B8LA 3LK0A 2KHNA 2LUXA 2MRDA 5J3XA 3VRQA 2JT3A 2JZIA 2FJYA 3FS7A 4JPZB 3WHUB 2KI6C 1OQPA 1PK0D 1CDLA 2JC2A 3BFAA 5CSJA 1NSHA 2BECA 1K95A 2BAPA 2F33A 1NPQA 5B8IB 2I2RE 1FF1A 1CLLA 4I5NB 2JNFA 3VB1A 2K0JA 2LMVA 1EJ3A 3VRPA 2V53A 3TUYC 2JRFA 1FI6A 1S6JA 3PFVA 3VGOA 1PVAA 2KI4B 3PM2A 2WCMA 2PQLA 4NDDA 2K2FA 1H4BA 2LP2A 1RJVA 4YBHB 1YX7A 5FYXA 1CFDA 1Z4HA 1MHOA 1Y0VH 1Y1UA 2WCBA 4Q04A 2DOQA 2BE6A 1SL9A 4YI8A 1AJ4A 2QEBA 4ORCB 1CTRA 1CMFA 1TIZA 1BJFA 2VRGA 4N1FA 3AAJA 5I2OA 4GBAA 3UO9A 1EH2A 1PSRA 5DICA 3PLFB 2F2OA 2KGRA 4PHMA 1V1FA 1H8BA 1K94A 3SG2A 2AUCA 2F2PA 1DJWA 1QWVA 2BKIB 3CZ0A 1D1OA 3TDIA 1SK6D 1J1DA 2E6WA 2KBMA 3LLEA 4MZLA 4DCKA 1RWYA 4N1GA 3EK7A 1QV0A 1PSBA 2WCKA 1CDPA 2JT8A 1J1EA 2KAVA 2LVKA 4CPVA 1BR1B 1AJ5A 1RFJA 1CKKA 1YUTA 2YGUA 4MZKA 3NHIA 3R72A 2LHLA 3RZSA 1NYAA 1KQMB 1J55A 3OHMB 3BJHA 2Y1MA 2JWWA 1V1GA 3TZ1A 3B88A 3JTDC 4OR9B 1TCOB 1KFXS 2ZN8A 1Y6WA 1SY9A 2K60A 3EKHA 3CR2A 2QPTA 2GTEA 2SASA 2ZNDA 1E8AA 3DF0B 4ZCUA 1RK9A 3I5HB 4JKTA 3KF9A 5ER5A 5CPVA 4PT1A 2Y4QA 4YGEB 2JU0A 1TRFA 3CABA 1C3YA 1C7VA 4ICBA 3BXKA 3FE6A 2L51A 4GNKB 3SIAA 3I5FB 1F54A 2ZKMX 1IH0A 1JWDA 1SYMA 4CIDA 3CR5X 1OOHA 4BY5A 1KFXL 3SS4A 4DUQA 1CM1A 1QV1A 4DS7A 3OGNA 5BPJA 4PHNA 3R1VA 1CFFA 2ZFDA 1JC2A 2GGMA 1IIOA 1SCMB 1XYDA 4OCIA 1C7WA 2JTTA 5HKYA 1W9ZA 2K7DA 3TS5C 3ZNIA 5HL1A 1PRWA 2KLDA 1B7TZ 4GPLB 3PSRA 2JPOA 3BQ3A 1K90D 1KWOC 3WNXB 2K8MB 4GGFA 1NCYA 5GQQC 2LLTA 1BG1A 4JWQA 1M39A 1OZOA 4M2QA 1CNPA 1BU3A 4FQTA 4ETOA 5DKQA 2M9GA 1CDNA 1M31A 1B47A 3K21A 4PDZA 3D10A 1SW8A 2PSRA 4XJKB 4NDCA 3O78A 3I5IB 4NDBA 4OKHA 1IRJA 2LANA 2A4JA 2KAYA 2LVIA 3Q8IA 4IJ7A 1TOPA 2KPHA 3DVJA 1J7PA 1XFXO 1TNPA 4GGFC 2L5XB 5EL2A 2BE4A 2COLB 4C0KA 3BFBA 4YRUA 3KHEA 1S26D 1TNXA 1UWOA 2LHIA 2ZN9A 3D77A 1MXLC 4HRHA 2NZ0A 3I5GC 1XK4A 5AXIA 1LA3A 1XA5A 2FCDA 5I8NA 3O4XA 1TCFA 1NX3A 1OMRA 2HQ8A 2WC5A 4I5JA 1UUSA 4MN0A 1U5IA 2L5YA 3EVVA 2JQ6A 3D0YA 1SL8A 2K7CA 1K93D 4AQJA 2CNPA 1MR8A 5F6TA 1CB1A 2LNKA 3VRRA 2L4HA 2LVJA 2JXLA 4AQIA 1K96A 1XK4C 2JPTA 4PCWA 3N7HA 2M8UA 1S6CA 1J7OA 1TUJA 1SBJA 1DGVA 4TNCA 3IF7A 1DTLA 1KK7Z 1C07A 1DJIA 3PN7C 4WQ3A 3DXLA 1MF8B 2M29A 1WLMA 1B8RA 1IKUA 1AHRA 3CWGA 1BLQA 2OS8B 2B1UA 2OTGB 3MSEB 4OZDA 1QS7A 3SG7A 3FWBA 1A2XA 1DVIA 1QVIZ 5JJGA 2ZRSA 3K1EA 1RTP1 3NXAA 4CLNA 1B7TY 1SR6B 4C0JA 3L4AA 1MWNA 1WDCC 2SCPA 3EK4A 1N0YA 1UHHA 1ALWA 2Q4UA 2BCBA 2PMYA 5G08A 2LE9B 4MSPA 2CBLA 3VROA 3DYEA 3SIBA 2F3ZA 4NQGA 2NXQA 5KU1A 2BCXA 1A75A 4QJ5B 1NUBA 2H2KA 2O5GA 1GGZA 5I2LA 2M7LA 1LKJA 1N2DA 4MZJA 1PULA 2BBMA 2JXCA 1X02A 1UHIA 5HYDA 3D73A 1CFCA 3S0AA 1S3PA 1SNLA 3R1PA 2KI4C 2M49B 2Y5IA 4N5XA 4JQ0D 1DT7B 1M46A 2PVBA 4A4BA 1DEKA 2GGZA 1OMVA 1S6IA 2MAZA 3DZTA 3WHTB 3NGVA 1UHKA 3SG5A 5HKZA 2CXJA 1QX2A 4JD9A 1EG3A 2KDHA 2BL0B 1QIVA 4MRYA 5FI2A 3S0DA 2JNXA 4D1EA 1CDMA 2LM5A 2QEHA 5FI7A 2KBIA 2LMTA 1FBVA 1Z2CB 2L50A 2M3WA 1OOGA 1IQ3A 4PALA 1EG4A 4AOMA 1AVSA 2M7NA 2WCJA 2EGDA 1GQMA 2KQYA 2Y1NA 2MBXA 1J7RA 1QASA 1B1GA 1NX1A 1QTXA 2KAXA 1B4CA 1QJTA 3DD4A 3BFHA 1DGUA 1WRLA 4U8DA 1NWDA 1F55A 5HLVA 5D7FA 3IQQA 2NCPA 3CDNA 3HX4A 1SKTA 2H8VA 4HSZA 1L2OB 1L7ZA 1YRTB 2BBNA 3S0FA 4INXA 2I18A 3O6BA 1KK7Y 1FW4A 5AERA 2M1KB 1LA0A 5DKNA 1IJ6A 1IWQA 1KQMC 2R2IA 2WC8A 2M0RA 3CZTX 4YGBB 1OSAA 1M63B 1UURA 4GFTA 1JFJA 3OB1B 3JVTB 2P6BB 2L4IA 1QVIY 4CFQA 1NP8A 1AUIB 2KLEA 4OV2A 3TDUA 2K7OA 1OOIX 2EC6B 1AK8A 4YI9A 2M97A 1LVCD 2QACA 3CZ1A 2LV7A 1B8CA 3BUNB 3S0GA 2CCMA 1XO5A 2LLSA 2CTNA 2MJWB 5TNCA 3SJSA 3IVTA 5HLOA 4YGAA 2BNXA 2WCFA 1K9KA 1S1EA 1IGVA 1SPYA 3EVRA 3KPXA 4DIRA 2LVVA 2KFGA 5IBWA 1KK8B 1LS8A 4FQOA 5CSNA 2JULA 3ZWHA 1KSOA 2L0PA 3B6XA 2F8PA 3I5FC 1ZOTB 4I5LB 1MUXA 3DVMA 1P28A 3NHTA 2BCAA 2EHBA 1F8HA 4PE7A 1DF0A 1BOCA 1KFUS 1BT6A 4A4CA 1HT9A 2ZRTA 4GUKA 1TNWA 2KYCA 2D8NA 2PRUA 2QEOA 3L47A 5ER4X 1SCMC 3BUOB 3BYAA 4DRWA 3BOWA 5I2QA 3L4LA 1S5GZ 1IJ5A 3B86A 2WOSA 3TUYB 2G2BA 1C3ZA 4YGCB 1G4YR 1OW4A 3EK8A 1SCVA 2G9BA 5AFPA 3OX6A 1UP5A 1TN4A 3F45A 3LCPC 3CLNA 3D0YB 1OMDA 2KGBC 3E3RA 2WCEA 1JSAA 1XFVO 1YVHA 3DY9A 1WY9A 1DELA 3I5IC 1KFUL 1NCZA 2HETA 3RM1A 1BF5A 1M45A 1T14A 2WCHA 2JT0A 5AANA 3FIAA 2K61A 3CGAA 1YVLA 1UHNA 1OOJA 2PASA 1XFWO 5CSIA 1W7JB 1KSMA 2LAPA 1CM4A 3NSLA 3B7AA 3S0EA 3HCMA 3PM8A 1K9UA 3FWCA 2NLNA 1R6PA 1Q80A 3FE8A 2NCOA 1AP4A 3C1VA 3O4YA 1NCXA 5HKWA 3PALA 2LMUA 1K9PA 3GK1A 3CYZA 2KNEA 1JFKA 3QMEA 1UHJA 4HREE 1BODA 2MLFC 2P70A 1BMOA 1CMGA 3NSKA
chains in the Genus database with same CATH topology
1EL4A 1DJGA 5CSFA 4PE0A 1B9AA 4FTGA 5AEQA 3SG3A 1W7IB 2O60A 1QXPA 2LC5A 2LP3A 4PHJA 3JTDB 1A75B 2JOJA 3AAKA 1R2UA 3M0WA 2AMIA 3LL8B 4MVFA 4OVNF 1WRZA 4UPGA 1NIWA 1YR5A 2HPSA 3O2PA 2MA2A 3BUWB 1KQVA 3GK4X 1ODBA 1QLSA 1A4PA 2GV5A 3WXAA 3KEVA 1VRKA 3CS1A 1YRUB 4ZCVA 1OZSA 1F4OA 1N65A 2FCEA 2OS8C 3EKJA 3EVUA 3IQOA 2OTGC 3OP0A 4MEWA 1CLBA 1NX2A 2L2EA 1ZMZA 2IS9A 1K2HA 3NSOA 4I5KA 4YGDB 1DJXA 2CT9A 4L9MA 1TTXA 1S5GY 1XFZO 1HQVA 1DJHA 1SR6C 2ISDA 3AKBA 1YUUA 1QX7A 5DKRA 1JBAA 1LINA 2MLEC 1QX5B 2LLUA 4CFRA 3OB2B 4P2YB 1SL7A 1A29A 2I94A 3TDZA 3SG4A 1RECA 1Y1XA 5KTYA 1G8IA 1NX0A 3TS5B 3NSIA 1BR4B 1JF2A 4R1EA 2HF5A 1DJYA 1KWOB 2KQ6A 2JTZA 3ICBA 3VRNA 2KI6D 1DMOA 1ALVA 1K8UA 1EXRA 1S36A 1Y1AA 3DF0A 3BUMB 4BY4A 3A8RA 4MLWA 5PALA 1JF0A 1QLKA 2BKHB 1G33A 1MXEA 2BL0C 1LXFC 2K2AA 2KSPA 1OE9B 5KSZA 1XFYO 4GAOA 1SMGA 2WORA 4E68A 4P5OE 1YX8A 3CR4X 4GGNA 3CTNA 1DJZA 1F71A 1IQ5A 1CLMA 3DVKA 1PALA 2KYFA 2HQWA 3I5HC 1ZFSA 1JUOA 1ZACA 3LK1A 1WLZA 4QJ4B 1F4QA 2L98A 1J7QA 1WRKA 1FI5A 4MBEA 4HRGA 4WRIA 3I5GB 2RGIA 2PALA 4M2OA 1ZUZA 3GK2A 1QIWA 2MHHA 1L2OC 2KOTA 2KFFA 2Q91A 1RROA 3AKAA 2KFHA 3KO0A 4ORAB 4M2PA 4PE4A 4ORBB 5JOLA 2LUCA 1DF0B 3PATA 3SG6A 1XFUO 2TN4A 4WQ2A 5K89A 4XJKA 1MQ1A 1A03A 2I7AA 2FOTA 3JVTC 4XYNA 3BOWB 1FPWA 1YURA 2H61A 1YUSA 2EC6C 2F3YA 2AAOA 1SRAA 2FJUB 3QRXA 1U5IB 3PN7B 4USLA 5D69A 1TNQA 2K7BA 2M1UA 3RLZA 2WNDA 2OPOA 3GOFA 1F70A 1IG5A 1PVBA 1KCYA 3BUXB 4QJ3B 2ZNEA 1QATA 3A4UB 1KK8C 3H4SE 1GJYA 3OX5A 1CFPA 2H61C 4PHKA 1YTZC 4F0ZB 4MRXA 4PE1A 2LCPA 3DVEA 1WDCB 4IL1A 1XVJA 1GGWA 4C0LA 2E30A 1B8LA 3LK0A 2KHNA 2LUXA 2MRDA 5J3XA 3VRQA 2JT3A 2JZIA 3FS7A 4JPZB 3WHUB 2KI6C 1OQPA 1PK0D 1CDLA 2JC2A 5CSJA 1NSHA 2BECA 1K95A 2F33A 1NPQA 5B8IB 2I2RE 1FF1A 1CLLA 4I5NB 2JNFA 2K0JA 2LMVA 1EJ3A 3VRPA 2V53A 3TUYC 2JRFA 1FI6A 1S6JA 3PFVA 3VGOA 1PVAA 2KI4B 4NDDA 2K2FA 1H4BA 2LP2A 1RJVA 4YBHB 1YX7A 5FYXA 1CFDA 1MHOA 1Y0VH 1Y1UA 2WCBA 4Q04A 2DOQA 2BE6A 1SL9A 4YI8A 1AJ4A 4ORCB 1CTRA 1CMFA 1TIZA 1BJFA 2VRGA 4N1FA 3AAJA 5I2OA 4GBAA 1EH2A 1PSRA 3PLFB 2F2OA 2KGRA 4PHMA 1V1FA 1H8BA 1K94A 3SG2A 2AUCA 2F2PA 1DJWA 2BKIB 1D1OA 3TDIA 1SK6D 1J1DA 2E6WA 2KBMA 3LLEA 4MZLA 4DCKA 1RWYA 4N1GA 3EK7A 1QV0A 1PSBA 1CDPA 2JT8A 1J1EA 2KAVA 2LVKA 4CPVA 1BR1B 1AJ5A 1RFJA 1CKKA 1YUTA 4MZKA 2LHLA 1NYAA 1KQMB 1J55A 3OHMB 2Y1MA 2JWWA 1V1GA 3TZ1A 3JTDC 4OR9B 1TCOB 1KFXS 2ZN8A 1Y6WA 1SY9A 3EKHA 3CR2A 2QPTA 2ZNDA 2SASA 1E8AA 3DF0B 4ZCUA 1RK9A 3I5HB 3KF9A 5ER5A 5CPVA 2Y4QA 4YGEB 2JU0A 1TRFA 1C7VA 4ICBA 3BXKA 4GNKB 2L51A 3SIAA 1IH0A 3I5FB 1F54A 2ZKMX 1JWDA 1SYMA 4CIDA 3CR5X 4BY5A 1KFXL 4DUQA 1CM1A 1QV1A 4DS7A 5BPJA 4PHNA 1CFFA 2ZFDA 1JC2A 2GGMA 1SCMB 1XYDA 4OCIA 1C7WA 2JTTA 5HKYA 2K7DA 3TS5C 3ZNIA 1PRWA 1B7TZ 4GPLB 3PSRA 3BQ3A 1K90D 1KWOC 3WNXB 2K8MB 4GGFA 1NCYA 5GQQC 2LLTA 1BG1A 4JWQA 1M39A 1OZOA 4M2QA 1CNPA 1BU3A 4ETOA 5DKQA 2M9GA 1CDNA 1M31A 1B47A 3K21A 4PDZA 3D10A 1SW8A 2PSRA 4XJKB 4NDCA 3O78A 3I5IB 4NDBA 4OKHA 1IRJA 2LANA 2A4JA 2KAYA 2LVIA 1TOPA 3DVJA 1J7PA 1XFXO 1TNPA 4GGFC 2L5XB 2BE4A 2COLB 4C0KA 4YRUA 3KHEA 1S26D 1TNXA 1UWOA 2LHIA 2ZN9A 1MXLC 4HRHA 2NZ0A 3I5GC 1XK4A 5AXIA 1LA3A 1XA5A 2FCDA 5I8NA 1TCFA 1NX3A 1OMRA 2HQ8A 4I5JA 1UUSA 4MN0A 1U5IA 3EVVA 2JQ6A 3D0YA 1SL8A 2K7CA 1K93D 4AQJA 2CNPA 1MR8A 5F6TA 1CB1A 2LNKA 3VRRA 2L4HA 2LVJA 2JXLA 4AQIA 1K96A 1XK4C 2JPTA 4PCWA 2M8UA 1S6CA 1J7OA 1SBJA 1DGVA 4TNCA 3IF7A 1DTLA 1KK7Z 1C07A 1DJIA 3PN7C 4WQ3A 1MF8B 2M29A 1WLMA 1B8RA 1IKUA 1AHRA 3CWGA 1BLQA 2OS8B 2B1UA 2OTGB 3MSEB 1QS7A 3SG7A 3FWBA 1A2XA 1DVIA 1QVIZ 5JJGA 2ZRSA 3NXAA 1RTP1 4CLNA 1B7TY 1SR6B 4C0JA 1MWNA 1WDCC 2SCPA 3EK4A 1N0YA 1UHHA 1ALWA 2Q4UA 2BCBA 2PMYA 5G08A 2LE9B 4MSPA 2CBLA 3VROA 3SIBA 2F3ZA 4NQGA 2NXQA 5KU1A 2BCXA 1A75A 4QJ5B 1NUBA 2H2KA 2O5GA 1GGZA 5I2LA 2M7LA 1LKJA 1N2DA 4MZJA 1PULA 2BBMA 2JXCA 1X02A 1UHIA 5HYDA 1CFCA 1S3PA 1SNLA 2KI4C 2M49B 2Y5IA 4N5XA 4JQ0D 1DT7B 1M46A 2PVBA 4A4BA 2GGZA 1OMVA 1S6IA 2MAZA 3WHTB 1UHKA 3SG5A 5HKZA 2CXJA 1QX2A 4MRYA 1EG3A 2KDHA 2BL0B 1QIVA 4D1EA 2JNXA 1CDMA 2LM5A 2KBIA 2LMTA 1FBVA 2L50A 2M3WA 1IQ3A 4PALA 1EG4A 4AOMA 1AVSA 2M7NA 2EGDA 1GQMA 2KQYA 2Y1NA 2MBXA 1J7RA 1QASA 1B1GA 1NX1A 1QTXA 2KAXA 1B4CA 1QJTA 3DD4A 4U8DA 1DGUA 1WRLA 1NWDA 1F55A 5HLVA 5D7FA 3IQQA 2NCPA 3HX4A 1SKTA 4HSZA 1L2OB 1L7ZA 1YRTB 2BBNA 2I18A 3O6BA 1KK7Y 1FW4A 5AERA 2M1KB 1LA0A 5DKNA 1IJ6A 1IWQA 1KQMC 2R2IA 2WC8A 2M0RA 3CZTX 4YGBB 1OSAA 1M63B 1UURA 4GFTA 1JFJA 3OB1B 3JVTB 2P6BB 2L4IA 1QVIY 4CFQA 1NP8A 1AUIB 4OV2A 3TDUA 2K7OA 2EC6B 1AK8A 4YI9A 2M97A 1LVCD 2QACA 2LV7A 1B8CA 3BUNB 2CCMA 1XO5A 2LLSA 2CTNA 2MJWB 5TNCA 3SJSA 5HLOA 4YGAA 2WCFA 1K9KA 1S1EA 1IGVA 1SPYA 3EVRA 3KPXA 4DIRA 2LVVA 2KFGA 5IBWA 1KK8B 4FQOA 5CSNA 2JULA 3ZWHA 1KSOA 2L0PA 3I5FC 2F8PA 1ZOTB 4I5LB 1MUXA 3DVMA 2BCAA 2EHBA 1F8HA 4PE7A 1DF0A 1BOCA 1KFUS 1BT6A 4A4CA 1HT9A 2ZRTA 4GUKA 1TNWA 2KYCA 2D8NA 2PRUA 5ER4X 1SCMC 3BUOB 3BYAA 4DRWA 3BOWA 5I2QA 1S5GZ 1IJ5A 3TUYB 2WOSA 2G2BA 4YGCB 1G4YR 3EK8A 1SCVA 2G9BA 5AFPA 3OX6A 1UP5A 1TN4A 3F45A 3LCPC 3CLNA 3D0YB 1OMDA 2KGBC 3E3RA 2WCEA 1JSAA 1XFVO 1YVHA 1WY9A 3I5IC 1KFUL 1NCZA 2HETA 3RM1A 1BF5A 1M45A 2JT0A 5AANA 3FIAA 2K61A 3CGAA 1YVLA 1UHNA 1OOJA 2PASA 1XFWO 5CSIA 1W7JB 1KSMA 2LAPA 1CM4A 3NSLA 3HCMA 3PM8A 1K9UA 3FWCA 2NLNA 1R6PA 1Q80A 2NCOA 1AP4A 3C1VA 3O4YA 1NCXA 5HKWA 3PALA 2LMUA 1K9PA 3GK1A 2KNEA 1JFKA 1UHJA 4HREE 1BODA 2MLFC 1BMOA 1CMGA 3NSKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EL4 A;  1DJG A;  5CSF A;  4PE0 A;  1B9A A;  4FTG A;  5AEQ A;  3SG3 A;  1W7I B;  2O60 A;  1QXP A;  2LC5 A;  2LP3 A;  4PHJ A;  3JTD B;  1A75 B;  2JOJ A;  3AAK A;  1R2U A;  3M0W A;  2AMI A;  3LL8 B;  4MVF A;  4OVN F;  1WRZ A;  4UPG A;  1NIW A;  1YR5 A;  2HPS A;  3O2P A;  2MA2 A;  3BUW B;  1KQV A;  3GK4 X;  1ODB A;  1QLS A;  1A4P A;  2GV5 A;  3WXA A;  3KEV A;  1VRK A;  3CS1 A;  1YRU B;  4ZCV A;  1OZS A;  1F4O A;  1N65 A;  2FCE A;  2OS8 C;  3EKJ A;  3EVU A;  3IQO A;  2OTG C;  3OP0 A;  4MEW A;  1CLB A;  1NX2 A;  2L2E A;  1ZMZ A;  2IS9 A;  1K2H A;  3NSO A;  4I5K A;  4YGD B;  1DJX A;  2CT9 A;  4L9M A;  1TTX A;  1S5G Y;  1XFZ O;  1HQV A;  1DJH A;  1SR6 C;  2ISD A;  3AKB A;  1YUU A;  1QX7 A;  5DKR A;  1JBA A;  1LIN A;  2MLE C;  1QX5 B;  2LLU A;  4CFR A;  3OB2 B;  4P2Y B;  1SL7 A;  1A29 A;  2I94 A;  3TDZ A;  3SG4 A;  1REC A;  1Y1X A;  5KTY A;  1G8I A;  1NX0 A;  3TS5 B;  3NSI A;  1BR4 B;  1JF2 A;  4R1E A;  2HF5 A;  1DJY A;  1KWO B;  2KQ6 A;  2JTZ A;  3ICB A;  3VRN A;  2KI6 D;  1DMO A;  1ALV A;  1K8U A;  1EXR A;  1S36 A;  1Y1A A;  3DF0 A;  3BUM B;  4BY4 A;  3A8R A;  4MLW A;  5PAL A;  1JF0 A;  1QLK A;  2BKH B;  1G33 A;  1MXE A;  2BL0 C;  1LXF C;  2K2A A;  2KSP A;  1OE9 B;  5KSZ A;  1XFY O;  4GAO A;  1SMG A;  2WOR A;  4E68 A;  4P5O E;  1YX8 A;  3CR4 X;  4GGN A;  3CTN A;  1DJZ A;  1F71 A;  1IQ5 A;  1CLM A;  3DVK A;  1PAL A;  2KYF A;  2HQW A;  3I5H C;  1ZFS A;  1JUO A;  1ZAC A;  3LK1 A;  1WLZ A;  4QJ4 B;  1F4Q A;  2L98 A;  1J7Q A;  1WRK A;  1FI5 A;  4MBE A;  4HRG A;  4WRI A;  3I5G B;  2RGI A;  2PAL A;  4M2O A;  1ZUZ A;  3GK2 A;  1QIW A;  2MHH A;  1L2O C;  2KOT A;  2KFF A;  2Q91 A;  1RRO A;  3AKA A;  2KFH A;  3KO0 A;  4ORA B;  4M2P A;  4PE4 A;  4ORB B;  5JOL A;  2LUC A;  1DF0 B;  3PAT A;  3SG6 A;  1XFU O;  2TN4 A;  4WQ2 A;  5K89 A;  4XJK A;  1MQ1 A;  1A03 A;  2I7A A;  2FOT A;  3JVT C;  4XYN A;  3BOW B;  1FPW A;  1YUR A;  2H61 A;  1YUS A;  2EC6 C;  2F3Y A;  2AAO A;  1SRA A;  2FJU B;  3QRX A;  1U5I B;  3PN7 B;  4USL A;  5D69 A;  1TNQ A;  2K7B A;  2M1U A;  3RLZ A;  2WND A;  2OPO A;  3GOF A;  1F70 A;  1IG5 A;  1PVB A;  1KCY A;  3BUX B;  4QJ3 B;  2ZNE A;  1QAT A;  3A4U B;  1KK8 C;  3H4S E;  1GJY A;  3OX5 A;  1CFP A;  2H61 C;  4PHK A;  1YTZ C;  4F0Z B;  4MRX A;  4PE1 A;  2LCP A;  3DVE A;  1WDC B;  4IL1 A;  1XVJ A;  1GGW A;  4C0L A;  2E30 A;  1B8L A;  3LK0 A;  2KHN A;  2LUX A;  2MRD A;  5J3X A;  3VRQ A;  2JT3 A;  2JZI A;  3FS7 A;  4JPZ B;  3WHU B;  2KI6 C;  1OQP A;  1PK0 D;  1CDL A;  2JC2 A;  5CSJ A;  1NSH A;  2BEC A;  1K95 A;  2F33 A;  1NPQ A;  5B8I B;  2I2R E;  1FF1 A;  1CLL A;  4I5N B;  2JNF A;  2K0J A;  2LMV A;  1EJ3 A;  3VRP A;  2V53 A;  3TUY C;  2JRF A;  1FI6 A;  1S6J A;  3PFV A;  3VGO A;  1PVA A;  2KI4 B;  4NDD A;  2K2F A;  1H4B A;  2LP2 A;  1RJV A;  4YBH B;  1YX7 A;  5FYX A;  1CFD A;  1MHO A;  1Y0V H;  1Y1U A;  2WCB A;  4Q04 A;  2DOQ A;  2BE6 A;  1SL9 A;  4YI8 A;  1AJ4 A;  4ORC B;  1CTR A;  1CMF A;  1TIZ A;  1BJF A;  2VRG A;  4N1F A;  3AAJ A;  5I2O A;  4GBA A;  1EH2 A;  1PSR A;  3PLF B;  2F2O A;  2KGR A;  4PHM A;  1V1F A;  1H8B A;  1K94 A;  3SG2 A;  2AUC A;  2F2P A;  1DJW A;  2BKI B;  1D1O A;  3TDI A;  1SK6 D;  1J1D A;  2E6W A;  2KBM A;  3LLE A;  4MZL A;  4DCK A;  1RWY A;  4N1G A;  3EK7 A;  1QV0 A;  1PSB A;  1CDP A;  2JT8 A;  1J1E A;  2KAV A;  2LVK A;  4CPV A;  1BR1 B;  1AJ5 A;  1RFJ A;  1CKK A;  1YUT A;  4MZK A;  2LHL A;  1NYA A;  1KQM B;  1J55 A;  3OHM B;  2Y1M A;  2JWW A;  1V1G A;  3TZ1 A;  3JTD C;  4OR9 B;  1TCO B;  1KFX S;  2ZN8 A;  1Y6W A;  1SY9 A;  3EKH A;  3CR2 A;  2QPT A;  2ZND A;  2SAS A;  1E8A A;  3DF0 B;  4ZCU A;  1RK9 A;  3I5H B;  3KF9 A;  5ER5 A;  5CPV A;  2Y4Q A;  4YGE B;  2JU0 A;  1TRF A;  1C7V A;  4ICB A;  3BXK A;  4GNK B;  2L51 A;  3SIA A;  1IH0 A;  3I5F B;  1F54 A;  2ZKM X;  1JWD A;  1SYM A;  4CID A;  3CR5 X;  4BY5 A;  1KFX L;  4DUQ A;  1CM1 A;  1QV1 A;  4DS7 A;  5BPJ A;  4PHN A;  1CFF A;  2ZFD A;  1JC2 A;  2GGM A;  1SCM B;  1XYD A;  4OCI A;  1C7W A;  2JTT A;  5HKY A;  2K7D A;  3TS5 C;  3ZNI A;  1PRW A;  1B7T Z;  4GPL B;  3PSR A;  3BQ3 A;  1K90 D;  1KWO C;  3WNX B;  2K8M B;  4GGF A;  1NCY A;  5GQQ C;  2LLT A;  1BG1 A;  4JWQ A;  1M39 A;  1OZO A;  4M2Q A;  1CNP A;  1BU3 A;  4ETO A;  5DKQ A;  2M9G A;  1CDN A;  1M31 A;  1B47 A;  3K21 A;  4PDZ A;  3D10 A;  1SW8 A;  2PSR A;  4XJK B;  4NDC A;  3O78 A;  3I5I B;  4NDB A;  4OKH A;  1IRJ A;  2LAN A;  2A4J A;  2KAY A;  2LVI A;  1TOP A;  3DVJ A;  1J7P A;  1XFX O;  1TNP A;  4GGF C;  2L5X B;  2BE4 A;  2COL B;  4C0K A;  4YRU A;  3KHE A;  1S26 D;  1TNX A;  1UWO A;  2LHI A;  2ZN9 A;  1MXL C;  4HRH A;  2NZ0 A;  3I5G C;  1XK4 A;  5AXI A;  1LA3 A;  1XA5 A;  2FCD A;  5I8N A;  1TCF A;  1NX3 A;  1OMR A;  2HQ8 A;  4I5J A;  1UUS A;  4MN0 A;  1U5I A;  3EVV A;  2JQ6 A;  3D0Y A;  1SL8 A;  2K7C A;  1K93 D;  4AQJ A;  2CNP A;  1MR8 A;  5F6T A;  1CB1 A;  2LNK A;  3VRR A;  2L4H A;  2LVJ A;  2JXL A;  4AQI A;  1K96 A;  1XK4 C;  2JPT A;  4PCW A;  2M8U A;  1S6C A;  1J7O A;  1SBJ A;  1DGV A;  4TNC A;  3IF7 A;  1DTL A;  1KK7 Z;  1C07 A;  1DJI A;  3PN7 C;  4WQ3 A;  1MF8 B;  2M29 A;  1WLM A;  1B8R A;  1IKU A;  1AHR A;  3CWG A;  1BLQ A;  2OS8 B;  2B1U A;  2OTG B;  3MSE B;  1QS7 A;  3SG7 A;  3FWB A;  1A2X A;  1DVI A;  1QVI Z;  5JJG A;  2ZRS A;  3NXA A;  1RTP 1;  4CLN A;  1B7T Y;  1SR6 B;  4C0J A;  1MWN A;  1WDC C;  2SCP A;  3EK4 A;  1N0Y A;  1UHH A;  1ALW A;  2Q4U A;  2BCB A;  2PMY A;  5G08 A;  2LE9 B;  4MSP A;  2CBL A;  3VRO A;  3SIB A;  2F3Z A;  4NQG A;  2NXQ A;  5KU1 A;  2BCX A;  1A75 A;  4QJ5 B;  1NUB A;  2H2K A;  2O5G A;  1GGZ A;  5I2L A;  2M7L A;  1LKJ A;  1N2D A;  4MZJ A;  1PUL A;  2BBM A;  2JXC A;  1X02 A;  1UHI A;  5HYD A;  1CFC A;  1S3P A;  1SNL A;  2KI4 C;  2M49 B;  2Y5I A;  4N5X A;  4JQ0 D;  1DT7 B;  1M46 A;  2PVB A;  4A4B A;  2GGZ A;  1OMV A;  1S6I A;  2MAZ A;  3WHT B;  1UHK A;  3SG5 A;  5HKZ A;  2CXJ A;  1QX2 A;  4MRY A;  1EG3 A;  2KDH A;  2BL0 B;  1QIV A;  4D1E A;  2JNX A;  1CDM A;  2LM5 A;  2KBI A;  2LMT A;  1FBV A;  2L50 A;  2M3W A;  1IQ3 A;  4PAL A;  1EG4 A;  4AOM A;  1AVS A;  2M7N A;  2EGD A;  1GQM A;  2KQY A;  2Y1N A;  2MBX A;  1J7R A;  1QAS A;  1B1G A;  1NX1 A;  1QTX A;  2KAX A;  1B4C A;  1QJT A;  3DD4 A;  4U8D A;  1DGU A;  1WRL A;  1NWD A;  1F55 A;  5HLV A;  5D7F A;  3IQQ A;  2NCP A;  3HX4 A;  1SKT A;  4HSZ A;  1L2O B;  1L7Z A;  1YRT B;  2BBN A;  2I18 A;  3O6B A;  1KK7 Y;  1FW4 A;  5AER A;  2M1K B;  1LA0 A;  5DKN A;  1IJ6 A;  1IWQ A;  1KQM C;  2R2I A;  2WC8 A;  2M0R A;  3CZT X;  4YGB B;  1OSA A;  1M63 B;  1UUR A;  4GFT A;  1JFJ A;  3OB1 B;  3JVT B;  2P6B B;  2L4I A;  1QVI Y;  4CFQ A;  1NP8 A;  1AUI B;  4OV2 A;  3TDU A;  2K7O A;  2EC6 B;  1AK8 A;  4YI9 A;  2M97 A;  1LVC D;  2QAC A;  2LV7 A;  1B8C A;  3BUN B;  2CCM A;  1XO5 A;  2LLS A;  2CTN A;  2MJW B;  5TNC A;  3SJS A;  5HLO A;  4YGA A;  2WCF A;  1K9K A;  1S1E A;  1IGV A;  1SPY A;  3EVR A;  3KPX A;  4DIR A;  2LVV A;  2KFG A;  5IBW A;  1KK8 B;  4FQO A;  5CSN A;  2JUL A;  3ZWH A;  1KSO A;  2L0P A;  3I5F C;  2F8P A;  1ZOT B;  4I5L B;  1MUX A;  3DVM A;  2BCA A;  2EHB A;  1F8H A;  4PE7 A;  1DF0 A;  1BOC A;  1KFU S;  1BT6 A;  4A4C A;  1HT9 A;  2ZRT A;  4GUK A;  1TNW A;  2KYC A;  2D8N A;  2PRU A;  5ER4 X;  1SCM C;  3BUO B;  3BYA A;  4DRW A;  3BOW A;  5I2Q A;  1S5G Z;  1IJ5 A;  3TUY B;  2WOS A;  2G2B A;  4YGC B;  1G4Y R;  3EK8 A;  1SCV A;  2G9B A;  5AFP A;  3OX6 A;  1UP5 A;  1TN4 A;  3F45 A;  3LCP C;  3CLN A;  3D0Y B;  1OMD A;  2KGB C;  3E3R A;  2WCE A;  1JSA A;  1XFV O;  1YVH A;  1WY9 A;  3I5I C;  1KFU L;  1NCZ A;  2HET A;  3RM1 A;  1BF5 A;  1M45 A;  2JT0 A;  5AAN A;  3FIA A;  2K61 A;  3CGA A;  1YVL A;  1UHN A;  1OOJ A;  2PAS A;  1XFW O;  5CSI A;  1W7J B;  1KSM A;  2LAP A;  1CM4 A;  3NSL A;  3HCM A;  3PM8 A;  1K9U A;  3FWC A;  2NLN A;  1R6P A;  1Q80 A;  2NCO A;  1AP4 A;  3C1V A;  3O4Y A;  1NCX A;  5HKW A;  3PAL A;  2LMU A;  1K9P A;  3GK1 A;  2KNE A;  1JFK A;  1UHJ A;  4HRE E;  1BOD A;  2MLF C;  1BMO A;  1CMG A;  3NSK A; 
#chains in the Genus database with same CATH topology
 1EL4 A;  1DJG A;  5CSF A;  4PE0 A;  2P71 A;  5I94 A;  1B9A A;  4FTG A;  5AEQ A;  3B87 A;  3SG3 A;  1W7I B;  2O60 A;  1QXP A;  2LC5 A;  4INW A;  2LP3 A;  4PHJ A;  3JTD B;  1A75 B;  2JOJ A;  3AAK A;  1R2U A;  3M0W A;  2AMI A;  3LL8 B;  4MVF A;  4OVN F;  1WRZ A;  4UPG A;  1NIW A;  1YR5 A;  2HPS A;  1XFR A;  3O2P A;  2MA2 A;  1OOF A;  3BUW B;  1KQV A;  3GK4 X;  1ODB A;  1QLS A;  1A4P A;  2GV5 A;  3WXA A;  3KEV A;  1VRK A;  3CS1 A;  1YRU B;  4ZCV A;  1OZS A;  1F4O A;  1N65 A;  2FCE A;  2OS8 C;  3EKJ A;  3EVU A;  3IQO A;  2OTG C;  3OP0 A;  4MEW A;  1CLB A;  1NX2 A;  4KYN A;  2L2E A;  1ZMZ A;  2IS9 A;  1K2H A;  3NSO A;  4I5K A;  4YGD B;  1DJX A;  2CT9 A;  4L9M A;  1TTX A;  1S5G Y;  1XFZ O;  1HQV A;  1DJH A;  2QEV A;  1SR6 C;  2ISD A;  3SS5 A;  3AKB A;  1YUU A;  1QX7 A;  5DKR A;  1JBA A;  3EG5 B;  1LIN A;  1ORG A;  2MLE C;  1QX5 B;  2LLU A;  4CFR A;  1DQE A;  3OB2 B;  4P2Y B;  2PYQ A;  1SL7 A;  1A29 A;  2I94 A;  3TDZ A;  3SG4 A;  1REC A;  1Y1X A;  5KTY A;  1G8I A;  1NX0 A;  3TS5 B;  3NSI A;  1BR4 B;  1JF2 A;  4R1E A;  2HF5 A;  1DJY A;  1KWO B;  3OBV A;  2KQ6 A;  2JTZ A;  3ICB A;  3VRN A;  2KI6 D;  1DMO A;  1ALV A;  1K8U A;  1EXR A;  1S36 A;  1Y1A A;  3DF0 A;  3BUM B;  1TUZ A;  4BY4 A;  3A8R A;  4MLW A;  5PAL A;  1JF0 A;  1QLK A;  2BKH B;  1G33 A;  1MXE A;  2BL0 C;  1LXF C;  2K2A A;  2KSP A;  1OE9 B;  5KSZ A;  3CZ2 A;  1XFY O;  3FE9 A;  4GAO A;  1SMG A;  2WOR A;  4E68 A;  4P5O E;  1YX8 A;  3CR4 X;  4GGN A;  3CTN A;  3SS3 A;  1DJZ A;  1F71 A;  1IQ5 A;  1CLM A;  3DVK A;  1PAL A;  2KYF A;  2WCL A;  2HQW A;  3I5H C;  4F7F A;  2QDI A;  5D3O A;  1ZFS A;  1JUO A;  1ZAC A;  3LK1 A;  1WLZ A;  3PJI A;  1F4Q A;  2L98 A;  4QJ4 B;  1J7Q A;  1WRK A;  1FI5 A;  2L2C A;  4HRG A;  4MBE A;  3I5G B;  4WRI A;  2RGI A;  2PAL A;  1TWO A;  3R1O A;  4M2O A;  1ZUZ A;  3GK2 A;  1DC1 A;  1QIW A;  2MHH A;  1L2O C;  2KOT A;  2KFF A;  2Q91 A;  1RRO A;  3AKA A;  2KFH A;  3KO0 A;  4ORA B;  4M2P A;  4PE4 A;  4ORB B;  2WC6 A;  5JOL A;  2LUC A;  1DF0 B;  3PAT A;  3SG6 A;  3UNW A;  1XFU O;  2TN4 A;  4WQ2 A;  1SSE B;  3V2L A;  5K89 A;  4XJK A;  1MQ1 A;  3D78 A;  1A03 A;  2I7A A;  2FOT A;  3JVT C;  3D76 A;  3BOW B;  4XYN A;  1FPW A;  1YUR A;  2H61 A;  1YUS A;  2EC6 C;  3S0B A;  2ERB A;  2F3Y A;  2AAO A;  1SRA A;  2FJU B;  3QRX A;  1U5I B;  3PN7 B;  4USL A;  5D69 A;  1TNQ A;  2K7B A;  2M1U A;  3RLZ A;  2WND A;  5FI6 A;  2OPO A;  3GOF A;  1F70 A;  1IG5 A;  1PVB A;  1GM0 A;  3BUX B;  4QJ3 B;  2ZNE A;  1KCY A;  1QAT A;  3A4U B;  1KK8 C;  3D75 A;  1GJY A;  3H4S E;  3OX5 A;  1CFP A;  2H61 C;  4PHK A;  1YTZ C;  4F0Z B;  4MRX A;  4PE1 A;  2LCP A;  3DVE A;  1WDC B;  4IL1 A;  1XVJ A;  1GGW A;  3D74 A;  4C0L A;  2E30 A;  1B8L A;  3LK0 A;  2KHN A;  2LUX A;  2MRD A;  5J3X A;  3VRQ A;  2JT3 A;  2JZI A;  2FJY A;  3FS7 A;  4JPZ B;  3WHU B;  2KI6 C;  1OQP A;  1PK0 D;  1CDL A;  2JC2 A;  3BFA A;  5CSJ A;  1NSH A;  2BEC A;  1K95 A;  2BAP A;  2F33 A;  1NPQ A;  5B8I B;  2I2R E;  1FF1 A;  1CLL A;  4I5N B;  2JNF A;  3VB1 A;  2K0J A;  2LMV A;  1EJ3 A;  3VRP A;  2V53 A;  3TUY C;  2JRF A;  1FI6 A;  1S6J A;  3PFV A;  3VGO A;  1PVA A;  2KI4 B;  3PM2 A;  2WCM A;  2PQL A;  4NDD A;  2K2F A;  1H4B A;  2LP2 A;  1RJV A;  4YBH B;  1YX7 A;  5FYX A;  1CFD A;  1Z4H A;  1MHO A;  1Y0V H;  1Y1U A;  2WCB A;  4Q04 A;  2DOQ A;  2BE6 A;  1SL9 A;  4YI8 A;  1AJ4 A;  2QEB A;  4ORC B;  1CTR A;  1CMF A;  1TIZ A;  1BJF A;  2VRG A;  4N1F A;  3AAJ A;  5I2O A;  4GBA A;  3UO9 A;  1EH2 A;  1PSR A;  5DIC A;  3PLF B;  2F2O A;  2KGR A;  4PHM A;  1V1F A;  1H8B A;  1K94 A;  3SG2 A;  2AUC A;  2F2P A;  1DJW A;  1QWV A;  2BKI B;  3CZ0 A;  1D1O A;  3TDI A;  1SK6 D;  1J1D A;  2E6W A;  2KBM A;  3LLE A;  4MZL A;  4DCK A;  1RWY A;  4N1G A;  3EK7 A;  1QV0 A;  1PSB A;  2WCK A;  1CDP A;  2JT8 A;  1J1E A;  2KAV A;  2LVK A;  4CPV A;  1BR1 B;  1AJ5 A;  1RFJ A;  1CKK A;  1YUT A;  2YGU A;  4MZK A;  3NHI A;  3R72 A;  2LHL A;  3RZS A;  1NYA A;  1KQM B;  1J55 A;  3OHM B;  3BJH A;  2Y1M A;  2JWW A;  1V1G A;  3TZ1 A;  3B88 A;  3JTD C;  4OR9 B;  1TCO B;  1KFX S;  2ZN8 A;  1Y6W A;  1SY9 A;  2K60 A;  3EKH A;  3CR2 A;  2QPT A;  2GTE A;  2SAS A;  2ZND A;  1E8A A;  3DF0 B;  4ZCU A;  1RK9 A;  3I5H B;  4JKT A;  3KF9 A;  5ER5 A;  5CPV A;  4PT1 A;  2Y4Q A;  4YGE B;  2JU0 A;  1TRF A;  3CAB A;  1C3Y A;  1C7V A;  4ICB A;  3BXK A;  3FE6 A;  2L51 A;  4GNK B;  3SIA A;  3I5F B;  1F54 A;  2ZKM X;  1IH0 A;  1JWD A;  1SYM A;  4CID A;  3CR5 X;  1OOH A;  4BY5 A;  1KFX L;  3SS4 A;  4DUQ A;  1CM1 A;  1QV1 A;  4DS7 A;  3OGN A;  5BPJ A;  4PHN A;  3R1V A;  1CFF A;  2ZFD A;  1JC2 A;  2GGM A;  1IIO A;  1SCM B;  1XYD A;  4OCI A;  1C7W A;  2JTT A;  5HKY A;  1W9Z A;  2K7D A;  3TS5 C;  3ZNI A;  5HL1 A;  1PRW A;  2KLD A;  1B7T Z;  4GPL B;  3PSR A;  2JPO A;  3BQ3 A;  1K90 D;  1KWO C;  3WNX B;  2K8M B;  4GGF A;  1NCY A;  5GQQ C;  2LLT A;  1BG1 A;  4JWQ A;  1M39 A;  1OZO A;  4M2Q A;  1CNP A;  1BU3 A;  4FQT A;  4ETO A;  5DKQ A;  2M9G A;  1CDN A;  1M31 A;  1B47 A;  3K21 A;  4PDZ A;  3D10 A;  1SW8 A;  2PSR A;  4XJK B;  4NDC A;  3O78 A;  3I5I B;  4NDB A;  4OKH A;  1IRJ A;  2LAN A;  2A4J A;  2KAY A;  2LVI A;  3Q8I A;  4IJ7 A;  1TOP A;  2KPH A;  3DVJ A;  1J7P A;  1XFX O;  1TNP A;  4GGF C;  2L5X B;  5EL2 A;  2BE4 A;  2COL B;  4C0K A;  3BFB A;  4YRU A;  3KHE A;  1S26 D;  1TNX A;  1UWO A;  2LHI A;  2ZN9 A;  3D77 A;  1MXL C;  4HRH A;  2NZ0 A;  3I5G C;  1XK4 A;  5AXI A;  1LA3 A;  1XA5 A;  2FCD A;  5I8N A;  3O4X A;  1TCF A;  1NX3 A;  1OMR A;  2HQ8 A;  2WC5 A;  4I5J A;  1UUS A;  4MN0 A;  1U5I A;  2L5Y A;  3EVV A;  2JQ6 A;  3D0Y A;  1SL8 A;  2K7C A;  1K93 D;  4AQJ A;  2CNP A;  1MR8 A;  5F6T A;  1CB1 A;  2LNK A;  3VRR A;  2L4H A;  2LVJ A;  2JXL A;  4AQI A;  1K96 A;  1XK4 C;  2JPT A;  4PCW A;  3N7H A;  2M8U A;  1S6C A;  1J7O A;  1TUJ A;  1SBJ A;  1DGV A;  4TNC A;  3IF7 A;  1DTL A;  1KK7 Z;  1C07 A;  1DJI A;  3PN7 C;  4WQ3 A;  3DXL A;  1MF8 B;  2M29 A;  1WLM A;  1B8R A;  1IKU A;  1AHR A;  3CWG A;  1BLQ A;  2OS8 B;  2B1U A;  2OTG B;  3MSE B;  4OZD A;  1QS7 A;  3SG7 A;  3FWB A;  1A2X A;  1DVI A;  1QVI Z;  5JJG A;  2ZRS A;  3K1E A;  1RTP 1;  3NXA A;  4CLN A;  1B7T Y;  1SR6 B;  4C0J A;  3L4A A;  1MWN A;  1WDC C;  2SCP A;  3EK4 A;  1N0Y A;  1UHH A;  1ALW A;  2Q4U A;  2BCB A;  2PMY A;  5G08 A;  2LE9 B;  4MSP A;  2CBL A;  3VRO A;  3DYE A;  3SIB A;  2F3Z A;  4NQG A;  2NXQ A;  5KU1 A;  2BCX A;  1A75 A;  4QJ5 B;  1NUB A;  2H2K A;  2O5G A;  1GGZ A;  5I2L A;  2M7L A;  1LKJ A;  1N2D A;  4MZJ A;  1PUL A;  2BBM A;  2JXC A;  1X02 A;  1UHI A;  5HYD A;  3D73 A;  1CFC A;  3S0A A;  1S3P A;  1SNL A;  3R1P A;  2KI4 C;  2M49 B;  2Y5I A;  4N5X A;  4JQ0 D;  1DT7 B;  1M46 A;  2PVB A;  4A4B A;  1DEK A;  2GGZ A;  1OMV A;  1S6I A;  2MAZ A;  3DZT A;  3WHT B;  3NGV A;  1UHK A;  3SG5 A;  5HKZ A;  2CXJ A;  1QX2 A;  4JD9 A;  1EG3 A;  2KDH A;  2BL0 B;  1QIV A;  4MRY A;  5FI2 A;  3S0D A;  2JNX A;  4D1E A;  1CDM A;  2LM5 A;  2QEH A;  5FI7 A;  2KBI A;  2LMT A;  1FBV A;  1Z2C B;  2L50 A;  2M3W A;  1OOG A;  1IQ3 A;  4PAL A;  1EG4 A;  4AOM A;  1AVS A;  2M7N A;  2WCJ A;  2EGD A;  1GQM A;  2KQY A;  2Y1N A;  2MBX A;  1J7R A;  1QAS A;  1B1G A;  1NX1 A;  1QTX A;  2KAX A;  1B4C A;  1QJT A;  3DD4 A;  3BFH A;  1DGU A;  1WRL A;  4U8D A;  1NWD A;  1F55 A;  5HLV A;  5D7F A;  3IQQ A;  2NCP A;  3CDN A;  3HX4 A;  1SKT A;  2H8V A;  4HSZ A;  1L2O B;  1L7Z A;  1YRT B;  2BBN A;  3S0F A;  4INX A;  2I18 A;  3O6B A;  1KK7 Y;  1FW4 A;  5AER A;  2M1K B;  1LA0 A;  5DKN A;  1IJ6 A;  1IWQ A;  1KQM C;  2R2I A;  2WC8 A;  2M0R A;  3CZT X;  4YGB B;  1OSA A;  1M63 B;  1UUR A;  4GFT A;  1JFJ A;  3OB1 B;  3JVT B;  2P6B B;  2L4I A;  1QVI Y;  4CFQ A;  1NP8 A;  1AUI B;  2KLE A;  4OV2 A;  3TDU A;  2K7O A;  1OOI X;  2EC6 B;  1AK8 A;  4YI9 A;  2M97 A;  1LVC D;  2QAC A;  3CZ1 A;  2LV7 A;  1B8C A;  3BUN B;  3S0G A;  2CCM A;  1XO5 A;  2LLS A;  2CTN A;  2MJW B;  5TNC A;  3SJS A;  3IVT A;  5HLO A;  4YGA A;  2BNX A;  2WCF A;  1K9K A;  1S1E A;  1IGV A;  1SPY A;  3EVR A;  3KPX A;  4DIR A;  2LVV A;  2KFG A;  5IBW A;  1KK8 B;  1LS8 A;  4FQO A;  5CSN A;  2JUL A;  3ZWH A;  1KSO A;  2L0P A;  3B6X A;  2F8P A;  3I5F C;  1ZOT B;  4I5L B;  1MUX A;  3DVM A;  1P28 A;  3NHT A;  2BCA A;  2EHB A;  1F8H A;  4PE7 A;  1DF0 A;  1BOC A;  1KFU S;  1BT6 A;  4A4C A;  1HT9 A;  2ZRT A;  4GUK A;  1TNW A;  2KYC A;  2D8N A;  2PRU A;  2QEO A;  3L47 A;  5ER4 X;  1SCM C;  3BUO B;  3BYA A;  4DRW A;  3BOW A;  5I2Q A;  3L4L A;  1S5G Z;  1IJ5 A;  3B86 A;  2WOS A;  3TUY B;  2G2B A;  1C3Z A;  4YGC B;  1G4Y R;  1OW4 A;  3EK8 A;  1SCV A;  2G9B A;  5AFP A;  3OX6 A;  1UP5 A;  1TN4 A;  3F45 A;  3LCP C;  3CLN A;  3D0Y B;  1OMD A;  2KGB C;  3E3R A;  2WCE A;  1JSA A;  1XFV O;  1YVH A;  3DY9 A;  1WY9 A;  1DEL A;  3I5I C;  1KFU L;  1NCZ A;  2HET A;  3RM1 A;  1BF5 A;  1M45 A;  1T14 A;  2WCH A;  2JT0 A;  5AAN A;  3FIA A;  2K61 A;  3CGA A;  1YVL A;  1UHN A;  1OOJ A;  2PAS A;  1XFW O;  5CSI A;  1W7J B;  1KSM A;  2LAP A;  1CM4 A;  3NSL A;  3B7A A;  3S0E A;  3HCM A;  3PM8 A;  1K9U A;  3FWC A;  2NLN A;  1R6P A;  1Q80 A;  3FE8 A;  2NCO A;  1AP4 A;  3C1V A;  3O4Y A;  1NCX A;  5HKW A;  3PAL A;  2LMU A;  1K9P A;  3GK1 A;  3CYZ A;  2KNE A;  1JFK A;  3QME A;  1UHJ A;  4HRE E;  1BOD A;  2MLF C;  2P70 A;  1BMO A;  1CMG A;  3NSK A; 
#chains in the Genus database with same CATH homology
 1EL4 A;  1DJG A;  5CSF A;  4PE0 A;  1B9A A;  4FTG A;  5AEQ A;  3SG3 A;  1W7I B;  2O60 A;  1QXP A;  2LC5 A;  2LP3 A;  4PHJ A;  3JTD B;  1A75 B;  2JOJ A;  3AAK A;  1R2U A;  3M0W A;  2AMI A;  3LL8 B;  4MVF A;  4OVN F;  1WRZ A;  4UPG A;  1NIW A;  1YR5 A;  2HPS A;  3O2P A;  2MA2 A;  3BUW B;  1KQV A;  3GK4 X;  1ODB A;  1QLS A;  1A4P A;  2GV5 A;  3WXA A;  3KEV A;  1VRK A;  3CS1 A;  1YRU B;  4ZCV A;  1OZS A;  1F4O A;  1N65 A;  2FCE A;  2OS8 C;  3EKJ A;  3EVU A;  3IQO A;  2OTG C;  3OP0 A;  4MEW A;  1CLB A;  1NX2 A;  2L2E A;  1ZMZ A;  2IS9 A;  1K2H A;  3NSO A;  4I5K A;  4YGD B;  1DJX A;  2CT9 A;  4L9M A;  1TTX A;  1S5G Y;  1XFZ O;  1HQV A;  1DJH A;  1SR6 C;  2ISD A;  3AKB A;  1YUU A;  1QX7 A;  5DKR A;  1JBA A;  1LIN A;  2MLE C;  1QX5 B;  2LLU A;  4CFR A;  3OB2 B;  4P2Y B;  1SL7 A;  1A29 A;  2I94 A;  3TDZ A;  3SG4 A;  1REC A;  1Y1X A;  5KTY A;  1G8I A;  1NX0 A;  3TS5 B;  3NSI A;  1BR4 B;  1JF2 A;  4R1E A;  2HF5 A;  1DJY A;  1KWO B;  2KQ6 A;  2JTZ A;  3ICB A;  3VRN A;  2KI6 D;  1DMO A;  1ALV A;  1K8U A;  1EXR A;  1S36 A;  1Y1A A;  3DF0 A;  3BUM B;  4BY4 A;  3A8R A;  4MLW A;  5PAL A;  1JF0 A;  1QLK A;  2BKH B;  1G33 A;  1MXE A;  2BL0 C;  1LXF C;  2K2A A;  2KSP A;  1OE9 B;  5KSZ A;  1XFY O;  4GAO A;  1SMG A;  2WOR A;  4E68 A;  4P5O E;  1YX8 A;  3CR4 X;  4GGN A;  3CTN A;  1DJZ A;  1F71 A;  1IQ5 A;  1CLM A;  3DVK A;  1PAL A;  2KYF A;  2HQW A;  3I5H C;  1ZFS A;  1JUO A;  1ZAC A;  3LK1 A;  1WLZ A;  4QJ4 B;  1F4Q A;  2L98 A;  1J7Q A;  1WRK A;  1FI5 A;  4MBE A;  4HRG A;  4WRI A;  3I5G B;  2RGI A;  2PAL A;  4M2O A;  1ZUZ A;  3GK2 A;  1QIW A;  2MHH A;  1L2O C;  2KOT A;  2KFF A;  2Q91 A;  1RRO A;  3AKA A;  2KFH A;  3KO0 A;  4ORA B;  4M2P A;  4PE4 A;  4ORB B;  5JOL A;  2LUC A;  1DF0 B;  3PAT A;  3SG6 A;  1XFU O;  2TN4 A;  4WQ2 A;  5K89 A;  4XJK A;  1MQ1 A;  1A03 A;  2I7A A;  2FOT A;  3JVT C;  4XYN A;  3BOW B;  1FPW A;  1YUR A;  2H61 A;  1YUS A;  2EC6 C;  2F3Y A;  2AAO A;  1SRA A;  2FJU B;  3QRX A;  1U5I B;  3PN7 B;  4USL A;  5D69 A;  1TNQ A;  2K7B A;  2M1U A;  3RLZ A;  2WND A;  2OPO A;  3GOF A;  1F70 A;  1IG5 A;  1PVB A;  1KCY A;  3BUX B;  4QJ3 B;  2ZNE A;  1QAT A;  3A4U B;  1KK8 C;  3H4S E;  1GJY A;  3OX5 A;  1CFP A;  2H61 C;  4PHK A;  1YTZ C;  4F0Z B;  4MRX A;  4PE1 A;  2LCP A;  3DVE A;  1WDC B;  4IL1 A;  1XVJ A;  1GGW A;  4C0L A;  2E30 A;  1B8L A;  3LK0 A;  2KHN A;  2LUX A;  2MRD A;  5J3X A;  3VRQ A;  2JT3 A;  2JZI A;  3FS7 A;  4JPZ B;  3WHU B;  2KI6 C;  1OQP A;  1PK0 D;  1CDL A;  2JC2 A;  5CSJ A;  1NSH A;  2BEC A;  1K95 A;  2F33 A;  1NPQ A;  5B8I B;  2I2R E;  1FF1 A;  1CLL A;  4I5N B;  2JNF A;  2K0J A;  2LMV A;  1EJ3 A;  3VRP A;  2V53 A;  3TUY C;  2JRF A;  1FI6 A;  1S6J A;  3PFV A;  3VGO A;  1PVA A;  2KI4 B;  4NDD A;  2K2F A;  1H4B A;  2LP2 A;  1RJV A;  4YBH B;  1YX7 A;  5FYX A;  1CFD A;  1MHO A;  1Y0V H;  1Y1U A;  2WCB A;  4Q04 A;  2DOQ A;  2BE6 A;  1SL9 A;  4YI8 A;  1AJ4 A;  4ORC B;  1CTR A;  1CMF A;  1TIZ A;  1BJF A;  2VRG A;  4N1F A;  3AAJ A;  5I2O A;  4GBA A;  1EH2 A;  1PSR A;  3PLF B;  2F2O A;  2KGR A;  4PHM A;  1V1F A;  1H8B A;  1K94 A;  3SG2 A;  2AUC A;  2F2P A;  1DJW A;  2BKI B;  1D1O A;  3TDI A;  1SK6 D;  1J1D A;  2E6W A;  2KBM A;  3LLE A;  4MZL A;  4DCK A;  1RWY A;  4N1G A;  3EK7 A;  1QV0 A;  1PSB A;  1CDP A;  2JT8 A;  1J1E A;  2KAV A;  2LVK A;  4CPV A;  1BR1 B;  1AJ5 A;  1RFJ A;  1CKK A;  1YUT A;  4MZK A;  2LHL A;  1NYA A;  1KQM B;  1J55 A;  3OHM B;  2Y1M A;  2JWW A;  1V1G A;  3TZ1 A;  3JTD C;  4OR9 B;  1TCO B;  1KFX S;  2ZN8 A;  1Y6W A;  1SY9 A;  3EKH A;  3CR2 A;  2QPT A;  2ZND A;  2SAS A;  1E8A A;  3DF0 B;  4ZCU A;  1RK9 A;  3I5H B;  3KF9 A;  5ER5 A;  5CPV A;  2Y4Q A;  4YGE B;  2JU0 A;  1TRF A;  1C7V A;  4ICB A;  3BXK A;  4GNK B;  2L51 A;  3SIA A;  1IH0 A;  3I5F B;  1F54 A;  2ZKM X;  1JWD A;  1SYM A;  4CID A;  3CR5 X;  4BY5 A;  1KFX L;  4DUQ A;  1CM1 A;  1QV1 A;  4DS7 A;  5BPJ A;  4PHN A;  1CFF A;  2ZFD A;  1JC2 A;  2GGM A;  1SCM B;  1XYD A;  4OCI A;  1C7W A;  2JTT A;  5HKY A;  2K7D A;  3TS5 C;  3ZNI A;  1PRW A;  1B7T Z;  4GPL B;  3PSR A;  3BQ3 A;  1K90 D;  1KWO C;  3WNX B;  2K8M B;  4GGF A;  1NCY A;  5GQQ C;  2LLT A;  1BG1 A;  4JWQ A;  1M39 A;  1OZO A;  4M2Q A;  1CNP A;  1BU3 A;  4ETO A;  5DKQ A;  2M9G A;  1CDN A;  1M31 A;  1B47 A;  3K21 A;  4PDZ A;  3D10 A;  1SW8 A;  2PSR A;  4XJK B;  4NDC A;  3O78 A;  3I5I B;  4NDB A;  4OKH A;  1IRJ A;  2LAN A;  2A4J A;  2KAY A;  2LVI A;  1TOP A;  3DVJ A;  1J7P A;  1XFX O;  1TNP A;  4GGF C;  2L5X B;  2BE4 A;  2COL B;  4C0K A;  4YRU A;  3KHE A;  1S26 D;  1TNX A;  1UWO A;  2LHI A;  2ZN9 A;  1MXL C;  4HRH A;  2NZ0 A;  3I5G C;  1XK4 A;  5AXI A;  1LA3 A;  1XA5 A;  2FCD A;  5I8N A;  1TCF A;  1NX3 A;  1OMR A;  2HQ8 A;  4I5J A;  1UUS A;  4MN0 A;  1U5I A;  3EVV A;  2JQ6 A;  3D0Y A;  1SL8 A;  2K7C A;  1K93 D;  4AQJ A;  2CNP A;  1MR8 A;  5F6T A;  1CB1 A;  2LNK A;  3VRR A;  2L4H A;  2LVJ A;  2JXL A;  4AQI A;  1K96 A;  1XK4 C;  2JPT A;  4PCW A;  2M8U A;  1S6C A;  1J7O A;  1SBJ A;  1DGV A;  4TNC A;  3IF7 A;  1DTL A;  1KK7 Z;  1C07 A;  1DJI A;  3PN7 C;  4WQ3 A;  1MF8 B;  2M29 A;  1WLM A;  1B8R A;  1IKU A;  1AHR A;  3CWG A;  1BLQ A;  2OS8 B;  2B1U A;  2OTG B;  3MSE B;  1QS7 A;  3SG7 A;  3FWB A;  1A2X A;  1DVI A;  1QVI Z;  5JJG A;  2ZRS A;  3NXA A;  1RTP 1;  4CLN A;  1B7T Y;  1SR6 B;  4C0J A;  1MWN A;  1WDC C;  2SCP A;  3EK4 A;  1N0Y A;  1UHH A;  1ALW A;  2Q4U A;  2BCB A;  2PMY A;  5G08 A;  2LE9 B;  4MSP A;  2CBL A;  3VRO A;  3SIB A;  2F3Z A;  4NQG A;  2NXQ A;  5KU1 A;  2BCX A;  1A75 A;  4QJ5 B;  1NUB A;  2H2K A;  2O5G A;  1GGZ A;  5I2L A;  2M7L A;  1LKJ A;  1N2D A;  4MZJ A;  1PUL A;  2BBM A;  2JXC A;  1X02 A;  1UHI A;  5HYD A;  1CFC A;  1S3P A;  1SNL A;  2KI4 C;  2M49 B;  2Y5I A;  4N5X A;  4JQ0 D;  1DT7 B;  1M46 A;  2PVB A;  4A4B A;  2GGZ A;  1OMV A;  1S6I A;  2MAZ A;  3WHT B;  1UHK A;  3SG5 A;  5HKZ A;  2CXJ A;  1QX2 A;  4MRY A;  1EG3 A;  2KDH A;  2BL0 B;  1QIV A;  4D1E A;  2JNX A;  1CDM A;  2LM5 A;  2KBI A;  2LMT A;  1FBV A;  2L50 A;  2M3W A;  1IQ3 A;  4PAL A;  1EG4 A;  4AOM A;  1AVS A;  2M7N A;  2EGD A;  1GQM A;  2KQY A;  2Y1N A;  2MBX A;  1J7R A;  1QAS A;  1B1G A;  1NX1 A;  1QTX A;  2KAX A;  1B4C A;  1QJT A;  3DD4 A;  4U8D A;  1DGU A;  1WRL A;  1NWD A;  1F55 A;  5HLV A;  5D7F A;  3IQQ A;  2NCP A;  3HX4 A;  1SKT A;  4HSZ A;  1L2O B;  1L7Z A;  1YRT B;  2BBN A;  2I18 A;  3O6B A;  1KK7 Y;  1FW4 A;  5AER A;  2M1K B;  1LA0 A;  5DKN A;  1IJ6 A;  1IWQ A;  1KQM C;  2R2I A;  2WC8 A;  2M0R A;  3CZT X;  4YGB B;  1OSA A;  1M63 B;  1UUR A;  4GFT A;  1JFJ A;  3OB1 B;  3JVT B;  2P6B B;  2L4I A;  1QVI Y;  4CFQ A;  1NP8 A;  1AUI B;  4OV2 A;  3TDU A;  2K7O A;  2EC6 B;  1AK8 A;  4YI9 A;  2M97 A;  1LVC D;  2QAC A;  2LV7 A;  1B8C A;  3BUN B;  2CCM A;  1XO5 A;  2LLS A;  2CTN A;  2MJW B;  5TNC A;  3SJS A;  5HLO A;  4YGA A;  2WCF A;  1K9K A;  1S1E A;  1IGV A;  1SPY A;  3EVR A;  3KPX A;  4DIR A;  2LVV A;  2KFG A;  5IBW A;  1KK8 B;  4FQO A;  5CSN A;  2JUL A;  3ZWH A;  1KSO A;  2L0P A;  3I5F C;  2F8P A;  1ZOT B;  4I5L B;  1MUX A;  3DVM A;  2BCA A;  2EHB A;  1F8H A;  4PE7 A;  1DF0 A;  1BOC A;  1KFU S;  1BT6 A;  4A4C A;  1HT9 A;  2ZRT A;  4GUK A;  1TNW A;  2KYC A;  2D8N A;  2PRU A;  5ER4 X;  1SCM C;  3BUO B;  3BYA A;  4DRW A;  3BOW A;  5I2Q A;  1S5G Z;  1IJ5 A;  3TUY B;  2WOS A;  2G2B A;  4YGC B;  1G4Y R;  3EK8 A;  1SCV A;  2G9B A;  5AFP A;  3OX6 A;  1UP5 A;  1TN4 A;  3F45 A;  3LCP C;  3CLN A;  3D0Y B;  1OMD A;  2KGB C;  3E3R A;  2WCE A;  1JSA A;  1XFV O;  1YVH A;  1WY9 A;  3I5I C;  1KFU L;  1NCZ A;  2HET A;  3RM1 A;  1BF5 A;  1M45 A;  2JT0 A;  5AAN A;  3FIA A;  2K61 A;  3CGA A;  1YVL A;  1UHN A;  1OOJ A;  2PAS A;  1XFW O;  5CSI A;  1W7J B;  1KSM A;  2LAP A;  1CM4 A;  3NSL A;  3HCM A;  3PM8 A;  1K9U A;  3FWC A;  2NLN A;  1R6P A;  1Q80 A;  2NCO A;  1AP4 A;  3C1V A;  3O4Y A;  1NCX A;  5HKW A;  3PAL A;  2LMU A;  1K9P A;  3GK1 A;  2KNE A;  1JFK A;  1UHJ A;  4HRE E;  1BOD A;  2MLF C;  1BMO A;  1CMG A;  3NSK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...