1XFXO

Crystal structure of anthrax edema factor (ef) in complex with calmodulin in the presence of 10 millimolar exogenously added calcium chloride
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
146
structure length
146
Chain Sequence
QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDQMIREADIDGDGQVNYEEFVQMMTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Calcium-independent calmodulin binding and two-metal-ion catalytic mechanism of anthrax edema factor.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Lyase/metal binding protein
molecule keywords Calmodulin-sensitive adenylate cyclase
total genus 33
structure length 146
sequence length 146
chains with identical sequence P, Q, R, S, T
ec nomenclature
pdb deposition date 2004-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xfxO01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xfxO02
4GBAA 1HT9A 1YUTA 2LMUA 3C1VA 4BY4A 1CLBA 1XYDA 3AKBA 1ZFSA 4PHKA 1TCOB 4A4BA 2ZRSA 3FWBA 4CFRA 1CFDA 5PALA 4OV2A 3HX4A 3CR2A 3SIAA 1L2OC 3VRPA 1CKKA 1NP8A 4HRHA 4MZKA 4ORCB 1FI6A 2ISDA 4PE4A 1JUOA 1DJWA 1N65A 3DVKA 1Y0VH 3VROA 4C0KA 1F55A 2ZNEA 1AJ4A 5AFPA 1J7QA 1QLSA 2I94A 5CSFA 5HKWA 2NXQA 4MN0A 2K2AA 3LL8B 2LE9B 2LCPA 4GPLB 2BL0B 3D0YA 4PE1A 3TS5C 1GGZA 2GGMA 1W7IB 1BR1B 4C0LA 5JJGA 2LNKA 4E68A 1XFXO 3EVUA 1WY9A 2QPTA 2L51A 1GQMA 1BF5A 2K0JA 3NSLA 1CLMA 1G8IA 2H61A 1AUIB 4USLA 1K95A 1WLMA 1CLLA 1FW4A 1PULA 1S5GY 3I5IC 2OPOA 1BLQA 1CMGA 2SASA 4YI8A 4NDCA 1NX2A 2KSPA 4WQ3A 1F71A 4PHJA 1NX1A 4I5LB 1Q80A 1YR5A 2NCPA 4OVNF 5F6TA 1RTP1 1SRAA 3EKHA 4D1EA 1K8UA 2MLFC 1TNXA 2BBNA 1XFYO 5I2OA 1EG3A 1YRTB 1DVIA 3RLZA 4OKHA 1QS7A 2EHBA 2PALA 3WNXB 1X02A 1KFUS 2LAPA 3KF9A 4OCIA 2KI6C 4ZCVA 1Y6WA 4P5OE 1BJFA 1B8LA 1J7RA 1DJZA 2M7NA 4ZCUA 1IQ3A 1A4PA 4UPGA 5TNCA 2PASA 1KWOB 4AQJA 1NX3A 2M3WA 5AANA 1LVCD 1UHJA 2L5XB 1NCYA 4YGDB 1M31A 1QV1A 4PDZA 5HLOA 1TOPA 2OS8C 1LKJA 4GGFA 1KSOA 1SKTA 4FQOA 1AHRA 1WDCC 1FPWA 1VRKA 4DUQA 2WC8A 2O60A 2Y1NA 5HYDA 1V1GA 4GFTA 2Q91A 1NUBA 4ETOA 1KCYA 1L2OB 1YX7A 2LANA 5K89A 3DVMA 5AERA 4XJKA 1QIWA 4CFQA 1EL4A 2KHNA 2RGIA 3BUXB 5D69A 4YGEB 4ORBB 1PRWA 3MSEB 1QJTA 2FCDA 3A8RA 1SCMB 3BXKA 2O5GA 1SR6B 4GAOA 1XFVO 1XO5A 1OE9B 1S1EA 1DGVA 3O6BA 3ZNIA 1B7TZ 3KO0A 1OZSA 1IKUA 1EJ3A 4WRIA 1SW8A 1JFKA 2WOSA 3GOFA 2K8MB 3KEVA 3IQOA 3I5FB 5HLVA 1QV0A 2MLEC 1AP4A 1DF0B 2FJUB 5D7FA 4AOMA 1NCZA 4GGFC 5J3XA 1K96A 2VRGA 4A4CA 3CGAA 2HQ8A 1QVIY 3SJSA 4NDBA 2L4HA 4N1GA 1TRFA 2BE6A 1LXFC 2Y1MA 5HKZA 1IQ5A 4DRWA 3PLFB 1IJ5A 1Y1UA 2F33A 1H8BA 4MZJA 1K2HA 3JVTB 3BUMB 1CM4A 3LK0A 4L9MA 1KK8B 3PSRA 3SG4A 1SL7A 3TZ1A 1C7VA 1NYAA 3TDZA 3A4UB 1ZMZA 2PVBA 2ZNDA 3OX5A 1BG1A 2G2BA 2P6BB 3JTDC 2BCXA 1TNQA 2LLTA 1CFPA 1SY9A 1XFUO 1NSHA 2L2EA 2LVVA 4R1EA 2L98A 2JT3A 5DKRA 2KI4B 1C7WA 4PHMA 5GQQC 2LLSA 1JFJA 1QLKA 1NX0A 3AAKA 2KAYA 3FIAA 3NXAA 2KBMA 1A2XA 5B8IB 1G4YR 1M46A 1MXLC 2Y4QA 1F4QA 2CCMA 1YVHA 3OP0A 1TNWA 2LP2A 1CDMA 2LVIA 1TTXA 4TNCA 5AXIA 1IH0A 2M9GA 2WCBA 3PN7C 1OOJA 3CTNA 1AK8A 1JF2A 3EVVA 3LLEA 2B1UA 2JULA 2K7BA 5CSJA 3H4SE 2A4JA 1AVSA 4MLWA 2BKIB 1QX2A 1A75A 2AUCA 1LINA 1XK4A 2BE4A 3EK4A 4HSZA 4YGBB 2KOTA 1BR4B 2M1KB 1J7PA 3AKAA 2M29A 3CLNA 2JXCA 4DS7A 1N0YA 2F2OA 1DJXA 3O2PA 4PHNA 1QX5B 1YRUB 2CTNA 3KPXA 3NSOA 3BOWA 3VRNA 3TUYB 2KI4C 1U5IA 2Q4UA 4CLNA 1XA5A 3OHMB 5KU1A 4JQ0D 4CIDA 2E6WA 2K7DA 1WLZA 3I5HC 1UHIA 1DJYA 1CNPA 1TCFA 2LP3A 3EVRA 2V53A 1BOCA 1QXPA 1BU3A 2D8NA 3PATA 5I2LA 3WXAA 2LVKA 1AJ5A 1IWQA 1IGVA 1UHHA 5AEQA 2KNEA 5I2QA 2PMYA 2LM5A 1BODA 4JWQA 5BPJA 3D0YB 2M49B 5ER5A 2F3YA 4PCWA 3I5HB 3WHUB 2KAXA 2JTZA 2AAOA 2BL0C 1K9KA 2KFHA 3BQ3A 2JT8A 1KFUL 1DMOA 1TIZA 1KWOC 1MWNA 3DF0B 1KK7Z 2K7OA 2ZRTA 1KFXS 3DD4A 4XJKB 5DKNA 5FYXA 4M2OA 1JC2A 4NQGA 1FF1A 2BBMA 2BKHB 2JPTA 2JNFA 1A29A 2KYCA 1DJHA 2L50A 3JTDB 4QJ4B 4M2PA 4ORAB 1WRLA 2CT9A 4I5JA 4YI9A 5JOLA 3OB2B 3IF7A 2I7AA 3BUNB 1J1DA 4MZLA 1ALWA 3SG5A 4C0JA 5I8NA 3CZTX 2K61A 2FCEA 4PE0A 2JTTA 1QX7A 1B4CA 2L4IA 5HKYA 1XFZO 2ZN8A 1SBJA 3GK4X 1B8RA 3CR5X 4GGNA 1JF0A 1CMFA 2BCBA 4YGCB 1CFCA 2EGDA 1YURA 1SR6C 1PVBA 2LVJA 1YUSA 4BY5A 3EK8A 4MEWA 2EC6C 5CSNA 1DGUA 4QJ5B 1E8AA 2MAZA 4M2QA 1UURA 2KBIA 2KGBC 2K7CA 2KDHA 2LC5A 4HREE 1CDLA 1OSAA 2MA2A 3SG6A 2KYFA 3D10A 1WRZA 2ZKMX 1RROA 1OQPA 2HPSA 5KSZA 4NDDA 1H4BA 2MBXA 2TN4A 3DF0A 3O4YA 4U8DA 3VGOA 1KQMC 1SYMA 5DKQA 1B9AA 1NPQA 1KFXL 1NCXA 1RWYA 1J55A 1DJGA 1QASA 3LK1A 2KFFA 3M0WA 1GJYA 2F3ZA 2Y5IA 4DCKA 2BECA 4N5XA 3I5IB 5IBWA 2OS8B 1DTLA 2JRFA 3K21A 1B47A 2LHIA 1SPYA 1S6IA 2NCOA 1S5GZ 4I5NB 1XVJA 3SG7A 4YGAA 3OB1B 4WQ2A 2G9BA 1OMVA 1KQMB 1SL8A 3I5GB 1PALA 2F2PA 2OTGC 1XK4C 3HCMA 2WCFA 3EK7A 2SCPA 2LHLA 1A75B 1MQ1A 3EKJA 3PN7B 4AQIA 1CB1A 1JSAA 1A03A 2KAVA 2GGZA 1PVAA 1UUSA 2CXJA 1M63B 2H2KA 3O78A 1JWDA 2BCAA 4MVFA 1S3PA 3AAJA 1B1GA 2HF5A 2K2FA 1YTZC 2ZFDA 1S36A 1UP5A 5ER4X 2M0RA 2L0PA 3SG2A 1K90D 1IRJA 2M1UA 2WCEA 3IQQA 1CTRA 1R6PA 2KFGA 2JQ6A 3BUOB 3I5FC 1ALVA 1QVIZ 1W7JB 3GK1A 1UHNA 2KQYA 4PALA 1Y1XA 1OMDA 1EH2A 1MF8B 3LCPC 3FWCA 1U5IB 2WNDA 2AMIA 1EXRA 3BOWB 3PM8A 1J7OA 3BYAA 2JC2A 1NIWA 1S6CA 3DVEA 4GUKA 1D1OA 2I18A 2KI6D 3JVTC 2JXLA 1C07A 2LUCA 3VRQA 1F70A 3E3RA 4FTGA 1OZOA 4DIRA 1KSMA 1M39A 2CBLA 2OTGB 2JU0A 1TNPA 2NZ0A 3KHEA 1WRKA 4CPVA 3TUYC 1UHKA 2PRUA 1CFFA 3RM1A 1V1FA 2KGRA 2ZN9A 1HQVA 3DVJA 3CR4X 3WHTB 3SIBA 2KQ6A 2FOTA 3FS7A 1FI5A 3CWGA 2JOJA 2JT0A 2LMTA 1R2UA 3NSKA 3PFVA 3TDUA 1M45A 4I5KA 1MR8A 1DF0A 5KTYA 2NLNA 2LLUA 2LMVA 4ICBA 4QJ3B 2LUXA 1SK6D 1EG4A 3NSIA 1UWOA 3TDIA 4JPZB 1DJIA 1DT7B 1SCMC 4F0ZB 3BUWB 1B7TY 5CSIA 1SCVA 2F8PA 2CNPA 2I2RE 4GNKB 1PSRA 1KQVA 2HETA 1K9UA 4IL1A 2DOQA 2LV7A 2WORA 3TS5B 1QIVA 2JZIA 2M8UA 1S26D 1B8CA 1F4OA 1QTXA 1IG5A 1PK0D 2MHHA 1S6JA 1K93D 3QRXA 2JWWA 1CM1A 1RFJA 1SL9A 2COLB 2R2IA 4XYNA 1IJ6A 1ZOTB 1OMRA 4YRUA 1CDPA 1N2DA 1GGWA 2HQWA 4PE7A 1FBVA 2EC6B 1TN4A 2GV5A 4Q04A 3ZWHA 4MRYA 2E30A 4OR9B 1RK9A 3ICBA 4HRGA 1ODBA 4P2YB 1L7ZA 4N1FA 1G33A 1CDNA 2M7LA 1WDCB 1YX8A 1SMGA 1PSBA 1MXEA 1YVLA 1NWDA 5G08A 2QACA 4MRXA 1BT6A 1RECA 1Y1AA 1ZACA 4MBEA 1XFWO 1LA3A 1K9PA 5CPVA 3SG3A 1K94A 2MRDA 1SNLA 1BMOA 1J1EA 2JNXA 2H61C 1LA0A 3PALA 1MHOA 1YUUA 1KK7Y 3GK2A 2M97A 2MJWB 2IS9A 1F54A 3VRRA 1QATA 2PSRA 1RJVA 1MUXA 4MSPA 4YBHB 3I5GC 1ZUZA 3CS1A 1F8HA 1JBAA 1KK8C 3OX6A 3F45A
chains in the Genus database with same CATH superfamily
4GBAA 1HT9A 1YUTA 3QMEA 2LMUA 3C1VA 4BY4A 5FI6A 1CLBA 1XYDA 3AKBA 1ZFSA 4PHKA 1TCOB 4A4BA 2ZRSA 3FWBA 4CFRA 1CFDA 5PALA 4OV2A 3HX4A 3CR2A 3SIAA 1L2OC 3VRPA 1CKKA 1NP8A 4HRHA 4MZKA 4ORCB 1FI6A 1DELA 5I94A 2ISDA 4PE4A 1OOHA 1JUOA 1DJWA 1N65A 3DVKA 1Y0VH 3VROA 4C0KA 1F55A 2ZNEA 1AJ4A 5AFPA 1J7QA 3D74A 1QLSA 3B87A 2I94A 5CSFA 5HKWA 2NXQA 4MN0A 1OOGA 3S0GA 2K2AA 3LL8B 2LE9B 2LCPA 3D75A 4IJ7A 4GPLB 2BL0B 3D0YA 4PE1A 3TS5C 1GGZA 2GGMA 2WC6A 1W7IB 1BR1B 5D3OA 4C0LA 5JJGA 2LNKA 4E68A 1XFXO 3EVUA 1WY9A 2QPTA 2L51A 1GQMA 1BF5A 2K0JA 3CZ2A 3NSLA 1CLMA 2ERBA 1G8IA 5DICA 2H61A 1AUIB 4USLA 1K95A 1WLMA 1CLLA 1FW4A 1PULA 1S5GY 3I5IC 1T14A 2OPOA 1BLQA 1CMGA 2SASA 1OW4A 1SSEB 4YI8A 3L4AA 4NDCA 3CDNA 1NX2A 2KSPA 4WQ3A 2GTEA 1F71A 4PHJA 1NX1A 4I5LB 1Q80A 3V2LA 4KYNA 1YR5A 2NCPA 4OVNF 5F6TA 1RTP1 1SRAA 3EKHA 4D1EA 1K8UA 2MLFC 1TNXA 2BBNA 1XFYO 5I2OA 1EG3A 1YRTB 1DVIA 3RLZA 4OKHA 1TUJA 1QS7A 2EHBA 2PALA 3WNXB 1X02A 1C3ZA 1KFUS 2LAPA 3KF9A 4OCIA 2KI6C 4ZCVA 1Y6WA 4P5OE 3S0AA 1BJFA 1B8LA 1J7RA 1DJZA 2M7NA 3R1OA 4ZCUA 1IQ3A 2WCLA 1A4PA 4UPGA 3RZSA 2QDIA 2PASA 3R1PA 5TNCA 1KWOB 2PYQA 1NX3A 4AQJA 2M3WA 5AANA 1LVCD 1UHJA 2JPOA 3D73A 2L5XB 1NCYA 4YGDB 1M31A 1QV1A 4PDZA 5HLOA 1TOPA 2OS8C 1LKJA 3B6XA 4GGFA 1KSOA 1SKTA 4FQOA 1AHRA 1WDCC 1FPWA 1VRKA 4DUQA 2WC8A 2O60A 2Y1NA 5HYDA 1V1GA 4GFTA 2Q91A 1NUBA 4ETOA 1KCYA 1L2OB 1YX7A 2LANA 5K89A 3DVMA 3SS4A 5AERA 4XJKA 1QIWA 4CFQA 1EL4A 2KHNA 2RGIA 3BUXB 5D69A 2WC5A 4YGEB 4ORBB 1PRWA 3MSEB 3S0BA 1QJTA 2FCDA 3A8RA 1SCMB 3BXKA 3R72A 2O5GA 1SR6B 4GAOA 1XFVO 1XO5A 1OE9B 1S1EA 1DGVA 3O6BA 2L2CA 3ZNIA 1B7TZ 3KO0A 3S0EA 1OZSA 1IKUA 1EJ3A 4WRIA 3R1VA 1SW8A 1JFKA 2BNXA 2WOSA 3GOFA 2K8MB 3KEVA 3IQOA 3I5FB 5HLVA 1QV0A 2MLEC 3CZ0A 1AP4A 1DF0B 2FJUB 5D7FA 3SS3A 1DC1A 4AOMA 1NCZA 4GGFC 3BFHA 5J3XA 1K96A 2VRGA 3DYEA 3CGAA 4A4CA 2HQ8A 1QVIY 3SJSA 3B7AA 4NDBA 2L4HA 4N1GA 1TRFA 2BE6A 1LXFC 2Y1MA 5HKZA 1IQ5A 4DRWA 3PLFB 1IJ5A 1Y1UA 2F33A 1H8BA 4MZJA 1K2HA 3JVTB 3BUMB 1CM4A 3LK0A 4L9MA 3S0DA 1KK8B 3PSRA 3SG4A 1SL7A 3TZ1A 1C7VA 1NYAA 3TDZA 3A4UB 1ZMZA 2PVBA 2ZNDA 3OX5A 1BG1A 2G2BA 1DQEA 2P6BB 3JTDC 3VB1A 3BFBA 2BCXA 4JKTA 1TNQA 2LLTA 1CFPA 1SY9A 1XFUO 1NSHA 2L2EA 2LVVA 3IVTA 4R1EA 2L98A 2JT3A 5DKRA 2KI4B 1C7WA 4PHMA 5GQQC 2LLSA 1JFJA 1QLKA 3DXLA 1NX0A 3AAKA 2KAYA 3FIAA 3NXAA 2KBMA 1A2XA 3K1EA 5B8IB 1G4YR 1M46A 1MXLC 2Y4QA 1F4QA 2CCMA 1YVHA 3OP0A 1TNWA 2LP2A 1CDMA 2LVIA 1TTXA 4TNCA 5AXIA 1IH0A 2M9GA 2WCBA 3PN7C 1OOJA 3CTNA 1AK8A 1JF2A 3EVVA 3LLEA 2B1UA 2JULA 2K7BA 5CSJA 3H4SE 2A4JA 1AVSA 4MLWA 2BKIB 1QX2A 1A75A 2AUCA 1LINA 1XK4A 2BE4A 3EK4A 4HSZA 4YGBB 2KOTA 1BR4B 2M1KB 1J7PA 3AKAA 2M29A 3NHIA 3CLNA 2JXCA 4DS7A 1N0YA 2F2OA 1DJXA 2QEVA 2WCJA 3O2PA 1LS8A 3B88A 4PHNA 1QX5B 1YRUB 2CTNA 3KPXA 3NSOA 3BOWA 3VRNA 3TUYB 2KI4C 1U5IA 2Q4UA 4CLNA 1XA5A 3EG5B 3OHMB 5KU1A 4JQ0D 3BFAA 4CIDA 1TWOA 2E6WA 2K7DA 1WLZA 3I5HC 1UHIA 3FE9A 1DJYA 3DZTA 1CNPA 1TCFA 2LP3A 3EVRA 2V53A 5FI7A 3SS5A 1QWVA 3N7HA 1QXPA 1BOCA 1BU3A 2D8NA 3PATA 3PM2A 5I2LA 3WXAA 2LVKA 1AJ5A 1IWQA 1IGVA 1UHHA 5AEQA 2KNEA 2H8VA 2PMYA 2LM5A 5I2QA 4JWQA 5BPJA 3Q8IA 3D0YB 2M49B 5ER5A 2F3YA 2KLDA 4PCWA 3I5HB 3WHUB 3OGNA 2KAXA 2JTZA 2AAOA 2BL0C 1K9KA 2KFHA 3BQ3A 2JT8A 1KFUL 1DMOA 1TIZA 1KWOC 4INXA 1MWNA 3DF0B 1KK7Z 1Z2CB 2K7OA 1KFXS 2ZRTA 3D77A 3DD4A 4XJKB 4M2OA 5DKNA 5FI2A 5FYXA 1BODA 1JC2A 2P70A 4NQGA 2BBMA 2BKHB 1FF1A 2JPTA 2JNFA 2L5YA 1A29A 2KYCA 1DJHA 2L50A 3JTDB 4QJ4B 3FE6A 4M2PA 4ORAB 1WRLA 2CT9A 4I5JA 4OZDA 4YI9A 5JOLA 3OB2B 3IF7A 2I7AA 3BUNB 1J1DA 4MZLA 1ALWA 3SG5A 4C0JA 5I8NA 3CZTX 2K61A 2FCEA 4PE0A 1W9ZA 2JTTA 1QX7A 3D76A 1B4CA 2L4IA 5HKYA 1XFZO 2ZN8A 1SBJA 3GK4X 1B8RA 3CR5X 4GGNA 1JF0A 1CMFA 2BCBA 4YGCB 3UO9A 2YGUA 2EGDA 1YURA 1CFCA 1SR6C 1PVBA 2LVJA 1YUSA 4BY5A 3EK8A 4MEWA 2EC6C 5CSNA 1DGUA 4QJ5B 1E8AA 2MAZA 4M2QA 1UURA 2KBIA 2KGBC 2K7CA 2KDHA 2LC5A 4HREE 1CDLA 4JD9A 1OSAA 2MA2A 3SG6A 2KYFA 3D10A 1WRZA 2ZKMX 1RROA 1OQPA 1OOFA 2HPSA 5KSZA 4NDDA 1H4BA 2MBXA 2TN4A 3DF0A 3O4YA 4U8DA 3VGOA 1KQMC 1SYMA 5DKQA 1B9AA 1NPQA 1KFXL 1NCXA 1RWYA 1J55A 1DJGA 1QASA 3LK1A 2KFFA 3L4LA 3M0WA 1GJYA 3D78A 2F3ZA 2Y5IA 1P28A 4DCKA 2BECA 4N5XA 3I5IB 5IBWA 2OS8B 3DY9A 1DTLA 2JRFA 3K21A 1B47A 2LHIA 1SPYA 3OBVA 1S6IA 2NCOA 1S5GZ 4I5NB 1XVJA 3SG7A 4YGAA 1IIOA 3OB1B 3UNWA 4WQ2A 2G9BA 1OOIX 1KQMB 1OMVA 1SL8A 1PALA 3I5GB 2WCHA 2F2PA 3S0FA 2OTGC 1XK4C 3HCMA 2WCFA 3EK7A 2SCPA 3NGVA 2LHLA 1A75B 1MQ1A 3EKJA 3PN7B 4AQIA 5HL1A 1CB1A 1JSAA 1A03A 2KAVA 1PVAA 2GGZA 1UUSA 2CXJA 1M63B 2H2KA 3O78A 1JWDA 2BCAA 4MVFA 1S3PA 3AAJA 1B1GA 2QEBA 2HF5A 2KLEA 2K2FA 1YTZC 2ZFDA 1S36A 3PJIA 1UP5A 5ER4X 3BJHA 2M0RA 2L0PA 5EL2A 3SG2A 1K90D 1IRJA 2M1UA 2WCEA 3IQQA 1CTRA 1R6PA 2KFGA 2JQ6A 3BUOB 3I5FC 1ALVA 1QVIZ 1W7JB 3GK1A 1UHNA 2KQYA 4PALA 1XFRA 1Y1XA 1OMDA 1EH2A 2WCKA 1MF8B 2PQLA 3CZ1A 3FWCA 1U5IB 2WNDA 3LCPC 3O4XA 2AMIA 1EXRA 3BOWB 3PM8A 1J7OA 3BYAA 2JC2A 1NIWA 1S6CA 3DVEA 4GUKA 1D1OA 2I18A 2KI6D 3JVTC 2JXLA 1C07A 2LUCA 3VRQA 1F70A 3E3RA 4FTGA 1OZOA 4DIRA 1KSMA 1M39A 2CBLA 2OTGB 2JU0A 1TNPA 2NZ0A 3KHEA 4PT1A 1WRKA 2WCMA 4CPVA 4INWA 3TUYC 1UHKA 2PRUA 1CFFA 3RM1A 1V1FA 2KGRA 2ZN9A 1HQVA 3DVJA 3CR4X 3WHTB 3SIBA 1GM0A 2KQ6A 2FOTA 3FS7A 1FI5A 3CWGA 2K60A 2JOJA 2JT0A 2LMTA 1R2UA 3NSKA 3PFVA 3TDUA 1M45A 4I5KA 1MR8A 1DF0A 5KTYA 2NLNA 2LLUA 2LMVA 3B86A 4ICBA 4QJ3B 2QEOA 2LUXA 1SK6D 1EG4A 3NSIA 1UWOA 3TDIA 4JPZB 1DJIA 1DT7B 1SCMC 4F0ZB 3BUWB 1B7TY 5CSIA 1SCVA 3CABA 2F8PA 2CNPA 2I2RE 3OX6A 4GNKB 1PSRA 1KQVA 2HETA 2P71A 1K9UA 4IL1A 2DOQA 2LV7A 2WORA 3CYZA 3TS5B 3L47A 1QIVA 2JZIA 1C3YA 2M8UA 3NHTA 1S26D 1B8CA 1F4OA 1QTXA 1IG5A 1PK0D 2MHHA 1S6JA 2BAPA 1K93D 3QRXA 2JWWA 1CM1A 1RFJA 1SL9A 2COLB 2R2IA 4XYNA 1IJ6A 4F7FA 1ZOTB 1OMRA 4YRUA 1CDPA 1N2DA 1Z4HA 2HQWA 1GGWA 4PE7A 1FBVA 2EC6B 1TN4A 2GV5A 4Q04A 3ZWHA 4MRYA 2E30A 4OR9B 1RK9A 3ICBA 4HRGA 1ODBA 4P2YB 1L7ZA 4N1FA 1G33A 1TUZA 2M7LA 1WDCB 1YX8A 1SMGA 1CDNA 1PSBA 1MXEA 1YVLA 1NWDA 5G08A 2QACA 4MRXA 1BT6A 1RECA 1Y1AA 2KPHA 1ZACA 4MBEA 1XFWO 1DEKA 1K9PA 1LA3A 5CPVA 3SG3A 1K94A 2MRDA 1SNLA 3FE8A 1BMOA 1J1EA 2JNXA 1LA0A 2H61C 3PALA 4FQTA 1MHOA 1YUUA 1KK7Y 3GK2A 2M97A 2MJWB 2IS9A 1F54A 3VRRA 1QATA 2PSRA 1RJVA 2QEHA 1MUXA 4MSPA 4YBHB 3I5GC 1ZUZA 3CS1A 1F8HA 1JBAA 1KK8C 1ORGA 2FJYA 3F45A
chains in the Genus database with same CATH topology
4GBAA 1HT9A 1YUTA 2LMUA 3C1VA 4BY4A 1CLBA 1XYDA 3AKBA 1ZFSA 4PHKA 1TCOB 4A4BA 2ZRSA 3FWBA 4CFRA 1CFDA 5PALA 4OV2A 3HX4A 3CR2A 3SIAA 1L2OC 3VRPA 1CKKA 1NP8A 4HRHA 4MZKA 4ORCB 1FI6A 2ISDA 4PE4A 1JUOA 1DJWA 1N65A 3DVKA 1Y0VH 3VROA 4C0KA 1F55A 2ZNEA 1AJ4A 5AFPA 1J7QA 1QLSA 2I94A 5CSFA 5HKWA 2NXQA 4MN0A 2K2AA 3LL8B 2LE9B 2LCPA 4GPLB 2BL0B 3D0YA 4PE1A 3TS5C 1GGZA 2GGMA 1W7IB 1BR1B 4C0LA 5JJGA 2LNKA 4E68A 1XFXO 3EVUA 1WY9A 2QPTA 2L51A 1GQMA 1BF5A 2K0JA 3NSLA 1CLMA 1G8IA 2H61A 1AUIB 4USLA 1K95A 1WLMA 1CLLA 1FW4A 1PULA 1S5GY 3I5IC 2OPOA 1BLQA 1CMGA 2SASA 4YI8A 4NDCA 1NX2A 2KSPA 4WQ3A 1F71A 4PHJA 1NX1A 4I5LB 1Q80A 1YR5A 2NCPA 4OVNF 5F6TA 1RTP1 1SRAA 3EKHA 4D1EA 1K8UA 2MLFC 1TNXA 2BBNA 1XFYO 5I2OA 1EG3A 1YRTB 1DVIA 3RLZA 4OKHA 1QS7A 2EHBA 2PALA 3WNXB 1X02A 1KFUS 2LAPA 3KF9A 4OCIA 2KI6C 4ZCVA 1Y6WA 4P5OE 1BJFA 1B8LA 1J7RA 1DJZA 2M7NA 4ZCUA 1IQ3A 1A4PA 4UPGA 5TNCA 2PASA 1KWOB 4AQJA 1NX3A 2M3WA 5AANA 1LVCD 1UHJA 2L5XB 1NCYA 4YGDB 1M31A 1QV1A 4PDZA 5HLOA 1TOPA 2OS8C 1LKJA 4GGFA 1KSOA 1SKTA 4FQOA 1AHRA 1WDCC 1FPWA 1VRKA 4DUQA 2WC8A 2O60A 2Y1NA 5HYDA 1V1GA 4GFTA 2Q91A 1NUBA 4ETOA 1KCYA 1L2OB 1YX7A 2LANA 5K89A 3DVMA 5AERA 4XJKA 1QIWA 4CFQA 1EL4A 2KHNA 2RGIA 3BUXB 5D69A 4YGEB 4ORBB 1PRWA 3MSEB 1QJTA 2FCDA 3A8RA 1SCMB 3BXKA 2O5GA 1SR6B 4GAOA 1XFVO 1XO5A 1OE9B 1S1EA 1DGVA 3O6BA 3ZNIA 1B7TZ 3KO0A 1OZSA 1IKUA 1EJ3A 4WRIA 1SW8A 1JFKA 2WOSA 3GOFA 2K8MB 3KEVA 3IQOA 3I5FB 5HLVA 1QV0A 2MLEC 1AP4A 1DF0B 2FJUB 5D7FA 4AOMA 1NCZA 4GGFC 5J3XA 1K96A 2VRGA 4A4CA 3CGAA 2HQ8A 1QVIY 3SJSA 4NDBA 2L4HA 4N1GA 1TRFA 2BE6A 1LXFC 2Y1MA 5HKZA 1IQ5A 4DRWA 3PLFB 1IJ5A 1Y1UA 2F33A 1H8BA 4MZJA 1K2HA 3JVTB 3BUMB 1CM4A 3LK0A 4L9MA 1KK8B 3PSRA 3SG4A 1SL7A 3TZ1A 1C7VA 1NYAA 3TDZA 3A4UB 1ZMZA 2PVBA 2ZNDA 3OX5A 1BG1A 2G2BA 2P6BB 3JTDC 2BCXA 1TNQA 2LLTA 1CFPA 1SY9A 1XFUO 1NSHA 2L2EA 2LVVA 4R1EA 2L98A 2JT3A 5DKRA 2KI4B 1C7WA 4PHMA 5GQQC 2LLSA 1JFJA 1QLKA 1NX0A 3AAKA 2KAYA 3FIAA 3NXAA 2KBMA 1A2XA 5B8IB 1G4YR 1M46A 1MXLC 2Y4QA 1F4QA 2CCMA 1YVHA 3OP0A 1TNWA 2LP2A 1CDMA 2LVIA 1TTXA 4TNCA 5AXIA 1IH0A 2M9GA 2WCBA 3PN7C 1OOJA 3CTNA 1AK8A 1JF2A 3EVVA 3LLEA 2B1UA 2JULA 2K7BA 5CSJA 3H4SE 2A4JA 1AVSA 4MLWA 2BKIB 1QX2A 1A75A 2AUCA 1LINA 1XK4A 2BE4A 3EK4A 4HSZA 4YGBB 2KOTA 1BR4B 2M1KB 1J7PA 3AKAA 2M29A 3CLNA 2JXCA 4DS7A 1N0YA 2F2OA 1DJXA 3O2PA 4PHNA 1QX5B 1YRUB 2CTNA 3KPXA 3NSOA 3BOWA 3VRNA 3TUYB 2KI4C 1U5IA 2Q4UA 4CLNA 1XA5A 3OHMB 5KU1A 4JQ0D 4CIDA 2E6WA 2K7DA 1WLZA 3I5HC 1UHIA 1DJYA 1CNPA 1TCFA 2LP3A 3EVRA 2V53A 1BOCA 1QXPA 1BU3A 2D8NA 3PATA 5I2LA 3WXAA 2LVKA 1AJ5A 1IWQA 1IGVA 1UHHA 5AEQA 2KNEA 5I2QA 2PMYA 2LM5A 1BODA 4JWQA 5BPJA 3D0YB 2M49B 5ER5A 2F3YA 4PCWA 3I5HB 3WHUB 2KAXA 2JTZA 2AAOA 2BL0C 1K9KA 2KFHA 3BQ3A 2JT8A 1KFUL 1DMOA 1TIZA 1KWOC 1MWNA 3DF0B 1KK7Z 2K7OA 2ZRTA 1KFXS 3DD4A 4XJKB 5DKNA 5FYXA 4M2OA 1JC2A 4NQGA 1FF1A 2BBMA 2BKHB 2JPTA 2JNFA 1A29A 2KYCA 1DJHA 2L50A 3JTDB 4QJ4B 4M2PA 4ORAB 1WRLA 2CT9A 4I5JA 4YI9A 5JOLA 3OB2B 3IF7A 2I7AA 3BUNB 1J1DA 4MZLA 1ALWA 3SG5A 4C0JA 5I8NA 3CZTX 2K61A 2FCEA 4PE0A 2JTTA 1QX7A 1B4CA 2L4IA 5HKYA 1XFZO 2ZN8A 1SBJA 3GK4X 1B8RA 3CR5X 4GGNA 1JF0A 1CMFA 2BCBA 4YGCB 1CFCA 2EGDA 1YURA 1SR6C 1PVBA 2LVJA 1YUSA 4BY5A 3EK8A 4MEWA 2EC6C 5CSNA 1DGUA 4QJ5B 1E8AA 2MAZA 4M2QA 1UURA 2KBIA 2KGBC 2K7CA 2KDHA 2LC5A 4HREE 1CDLA 1OSAA 2MA2A 3SG6A 2KYFA 3D10A 1WRZA 2ZKMX 1RROA 1OQPA 2HPSA 5KSZA 4NDDA 1H4BA 2MBXA 2TN4A 3DF0A 3O4YA 4U8DA 3VGOA 1KQMC 1SYMA 5DKQA 1B9AA 1NPQA 1KFXL 1NCXA 1RWYA 1J55A 1DJGA 1QASA 3LK1A 2KFFA 3M0WA 1GJYA 2F3ZA 2Y5IA 4DCKA 2BECA 4N5XA 3I5IB 5IBWA 2OS8B 1DTLA 2JRFA 3K21A 1B47A 2LHIA 1SPYA 1S6IA 2NCOA 1S5GZ 4I5NB 1XVJA 3SG7A 4YGAA 3OB1B 4WQ2A 2G9BA 1OMVA 1KQMB 1SL8A 3I5GB 1PALA 2F2PA 2OTGC 1XK4C 3HCMA 2WCFA 3EK7A 2SCPA 2LHLA 1A75B 1MQ1A 3EKJA 3PN7B 4AQIA 1CB1A 1JSAA 1A03A 2KAVA 2GGZA 1PVAA 1UUSA 2CXJA 1M63B 2H2KA 3O78A 1JWDA 2BCAA 4MVFA 1S3PA 3AAJA 1B1GA 2HF5A 2K2FA 1YTZC 2ZFDA 1S36A 1UP5A 5ER4X 2M0RA 2L0PA 3SG2A 1K90D 1IRJA 2M1UA 2WCEA 3IQQA 1CTRA 1R6PA 2KFGA 2JQ6A 3BUOB 3I5FC 1ALVA 1QVIZ 1W7JB 3GK1A 1UHNA 2KQYA 4PALA 1Y1XA 1OMDA 1EH2A 1MF8B 3LCPC 3FWCA 1U5IB 2WNDA 2AMIA 1EXRA 3BOWB 3PM8A 1J7OA 3BYAA 2JC2A 1NIWA 1S6CA 3DVEA 4GUKA 1D1OA 2I18A 2KI6D 3JVTC 2JXLA 1C07A 2LUCA 3VRQA 1F70A 3E3RA 4FTGA 1OZOA 4DIRA 1KSMA 1M39A 2CBLA 2OTGB 2JU0A 1TNPA 2NZ0A 3KHEA 1WRKA 4CPVA 3TUYC 1UHKA 2PRUA 1CFFA 3RM1A 1V1FA 2KGRA 2ZN9A 1HQVA 3DVJA 3CR4X 3WHTB 3SIBA 2KQ6A 2FOTA 3FS7A 1FI5A 3CWGA 2JOJA 2JT0A 2LMTA 1R2UA 3NSKA 3PFVA 3TDUA 1M45A 4I5KA 1MR8A 1DF0A 5KTYA 2NLNA 2LLUA 2LMVA 4ICBA 4QJ3B 2LUXA 1SK6D 1EG4A 3NSIA 1UWOA 3TDIA 4JPZB 1DJIA 1DT7B 1SCMC 4F0ZB 3BUWB 1B7TY 5CSIA 1SCVA 2F8PA 2CNPA 2I2RE 4GNKB 1PSRA 1KQVA 2HETA 1K9UA 4IL1A 2DOQA 2LV7A 2WORA 3TS5B 1QIVA 2JZIA 2M8UA 1S26D 1B8CA 1F4OA 1QTXA 1IG5A 1PK0D 2MHHA 1S6JA 1K93D 3QRXA 2JWWA 1CM1A 1RFJA 1SL9A 2COLB 2R2IA 4XYNA 1IJ6A 1ZOTB 1OMRA 4YRUA 1CDPA 1N2DA 1GGWA 2HQWA 4PE7A 1FBVA 2EC6B 1TN4A 2GV5A 4Q04A 3ZWHA 4MRYA 2E30A 4OR9B 1RK9A 3ICBA 4HRGA 1ODBA 4P2YB 1L7ZA 4N1FA 1G33A 1CDNA 2M7LA 1WDCB 1YX8A 1SMGA 1PSBA 1MXEA 1YVLA 1NWDA 5G08A 2QACA 4MRXA 1BT6A 1RECA 1Y1AA 1ZACA 4MBEA 1XFWO 1LA3A 1K9PA 5CPVA 3SG3A 1K94A 2MRDA 1SNLA 1BMOA 1J1EA 2JNXA 2H61C 1LA0A 3PALA 1MHOA 1YUUA 1KK7Y 3GK2A 2M97A 2MJWB 2IS9A 1F54A 3VRRA 1QATA 2PSRA 1RJVA 1MUXA 4MSPA 4YBHB 3I5GC 1ZUZA 3CS1A 1F8HA 1JBAA 1KK8C 3OX6A 3F45A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GBA A;  1HT9 A;  1YUT A;  2LMU A;  3C1V A;  4BY4 A;  1CLB A;  1XYD A;  3AKB A;  1ZFS A;  4PHK A;  1TCO B;  4A4B A;  2ZRS A;  3FWB A;  4CFR A;  1CFD A;  5PAL A;  4OV2 A;  3HX4 A;  3CR2 A;  3SIA A;  1L2O C;  3VRP A;  1CKK A;  1NP8 A;  4HRH A;  4MZK A;  4ORC B;  1FI6 A;  2ISD A;  4PE4 A;  1JUO A;  1DJW A;  1N65 A;  3DVK A;  1Y0V H;  3VRO A;  4C0K A;  1F55 A;  2ZNE A;  1AJ4 A;  5AFP A;  1J7Q A;  1QLS A;  2I94 A;  5CSF A;  5HKW A;  2NXQ A;  4MN0 A;  2K2A A;  3LL8 B;  2LE9 B;  2LCP A;  4GPL B;  2BL0 B;  3D0Y A;  4PE1 A;  3TS5 C;  1GGZ A;  2GGM A;  1W7I B;  1BR1 B;  4C0L A;  5JJG A;  2LNK A;  4E68 A;  1XFX O;  3EVU A;  1WY9 A;  2QPT A;  2L51 A;  1GQM A;  1BF5 A;  2K0J A;  3NSL A;  1CLM A;  1G8I A;  2H61 A;  1AUI B;  4USL A;  1K95 A;  1WLM A;  1CLL A;  1FW4 A;  1PUL A;  1S5G Y;  3I5I C;  2OPO A;  1BLQ A;  1CMG A;  2SAS A;  4YI8 A;  4NDC A;  1NX2 A;  2KSP A;  4WQ3 A;  1F71 A;  4PHJ A;  1NX1 A;  4I5L B;  1Q80 A;  1YR5 A;  2NCP A;  4OVN F;  5F6T A;  1RTP 1;  1SRA A;  3EKH A;  4D1E A;  1K8U A;  2MLF C;  1TNX A;  2BBN A;  1XFY O;  5I2O A;  1EG3 A;  1YRT B;  1DVI A;  3RLZ A;  4OKH A;  1QS7 A;  2EHB A;  2PAL A;  3WNX B;  1X02 A;  1KFU S;  2LAP A;  3KF9 A;  4OCI A;  2KI6 C;  4ZCV A;  1Y6W A;  4P5O E;  1BJF A;  1B8L A;  1J7R A;  1DJZ A;  2M7N A;  4ZCU A;  1IQ3 A;  1A4P A;  4UPG A;  5TNC A;  2PAS A;  1KWO B;  4AQJ A;  1NX3 A;  2M3W A;  5AAN A;  1LVC D;  1UHJ A;  2L5X B;  1NCY A;  4YGD B;  1M31 A;  1QV1 A;  4PDZ A;  5HLO A;  1TOP A;  2OS8 C;  1LKJ A;  4GGF A;  1KSO A;  1SKT A;  4FQO A;  1AHR A;  1WDC C;  1FPW A;  1VRK A;  4DUQ A;  2WC8 A;  2O60 A;  2Y1N A;  5HYD A;  1V1G A;  4GFT A;  2Q91 A;  1NUB A;  4ETO A;  1KCY A;  1L2O B;  1YX7 A;  2LAN A;  5K89 A;  3DVM A;  5AER A;  4XJK A;  1QIW A;  4CFQ A;  1EL4 A;  2KHN A;  2RGI A;  3BUX B;  5D69 A;  4YGE B;  4ORB B;  1PRW A;  3MSE B;  1QJT A;  2FCD A;  3A8R A;  1SCM B;  3BXK A;  2O5G A;  1SR6 B;  4GAO A;  1XFV O;  1XO5 A;  1OE9 B;  1S1E A;  1DGV A;  3O6B A;  3ZNI A;  1B7T Z;  3KO0 A;  1OZS A;  1IKU A;  1EJ3 A;  4WRI A;  1SW8 A;  1JFK A;  2WOS A;  3GOF A;  2K8M B;  3KEV A;  3IQO A;  3I5F B;  5HLV A;  1QV0 A;  2MLE C;  1AP4 A;  1DF0 B;  2FJU B;  5D7F A;  4AOM A;  1NCZ A;  4GGF C;  5J3X A;  1K96 A;  2VRG A;  4A4C A;  3CGA A;  2HQ8 A;  1QVI Y;  3SJS A;  4NDB A;  2L4H A;  4N1G A;  1TRF A;  2BE6 A;  1LXF C;  2Y1M A;  5HKZ A;  1IQ5 A;  4DRW A;  3PLF B;  1IJ5 A;  1Y1U A;  2F33 A;  1H8B A;  4MZJ A;  1K2H A;  3JVT B;  3BUM B;  1CM4 A;  3LK0 A;  4L9M A;  1KK8 B;  3PSR A;  3SG4 A;  1SL7 A;  3TZ1 A;  1C7V A;  1NYA A;  3TDZ A;  3A4U B;  1ZMZ A;  2PVB A;  2ZND A;  3OX5 A;  1BG1 A;  2G2B A;  2P6B B;  3JTD C;  2BCX A;  1TNQ A;  2LLT A;  1CFP A;  1SY9 A;  1XFU O;  1NSH A;  2L2E A;  2LVV A;  4R1E A;  2L98 A;  2JT3 A;  5DKR A;  2KI4 B;  1C7W A;  4PHM A;  5GQQ C;  2LLS A;  1JFJ A;  1QLK A;  1NX0 A;  3AAK A;  2KAY A;  3FIA A;  3NXA A;  2KBM A;  1A2X A;  5B8I B;  1G4Y R;  1M46 A;  1MXL C;  2Y4Q A;  1F4Q A;  2CCM A;  1YVH A;  3OP0 A;  1TNW A;  2LP2 A;  1CDM A;  2LVI A;  1TTX A;  4TNC A;  5AXI A;  1IH0 A;  2M9G A;  2WCB A;  3PN7 C;  1OOJ A;  3CTN A;  1AK8 A;  1JF2 A;  3EVV A;  3LLE A;  2B1U A;  2JUL A;  2K7B A;  5CSJ A;  3H4S E;  2A4J A;  1AVS A;  4MLW A;  2BKI B;  1QX2 A;  1A75 A;  2AUC A;  1LIN A;  1XK4 A;  2BE4 A;  3EK4 A;  4HSZ A;  4YGB B;  2KOT A;  1BR4 B;  2M1K B;  1J7P A;  3AKA A;  2M29 A;  3CLN A;  2JXC A;  4DS7 A;  1N0Y A;  2F2O A;  1DJX A;  3O2P A;  4PHN A;  1QX5 B;  1YRU B;  2CTN A;  3KPX A;  3NSO A;  3BOW A;  3VRN A;  3TUY B;  2KI4 C;  1U5I A;  2Q4U A;  4CLN A;  1XA5 A;  3OHM B;  5KU1 A;  4JQ0 D;  4CID A;  2E6W A;  2K7D A;  1WLZ A;  3I5H C;  1UHI A;  1DJY A;  1CNP A;  1TCF A;  2LP3 A;  3EVR A;  2V53 A;  1BOC A;  1QXP A;  1BU3 A;  2D8N A;  3PAT A;  5I2L A;  3WXA A;  2LVK A;  1AJ5 A;  1IWQ A;  1IGV A;  1UHH A;  5AEQ A;  2KNE A;  5I2Q A;  2PMY A;  2LM5 A;  1BOD A;  4JWQ A;  5BPJ A;  3D0Y B;  2M49 B;  5ER5 A;  2F3Y A;  4PCW A;  3I5H B;  3WHU B;  2KAX A;  2JTZ A;  2AAO A;  2BL0 C;  1K9K A;  2KFH A;  3BQ3 A;  2JT8 A;  1KFU L;  1DMO A;  1TIZ A;  1KWO C;  1MWN A;  3DF0 B;  1KK7 Z;  2K7O A;  2ZRT A;  1KFX S;  3DD4 A;  4XJK B;  5DKN A;  5FYX A;  4M2O A;  1JC2 A;  4NQG A;  1FF1 A;  2BBM A;  2BKH B;  2JPT A;  2JNF A;  1A29 A;  2KYC A;  1DJH A;  2L50 A;  3JTD B;  4QJ4 B;  4M2P A;  4ORA B;  1WRL A;  2CT9 A;  4I5J A;  4YI9 A;  5JOL A;  3OB2 B;  3IF7 A;  2I7A A;  3BUN B;  1J1D A;  4MZL A;  1ALW A;  3SG5 A;  4C0J A;  5I8N A;  3CZT X;  2K61 A;  2FCE A;  4PE0 A;  2JTT A;  1QX7 A;  1B4C A;  2L4I A;  5HKY A;  1XFZ O;  2ZN8 A;  1SBJ A;  3GK4 X;  1B8R A;  3CR5 X;  4GGN A;  1JF0 A;  1CMF A;  2BCB A;  4YGC B;  1CFC A;  2EGD A;  1YUR A;  1SR6 C;  1PVB A;  2LVJ A;  1YUS A;  4BY5 A;  3EK8 A;  4MEW A;  2EC6 C;  5CSN A;  1DGU A;  4QJ5 B;  1E8A A;  2MAZ A;  4M2Q A;  1UUR A;  2KBI A;  2KGB C;  2K7C A;  2KDH A;  2LC5 A;  4HRE E;  1CDL A;  1OSA A;  2MA2 A;  3SG6 A;  2KYF A;  3D10 A;  1WRZ A;  2ZKM X;  1RRO A;  1OQP A;  2HPS A;  5KSZ A;  4NDD A;  1H4B A;  2MBX A;  2TN4 A;  3DF0 A;  3O4Y A;  4U8D A;  3VGO A;  1KQM C;  1SYM A;  5DKQ A;  1B9A A;  1NPQ A;  1KFX L;  1NCX A;  1RWY A;  1J55 A;  1DJG A;  1QAS A;  3LK1 A;  2KFF A;  3M0W A;  1GJY A;  2F3Z A;  2Y5I A;  4DCK A;  2BEC A;  4N5X A;  3I5I B;  5IBW A;  2OS8 B;  1DTL A;  2JRF A;  3K21 A;  1B47 A;  2LHI A;  1SPY A;  1S6I A;  2NCO A;  1S5G Z;  4I5N B;  1XVJ A;  3SG7 A;  4YGA A;  3OB1 B;  4WQ2 A;  2G9B A;  1OMV A;  1KQM B;  1SL8 A;  3I5G B;  1PAL A;  2F2P A;  2OTG C;  1XK4 C;  3HCM A;  2WCF A;  3EK7 A;  2SCP A;  2LHL A;  1A75 B;  1MQ1 A;  3EKJ A;  3PN7 B;  4AQI A;  1CB1 A;  1JSA A;  1A03 A;  2KAV A;  2GGZ A;  1PVA A;  1UUS A;  2CXJ A;  1M63 B;  2H2K A;  3O78 A;  1JWD A;  2BCA A;  4MVF A;  1S3P A;  3AAJ A;  1B1G A;  2HF5 A;  2K2F A;  1YTZ C;  2ZFD A;  1S36 A;  1UP5 A;  5ER4 X;  2M0R A;  2L0P A;  3SG2 A;  1K90 D;  1IRJ A;  2M1U A;  2WCE A;  3IQQ A;  1CTR A;  1R6P A;  2KFG A;  2JQ6 A;  3BUO B;  3I5F C;  1ALV A;  1QVI Z;  1W7J B;  3GK1 A;  1UHN A;  2KQY A;  4PAL A;  1Y1X A;  1OMD A;  1EH2 A;  1MF8 B;  3LCP C;  3FWC A;  1U5I B;  2WND A;  2AMI A;  1EXR A;  3BOW B;  3PM8 A;  1J7O A;  3BYA A;  2JC2 A;  1NIW A;  1S6C A;  3DVE A;  4GUK A;  1D1O A;  2I18 A;  2KI6 D;  3JVT C;  2JXL A;  1C07 A;  2LUC A;  3VRQ A;  1F70 A;  3E3R A;  4FTG A;  1OZO A;  4DIR A;  1KSM A;  1M39 A;  2CBL A;  2OTG B;  2JU0 A;  1TNP A;  2NZ0 A;  3KHE A;  1WRK A;  4CPV A;  3TUY C;  1UHK A;  2PRU A;  1CFF A;  3RM1 A;  1V1F A;  2KGR A;  2ZN9 A;  1HQV A;  3DVJ A;  3CR4 X;  3WHT B;  3SIB A;  2KQ6 A;  2FOT A;  3FS7 A;  1FI5 A;  3CWG A;  2JOJ A;  2JT0 A;  2LMT A;  1R2U A;  3NSK A;  3PFV A;  3TDU A;  1M45 A;  4I5K A;  1MR8 A;  1DF0 A;  5KTY A;  2NLN A;  2LLU A;  2LMV A;  4ICB A;  4QJ3 B;  2LUX A;  1SK6 D;  1EG4 A;  3NSI A;  1UWO A;  3TDI A;  4JPZ B;  1DJI A;  1DT7 B;  1SCM C;  4F0Z B;  3BUW B;  1B7T Y;  5CSI A;  1SCV A;  2F8P A;  2CNP A;  2I2R E;  4GNK B;  1PSR A;  1KQV A;  2HET A;  1K9U A;  4IL1 A;  2DOQ A;  2LV7 A;  2WOR A;  3TS5 B;  1QIV A;  2JZI A;  2M8U A;  1S26 D;  1B8C A;  1F4O A;  1QTX A;  1IG5 A;  1PK0 D;  2MHH A;  1S6J A;  1K93 D;  3QRX A;  2JWW A;  1CM1 A;  1RFJ A;  1SL9 A;  2COL B;  2R2I A;  4XYN A;  1IJ6 A;  1ZOT B;  1OMR A;  4YRU A;  1CDP A;  1N2D A;  1GGW A;  2HQW A;  4PE7 A;  1FBV A;  2EC6 B;  1TN4 A;  2GV5 A;  4Q04 A;  3ZWH A;  4MRY A;  2E30 A;  4OR9 B;  1RK9 A;  3ICB A;  4HRG A;  1ODB A;  4P2Y B;  1L7Z A;  4N1F A;  1G33 A;  1CDN A;  2M7L A;  1WDC B;  1YX8 A;  1SMG A;  1PSB A;  1MXE A;  1YVL A;  1NWD A;  5G08 A;  2QAC A;  4MRX A;  1BT6 A;  1REC A;  1Y1A A;  1ZAC A;  4MBE A;  1XFW O;  1LA3 A;  1K9P A;  5CPV A;  3SG3 A;  1K94 A;  2MRD A;  1SNL A;  1BMO A;  1J1E A;  2JNX A;  2H61 C;  1LA0 A;  3PAL A;  1MHO A;  1YUU A;  1KK7 Y;  3GK2 A;  2M97 A;  2MJW B;  2IS9 A;  1F54 A;  3VRR A;  1QAT A;  2PSR A;  1RJV A;  1MUX A;  4MSP A;  4YBH B;  3I5G C;  1ZUZ A;  3CS1 A;  1F8H A;  1JBA A;  1KK8 C;  3OX6 A;  3F45 A; 
#chains in the Genus database with same CATH topology
 4GBA A;  1HT9 A;  1YUT A;  3QME A;  2LMU A;  3C1V A;  4BY4 A;  5FI6 A;  1CLB A;  1XYD A;  3AKB A;  1ZFS A;  4PHK A;  1TCO B;  4A4B A;  2ZRS A;  3FWB A;  4CFR A;  1CFD A;  5PAL A;  4OV2 A;  3HX4 A;  3CR2 A;  3SIA A;  1L2O C;  3VRP A;  1CKK A;  1NP8 A;  4HRH A;  4MZK A;  4ORC B;  1FI6 A;  1DEL A;  5I94 A;  2ISD A;  4PE4 A;  1OOH A;  1JUO A;  1DJW A;  1N65 A;  3DVK A;  1Y0V H;  3VRO A;  4C0K A;  1F55 A;  2ZNE A;  1AJ4 A;  5AFP A;  1J7Q A;  3D74 A;  1QLS A;  3B87 A;  2I94 A;  5CSF A;  5HKW A;  2NXQ A;  4MN0 A;  1OOG A;  3S0G A;  2K2A A;  3LL8 B;  2LE9 B;  2LCP A;  3D75 A;  4IJ7 A;  4GPL B;  2BL0 B;  3D0Y A;  4PE1 A;  3TS5 C;  1GGZ A;  2GGM A;  2WC6 A;  1W7I B;  1BR1 B;  5D3O A;  4C0L A;  5JJG A;  2LNK A;  4E68 A;  1XFX O;  3EVU A;  1WY9 A;  2QPT A;  2L51 A;  1GQM A;  1BF5 A;  2K0J A;  3CZ2 A;  3NSL A;  1CLM A;  2ERB A;  1G8I A;  5DIC A;  2H61 A;  1AUI B;  4USL A;  1K95 A;  1WLM A;  1CLL A;  1FW4 A;  1PUL A;  1S5G Y;  3I5I C;  1T14 A;  2OPO A;  1BLQ A;  1CMG A;  2SAS A;  1OW4 A;  1SSE B;  4YI8 A;  3L4A A;  4NDC A;  3CDN A;  1NX2 A;  2KSP A;  4WQ3 A;  2GTE A;  1F71 A;  4PHJ A;  1NX1 A;  4I5L B;  1Q80 A;  3V2L A;  4KYN A;  1YR5 A;  2NCP A;  4OVN F;  5F6T A;  1RTP 1;  1SRA A;  3EKH A;  4D1E A;  1K8U A;  2MLF C;  1TNX A;  2BBN A;  1XFY O;  5I2O A;  1EG3 A;  1YRT B;  1DVI A;  3RLZ A;  4OKH A;  1TUJ A;  1QS7 A;  2EHB A;  2PAL A;  3WNX B;  1X02 A;  1C3Z A;  1KFU S;  2LAP A;  3KF9 A;  4OCI A;  2KI6 C;  4ZCV A;  1Y6W A;  4P5O E;  3S0A A;  1BJF A;  1B8L A;  1J7R A;  1DJZ A;  2M7N A;  3R1O A;  4ZCU A;  1IQ3 A;  2WCL A;  1A4P A;  4UPG A;  3RZS A;  2QDI A;  2PAS A;  3R1P A;  5TNC A;  1KWO B;  2PYQ A;  1NX3 A;  4AQJ A;  2M3W A;  5AAN A;  1LVC D;  1UHJ A;  2JPO A;  3D73 A;  2L5X B;  1NCY A;  4YGD B;  1M31 A;  1QV1 A;  4PDZ A;  5HLO A;  1TOP A;  2OS8 C;  1LKJ A;  3B6X A;  4GGF A;  1KSO A;  1SKT A;  4FQO A;  1AHR A;  1WDC C;  1FPW A;  1VRK A;  4DUQ A;  2WC8 A;  2O60 A;  2Y1N A;  5HYD A;  1V1G A;  4GFT A;  2Q91 A;  1NUB A;  4ETO A;  1KCY A;  1L2O B;  1YX7 A;  2LAN A;  5K89 A;  3DVM A;  3SS4 A;  5AER A;  4XJK A;  1QIW A;  4CFQ A;  1EL4 A;  2KHN A;  2RGI A;  3BUX B;  5D69 A;  2WC5 A;  4YGE B;  4ORB B;  1PRW A;  3MSE B;  3S0B A;  1QJT A;  2FCD A;  3A8R A;  1SCM B;  3BXK A;  3R72 A;  2O5G A;  1SR6 B;  4GAO A;  1XFV O;  1XO5 A;  1OE9 B;  1S1E A;  1DGV A;  3O6B A;  2L2C A;  3ZNI A;  1B7T Z;  3KO0 A;  3S0E A;  1OZS A;  1IKU A;  1EJ3 A;  4WRI A;  3R1V A;  1SW8 A;  1JFK A;  2BNX A;  2WOS A;  3GOF A;  2K8M B;  3KEV A;  3IQO A;  3I5F B;  5HLV A;  1QV0 A;  2MLE C;  3CZ0 A;  1AP4 A;  1DF0 B;  2FJU B;  5D7F A;  3SS3 A;  1DC1 A;  4AOM A;  1NCZ A;  4GGF C;  3BFH A;  5J3X A;  1K96 A;  2VRG A;  3DYE A;  3CGA A;  4A4C A;  2HQ8 A;  1QVI Y;  3SJS A;  3B7A A;  4NDB A;  2L4H A;  4N1G A;  1TRF A;  2BE6 A;  1LXF C;  2Y1M A;  5HKZ A;  1IQ5 A;  4DRW A;  3PLF B;  1IJ5 A;  1Y1U A;  2F33 A;  1H8B A;  4MZJ A;  1K2H A;  3JVT B;  3BUM B;  1CM4 A;  3LK0 A;  4L9M A;  3S0D A;  1KK8 B;  3PSR A;  3SG4 A;  1SL7 A;  3TZ1 A;  1C7V A;  1NYA A;  3TDZ A;  3A4U B;  1ZMZ A;  2PVB A;  2ZND A;  3OX5 A;  1BG1 A;  2G2B A;  1DQE A;  2P6B B;  3JTD C;  3VB1 A;  3BFB A;  2BCX A;  4JKT A;  1TNQ A;  2LLT A;  1CFP A;  1SY9 A;  1XFU O;  1NSH A;  2L2E A;  2LVV A;  3IVT A;  4R1E A;  2L98 A;  2JT3 A;  5DKR A;  2KI4 B;  1C7W A;  4PHM A;  5GQQ C;  2LLS A;  1JFJ A;  1QLK A;  3DXL A;  1NX0 A;  3AAK A;  2KAY A;  3FIA A;  3NXA A;  2KBM A;  1A2X A;  3K1E A;  5B8I B;  1G4Y R;  1M46 A;  1MXL C;  2Y4Q A;  1F4Q A;  2CCM A;  1YVH A;  3OP0 A;  1TNW A;  2LP2 A;  1CDM A;  2LVI A;  1TTX A;  4TNC A;  5AXI A;  1IH0 A;  2M9G A;  2WCB A;  3PN7 C;  1OOJ A;  3CTN A;  1AK8 A;  1JF2 A;  3EVV A;  3LLE A;  2B1U A;  2JUL A;  2K7B A;  5CSJ A;  3H4S E;  2A4J A;  1AVS A;  4MLW A;  2BKI B;  1QX2 A;  1A75 A;  2AUC A;  1LIN A;  1XK4 A;  2BE4 A;  3EK4 A;  4HSZ A;  4YGB B;  2KOT A;  1BR4 B;  2M1K B;  1J7P A;  3AKA A;  2M29 A;  3NHI A;  3CLN A;  2JXC A;  4DS7 A;  1N0Y A;  2F2O A;  1DJX A;  2QEV A;  2WCJ A;  3O2P A;  1LS8 A;  3B88 A;  4PHN A;  1QX5 B;  1YRU B;  2CTN A;  3KPX A;  3NSO A;  3BOW A;  3VRN A;  3TUY B;  2KI4 C;  1U5I A;  2Q4U A;  4CLN A;  1XA5 A;  3EG5 B;  3OHM B;  5KU1 A;  4JQ0 D;  3BFA A;  4CID A;  1TWO A;  2E6W A;  2K7D A;  1WLZ A;  3I5H C;  1UHI A;  3FE9 A;  1DJY A;  3DZT A;  1CNP A;  1TCF A;  2LP3 A;  3EVR A;  2V53 A;  5FI7 A;  3SS5 A;  1QWV A;  3N7H A;  1QXP A;  1BOC A;  1BU3 A;  2D8N A;  3PAT A;  3PM2 A;  5I2L A;  3WXA A;  2LVK A;  1AJ5 A;  1IWQ A;  1IGV A;  1UHH A;  5AEQ A;  2KNE A;  2H8V A;  2PMY A;  2LM5 A;  5I2Q A;  4JWQ A;  5BPJ A;  3Q8I A;  3D0Y B;  2M49 B;  5ER5 A;  2F3Y A;  2KLD A;  4PCW A;  3I5H B;  3WHU B;  3OGN A;  2KAX A;  2JTZ A;  2AAO A;  2BL0 C;  1K9K A;  2KFH A;  3BQ3 A;  2JT8 A;  1KFU L;  1DMO A;  1TIZ A;  1KWO C;  4INX A;  1MWN A;  3DF0 B;  1KK7 Z;  1Z2C B;  2K7O A;  1KFX S;  2ZRT A;  3D77 A;  3DD4 A;  4XJK B;  4M2O A;  5DKN A;  5FI2 A;  5FYX A;  1BOD A;  1JC2 A;  2P70 A;  4NQG A;  2BBM A;  2BKH B;  1FF1 A;  2JPT A;  2JNF A;  2L5Y A;  1A29 A;  2KYC A;  1DJH A;  2L50 A;  3JTD B;  4QJ4 B;  3FE6 A;  4M2P A;  4ORA B;  1WRL A;  2CT9 A;  4I5J A;  4OZD A;  4YI9 A;  5JOL A;  3OB2 B;  3IF7 A;  2I7A A;  3BUN B;  1J1D A;  4MZL A;  1ALW A;  3SG5 A;  4C0J A;  5I8N A;  3CZT X;  2K61 A;  2FCE A;  4PE0 A;  1W9Z A;  2JTT A;  1QX7 A;  3D76 A;  1B4C A;  2L4I A;  5HKY A;  1XFZ O;  2ZN8 A;  1SBJ A;  3GK4 X;  1B8R A;  3CR5 X;  4GGN A;  1JF0 A;  1CMF A;  2BCB A;  4YGC B;  3UO9 A;  2YGU A;  2EGD A;  1YUR A;  1CFC A;  1SR6 C;  1PVB A;  2LVJ A;  1YUS A;  4BY5 A;  3EK8 A;  4MEW A;  2EC6 C;  5CSN A;  1DGU A;  4QJ5 B;  1E8A A;  2MAZ A;  4M2Q A;  1UUR A;  2KBI A;  2KGB C;  2K7C A;  2KDH A;  2LC5 A;  4HRE E;  1CDL A;  4JD9 A;  1OSA A;  2MA2 A;  3SG6 A;  2KYF A;  3D10 A;  1WRZ A;  2ZKM X;  1RRO A;  1OQP A;  1OOF A;  2HPS A;  5KSZ A;  4NDD A;  1H4B A;  2MBX A;  2TN4 A;  3DF0 A;  3O4Y A;  4U8D A;  3VGO A;  1KQM C;  1SYM A;  5DKQ A;  1B9A A;  1NPQ A;  1KFX L;  1NCX A;  1RWY A;  1J55 A;  1DJG A;  1QAS A;  3LK1 A;  2KFF A;  3L4L A;  3M0W A;  1GJY A;  3D78 A;  2F3Z A;  2Y5I A;  1P28 A;  4DCK A;  2BEC A;  4N5X A;  3I5I B;  5IBW A;  2OS8 B;  3DY9 A;  1DTL A;  2JRF A;  3K21 A;  1B47 A;  2LHI A;  1SPY A;  3OBV A;  1S6I A;  2NCO A;  1S5G Z;  4I5N B;  1XVJ A;  3SG7 A;  4YGA A;  1IIO A;  3OB1 B;  3UNW A;  4WQ2 A;  2G9B A;  1OOI X;  1KQM B;  1OMV A;  1SL8 A;  1PAL A;  3I5G B;  2WCH A;  2F2P A;  3S0F A;  2OTG C;  1XK4 C;  3HCM A;  2WCF A;  3EK7 A;  2SCP A;  3NGV A;  2LHL A;  1A75 B;  1MQ1 A;  3EKJ A;  3PN7 B;  4AQI A;  5HL1 A;  1CB1 A;  1JSA A;  1A03 A;  2KAV A;  1PVA A;  2GGZ A;  1UUS A;  2CXJ A;  1M63 B;  2H2K A;  3O78 A;  1JWD A;  2BCA A;  4MVF A;  1S3P A;  3AAJ A;  1B1G A;  2QEB A;  2HF5 A;  2KLE A;  2K2F A;  1YTZ C;  2ZFD A;  1S36 A;  3PJI A;  1UP5 A;  5ER4 X;  3BJH A;  2M0R A;  2L0P A;  5EL2 A;  3SG2 A;  1K90 D;  1IRJ A;  2M1U A;  2WCE A;  3IQQ A;  1CTR A;  1R6P A;  2KFG A;  2JQ6 A;  3BUO B;  3I5F C;  1ALV A;  1QVI Z;  1W7J B;  3GK1 A;  1UHN A;  2KQY A;  4PAL A;  1XFR A;  1Y1X A;  1OMD A;  1EH2 A;  2WCK A;  1MF8 B;  2PQL A;  3CZ1 A;  3FWC A;  1U5I B;  2WND A;  3LCP C;  3O4X A;  2AMI A;  1EXR A;  3BOW B;  3PM8 A;  1J7O A;  3BYA A;  2JC2 A;  1NIW A;  1S6C A;  3DVE A;  4GUK A;  1D1O A;  2I18 A;  2KI6 D;  3JVT C;  2JXL A;  1C07 A;  2LUC A;  3VRQ A;  1F70 A;  3E3R A;  4FTG A;  1OZO A;  4DIR A;  1KSM A;  1M39 A;  2CBL A;  2OTG B;  2JU0 A;  1TNP A;  2NZ0 A;  3KHE A;  4PT1 A;  1WRK A;  2WCM A;  4CPV A;  4INW A;  3TUY C;  1UHK A;  2PRU A;  1CFF A;  3RM1 A;  1V1F A;  2KGR A;  2ZN9 A;  1HQV A;  3DVJ A;  3CR4 X;  3WHT B;  3SIB A;  1GM0 A;  2KQ6 A;  2FOT A;  3FS7 A;  1FI5 A;  3CWG A;  2K60 A;  2JOJ A;  2JT0 A;  2LMT A;  1R2U A;  3NSK A;  3PFV A;  3TDU A;  1M45 A;  4I5K A;  1MR8 A;  1DF0 A;  5KTY A;  2NLN A;  2LLU A;  2LMV A;  3B86 A;  4ICB A;  4QJ3 B;  2QEO A;  2LUX A;  1SK6 D;  1EG4 A;  3NSI A;  1UWO A;  3TDI A;  4JPZ B;  1DJI A;  1DT7 B;  1SCM C;  4F0Z B;  3BUW B;  1B7T Y;  5CSI A;  1SCV A;  3CAB A;  2F8P A;  2CNP A;  2I2R E;  3OX6 A;  4GNK B;  1PSR A;  1KQV A;  2HET A;  2P71 A;  1K9U A;  4IL1 A;  2DOQ A;  2LV7 A;  2WOR A;  3CYZ A;  3TS5 B;  3L47 A;  1QIV A;  2JZI A;  1C3Y A;  2M8U A;  3NHT A;  1S26 D;  1B8C A;  1F4O A;  1QTX A;  1IG5 A;  1PK0 D;  2MHH A;  1S6J A;  2BAP A;  1K93 D;  3QRX A;  2JWW A;  1CM1 A;  1RFJ A;  1SL9 A;  2COL B;  2R2I A;  4XYN A;  1IJ6 A;  4F7F A;  1ZOT B;  1OMR A;  4YRU A;  1CDP A;  1N2D A;  1Z4H A;  2HQW A;  1GGW A;  4PE7 A;  1FBV A;  2EC6 B;  1TN4 A;  2GV5 A;  4Q04 A;  3ZWH A;  4MRY A;  2E30 A;  4OR9 B;  1RK9 A;  3ICB A;  4HRG A;  1ODB A;  4P2Y B;  1L7Z A;  4N1F A;  1G33 A;  1TUZ A;  2M7L A;  1WDC B;  1YX8 A;  1SMG A;  1CDN A;  1PSB A;  1MXE A;  1YVL A;  1NWD A;  5G08 A;  2QAC A;  4MRX A;  1BT6 A;  1REC A;  1Y1A A;  2KPH A;  1ZAC A;  4MBE A;  1XFW O;  1DEK A;  1K9P A;  1LA3 A;  5CPV A;  3SG3 A;  1K94 A;  2MRD A;  1SNL A;  3FE8 A;  1BMO A;  1J1E A;  2JNX A;  1LA0 A;  2H61 C;  3PAL A;  4FQT A;  1MHO A;  1YUU A;  1KK7 Y;  3GK2 A;  2M97 A;  2MJW B;  2IS9 A;  1F54 A;  3VRR A;  1QAT A;  2PSR A;  1RJV A;  2QEH A;  1MUX A;  4MSP A;  4YBH B;  3I5G C;  1ZUZ A;  3CS1 A;  1F8H A;  1JBA A;  1KK8 C;  1ORG A;  2FJY A;  3F45 A; 
#chains in the Genus database with same CATH homology
 4GBA A;  1HT9 A;  1YUT A;  2LMU A;  3C1V A;  4BY4 A;  1CLB A;  1XYD A;  3AKB A;  1ZFS A;  4PHK A;  1TCO B;  4A4B A;  2ZRS A;  3FWB A;  4CFR A;  1CFD A;  5PAL A;  4OV2 A;  3HX4 A;  3CR2 A;  3SIA A;  1L2O C;  3VRP A;  1CKK A;  1NP8 A;  4HRH A;  4MZK A;  4ORC B;  1FI6 A;  2ISD A;  4PE4 A;  1JUO A;  1DJW A;  1N65 A;  3DVK A;  1Y0V H;  3VRO A;  4C0K A;  1F55 A;  2ZNE A;  1AJ4 A;  5AFP A;  1J7Q A;  1QLS A;  2I94 A;  5CSF A;  5HKW A;  2NXQ A;  4MN0 A;  2K2A A;  3LL8 B;  2LE9 B;  2LCP A;  4GPL B;  2BL0 B;  3D0Y A;  4PE1 A;  3TS5 C;  1GGZ A;  2GGM A;  1W7I B;  1BR1 B;  4C0L A;  5JJG A;  2LNK A;  4E68 A;  1XFX O;  3EVU A;  1WY9 A;  2QPT A;  2L51 A;  1GQM A;  1BF5 A;  2K0J A;  3NSL A;  1CLM A;  1G8I A;  2H61 A;  1AUI B;  4USL A;  1K95 A;  1WLM A;  1CLL A;  1FW4 A;  1PUL A;  1S5G Y;  3I5I C;  2OPO A;  1BLQ A;  1CMG A;  2SAS A;  4YI8 A;  4NDC A;  1NX2 A;  2KSP A;  4WQ3 A;  1F71 A;  4PHJ A;  1NX1 A;  4I5L B;  1Q80 A;  1YR5 A;  2NCP A;  4OVN F;  5F6T A;  1RTP 1;  1SRA A;  3EKH A;  4D1E A;  1K8U A;  2MLF C;  1TNX A;  2BBN A;  1XFY O;  5I2O A;  1EG3 A;  1YRT B;  1DVI A;  3RLZ A;  4OKH A;  1QS7 A;  2EHB A;  2PAL A;  3WNX B;  1X02 A;  1KFU S;  2LAP A;  3KF9 A;  4OCI A;  2KI6 C;  4ZCV A;  1Y6W A;  4P5O E;  1BJF A;  1B8L A;  1J7R A;  1DJZ A;  2M7N A;  4ZCU A;  1IQ3 A;  1A4P A;  4UPG A;  5TNC A;  2PAS A;  1KWO B;  4AQJ A;  1NX3 A;  2M3W A;  5AAN A;  1LVC D;  1UHJ A;  2L5X B;  1NCY A;  4YGD B;  1M31 A;  1QV1 A;  4PDZ A;  5HLO A;  1TOP A;  2OS8 C;  1LKJ A;  4GGF A;  1KSO A;  1SKT A;  4FQO A;  1AHR A;  1WDC C;  1FPW A;  1VRK A;  4DUQ A;  2WC8 A;  2O60 A;  2Y1N A;  5HYD A;  1V1G A;  4GFT A;  2Q91 A;  1NUB A;  4ETO A;  1KCY A;  1L2O B;  1YX7 A;  2LAN A;  5K89 A;  3DVM A;  5AER A;  4XJK A;  1QIW A;  4CFQ A;  1EL4 A;  2KHN A;  2RGI A;  3BUX B;  5D69 A;  4YGE B;  4ORB B;  1PRW A;  3MSE B;  1QJT A;  2FCD A;  3A8R A;  1SCM B;  3BXK A;  2O5G A;  1SR6 B;  4GAO A;  1XFV O;  1XO5 A;  1OE9 B;  1S1E A;  1DGV A;  3O6B A;  3ZNI A;  1B7T Z;  3KO0 A;  1OZS A;  1IKU A;  1EJ3 A;  4WRI A;  1SW8 A;  1JFK A;  2WOS A;  3GOF A;  2K8M B;  3KEV A;  3IQO A;  3I5F B;  5HLV A;  1QV0 A;  2MLE C;  1AP4 A;  1DF0 B;  2FJU B;  5D7F A;  4AOM A;  1NCZ A;  4GGF C;  5J3X A;  1K96 A;  2VRG A;  4A4C A;  3CGA A;  2HQ8 A;  1QVI Y;  3SJS A;  4NDB A;  2L4H A;  4N1G A;  1TRF A;  2BE6 A;  1LXF C;  2Y1M A;  5HKZ A;  1IQ5 A;  4DRW A;  3PLF B;  1IJ5 A;  1Y1U A;  2F33 A;  1H8B A;  4MZJ A;  1K2H A;  3JVT B;  3BUM B;  1CM4 A;  3LK0 A;  4L9M A;  1KK8 B;  3PSR A;  3SG4 A;  1SL7 A;  3TZ1 A;  1C7V A;  1NYA A;  3TDZ A;  3A4U B;  1ZMZ A;  2PVB A;  2ZND A;  3OX5 A;  1BG1 A;  2G2B A;  2P6B B;  3JTD C;  2BCX A;  1TNQ A;  2LLT A;  1CFP A;  1SY9 A;  1XFU O;  1NSH A;  2L2E A;  2LVV A;  4R1E A;  2L98 A;  2JT3 A;  5DKR A;  2KI4 B;  1C7W A;  4PHM A;  5GQQ C;  2LLS A;  1JFJ A;  1QLK A;  1NX0 A;  3AAK A;  2KAY A;  3FIA A;  3NXA A;  2KBM A;  1A2X A;  5B8I B;  1G4Y R;  1M46 A;  1MXL C;  2Y4Q A;  1F4Q A;  2CCM A;  1YVH A;  3OP0 A;  1TNW A;  2LP2 A;  1CDM A;  2LVI A;  1TTX A;  4TNC A;  5AXI A;  1IH0 A;  2M9G A;  2WCB A;  3PN7 C;  1OOJ A;  3CTN A;  1AK8 A;  1JF2 A;  3EVV A;  3LLE A;  2B1U A;  2JUL A;  2K7B A;  5CSJ A;  3H4S E;  2A4J A;  1AVS A;  4MLW A;  2BKI B;  1QX2 A;  1A75 A;  2AUC A;  1LIN A;  1XK4 A;  2BE4 A;  3EK4 A;  4HSZ A;  4YGB B;  2KOT A;  1BR4 B;  2M1K B;  1J7P A;  3AKA A;  2M29 A;  3CLN A;  2JXC A;  4DS7 A;  1N0Y A;  2F2O A;  1DJX A;  3O2P A;  4PHN A;  1QX5 B;  1YRU B;  2CTN A;  3KPX A;  3NSO A;  3BOW A;  3VRN A;  3TUY B;  2KI4 C;  1U5I A;  2Q4U A;  4CLN A;  1XA5 A;  3OHM B;  5KU1 A;  4JQ0 D;  4CID A;  2E6W A;  2K7D A;  1WLZ A;  3I5H C;  1UHI A;  1DJY A;  1CNP A;  1TCF A;  2LP3 A;  3EVR A;  2V53 A;  1BOC A;  1QXP A;  1BU3 A;  2D8N A;  3PAT A;  5I2L A;  3WXA A;  2LVK A;  1AJ5 A;  1IWQ A;  1IGV A;  1UHH A;  5AEQ A;  2KNE A;  5I2Q A;  2PMY A;  2LM5 A;  1BOD A;  4JWQ A;  5BPJ A;  3D0Y B;  2M49 B;  5ER5 A;  2F3Y A;  4PCW A;  3I5H B;  3WHU B;  2KAX A;  2JTZ A;  2AAO A;  2BL0 C;  1K9K A;  2KFH A;  3BQ3 A;  2JT8 A;  1KFU L;  1DMO A;  1TIZ A;  1KWO C;  1MWN A;  3DF0 B;  1KK7 Z;  2K7O A;  2ZRT A;  1KFX S;  3DD4 A;  4XJK B;  5DKN A;  5FYX A;  4M2O A;  1JC2 A;  4NQG A;  1FF1 A;  2BBM A;  2BKH B;  2JPT A;  2JNF A;  1A29 A;  2KYC A;  1DJH A;  2L50 A;  3JTD B;  4QJ4 B;  4M2P A;  4ORA B;  1WRL A;  2CT9 A;  4I5J A;  4YI9 A;  5JOL A;  3OB2 B;  3IF7 A;  2I7A A;  3BUN B;  1J1D A;  4MZL A;  1ALW A;  3SG5 A;  4C0J A;  5I8N A;  3CZT X;  2K61 A;  2FCE A;  4PE0 A;  2JTT A;  1QX7 A;  1B4C A;  2L4I A;  5HKY A;  1XFZ O;  2ZN8 A;  1SBJ A;  3GK4 X;  1B8R A;  3CR5 X;  4GGN A;  1JF0 A;  1CMF A;  2BCB A;  4YGC B;  1CFC A;  2EGD A;  1YUR A;  1SR6 C;  1PVB A;  2LVJ A;  1YUS A;  4BY5 A;  3EK8 A;  4MEW A;  2EC6 C;  5CSN A;  1DGU A;  4QJ5 B;  1E8A A;  2MAZ A;  4M2Q A;  1UUR A;  2KBI A;  2KGB C;  2K7C A;  2KDH A;  2LC5 A;  4HRE E;  1CDL A;  1OSA A;  2MA2 A;  3SG6 A;  2KYF A;  3D10 A;  1WRZ A;  2ZKM X;  1RRO A;  1OQP A;  2HPS A;  5KSZ A;  4NDD A;  1H4B A;  2MBX A;  2TN4 A;  3DF0 A;  3O4Y A;  4U8D A;  3VGO A;  1KQM C;  1SYM A;  5DKQ A;  1B9A A;  1NPQ A;  1KFX L;  1NCX A;  1RWY A;  1J55 A;  1DJG A;  1QAS A;  3LK1 A;  2KFF A;  3M0W A;  1GJY A;  2F3Z A;  2Y5I A;  4DCK A;  2BEC A;  4N5X A;  3I5I B;  5IBW A;  2OS8 B;  1DTL A;  2JRF A;  3K21 A;  1B47 A;  2LHI A;  1SPY A;  1S6I A;  2NCO A;  1S5G Z;  4I5N B;  1XVJ A;  3SG7 A;  4YGA A;  3OB1 B;  4WQ2 A;  2G9B A;  1OMV A;  1KQM B;  1SL8 A;  3I5G B;  1PAL A;  2F2P A;  2OTG C;  1XK4 C;  3HCM A;  2WCF A;  3EK7 A;  2SCP A;  2LHL A;  1A75 B;  1MQ1 A;  3EKJ A;  3PN7 B;  4AQI A;  1CB1 A;  1JSA A;  1A03 A;  2KAV A;  2GGZ A;  1PVA A;  1UUS A;  2CXJ A;  1M63 B;  2H2K A;  3O78 A;  1JWD A;  2BCA A;  4MVF A;  1S3P A;  3AAJ A;  1B1G A;  2HF5 A;  2K2F A;  1YTZ C;  2ZFD A;  1S36 A;  1UP5 A;  5ER4 X;  2M0R A;  2L0P A;  3SG2 A;  1K90 D;  1IRJ A;  2M1U A;  2WCE A;  3IQQ A;  1CTR A;  1R6P A;  2KFG A;  2JQ6 A;  3BUO B;  3I5F C;  1ALV A;  1QVI Z;  1W7J B;  3GK1 A;  1UHN A;  2KQY A;  4PAL A;  1Y1X A;  1OMD A;  1EH2 A;  1MF8 B;  3LCP C;  3FWC A;  1U5I B;  2WND A;  2AMI A;  1EXR A;  3BOW B;  3PM8 A;  1J7O A;  3BYA A;  2JC2 A;  1NIW A;  1S6C A;  3DVE A;  4GUK A;  1D1O A;  2I18 A;  2KI6 D;  3JVT C;  2JXL A;  1C07 A;  2LUC A;  3VRQ A;  1F70 A;  3E3R A;  4FTG A;  1OZO A;  4DIR A;  1KSM A;  1M39 A;  2CBL A;  2OTG B;  2JU0 A;  1TNP A;  2NZ0 A;  3KHE A;  1WRK A;  4CPV A;  3TUY C;  1UHK A;  2PRU A;  1CFF A;  3RM1 A;  1V1F A;  2KGR A;  2ZN9 A;  1HQV A;  3DVJ A;  3CR4 X;  3WHT B;  3SIB A;  2KQ6 A;  2FOT A;  3FS7 A;  1FI5 A;  3CWG A;  2JOJ A;  2JT0 A;  2LMT A;  1R2U A;  3NSK A;  3PFV A;  3TDU A;  1M45 A;  4I5K A;  1MR8 A;  1DF0 A;  5KTY A;  2NLN A;  2LLU A;  2LMV A;  4ICB A;  4QJ3 B;  2LUX A;  1SK6 D;  1EG4 A;  3NSI A;  1UWO A;  3TDI A;  4JPZ B;  1DJI A;  1DT7 B;  1SCM C;  4F0Z B;  3BUW B;  1B7T Y;  5CSI A;  1SCV A;  2F8P A;  2CNP A;  2I2R E;  4GNK B;  1PSR A;  1KQV A;  2HET A;  1K9U A;  4IL1 A;  2DOQ A;  2LV7 A;  2WOR A;  3TS5 B;  1QIV A;  2JZI A;  2M8U A;  1S26 D;  1B8C A;  1F4O A;  1QTX A;  1IG5 A;  1PK0 D;  2MHH A;  1S6J A;  1K93 D;  3QRX A;  2JWW A;  1CM1 A;  1RFJ A;  1SL9 A;  2COL B;  2R2I A;  4XYN A;  1IJ6 A;  1ZOT B;  1OMR A;  4YRU A;  1CDP A;  1N2D A;  1GGW A;  2HQW A;  4PE7 A;  1FBV A;  2EC6 B;  1TN4 A;  2GV5 A;  4Q04 A;  3ZWH A;  4MRY A;  2E30 A;  4OR9 B;  1RK9 A;  3ICB A;  4HRG A;  1ODB A;  4P2Y B;  1L7Z A;  4N1F A;  1G33 A;  1CDN A;  2M7L A;  1WDC B;  1YX8 A;  1SMG A;  1PSB A;  1MXE A;  1YVL A;  1NWD A;  5G08 A;  2QAC A;  4MRX A;  1BT6 A;  1REC A;  1Y1A A;  1ZAC A;  4MBE A;  1XFW O;  1LA3 A;  1K9P A;  5CPV A;  3SG3 A;  1K94 A;  2MRD A;  1SNL A;  1BMO A;  1J1E A;  2JNX A;  2H61 C;  1LA0 A;  3PAL A;  1MHO A;  1YUU A;  1KK7 Y;  3GK2 A;  2M97 A;  2MJW B;  2IS9 A;  1F54 A;  3VRR A;  1QAT A;  2PSR A;  1RJV A;  1MUX A;  4MSP A;  4YBH B;  3I5G C;  1ZUZ A;  3CS1 A;  1F8H A;  1JBA A;  1KK8 C;  3OX6 A;  3F45 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...