1XFXO

Crystal structure of anthrax edema factor (ef) in complex with calmodulin in the presence of 10 millimolar exogenously added calcium chloride
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
146
structure length
146
Chain Sequence
QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDQMIREADIDGDGQVNYEEFVQMMTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin-sensitive adenylate cyclase
publication title Calcium-independent calmodulin binding and two-metal-ion catalytic mechanism of anthrax edema factor.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Lyase/metal binding protein
total genus 33
structure length 146
sequence length 146
chains with identical sequence P, Q, R, S, T
ec nomenclature
pdb deposition date 2004-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xfxO01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xfxO02
4JPZB 4MZJA 3I5IC 1F4QA 3CTNA 4WRIA 2NXQA 1NX2A 1CLBA 2PVBA 4YGBB 2KI4B 2Q4UA 3TS5C 4E68A 1CDNA 1XK4A 2KI6C 1FBVA 5HKYA 2L5XB 4U8DA 1ZUZA 1MF8B 1L2OB 4MVFA 2ZKMX 4GAOA 1GJYA 2MA2A 1K93D 2WCBA 3TZ1A 4TNCA 1OMRA 3BXKA 1B8LA 2M1UA 1ALWA 3PFVA 2JXCA 3I5GB 3A8RA 1Y1XA 2OS8C 2Y5IA 4MZKA 4OVNF 2VRGA 1AUIB 3NSKA 3SG2A 3TDZA 1NSHA 1YVHA 1JF0A 1UHHA 1IJ5A 1UP5A 2KI6D 1CNPA 3WNXB 3LK1A 5KU1A 2F3YA 2LVKA 3AAKA 1YTZC 4MSPA 3TS5B 2LAPA 2F2OA 4XYNA 2HETA 4N5XA 1MHOA 4MN0A 1XK4C 2KFHA 3AKAA 4A4BA 1V1GA 1G8IA 1MXEA 1TN4A 2GGMA 3CR4X 3EK4A 4CPVA 1JC2A 1F71A 4C0KA 5HKWA 2G9BA 1W7JB 3GK2A 1N2DA 4QJ4B 3I5HC 1XYDA 1F70A 4CLNA 1XFXO 1YURA 1CKKA 4GPLB 1RJVA 2JC2A 1DJYA 2OS8B 3VRPA 2K7DA 2TN4A 3HCMA 3HX4A 2BE4A 3ICBA 2ISDA 1UHJA 3SG5A 2LC5A 2LMTA 1U5IA 1DJHA 1GQMA 2MBXA 4YI9A 4IL1A 1KK8C 1NX3A 1WDCC 3EKHA 2L4HA 1BR1B 2HQWA 4I5JA 1J1DA 1YRTB 2ZRTA 1LA3A 2PSRA 2I7AA 3K21A 4P5OE 3FS7A 5I8NA 5TNCA 2BCXA 1TTXA 3JTDC 1J7QA 1XA5A 2K2FA 1RFJA 4GGFC 2P6BB 4GGNA 1BLQA 3EVUA 2PMYA 2K7OA 3I5HB 1LVCD 1NIWA 4PALA 1QASA 2LP3A 1TOPA 1S6CA 2WCEA 1NUBA 3EVRA 2CT9A 1S5GY 1SW8A 1TNWA 3PN7C 5AEQA 1KFXL 1MR8A 3VRRA 3EK8A 1M63B 1SK6D 2JPTA 1NCYA 1SY9A 2LVIA 1QIWA 4ICBA 1CDPA 4BY5A 2KI4C 1AJ5A 5BPJA 2A4JA 1J7PA 4NDCA 3SIBA 2O5GA 2K2AA 1S1EA 2M0RA 3O78A 2KSPA 1HQVA 1B47A 1DJZA 1YX7A 1CMFA 2MJWB 2KQ6A 1XFWO 1BU3A 4DUQA 2L0PA 2KAVA 3IQOA 1QATA 1K9PA 2I18A 2KBMA 2LM5A 4C0LA 1OSAA 1IG5A 1B7TY 1RWYA 1UUSA 5AXIA 2CTNA 3I5GC 1SCVA 4YGAA 3EKJA 1KFUS 3ZWHA 3I5FC 4MRYA 2MAZA 3PN7B 1U5IB 1DF0B 1YVLA 3BUOB 3JVTC 2ZRSA 3EK7A 4OCIA 2BCBA 1XVJA 1S3PA 1FPWA 1LKJA 2R2IA 1DJIA 1PVAA 3A4UB 1A03A 4XJKA 1RROA 3BOWB 3F45A 2LP2A 4F0ZB 4DCKA 1YUSA 1DTLA 1WY9A 1SR6B 4ORBB 5J3XA 4PHKA 4BY4A 2M1KB 2Y4QA 3TUYC 2LANA 2M7LA 2RGIA 1VRKA 1TRFA 2QACA 1OMVA 3TDUA 3WHTB 1TCOB 3VROA 3I5FB 1UHIA 5ER5A 1CLMA 1MUXA 3FIAA 4GFTA 1XFVO 1LXFC 4NDBA 5CSJA 4GBAA 1KSOA 1J1EA 3O4YA 4P2YB 1OQPA 3JVTB 1KK7Y 3DVEA 1LINA 1NCZA 1NP8A 3SG4A 2F33A 1IQ3A 1CM1A 2AAOA 3MSEB 1AP4A 2LHIA 1WLMA 1G33A 5HLOA 1ZOTB 2NCPA 1EH2A 3NSOA 3GK1A 1KWOB 5HKZA 1AHRA 1XFUO 1DMOA 1F8HA 4MRXA 2K0JA 1A75B 4I5KA 1B1GA 3TUYB 2CCMA 2FOTA 1CDLA 1JF2A 1IKUA 4I5NB 1SPYA 3CGAA 3FWBA 2EC6C 2JULA 1V1FA 4I5LB 1TIZA 1F4OA 1QLSA 1G4YR 2NLNA 3KPXA 4YGDB 5CSFA 3BUXB 3IQQA 3BYAA 3OHMB 1BMOA 2GGZA 2Q91A 2CBLA 4M2OA 1A4PA 2K61A 3LL8B 2COLB 1PSRA 2GV5A 1ZFSA 5PALA 1CB1A 1JBAA 2JTZA 1WRKA 4YGCB 1QX7A 1CFDA 2SASA 2BECA 3CWGA 1JFJA 2Y1MA 1KFXS 5AANA 3CS1A 1R6PA 2MRDA 5JOLA 2KAXA 1JFKA 4XJKB 1Y1AA 4OKHA 3H4SE 1XFZO 4YI8A 1AJ4A 2KNEA 2M7NA 3BUMB 1W7IB 2H61A 1J7RA 4N1GA 1QV0A 3CZTX 5ER4X 1IGVA 1R2UA 5D69A 4AQJA 4PE7A 4WQ2A 1WLZA 3DVMA 4QJ5B 2EC6B 1KQVA 1OOJA 3AAJA 1QX5B 4DRWA 4MEWA 1PK0D 1TNQA 2NZ0A 2K7BA 2BBMA 3VRNA 2I94A 1K9KA 2L2EA 2EHBA 2ZNEA 1Q80A 1AVSA 2JRFA 1M39A 2BCAA 3O6BA 1ODBA 1UHNA 1IRJA 1BR4B 2JWWA 3C1VA 1FF1A 3SG3A 4AQIA 1QS7A 2KYCA 1UWOA 2WORA 4HREE 2M8UA 1IH0A 5DKQA 2BE6A 1DJGA 2KFFA 3KO0A 1DJXA 1SL7A 2JT3A 4DS7A 2F8PA 1FI5A 3O2PA 1IJ6A 1D1OA 4JQ0D 1SR6C 2MHHA 2AMIA 1Y0VH 2EGDA 2IS9A 1C07A 1EXRA 3KEVA 2KDHA 4CIDA 2LV7A 1QVIZ 1UHKA 1K8UA 1YUTA 4NDDA 1PALA 4USLA 4ETOA 5I2OA 5K89A 1SYMA 4ORCB 3IF7A 1CM4A 3KHEA 5AERA 2JOJA 2K8MB 5D7FA 1CFPA 2M49B 2ZN9A 2OPOA 1SMGA 3WXAA 5IBWA 1SNLA 1YR5A 2KGBC 1MWNA 1SL9A 2HQ8A 2JNFA 2WC8A 3DD4A 4MBEA 4N1FA 3OB2B 2G2BA 1K90D 1SCMC 1BG1A 4R1EA 2LLUA 4FTGA 1QIVA 2CXJA 2BL0B 2LUXA 1OZSA 3PALA 5FYXA 4UPGA 2JT8A 4ZCVA 1KWOC 1KSMA 1N65A 1F54A 3OP0A 1K9UA 2PRUA 2LMVA 1NWDA 1IWQA 2D8NA 4HRGA 1H8BA 1PSBA 2OTGC 1A2XA 4OR9B 4YGEB 5AFPA 4QJ3B 4PE0A 1BOCA 3OX6A 2JU0A 3VGOA 1J55A 3M0WA 2JQ6A 1DGUA 1EL4A 3GOFA 2E30A 2LNKA 5DKNA 3CLNA 2BKHB 2V53A 3SJSA 1B4CA 2KFGA 2E6WA 2KBIA 5CSNA 3CR5X 4PE1A 3AKBA 2O60A 4A4CA 5F6TA 1KK7Z 1SCMB 1S36A 2Y1NA 3DVKA 3QRXA 1S26D 1DVIA 4HSZA 3OB1B 2FJUB 1AK8A 1GGZA 1KFUL 4MLWA 2K7CA 1JUOA 1S6IA 1L7ZA 1XFYO 5I2LA 3SIAA 1TNXA 2JXLA 4CFRA 4WQ3A 1YUUA 1EG4A 1C7VA 2AUCA 2LUCA 1K2HA 2PALA 3NXAA 1B8CA 3ZNIA 5G08A 1XO5A 5HYDA 2OTGB 1TNPA 3SG7A 1DJWA 1OZOA 1QJTA 2M29A 3I5IB 4C0JA 1NCXA 1Y6WA 1QX2A 1SL8A 3CR2A 1E8AA 5DKRA 3DF0A 1TCFA 1N0YA 2L4IA 4PDZA 1S6JA 3D0YA 1MQ1A 1K96A 1CTRA 3LLEA 5KSZA 5KTYA 1CMGA 2JZIA 2MLFC 2NCOA 1RECA 1SBJA 2L98A 4D1EA 3NSLA 4GGFA 4M2QA 4CFQA 1YX8A 2ZFDA 3D10A 4MZLA 2BBNA 4DIRA 1K94A 1FW4A 1YRUB 2F3ZA 2WOSA 2B1UA 2QPTA 1JSAA 1PRWA 3LCPC 1SRAA 3PLFB 3FWCA 1CFFA 2PASA 2HF5A 2LHLA 3WHUB 1DT7B 1WRLA 1DF0A 1NX0A 1SKTA 2WNDA 4FQOA 4Q04A 2KOTA 4GUKA 5JJGA 1CFCA 5GQQC 1LA0A 2JT0A 2L50A 1QLKA 2KAYA 1S5GZ 1MXLC 1QXPA 2LMUA 3BOWA 3PSRA 4PHNA 3TDIA 1B9AA 1ZMZA 2BKIB 2FCDA 1FI6A 1J7OA 1KCYA 4AOMA 2LLTA 4GNKB 1ZACA 2LVVA 2F2PA 3BUWB 2BL0C 2LCPA 4M2PA 4OV2A 3OX5A 2ZNDA 1A29A 2JTTA 2FCEA 1B8RA 1EJ3A 2LE9B 1UURA 2DOQA 1BF5A 2H61C 2H2KA 1M45A 3PATA 3E3RA 1C7WA 4NQGA 1ALVA 1KQMC 1OE9B 1QV1A 2KYFA 1KK8B 1WDCB 1B7TZ 1OMDA 2CNPA 2HPSA 2WCFA 3BQ3A 3NSIA 1JWDA 5CSIA 2MLEC 3RM1A 1H4BA 3LK0A 3PM8A 3BUNB 4HRHA 5CPVA 5B8IB 1BJFA 3DF0B 1BODA 3SG6A 2SCPA 3DVJA 4ZCUA 4PE4A 3JTDB 3KF9A 1CLLA 1BT6A 2M9GA 3D0YB 1Y1UA 4JWQA 4YBHB 4YRUA 1EG3A 1GGWA 1RTP1 1L2OC 1IQ5A 4PCWA 1A75A 3VRQA 2L51A 2LLSA 2ZN8A 1X02A 1DGVA 2M3WA 2I2RE 2KQYA 1CDMA 1HT9A 1NYAA 1K95A 1QTXA 1NPQA 4L9MA 5I2QA 1QVIY 1F55A 3RLZA 1M46A 1RK9A 2KGRA 2LVJA 1PULA 5HLVA 1WRZA 1M31A 3GK4X 4ORAB 1PVBA 2KHNA 2JNXA 1NX1A 3EVVA 2M97A 4PHMA 1KQMB 4PHJA
chains in the Genus database with same CATH superfamily
4JPZB 4MZJA 3D78A 3I5IC 1F4QA 3CTNA 4WRIA 2NXQA 4JKTA 1NX2A 1CLBA 2PVBA 3L4AA 2KI4B 4YGBB 2WCLA 2Q4UA 3TS5C 4E68A 1CDNA 1XK4A 2KI6C 1FBVA 5HKYA 2L5XB 4U8DA 3BFBA 1ZUZA 1MF8B 1L2OB 4KYNA 4MVFA 2ZKMX 5HL1A 4GAOA 1GJYA 2MA2A 1K93D 2WCBA 3TZ1A 4TNCA 1OMRA 3BXKA 1B8LA 2M1UA 1ALWA 1OOIX 1TWOA 3PFVA 2JXCA 3I5GB 3A8RA 1Y1XA 2OS8C 2Y5IA 4MZKA 3N7HA 2VRGA 1AUIB 3NSKA 4OVNF 3SG2A 3DXLA 3TDZA 1NSHA 1YVHA 1JF0A 1UHHA 1IJ5A 1UP5A 3R1VA 2KI6D 3S0FA 1CNPA 2GTEA 3WNXB 3LK1A 5KU1A 3QMEA 2F3YA 2LVKA 3AAKA 1YTZC 4MSPA 3TS5B 2LAPA 2F2OA 4XYNA 2HETA 4N5XA 1MHOA 4MN0A 1XK4C 2KFHA 3AKAA 4A4BA 1V1GA 3FE8A 1G8IA 1MXEA 1TN4A 2GGMA 3CR4X 3EK4A 4CPVA 1OW4A 1JC2A 1F71A 4C0KA 5HKWA 2G9BA 1W7JB 2KPHA 1N2DA 3GK2A 4QJ4B 3I5HC 1XYDA 1F70A 4CLNA 1XFXO 1YURA 1CKKA 1IIOA 4GPLB 1RJVA 2JC2A 1DJYA 2OS8B 5DICA 3VRPA 2K7DA 2TN4A 3HCMA 3HX4A 2BE4A 3ICBA 2ISDA 1UHJA 3SG5A 2LC5A 2LMTA 1U5IA 1DJHA 1GQMA 2MBXA 4YI9A 4IL1A 2KLDA 1KK8C 1NX3A 1WDCC 3EKHA 3CZ0A 2L4HA 1BR1B 3Q8IA 2HQWA 4I5JA 1J1DA 1YRTB 2ZRTA 1DC1A 1LA3A 2PSRA 2I7AA 3K21A 4P5OE 3FS7A 3O4XA 5I8NA 5TNCA 2BCXA 1TTXA 3JTDC 1J7QA 1XA5A 2K2FA 1RFJA 3BFHA 4GGFC 2P6BB 4GGNA 1BLQA 2QEVA 3EVUA 2PMYA 2K7OA 3I5HB 1LVCD 1NIWA 3L4LA 4PALA 1QASA 3B86A 2LP3A 1TOPA 5I94A 1S6CA 2WCEA 1GM0A 1NUBA 3EVRA 2CT9A 4INXA 1S5GY 1SW8A 1TNWA 2WC5A 3PN7C 5AEQA 1KFXL 1MR8A 3VRRA 3EK8A 3B88A 1M63B 1SK6D 2JPTA 1NCYA 1SY9A 1Z2CB 2LVIA 1QIWA 4ICBA 1CDPA 4BY5A 2KI4C 1AJ5A 3IVTA 5BPJA 2A4JA 1J7PA 4NDCA 3SIBA 2O5GA 2K2AA 1S1EA 2M0RA 3O78A 2KSPA 1HQVA 1B47A 1DJZA 1OOHA 1YX7A 1CMFA 2JPOA 2MJWB 2KQ6A 1XFWO 1BU3A 4DUQA 2L0PA 2KAVA 3IQOA 1QATA 1K9PA 2I18A 2KBMA 2LM5A 4C0LA 1OSAA 1IG5A 1B7TY 1RWYA 1UUSA 5AXIA 2CTNA 3D77A 3I5GC 1SCVA 4YGAA 3EKJA 1KFUS 4F7FA 3ZWHA 3I5FC 4IJ7A 2K60A 4MRYA 2MAZA 3PN7B 1U5IB 1DF0B 1YVLA 3BUOB 2WCKA 2YGUA 2ZRSA 3JVTC 3EK7A 4OCIA 2BCBA 3RZSA 1XVJA 1S3PA 1FPWA 1LKJA 2R2IA 1DJIA 1PVAA 3A4UB 4INWA 1A03A 4XJKA 1RROA 3BOWB 3F45A 2LP2A 3L47A 4F0ZB 4DCKA 1YUSA 1XFRA 1DTLA 1WY9A 1SR6B 4ORBB 5J3XA 4PHKA 4BY4A 2M1KB 2Y4QA 3TUYC 3PM2A 2LANA 3UNWA 2M7LA 2RGIA 1VRKA 5FI2A 3DY9A 1TRFA 2QACA 1OMVA 3TDUA 3WHTB 1TCOB 3VROA 3I5FB 1UHIA 5ER5A 1CLMA 1MUXA 3FIAA 4GFTA 1XFVO 3S0AA 1LXFC 3EG5B 4NDBA 5CSJA 4GBAA 1KSOA 1J1EA 2QEHA 3O4YA 4P2YB 1OQPA 3JVTB 1KK7Y 3DVEA 1LINA 1NCZA 1NP8A 4OZDA 3SG4A 1P28A 2F33A 1IQ3A 1CM1A 2AAOA 3MSEB 1AP4A 2LHIA 1WLMA 1G33A 5HLOA 1OOGA 1ZOTB 2NCPA 1EH2A 1OOFA 3NSOA 3GK1A 1KWOB 5HKZA 1AHRA 1XFUO 1C3YA 1DMOA 1F8HA 4MRXA 2K0JA 1A75B 4I5KA 1B1GA 3TUYB 2QDIA 2CCMA 2FOTA 1CDLA 1JF2A 1DELA 1IKUA 4I5NB 1SPYA 3CGAA 3FWBA 2EC6C 2JULA 1V1FA 4I5LB 1TIZA 1F4OA 1QLSA 1G4YR 2NLNA 3KPXA 4YGDB 5CSFA 3BUXB 3IQQA 3BYAA 3OHMB 1BMOA 2GGZA 2Q91A 2CBLA 4M2OA 3S0GA 3VB1A 1A4PA 2K61A 3LL8B 2COLB 1PSRA 2GV5A 1ZFSA 5PALA 1CB1A 1JBAA 2JTZA 1WRKA 4YGCB 1QX7A 1CFDA 2SASA 2BECA 3CWGA 1JFJA 2Y1MA 1KFXS 5AANA 3CS1A 1R6PA 2MRDA 5JOLA 2KAXA 1JFKA 4XJKB 1Y1AA 2KLEA 4OKHA 3DZTA 3H4SE 1XFZO 4YI8A 1AJ4A 2KNEA 2M7NA 3BUMB 1W7IB 2H61A 1J7RA 4N1GA 1QV0A 3CZTX 5ER4X 1IGVA 1R2UA 5D69A 4AQJA 3V2LA 2WC6A 4PE7A 3TDIA 4WQ2A 1WLZA 3DVMA 2L5YA 2EC6B 4QJ5B 4PT1A 1OOJA 1KQVA 1DQEA 3AAJA 1QX5B 3NHTA 4MEWA 4DRWA 1PK0D 1TNQA 2NZ0A 2K7BA 2BBMA 3VRNA 2I94A 1K9KA 2L2EA 2EHBA 2ZNEA 1Q80A 1AVSA 2JRFA 1M39A 2BCAA 3O6BA 1ODBA 1UHNA 1IRJA 1BR4B 2JWWA 3C1VA 1FF1A 3SG3A 4AQIA 1QS7A 2KYCA 1UWOA 2WORA 4HREE 3S0EA 2M8UA 2BNXA 1IH0A 3CABA 5DKQA 2BE6A 1DJGA 2KFFA 3KO0A 3UO9A 1DJXA 2WCMA 1SL7A 2JT3A 4DS7A 2F8PA 1FI5A 2WCHA 3O2PA 1IJ6A 1D1OA 4JQ0D 1SR6C 2MHHA 2AMIA 1Y0VH 2EGDA 2IS9A 1C07A 1EXRA 3KEVA 2KDHA 4CIDA 2LV7A 1QVIZ 1UHKA 1K8UA 1YUTA 3K1EA 4NDDA 1PALA 4USLA 4ETOA 5I2OA 5K89A 1SYMA 4ORCB 3IF7A 1ORGA 1CM4A 3KHEA 5AERA 2JOJA 2K8MB 5D7FA 1CFPA 2M49B 2H8VA 2ZN9A 3BJHA 3OBVA 2OPOA 1SMGA 3WXAA 5IBWA 1SNLA 1YR5A 2KGBC 1MWNA 1SL9A 2HQ8A 2JNFA 2WC8A 3DD4A 4MBEA 4N1FA 3BFAA 3OB2B 3SS3A 2G2BA 1K90D 1SCMC 1BG1A 4R1EA 2LLUA 4FTGA 1QIVA 2CXJA 2BL0B 2LUXA 1OZSA 3PALA 3OGNA 2PYQA 5FYXA 2BAPA 4UPGA 2JT8A 3R1PA 4ZCVA 1KWOC 1KSMA 1N65A 1F54A 3OP0A 1K9UA 2PRUA 2LMVA 1NWDA 1IWQA 2D8NA 4HRGA 1SSEB 3FE6A 3NHIA 1H8BA 1PSBA 2OTGC 2ERBA 1A2XA 4OR9B 4YGEB 5AFPA 4QJ3B 4PE0A 3CDNA 1BOCA 3OX6A 3B6XA 2JU0A 3VGOA 3D75A 1J55A 3M0WA 2JQ6A 1DGUA 1EL4A 3GOFA 2E30A 2LNKA 5DKNA 1T14A 3CLNA 2BKHB 2V53A 3SJSA 1B4CA 2KFGA 2E6WA 2KBIA 5CSNA 3CR5X 4PE1A 3AKBA 2O60A 4A4CA 5F6TA 1KK7Z 1SCMB 1S36A 2Y1NA 3DVKA 3QRXA 1S26D 1DVIA 3B7AA 3NGVA 3OB1B 4HSZA 2FJUB 1AK8A 1GGZA 1KFUL 4MLWA 2K7CA 1JUOA 1S6IA 1L7ZA 1XFYO 5I2LA 3SIAA 1TNXA 2JXLA 4CFRA 4WQ3A 3SS4A 1YUUA 1Z4HA 1EG4A 1C7VA 2AUCA 2LUCA 1K2HA 2PALA 3NXAA 3D74A 1B8CA 3ZNIA 5G08A 1XO5A 5HYDA 1TUJA 2OTGB 1TNPA 3SG7A 1DJWA 1OZOA 1QJTA 2M29A 3I5IB 4C0JA 1NCXA 1Y6WA 1QX2A 1SL8A 3S0DA 2L2CA 3CR2A 1E8AA 5DKRA 4FQTA 3DF0A 1TCFA 1N0YA 2L4IA 4PDZA 1S6JA 3D0YA 1MQ1A 1K96A 1CTRA 3LLEA 5KSZA 5KTYA 2QEBA 1CMGA 2JZIA 2MLFC 2NCOA 1RECA 1SBJA 2L98A 4D1EA 3NSLA 4GGFA 4M2QA 4CFQA 1YX8A 2ZFDA 1TUZA 3D10A 5FI6A 3SS5A 3CZ1A 3FE9A 4MZLA 2BBNA 5D3OA 1K94A 4DIRA 2QEOA 1FW4A 1YRUB 2F3ZA 2WOSA 2B1UA 2QPTA 1JSAA 1PRWA 3LCPC 1SRAA 3PJIA 3FWCA 3PLFB 1CFFA 2PASA 2HF5A 3B87A 2LHLA 3WHUB 1DT7B 1WRLA 1DF0A 1NX0A 3S0BA 1SKTA 2WNDA 4FQOA 4Q04A 2KOTA 4GUKA 5JJGA 1CFCA 1DEKA 5GQQC 1LA0A 5FI7A 2JT0A 2L50A 1QLKA 2KAYA 1S5GZ 1MXLC 1QXPA 2LMUA 3BOWA 3CZ2A 3PSRA 4PHNA 1B9AA 1ZMZA 2BKIB 2FCDA 1FI6A 1J7OA 1KCYA 4AOMA 2LLTA 4GNKB 1C3ZA 1ZACA 2FJYA 2LVVA 3CYZA 3DYEA 2F2PA 3R1OA 3BUWB 2BL0C 2LCPA 4M2PA 4OV2A 3OX5A 4JD9A 2ZNDA 1A29A 2JTTA 1KQMB 2FCEA 1B8RA 1EJ3A 2LE9B 1UURA 2DOQA 1BF5A 2H61C 2H2KA 1M45A 3PATA 3E3RA 1C7WA 4NQGA 2P71A 1ALVA 1KQMC 1OE9B 1QV1A 2KYFA 1KK8B 1WDCB 3D73A 1B7TZ 1OMDA 2CNPA 2HPSA 2WCFA 3BQ3A 3NSIA 5EL2A 5CSIA 1JWDA 2MLEC 3RM1A 1H4BA 3LK0A 3PM8A 3BUNB 4HRHA 5CPVA 5B8IB 2P70A 1BJFA 3DF0B 1BODA 1W9ZA 3SG6A 2SCPA 3DVJA 4ZCUA 4PE4A 3JTDB 3KF9A 1CLLA 1BT6A 2M9GA 3D0YB 1Y1UA 4JWQA 4YBHB 4YRUA 1EG3A 1GGWA 1RTP1 1L2OC 1IQ5A 4PCWA 1A75A 3VRQA 2L51A 2LLSA 2ZN8A 1X02A 1DGVA 2M3WA 2I2RE 2KQYA 1CDMA 1HT9A 1NYAA 1K95A 1QTXA 1NPQA 3D76A 4L9MA 1QVIY 5I2QA 3RLZA 1F55A 1M46A 1QWVA 1RK9A 2PQLA 2KGRA 2LVJA 1PULA 5HLVA 1WRZA 1M31A 3GK4X 3R72A 1PVBA 4ORAB 2WCJA 2KHNA 2JNXA 1NX1A 3EVVA 2M97A 4PHMA 1LS8A 4PHJA
chains in the Genus database with same CATH topology
4JPZB 4MZJA 3I5IC 1F4QA 3CTNA 4WRIA 2NXQA 1NX2A 1CLBA 2PVBA 4YGBB 2KI4B 2Q4UA 3TS5C 4E68A 1CDNA 1XK4A 2KI6C 1FBVA 5HKYA 2L5XB 4U8DA 1ZUZA 1MF8B 1L2OB 4MVFA 2ZKMX 4GAOA 1GJYA 2MA2A 1K93D 2WCBA 3TZ1A 4TNCA 1OMRA 3BXKA 1B8LA 2M1UA 1ALWA 3PFVA 2JXCA 3I5GB 3A8RA 1Y1XA 2OS8C 2Y5IA 4MZKA 4OVNF 2VRGA 1AUIB 3NSKA 3SG2A 3TDZA 1NSHA 1YVHA 1JF0A 1UHHA 1IJ5A 1UP5A 2KI6D 1CNPA 3WNXB 3LK1A 5KU1A 2F3YA 2LVKA 3AAKA 1YTZC 4MSPA 3TS5B 2LAPA 2F2OA 4XYNA 2HETA 4N5XA 1MHOA 4MN0A 1XK4C 2KFHA 3AKAA 4A4BA 1V1GA 1G8IA 1MXEA 1TN4A 2GGMA 3CR4X 3EK4A 4CPVA 1JC2A 1F71A 4C0KA 5HKWA 2G9BA 1W7JB 3GK2A 1N2DA 4QJ4B 3I5HC 1XYDA 1F70A 4CLNA 1XFXO 1YURA 1CKKA 4GPLB 1RJVA 2JC2A 1DJYA 2OS8B 3VRPA 2K7DA 2TN4A 3HCMA 3HX4A 2BE4A 3ICBA 2ISDA 1UHJA 3SG5A 2LC5A 2LMTA 1U5IA 1DJHA 1GQMA 2MBXA 4YI9A 4IL1A 1KK8C 1NX3A 1WDCC 3EKHA 2L4HA 1BR1B 2HQWA 4I5JA 1J1DA 1YRTB 2ZRTA 1LA3A 2PSRA 2I7AA 3K21A 4P5OE 3FS7A 5I8NA 5TNCA 2BCXA 1TTXA 3JTDC 1J7QA 1XA5A 2K2FA 1RFJA 4GGFC 2P6BB 4GGNA 1BLQA 3EVUA 2PMYA 2K7OA 3I5HB 1LVCD 1NIWA 4PALA 1QASA 2LP3A 1TOPA 1S6CA 2WCEA 1NUBA 3EVRA 2CT9A 1S5GY 1SW8A 1TNWA 3PN7C 5AEQA 1KFXL 1MR8A 3VRRA 3EK8A 1M63B 1SK6D 2JPTA 1NCYA 1SY9A 2LVIA 1QIWA 4ICBA 1CDPA 4BY5A 2KI4C 1AJ5A 5BPJA 2A4JA 1J7PA 4NDCA 3SIBA 2O5GA 2K2AA 1S1EA 2M0RA 3O78A 2KSPA 1HQVA 1B47A 1DJZA 1YX7A 1CMFA 2MJWB 2KQ6A 1XFWO 1BU3A 4DUQA 2L0PA 2KAVA 3IQOA 1QATA 1K9PA 2I18A 2KBMA 2LM5A 4C0LA 1OSAA 1IG5A 1B7TY 1RWYA 1UUSA 5AXIA 2CTNA 3I5GC 1SCVA 4YGAA 3EKJA 1KFUS 3ZWHA 3I5FC 4MRYA 2MAZA 3PN7B 1U5IB 1DF0B 1YVLA 3BUOB 3JVTC 2ZRSA 3EK7A 4OCIA 2BCBA 1XVJA 1S3PA 1FPWA 1LKJA 2R2IA 1DJIA 1PVAA 3A4UB 1A03A 4XJKA 1RROA 3BOWB 3F45A 2LP2A 4F0ZB 4DCKA 1YUSA 1DTLA 1WY9A 1SR6B 4ORBB 5J3XA 4PHKA 4BY4A 2M1KB 2Y4QA 3TUYC 2LANA 2M7LA 2RGIA 1VRKA 1TRFA 2QACA 1OMVA 3TDUA 3WHTB 1TCOB 3VROA 3I5FB 1UHIA 5ER5A 1CLMA 1MUXA 3FIAA 4GFTA 1XFVO 1LXFC 4NDBA 5CSJA 4GBAA 1KSOA 1J1EA 3O4YA 4P2YB 1OQPA 3JVTB 1KK7Y 3DVEA 1LINA 1NCZA 1NP8A 3SG4A 2F33A 1IQ3A 1CM1A 2AAOA 3MSEB 1AP4A 2LHIA 1WLMA 1G33A 5HLOA 1ZOTB 2NCPA 1EH2A 3NSOA 3GK1A 1KWOB 5HKZA 1AHRA 1XFUO 1DMOA 1F8HA 4MRXA 2K0JA 1A75B 4I5KA 1B1GA 3TUYB 2CCMA 2FOTA 1CDLA 1JF2A 1IKUA 4I5NB 1SPYA 3CGAA 3FWBA 2EC6C 2JULA 1V1FA 4I5LB 1TIZA 1F4OA 1QLSA 1G4YR 2NLNA 3KPXA 4YGDB 5CSFA 3BUXB 3IQQA 3BYAA 3OHMB 1BMOA 2GGZA 2Q91A 2CBLA 4M2OA 1A4PA 2K61A 3LL8B 2COLB 1PSRA 2GV5A 1ZFSA 5PALA 1CB1A 1JBAA 2JTZA 1WRKA 4YGCB 1QX7A 1CFDA 2SASA 2BECA 3CWGA 1JFJA 2Y1MA 1KFXS 5AANA 3CS1A 1R6PA 2MRDA 5JOLA 2KAXA 1JFKA 4XJKB 1Y1AA 4OKHA 3H4SE 1XFZO 4YI8A 1AJ4A 2KNEA 2M7NA 3BUMB 1W7IB 2H61A 1J7RA 4N1GA 1QV0A 3CZTX 5ER4X 1IGVA 1R2UA 5D69A 4AQJA 4PE7A 4WQ2A 1WLZA 3DVMA 4QJ5B 2EC6B 1KQVA 1OOJA 3AAJA 1QX5B 4DRWA 4MEWA 1PK0D 1TNQA 2NZ0A 2K7BA 2BBMA 3VRNA 2I94A 1K9KA 2L2EA 2EHBA 2ZNEA 1Q80A 1AVSA 2JRFA 1M39A 2BCAA 3O6BA 1ODBA 1UHNA 1IRJA 1BR4B 2JWWA 3C1VA 1FF1A 3SG3A 4AQIA 1QS7A 2KYCA 1UWOA 2WORA 4HREE 2M8UA 1IH0A 5DKQA 2BE6A 1DJGA 2KFFA 3KO0A 1DJXA 1SL7A 2JT3A 4DS7A 2F8PA 1FI5A 3O2PA 1IJ6A 1D1OA 4JQ0D 1SR6C 2MHHA 2AMIA 1Y0VH 2EGDA 2IS9A 1C07A 1EXRA 3KEVA 2KDHA 4CIDA 2LV7A 1QVIZ 1UHKA 1K8UA 1YUTA 4NDDA 1PALA 4USLA 4ETOA 5I2OA 5K89A 1SYMA 4ORCB 3IF7A 1CM4A 3KHEA 5AERA 2JOJA 2K8MB 5D7FA 1CFPA 2M49B 2ZN9A 2OPOA 1SMGA 3WXAA 5IBWA 1SNLA 1YR5A 2KGBC 1MWNA 1SL9A 2HQ8A 2JNFA 2WC8A 3DD4A 4MBEA 4N1FA 3OB2B 2G2BA 1K90D 1SCMC 1BG1A 4R1EA 2LLUA 4FTGA 1QIVA 2CXJA 2BL0B 2LUXA 1OZSA 3PALA 5FYXA 4UPGA 2JT8A 4ZCVA 1KWOC 1KSMA 1N65A 1F54A 3OP0A 1K9UA 2PRUA 2LMVA 1NWDA 1IWQA 2D8NA 4HRGA 1H8BA 1PSBA 2OTGC 1A2XA 4OR9B 4YGEB 5AFPA 4QJ3B 4PE0A 1BOCA 3OX6A 2JU0A 3VGOA 1J55A 3M0WA 2JQ6A 1DGUA 1EL4A 3GOFA 2E30A 2LNKA 5DKNA 3CLNA 2BKHB 2V53A 3SJSA 1B4CA 2KFGA 2E6WA 2KBIA 5CSNA 3CR5X 4PE1A 3AKBA 2O60A 4A4CA 5F6TA 1KK7Z 1SCMB 1S36A 2Y1NA 3DVKA 3QRXA 1S26D 1DVIA 4HSZA 3OB1B 2FJUB 1AK8A 1GGZA 1KFUL 4MLWA 2K7CA 1JUOA 1S6IA 1L7ZA 1XFYO 5I2LA 3SIAA 1TNXA 2JXLA 4CFRA 4WQ3A 1YUUA 1EG4A 1C7VA 2AUCA 2LUCA 1K2HA 2PALA 3NXAA 1B8CA 3ZNIA 5G08A 1XO5A 5HYDA 2OTGB 1TNPA 3SG7A 1DJWA 1OZOA 1QJTA 2M29A 3I5IB 4C0JA 1NCXA 1Y6WA 1QX2A 1SL8A 3CR2A 1E8AA 5DKRA 3DF0A 1TCFA 1N0YA 2L4IA 4PDZA 1S6JA 3D0YA 1MQ1A 1K96A 1CTRA 3LLEA 5KSZA 5KTYA 1CMGA 2JZIA 2MLFC 2NCOA 1RECA 1SBJA 2L98A 4D1EA 3NSLA 4GGFA 4M2QA 4CFQA 1YX8A 2ZFDA 3D10A 4MZLA 2BBNA 4DIRA 1K94A 1FW4A 1YRUB 2F3ZA 2WOSA 2B1UA 2QPTA 1JSAA 1PRWA 3LCPC 1SRAA 3PLFB 3FWCA 1CFFA 2PASA 2HF5A 2LHLA 3WHUB 1DT7B 1WRLA 1DF0A 1NX0A 1SKTA 2WNDA 4FQOA 4Q04A 2KOTA 4GUKA 5JJGA 1CFCA 5GQQC 1LA0A 2JT0A 2L50A 1QLKA 2KAYA 1S5GZ 1MXLC 1QXPA 2LMUA 3BOWA 3PSRA 4PHNA 3TDIA 1B9AA 1ZMZA 2BKIB 2FCDA 1FI6A 1J7OA 1KCYA 4AOMA 2LLTA 4GNKB 1ZACA 2LVVA 2F2PA 3BUWB 2BL0C 2LCPA 4M2PA 4OV2A 3OX5A 2ZNDA 1A29A 2JTTA 2FCEA 1B8RA 1EJ3A 2LE9B 1UURA 2DOQA 1BF5A 2H61C 2H2KA 1M45A 3PATA 3E3RA 1C7WA 4NQGA 1ALVA 1KQMC 1OE9B 1QV1A 2KYFA 1KK8B 1WDCB 1B7TZ 1OMDA 2CNPA 2HPSA 2WCFA 3BQ3A 3NSIA 1JWDA 5CSIA 2MLEC 3RM1A 1H4BA 3LK0A 3PM8A 3BUNB 4HRHA 5CPVA 5B8IB 1BJFA 3DF0B 1BODA 3SG6A 2SCPA 3DVJA 4ZCUA 4PE4A 3JTDB 3KF9A 1CLLA 1BT6A 2M9GA 3D0YB 1Y1UA 4JWQA 4YBHB 4YRUA 1EG3A 1GGWA 1RTP1 1L2OC 1IQ5A 4PCWA 1A75A 3VRQA 2L51A 2LLSA 2ZN8A 1X02A 1DGVA 2M3WA 2I2RE 2KQYA 1CDMA 1HT9A 1NYAA 1K95A 1QTXA 1NPQA 4L9MA 5I2QA 1QVIY 1F55A 3RLZA 1M46A 1RK9A 2KGRA 2LVJA 1PULA 5HLVA 1WRZA 1M31A 3GK4X 4ORAB 1PVBA 2KHNA 2JNXA 1NX1A 3EVVA 2M97A 4PHMA 1KQMB 4PHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JPZ B;  4MZJ A;  3I5I C;  1F4Q A;  3CTN A;  4WRI A;  2NXQ A;  1NX2 A;  1CLB A;  2PVB A;  4YGB B;  2KI4 B;  2Q4U A;  3TS5 C;  4E68 A;  1CDN A;  1XK4 A;  2KI6 C;  1FBV A;  5HKY A;  2L5X B;  4U8D A;  1ZUZ A;  1MF8 B;  1L2O B;  4MVF A;  2ZKM X;  4GAO A;  1GJY A;  2MA2 A;  1K93 D;  2WCB A;  3TZ1 A;  4TNC A;  1OMR A;  3BXK A;  1B8L A;  2M1U A;  1ALW A;  3PFV A;  2JXC A;  3I5G B;  3A8R A;  1Y1X A;  2OS8 C;  2Y5I A;  4MZK A;  4OVN F;  2VRG A;  1AUI B;  3NSK A;  3SG2 A;  3TDZ A;  1NSH A;  1YVH A;  1JF0 A;  1UHH A;  1IJ5 A;  1UP5 A;  2KI6 D;  1CNP A;  3WNX B;  3LK1 A;  5KU1 A;  2F3Y A;  2LVK A;  3AAK A;  1YTZ C;  4MSP A;  3TS5 B;  2LAP A;  2F2O A;  4XYN A;  2HET A;  4N5X A;  1MHO A;  4MN0 A;  1XK4 C;  2KFH A;  3AKA A;  4A4B A;  1V1G A;  1G8I A;  1MXE A;  1TN4 A;  2GGM A;  3CR4 X;  3EK4 A;  4CPV A;  1JC2 A;  1F71 A;  4C0K A;  5HKW A;  2G9B A;  1W7J B;  3GK2 A;  1N2D A;  4QJ4 B;  3I5H C;  1XYD A;  1F70 A;  4CLN A;  1XFX O;  1YUR A;  1CKK A;  4GPL B;  1RJV A;  2JC2 A;  1DJY A;  2OS8 B;  3VRP A;  2K7D A;  2TN4 A;  3HCM A;  3HX4 A;  2BE4 A;  3ICB A;  2ISD A;  1UHJ A;  3SG5 A;  2LC5 A;  2LMT A;  1U5I A;  1DJH A;  1GQM A;  2MBX A;  4YI9 A;  4IL1 A;  1KK8 C;  1NX3 A;  1WDC C;  3EKH A;  2L4H A;  1BR1 B;  2HQW A;  4I5J A;  1J1D A;  1YRT B;  2ZRT A;  1LA3 A;  2PSR A;  2I7A A;  3K21 A;  4P5O E;  3FS7 A;  5I8N A;  5TNC A;  2BCX A;  1TTX A;  3JTD C;  1J7Q A;  1XA5 A;  2K2F A;  1RFJ A;  4GGF C;  2P6B B;  4GGN A;  1BLQ A;  3EVU A;  2PMY A;  2K7O A;  3I5H B;  1LVC D;  1NIW A;  4PAL A;  1QAS A;  2LP3 A;  1TOP A;  1S6C A;  2WCE A;  1NUB A;  3EVR A;  2CT9 A;  1S5G Y;  1SW8 A;  1TNW A;  3PN7 C;  5AEQ A;  1KFX L;  1MR8 A;  3VRR A;  3EK8 A;  1M63 B;  1SK6 D;  2JPT A;  1NCY A;  1SY9 A;  2LVI A;  1QIW A;  4ICB A;  1CDP A;  4BY5 A;  2KI4 C;  1AJ5 A;  5BPJ A;  2A4J A;  1J7P A;  4NDC A;  3SIB A;  2O5G A;  2K2A A;  1S1E A;  2M0R A;  3O78 A;  2KSP A;  1HQV A;  1B47 A;  1DJZ A;  1YX7 A;  1CMF A;  2MJW B;  2KQ6 A;  1XFW O;  1BU3 A;  4DUQ A;  2L0P A;  2KAV A;  3IQO A;  1QAT A;  1K9P A;  2I18 A;  2KBM A;  2LM5 A;  4C0L A;  1OSA A;  1IG5 A;  1B7T Y;  1RWY A;  1UUS A;  5AXI A;  2CTN A;  3I5G C;  1SCV A;  4YGA A;  3EKJ A;  1KFU S;  3ZWH A;  3I5F C;  4MRY A;  2MAZ A;  3PN7 B;  1U5I B;  1DF0 B;  1YVL A;  3BUO B;  3JVT C;  2ZRS A;  3EK7 A;  4OCI A;  2BCB A;  1XVJ A;  1S3P A;  1FPW A;  1LKJ A;  2R2I A;  1DJI A;  1PVA A;  3A4U B;  1A03 A;  4XJK A;  1RRO A;  3BOW B;  3F45 A;  2LP2 A;  4F0Z B;  4DCK A;  1YUS A;  1DTL A;  1WY9 A;  1SR6 B;  4ORB B;  5J3X A;  4PHK A;  4BY4 A;  2M1K B;  2Y4Q A;  3TUY C;  2LAN A;  2M7L A;  2RGI A;  1VRK A;  1TRF A;  2QAC A;  1OMV A;  3TDU A;  3WHT B;  1TCO B;  3VRO A;  3I5F B;  1UHI A;  5ER5 A;  1CLM A;  1MUX A;  3FIA A;  4GFT A;  1XFV O;  1LXF C;  4NDB A;  5CSJ A;  4GBA A;  1KSO A;  1J1E A;  3O4Y A;  4P2Y B;  1OQP A;  3JVT B;  1KK7 Y;  3DVE A;  1LIN A;  1NCZ A;  1NP8 A;  3SG4 A;  2F33 A;  1IQ3 A;  1CM1 A;  2AAO A;  3MSE B;  1AP4 A;  2LHI A;  1WLM A;  1G33 A;  5HLO A;  1ZOT B;  2NCP A;  1EH2 A;  3NSO A;  3GK1 A;  1KWO B;  5HKZ A;  1AHR A;  1XFU O;  1DMO A;  1F8H A;  4MRX A;  2K0J A;  1A75 B;  4I5K A;  1B1G A;  3TUY B;  2CCM A;  2FOT A;  1CDL A;  1JF2 A;  1IKU A;  4I5N B;  1SPY A;  3CGA A;  3FWB A;  2EC6 C;  2JUL A;  1V1F A;  4I5L B;  1TIZ A;  1F4O A;  1QLS A;  1G4Y R;  2NLN A;  3KPX A;  4YGD B;  5CSF A;  3BUX B;  3IQQ A;  3BYA A;  3OHM B;  1BMO A;  2GGZ A;  2Q91 A;  2CBL A;  4M2O A;  1A4P A;  2K61 A;  3LL8 B;  2COL B;  1PSR A;  2GV5 A;  1ZFS A;  5PAL A;  1CB1 A;  1JBA A;  2JTZ A;  1WRK A;  4YGC B;  1QX7 A;  1CFD A;  2SAS A;  2BEC A;  3CWG A;  1JFJ A;  2Y1M A;  1KFX S;  5AAN A;  3CS1 A;  1R6P A;  2MRD A;  5JOL A;  2KAX A;  1JFK A;  4XJK B;  1Y1A A;  4OKH A;  3H4S E;  1XFZ O;  4YI8 A;  1AJ4 A;  2KNE A;  2M7N A;  3BUM B;  1W7I B;  2H61 A;  1J7R A;  4N1G A;  1QV0 A;  3CZT X;  5ER4 X;  1IGV A;  1R2U A;  5D69 A;  4AQJ A;  4PE7 A;  4WQ2 A;  1WLZ A;  3DVM A;  4QJ5 B;  2EC6 B;  1KQV A;  1OOJ A;  3AAJ A;  1QX5 B;  4DRW A;  4MEW A;  1PK0 D;  1TNQ A;  2NZ0 A;  2K7B A;  2BBM A;  3VRN A;  2I94 A;  1K9K A;  2L2E A;  2EHB A;  2ZNE A;  1Q80 A;  1AVS A;  2JRF A;  1M39 A;  2BCA A;  3O6B A;  1ODB A;  1UHN A;  1IRJ A;  1BR4 B;  2JWW A;  3C1V A;  1FF1 A;  3SG3 A;  4AQI A;  1QS7 A;  2KYC A;  1UWO A;  2WOR A;  4HRE E;  2M8U A;  1IH0 A;  5DKQ A;  2BE6 A;  1DJG A;  2KFF A;  3KO0 A;  1DJX A;  1SL7 A;  2JT3 A;  4DS7 A;  2F8P A;  1FI5 A;  3O2P A;  1IJ6 A;  1D1O A;  4JQ0 D;  1SR6 C;  2MHH A;  2AMI A;  1Y0V H;  2EGD A;  2IS9 A;  1C07 A;  1EXR A;  3KEV A;  2KDH A;  4CID A;  2LV7 A;  1QVI Z;  1UHK A;  1K8U A;  1YUT A;  4NDD A;  1PAL A;  4USL A;  4ETO A;  5I2O A;  5K89 A;  1SYM A;  4ORC B;  3IF7 A;  1CM4 A;  3KHE A;  5AER A;  2JOJ A;  2K8M B;  5D7F A;  1CFP A;  2M49 B;  2ZN9 A;  2OPO A;  1SMG A;  3WXA A;  5IBW A;  1SNL A;  1YR5 A;  2KGB C;  1MWN A;  1SL9 A;  2HQ8 A;  2JNF A;  2WC8 A;  3DD4 A;  4MBE A;  4N1F A;  3OB2 B;  2G2B A;  1K90 D;  1SCM C;  1BG1 A;  4R1E A;  2LLU A;  4FTG A;  1QIV A;  2CXJ A;  2BL0 B;  2LUX A;  1OZS A;  3PAL A;  5FYX A;  4UPG A;  2JT8 A;  4ZCV A;  1KWO C;  1KSM A;  1N65 A;  1F54 A;  3OP0 A;  1K9U A;  2PRU A;  2LMV A;  1NWD A;  1IWQ A;  2D8N A;  4HRG A;  1H8B A;  1PSB A;  2OTG C;  1A2X A;  4OR9 B;  4YGE B;  5AFP A;  4QJ3 B;  4PE0 A;  1BOC A;  3OX6 A;  2JU0 A;  3VGO A;  1J55 A;  3M0W A;  2JQ6 A;  1DGU A;  1EL4 A;  3GOF A;  2E30 A;  2LNK A;  5DKN A;  3CLN A;  2BKH B;  2V53 A;  3SJS A;  1B4C A;  2KFG A;  2E6W A;  2KBI A;  5CSN A;  3CR5 X;  4PE1 A;  3AKB A;  2O60 A;  4A4C A;  5F6T A;  1KK7 Z;  1SCM B;  1S36 A;  2Y1N A;  3DVK A;  3QRX A;  1S26 D;  1DVI A;  4HSZ A;  3OB1 B;  2FJU B;  1AK8 A;  1GGZ A;  1KFU L;  4MLW A;  2K7C A;  1JUO A;  1S6I A;  1L7Z A;  1XFY O;  5I2L A;  3SIA A;  1TNX A;  2JXL A;  4CFR A;  4WQ3 A;  1YUU A;  1EG4 A;  1C7V A;  2AUC A;  2LUC A;  1K2H A;  2PAL A;  3NXA A;  1B8C A;  3ZNI A;  5G08 A;  1XO5 A;  5HYD A;  2OTG B;  1TNP A;  3SG7 A;  1DJW A;  1OZO A;  1QJT A;  2M29 A;  3I5I B;  4C0J A;  1NCX A;  1Y6W A;  1QX2 A;  1SL8 A;  3CR2 A;  1E8A A;  5DKR A;  3DF0 A;  1TCF A;  1N0Y A;  2L4I A;  4PDZ A;  1S6J A;  3D0Y A;  1MQ1 A;  1K96 A;  1CTR A;  3LLE A;  5KSZ A;  5KTY A;  1CMG A;  2JZI A;  2MLF C;  2NCO A;  1REC A;  1SBJ A;  2L98 A;  4D1E A;  3NSL A;  4GGF A;  4M2Q A;  4CFQ A;  1YX8 A;  2ZFD A;  3D10 A;  4MZL A;  2BBN A;  4DIR A;  1K94 A;  1FW4 A;  1YRU B;  2F3Z A;  2WOS A;  2B1U A;  2QPT A;  1JSA A;  1PRW A;  3LCP C;  1SRA A;  3PLF B;  3FWC A;  1CFF A;  2PAS A;  2HF5 A;  2LHL A;  3WHU B;  1DT7 B;  1WRL A;  1DF0 A;  1NX0 A;  1SKT A;  2WND A;  4FQO A;  4Q04 A;  2KOT A;  4GUK A;  5JJG A;  1CFC A;  5GQQ C;  1LA0 A;  2JT0 A;  2L50 A;  1QLK A;  2KAY A;  1S5G Z;  1MXL C;  1QXP A;  2LMU A;  3BOW A;  3PSR A;  4PHN A;  3TDI A;  1B9A A;  1ZMZ A;  2BKI B;  2FCD A;  1FI6 A;  1J7O A;  1KCY A;  4AOM A;  2LLT A;  4GNK B;  1ZAC A;  2LVV A;  2F2P A;  3BUW B;  2BL0 C;  2LCP A;  4M2P A;  4OV2 A;  3OX5 A;  2ZND A;  1A29 A;  2JTT A;  2FCE A;  1B8R A;  1EJ3 A;  2LE9 B;  1UUR A;  2DOQ A;  1BF5 A;  2H61 C;  2H2K A;  1M45 A;  3PAT A;  3E3R A;  1C7W A;  4NQG A;  1ALV A;  1KQM C;  1OE9 B;  1QV1 A;  2KYF A;  1KK8 B;  1WDC B;  1B7T Z;  1OMD A;  2CNP A;  2HPS A;  2WCF A;  3BQ3 A;  3NSI A;  1JWD A;  5CSI A;  2MLE C;  3RM1 A;  1H4B A;  3LK0 A;  3PM8 A;  3BUN B;  4HRH A;  5CPV A;  5B8I B;  1BJF A;  3DF0 B;  1BOD A;  3SG6 A;  2SCP A;  3DVJ A;  4ZCU A;  4PE4 A;  3JTD B;  3KF9 A;  1CLL A;  1BT6 A;  2M9G A;  3D0Y B;  1Y1U A;  4JWQ A;  4YBH B;  4YRU A;  1EG3 A;  1GGW A;  1RTP 1;  1L2O C;  1IQ5 A;  4PCW A;  1A75 A;  3VRQ A;  2L51 A;  2LLS A;  2ZN8 A;  1X02 A;  1DGV A;  2M3W A;  2I2R E;  2KQY A;  1CDM A;  1HT9 A;  1NYA A;  1K95 A;  1QTX A;  1NPQ A;  4L9M A;  5I2Q A;  1QVI Y;  1F55 A;  3RLZ A;  1M46 A;  1RK9 A;  2KGR A;  2LVJ A;  1PUL A;  5HLV A;  1WRZ A;  1M31 A;  3GK4 X;  4ORA B;  1PVB A;  2KHN A;  2JNX A;  1NX1 A;  3EVV A;  2M97 A;  4PHM A;  1KQM B;  4PHJ A; 
#chains in the Genus database with same CATH topology
 4JPZ B;  4MZJ A;  3D78 A;  3I5I C;  1F4Q A;  3CTN A;  4WRI A;  2NXQ A;  4JKT A;  1NX2 A;  1CLB A;  2PVB A;  3L4A A;  2KI4 B;  4YGB B;  2WCL A;  2Q4U A;  3TS5 C;  4E68 A;  1CDN A;  1XK4 A;  2KI6 C;  1FBV A;  5HKY A;  2L5X B;  4U8D A;  3BFB A;  1ZUZ A;  1MF8 B;  1L2O B;  4KYN A;  4MVF A;  2ZKM X;  5HL1 A;  4GAO A;  1GJY A;  2MA2 A;  1K93 D;  2WCB A;  3TZ1 A;  4TNC A;  1OMR A;  3BXK A;  1B8L A;  2M1U A;  1ALW A;  1OOI X;  1TWO A;  3PFV A;  2JXC A;  3I5G B;  3A8R A;  1Y1X A;  2OS8 C;  2Y5I A;  4MZK A;  3N7H A;  2VRG A;  1AUI B;  3NSK A;  4OVN F;  3SG2 A;  3DXL A;  3TDZ A;  1NSH A;  1YVH A;  1JF0 A;  1UHH A;  1IJ5 A;  1UP5 A;  3R1V A;  2KI6 D;  3S0F A;  1CNP A;  2GTE A;  3WNX B;  3LK1 A;  5KU1 A;  3QME A;  2F3Y A;  2LVK A;  3AAK A;  1YTZ C;  4MSP A;  3TS5 B;  2LAP A;  2F2O A;  4XYN A;  2HET A;  4N5X A;  1MHO A;  4MN0 A;  1XK4 C;  2KFH A;  3AKA A;  4A4B A;  1V1G A;  3FE8 A;  1G8I A;  1MXE A;  1TN4 A;  2GGM A;  3CR4 X;  3EK4 A;  4CPV A;  1OW4 A;  1JC2 A;  1F71 A;  4C0K A;  5HKW A;  2G9B A;  1W7J B;  2KPH A;  1N2D A;  3GK2 A;  4QJ4 B;  3I5H C;  1XYD A;  1F70 A;  4CLN A;  1XFX O;  1YUR A;  1CKK A;  1IIO A;  4GPL B;  1RJV A;  2JC2 A;  1DJY A;  2OS8 B;  5DIC A;  3VRP A;  2K7D A;  2TN4 A;  3HCM A;  3HX4 A;  2BE4 A;  3ICB A;  2ISD A;  1UHJ A;  3SG5 A;  2LC5 A;  2LMT A;  1U5I A;  1DJH A;  1GQM A;  2MBX A;  4YI9 A;  4IL1 A;  2KLD A;  1KK8 C;  1NX3 A;  1WDC C;  3EKH A;  3CZ0 A;  2L4H A;  1BR1 B;  3Q8I A;  2HQW A;  4I5J A;  1J1D A;  1YRT B;  2ZRT A;  1DC1 A;  1LA3 A;  2PSR A;  2I7A A;  3K21 A;  4P5O E;  3FS7 A;  3O4X A;  5I8N A;  5TNC A;  2BCX A;  1TTX A;  3JTD C;  1J7Q A;  1XA5 A;  2K2F A;  1RFJ A;  3BFH A;  4GGF C;  2P6B B;  4GGN A;  1BLQ A;  2QEV A;  3EVU A;  2PMY A;  2K7O A;  3I5H B;  1LVC D;  1NIW A;  3L4L A;  4PAL A;  1QAS A;  3B86 A;  2LP3 A;  1TOP A;  5I94 A;  1S6C A;  2WCE A;  1GM0 A;  1NUB A;  3EVR A;  2CT9 A;  4INX A;  1S5G Y;  1SW8 A;  1TNW A;  2WC5 A;  3PN7 C;  5AEQ A;  1KFX L;  1MR8 A;  3VRR A;  3EK8 A;  3B88 A;  1M63 B;  1SK6 D;  2JPT A;  1NCY A;  1SY9 A;  1Z2C B;  2LVI A;  1QIW A;  4ICB A;  1CDP A;  4BY5 A;  2KI4 C;  1AJ5 A;  3IVT A;  5BPJ A;  2A4J A;  1J7P A;  4NDC A;  3SIB A;  2O5G A;  2K2A A;  1S1E A;  2M0R A;  3O78 A;  2KSP A;  1HQV A;  1B47 A;  1DJZ A;  1OOH A;  1YX7 A;  1CMF A;  2JPO A;  2MJW B;  2KQ6 A;  1XFW O;  1BU3 A;  4DUQ A;  2L0P A;  2KAV A;  3IQO A;  1QAT A;  1K9P A;  2I18 A;  2KBM A;  2LM5 A;  4C0L A;  1OSA A;  1IG5 A;  1B7T Y;  1RWY A;  1UUS A;  5AXI A;  2CTN A;  3D77 A;  3I5G C;  1SCV A;  4YGA A;  3EKJ A;  1KFU S;  4F7F A;  3ZWH A;  3I5F C;  4IJ7 A;  2K60 A;  4MRY A;  2MAZ A;  3PN7 B;  1U5I B;  1DF0 B;  1YVL A;  3BUO B;  2WCK A;  2YGU A;  2ZRS A;  3JVT C;  3EK7 A;  4OCI A;  2BCB A;  3RZS A;  1XVJ A;  1S3P A;  1FPW A;  1LKJ A;  2R2I A;  1DJI A;  1PVA A;  3A4U B;  4INW A;  1A03 A;  4XJK A;  1RRO A;  3BOW B;  3F45 A;  2LP2 A;  3L47 A;  4F0Z B;  4DCK A;  1YUS A;  1XFR A;  1DTL A;  1WY9 A;  1SR6 B;  4ORB B;  5J3X A;  4PHK A;  4BY4 A;  2M1K B;  2Y4Q A;  3TUY C;  3PM2 A;  2LAN A;  3UNW A;  2M7L A;  2RGI A;  1VRK A;  5FI2 A;  3DY9 A;  1TRF A;  2QAC A;  1OMV A;  3TDU A;  3WHT B;  1TCO B;  3VRO A;  3I5F B;  1UHI A;  5ER5 A;  1CLM A;  1MUX A;  3FIA A;  4GFT A;  1XFV O;  3S0A A;  1LXF C;  3EG5 B;  4NDB A;  5CSJ A;  4GBA A;  1KSO A;  1J1E A;  2QEH A;  3O4Y A;  4P2Y B;  1OQP A;  3JVT B;  1KK7 Y;  3DVE A;  1LIN A;  1NCZ A;  1NP8 A;  4OZD A;  3SG4 A;  1P28 A;  2F33 A;  1IQ3 A;  1CM1 A;  2AAO A;  3MSE B;  1AP4 A;  2LHI A;  1WLM A;  1G33 A;  5HLO A;  1OOG A;  1ZOT B;  2NCP A;  1EH2 A;  1OOF A;  3NSO A;  3GK1 A;  1KWO B;  5HKZ A;  1AHR A;  1XFU O;  1C3Y A;  1DMO A;  1F8H A;  4MRX A;  2K0J A;  1A75 B;  4I5K A;  1B1G A;  3TUY B;  2QDI A;  2CCM A;  2FOT A;  1CDL A;  1JF2 A;  1DEL A;  1IKU A;  4I5N B;  1SPY A;  3CGA A;  3FWB A;  2EC6 C;  2JUL A;  1V1F A;  4I5L B;  1TIZ A;  1F4O A;  1QLS A;  1G4Y R;  2NLN A;  3KPX A;  4YGD B;  5CSF A;  3BUX B;  3IQQ A;  3BYA A;  3OHM B;  1BMO A;  2GGZ A;  2Q91 A;  2CBL A;  4M2O A;  3S0G A;  3VB1 A;  1A4P A;  2K61 A;  3LL8 B;  2COL B;  1PSR A;  2GV5 A;  1ZFS A;  5PAL A;  1CB1 A;  1JBA A;  2JTZ A;  1WRK A;  4YGC B;  1QX7 A;  1CFD A;  2SAS A;  2BEC A;  3CWG A;  1JFJ A;  2Y1M A;  1KFX S;  5AAN A;  3CS1 A;  1R6P A;  2MRD A;  5JOL A;  2KAX A;  1JFK A;  4XJK B;  1Y1A A;  2KLE A;  4OKH A;  3DZT A;  3H4S E;  1XFZ O;  4YI8 A;  1AJ4 A;  2KNE A;  2M7N A;  3BUM B;  1W7I B;  2H61 A;  1J7R A;  4N1G A;  1QV0 A;  3CZT X;  5ER4 X;  1IGV A;  1R2U A;  5D69 A;  4AQJ A;  3V2L A;  2WC6 A;  4PE7 A;  3TDI A;  4WQ2 A;  1WLZ A;  3DVM A;  2L5Y A;  2EC6 B;  4QJ5 B;  4PT1 A;  1OOJ A;  1KQV A;  1DQE A;  3AAJ A;  1QX5 B;  3NHT A;  4MEW A;  4DRW A;  1PK0 D;  1TNQ A;  2NZ0 A;  2K7B A;  2BBM A;  3VRN A;  2I94 A;  1K9K A;  2L2E A;  2EHB A;  2ZNE A;  1Q80 A;  1AVS A;  2JRF A;  1M39 A;  2BCA A;  3O6B A;  1ODB A;  1UHN A;  1IRJ A;  1BR4 B;  2JWW A;  3C1V A;  1FF1 A;  3SG3 A;  4AQI A;  1QS7 A;  2KYC A;  1UWO A;  2WOR A;  4HRE E;  3S0E A;  2M8U A;  2BNX A;  1IH0 A;  3CAB A;  5DKQ A;  2BE6 A;  1DJG A;  2KFF A;  3KO0 A;  3UO9 A;  1DJX A;  2WCM A;  1SL7 A;  2JT3 A;  4DS7 A;  2F8P A;  1FI5 A;  2WCH A;  3O2P A;  1IJ6 A;  1D1O A;  4JQ0 D;  1SR6 C;  2MHH A;  2AMI A;  1Y0V H;  2EGD A;  2IS9 A;  1C07 A;  1EXR A;  3KEV A;  2KDH A;  4CID A;  2LV7 A;  1QVI Z;  1UHK A;  1K8U A;  1YUT A;  3K1E A;  4NDD A;  1PAL A;  4USL A;  4ETO A;  5I2O A;  5K89 A;  1SYM A;  4ORC B;  3IF7 A;  1ORG A;  1CM4 A;  3KHE A;  5AER A;  2JOJ A;  2K8M B;  5D7F A;  1CFP A;  2M49 B;  2H8V A;  2ZN9 A;  3BJH A;  3OBV A;  2OPO A;  1SMG A;  3WXA A;  5IBW A;  1SNL A;  1YR5 A;  2KGB C;  1MWN A;  1SL9 A;  2HQ8 A;  2JNF A;  2WC8 A;  3DD4 A;  4MBE A;  4N1F A;  3BFA A;  3OB2 B;  3SS3 A;  2G2B A;  1K90 D;  1SCM C;  1BG1 A;  4R1E A;  2LLU A;  4FTG A;  1QIV A;  2CXJ A;  2BL0 B;  2LUX A;  1OZS A;  3PAL A;  3OGN A;  2PYQ A;  5FYX A;  2BAP A;  4UPG A;  2JT8 A;  3R1P A;  4ZCV A;  1KWO C;  1KSM A;  1N65 A;  1F54 A;  3OP0 A;  1K9U A;  2PRU A;  2LMV A;  1NWD A;  1IWQ A;  2D8N A;  4HRG A;  1SSE B;  3FE6 A;  3NHI A;  1H8B A;  1PSB A;  2OTG C;  2ERB A;  1A2X A;  4OR9 B;  4YGE B;  5AFP A;  4QJ3 B;  4PE0 A;  3CDN A;  1BOC A;  3OX6 A;  3B6X A;  2JU0 A;  3VGO A;  3D75 A;  1J55 A;  3M0W A;  2JQ6 A;  1DGU A;  1EL4 A;  3GOF A;  2E30 A;  2LNK A;  5DKN A;  1T14 A;  3CLN A;  2BKH B;  2V53 A;  3SJS A;  1B4C A;  2KFG A;  2E6W A;  2KBI A;  5CSN A;  3CR5 X;  4PE1 A;  3AKB A;  2O60 A;  4A4C A;  5F6T A;  1KK7 Z;  1SCM B;  1S36 A;  2Y1N A;  3DVK A;  3QRX A;  1S26 D;  1DVI A;  3B7A A;  3NGV A;  3OB1 B;  4HSZ A;  2FJU B;  1AK8 A;  1GGZ A;  1KFU L;  4MLW A;  2K7C A;  1JUO A;  1S6I A;  1L7Z A;  1XFY O;  5I2L A;  3SIA A;  1TNX A;  2JXL A;  4CFR A;  4WQ3 A;  3SS4 A;  1YUU A;  1Z4H A;  1EG4 A;  1C7V A;  2AUC A;  2LUC A;  1K2H A;  2PAL A;  3NXA A;  3D74 A;  1B8C A;  3ZNI A;  5G08 A;  1XO5 A;  5HYD A;  1TUJ A;  2OTG B;  1TNP A;  3SG7 A;  1DJW A;  1OZO A;  1QJT A;  2M29 A;  3I5I B;  4C0J A;  1NCX A;  1Y6W A;  1QX2 A;  1SL8 A;  3S0D A;  2L2C A;  3CR2 A;  1E8A A;  5DKR A;  4FQT A;  3DF0 A;  1TCF A;  1N0Y A;  2L4I A;  4PDZ A;  1S6J A;  3D0Y A;  1MQ1 A;  1K96 A;  1CTR A;  3LLE A;  5KSZ A;  5KTY A;  2QEB A;  1CMG A;  2JZI A;  2MLF C;  2NCO A;  1REC A;  1SBJ A;  2L98 A;  4D1E A;  3NSL A;  4GGF A;  4M2Q A;  4CFQ A;  1YX8 A;  2ZFD A;  1TUZ A;  3D10 A;  5FI6 A;  3SS5 A;  3CZ1 A;  3FE9 A;  4MZL A;  2BBN A;  5D3O A;  1K94 A;  4DIR A;  2QEO A;  1FW4 A;  1YRU B;  2F3Z A;  2WOS A;  2B1U A;  2QPT A;  1JSA A;  1PRW A;  3LCP C;  1SRA A;  3PJI A;  3FWC A;  3PLF B;  1CFF A;  2PAS A;  2HF5 A;  3B87 A;  2LHL A;  3WHU B;  1DT7 B;  1WRL A;  1DF0 A;  1NX0 A;  3S0B A;  1SKT A;  2WND A;  4FQO A;  4Q04 A;  2KOT A;  4GUK A;  5JJG A;  1CFC A;  1DEK A;  5GQQ C;  1LA0 A;  5FI7 A;  2JT0 A;  2L50 A;  1QLK A;  2KAY A;  1S5G Z;  1MXL C;  1QXP A;  2LMU A;  3BOW A;  3CZ2 A;  3PSR A;  4PHN A;  1B9A A;  1ZMZ A;  2BKI B;  2FCD A;  1FI6 A;  1J7O A;  1KCY A;  4AOM A;  2LLT A;  4GNK B;  1C3Z A;  1ZAC A;  2FJY A;  2LVV A;  3CYZ A;  3DYE A;  2F2P A;  3R1O A;  3BUW B;  2BL0 C;  2LCP A;  4M2P A;  4OV2 A;  3OX5 A;  4JD9 A;  2ZND A;  1A29 A;  2JTT A;  1KQM B;  2FCE A;  1B8R A;  1EJ3 A;  2LE9 B;  1UUR A;  2DOQ A;  1BF5 A;  2H61 C;  2H2K A;  1M45 A;  3PAT A;  3E3R A;  1C7W A;  4NQG A;  2P71 A;  1ALV A;  1KQM C;  1OE9 B;  1QV1 A;  2KYF A;  1KK8 B;  1WDC B;  3D73 A;  1B7T Z;  1OMD A;  2CNP A;  2HPS A;  2WCF A;  3BQ3 A;  3NSI A;  5EL2 A;  5CSI A;  1JWD A;  2MLE C;  3RM1 A;  1H4B A;  3LK0 A;  3PM8 A;  3BUN B;  4HRH A;  5CPV A;  5B8I B;  2P70 A;  1BJF A;  3DF0 B;  1BOD A;  1W9Z A;  3SG6 A;  2SCP A;  3DVJ A;  4ZCU A;  4PE4 A;  3JTD B;  3KF9 A;  1CLL A;  1BT6 A;  2M9G A;  3D0Y B;  1Y1U A;  4JWQ A;  4YBH B;  4YRU A;  1EG3 A;  1GGW A;  1RTP 1;  1L2O C;  1IQ5 A;  4PCW A;  1A75 A;  3VRQ A;  2L51 A;  2LLS A;  2ZN8 A;  1X02 A;  1DGV A;  2M3W A;  2I2R E;  2KQY A;  1CDM A;  1HT9 A;  1NYA A;  1K95 A;  1QTX A;  1NPQ A;  3D76 A;  4L9M A;  1QVI Y;  5I2Q A;  3RLZ A;  1F55 A;  1M46 A;  1QWV A;  1RK9 A;  2PQL A;  2KGR A;  2LVJ A;  1PUL A;  5HLV A;  1WRZ A;  1M31 A;  3GK4 X;  3R72 A;  1PVB A;  4ORA B;  2WCJ A;  2KHN A;  2JNX A;  1NX1 A;  3EVV A;  2M97 A;  4PHM A;  1LS8 A;  4PHJ A; 
#chains in the Genus database with same CATH homology
 4JPZ B;  4MZJ A;  3I5I C;  1F4Q A;  3CTN A;  4WRI A;  2NXQ A;  1NX2 A;  1CLB A;  2PVB A;  4YGB B;  2KI4 B;  2Q4U A;  3TS5 C;  4E68 A;  1CDN A;  1XK4 A;  2KI6 C;  1FBV A;  5HKY A;  2L5X B;  4U8D A;  1ZUZ A;  1MF8 B;  1L2O B;  4MVF A;  2ZKM X;  4GAO A;  1GJY A;  2MA2 A;  1K93 D;  2WCB A;  3TZ1 A;  4TNC A;  1OMR A;  3BXK A;  1B8L A;  2M1U A;  1ALW A;  3PFV A;  2JXC A;  3I5G B;  3A8R A;  1Y1X A;  2OS8 C;  2Y5I A;  4MZK A;  4OVN F;  2VRG A;  1AUI B;  3NSK A;  3SG2 A;  3TDZ A;  1NSH A;  1YVH A;  1JF0 A;  1UHH A;  1IJ5 A;  1UP5 A;  2KI6 D;  1CNP A;  3WNX B;  3LK1 A;  5KU1 A;  2F3Y A;  2LVK A;  3AAK A;  1YTZ C;  4MSP A;  3TS5 B;  2LAP A;  2F2O A;  4XYN A;  2HET A;  4N5X A;  1MHO A;  4MN0 A;  1XK4 C;  2KFH A;  3AKA A;  4A4B A;  1V1G A;  1G8I A;  1MXE A;  1TN4 A;  2GGM A;  3CR4 X;  3EK4 A;  4CPV A;  1JC2 A;  1F71 A;  4C0K A;  5HKW A;  2G9B A;  1W7J B;  3GK2 A;  1N2D A;  4QJ4 B;  3I5H C;  1XYD A;  1F70 A;  4CLN A;  1XFX O;  1YUR A;  1CKK A;  4GPL B;  1RJV A;  2JC2 A;  1DJY A;  2OS8 B;  3VRP A;  2K7D A;  2TN4 A;  3HCM A;  3HX4 A;  2BE4 A;  3ICB A;  2ISD A;  1UHJ A;  3SG5 A;  2LC5 A;  2LMT A;  1U5I A;  1DJH A;  1GQM A;  2MBX A;  4YI9 A;  4IL1 A;  1KK8 C;  1NX3 A;  1WDC C;  3EKH A;  2L4H A;  1BR1 B;  2HQW A;  4I5J A;  1J1D A;  1YRT B;  2ZRT A;  1LA3 A;  2PSR A;  2I7A A;  3K21 A;  4P5O E;  3FS7 A;  5I8N A;  5TNC A;  2BCX A;  1TTX A;  3JTD C;  1J7Q A;  1XA5 A;  2K2F A;  1RFJ A;  4GGF C;  2P6B B;  4GGN A;  1BLQ A;  3EVU A;  2PMY A;  2K7O A;  3I5H B;  1LVC D;  1NIW A;  4PAL A;  1QAS A;  2LP3 A;  1TOP A;  1S6C A;  2WCE A;  1NUB A;  3EVR A;  2CT9 A;  1S5G Y;  1SW8 A;  1TNW A;  3PN7 C;  5AEQ A;  1KFX L;  1MR8 A;  3VRR A;  3EK8 A;  1M63 B;  1SK6 D;  2JPT A;  1NCY A;  1SY9 A;  2LVI A;  1QIW A;  4ICB A;  1CDP A;  4BY5 A;  2KI4 C;  1AJ5 A;  5BPJ A;  2A4J A;  1J7P A;  4NDC A;  3SIB A;  2O5G A;  2K2A A;  1S1E A;  2M0R A;  3O78 A;  2KSP A;  1HQV A;  1B47 A;  1DJZ A;  1YX7 A;  1CMF A;  2MJW B;  2KQ6 A;  1XFW O;  1BU3 A;  4DUQ A;  2L0P A;  2KAV A;  3IQO A;  1QAT A;  1K9P A;  2I18 A;  2KBM A;  2LM5 A;  4C0L A;  1OSA A;  1IG5 A;  1B7T Y;  1RWY A;  1UUS A;  5AXI A;  2CTN A;  3I5G C;  1SCV A;  4YGA A;  3EKJ A;  1KFU S;  3ZWH A;  3I5F C;  4MRY A;  2MAZ A;  3PN7 B;  1U5I B;  1DF0 B;  1YVL A;  3BUO B;  3JVT C;  2ZRS A;  3EK7 A;  4OCI A;  2BCB A;  1XVJ A;  1S3P A;  1FPW A;  1LKJ A;  2R2I A;  1DJI A;  1PVA A;  3A4U B;  1A03 A;  4XJK A;  1RRO A;  3BOW B;  3F45 A;  2LP2 A;  4F0Z B;  4DCK A;  1YUS A;  1DTL A;  1WY9 A;  1SR6 B;  4ORB B;  5J3X A;  4PHK A;  4BY4 A;  2M1K B;  2Y4Q A;  3TUY C;  2LAN A;  2M7L A;  2RGI A;  1VRK A;  1TRF A;  2QAC A;  1OMV A;  3TDU A;  3WHT B;  1TCO B;  3VRO A;  3I5F B;  1UHI A;  5ER5 A;  1CLM A;  1MUX A;  3FIA A;  4GFT A;  1XFV O;  1LXF C;  4NDB A;  5CSJ A;  4GBA A;  1KSO A;  1J1E A;  3O4Y A;  4P2Y B;  1OQP A;  3JVT B;  1KK7 Y;  3DVE A;  1LIN A;  1NCZ A;  1NP8 A;  3SG4 A;  2F33 A;  1IQ3 A;  1CM1 A;  2AAO A;  3MSE B;  1AP4 A;  2LHI A;  1WLM A;  1G33 A;  5HLO A;  1ZOT B;  2NCP A;  1EH2 A;  3NSO A;  3GK1 A;  1KWO B;  5HKZ A;  1AHR A;  1XFU O;  1DMO A;  1F8H A;  4MRX A;  2K0J A;  1A75 B;  4I5K A;  1B1G A;  3TUY B;  2CCM A;  2FOT A;  1CDL A;  1JF2 A;  1IKU A;  4I5N B;  1SPY A;  3CGA A;  3FWB A;  2EC6 C;  2JUL A;  1V1F A;  4I5L B;  1TIZ A;  1F4O A;  1QLS A;  1G4Y R;  2NLN A;  3KPX A;  4YGD B;  5CSF A;  3BUX B;  3IQQ A;  3BYA A;  3OHM B;  1BMO A;  2GGZ A;  2Q91 A;  2CBL A;  4M2O A;  1A4P A;  2K61 A;  3LL8 B;  2COL B;  1PSR A;  2GV5 A;  1ZFS A;  5PAL A;  1CB1 A;  1JBA A;  2JTZ A;  1WRK A;  4YGC B;  1QX7 A;  1CFD A;  2SAS A;  2BEC A;  3CWG A;  1JFJ A;  2Y1M A;  1KFX S;  5AAN A;  3CS1 A;  1R6P A;  2MRD A;  5JOL A;  2KAX A;  1JFK A;  4XJK B;  1Y1A A;  4OKH A;  3H4S E;  1XFZ O;  4YI8 A;  1AJ4 A;  2KNE A;  2M7N A;  3BUM B;  1W7I B;  2H61 A;  1J7R A;  4N1G A;  1QV0 A;  3CZT X;  5ER4 X;  1IGV A;  1R2U A;  5D69 A;  4AQJ A;  4PE7 A;  4WQ2 A;  1WLZ A;  3DVM A;  4QJ5 B;  2EC6 B;  1KQV A;  1OOJ A;  3AAJ A;  1QX5 B;  4DRW A;  4MEW A;  1PK0 D;  1TNQ A;  2NZ0 A;  2K7B A;  2BBM A;  3VRN A;  2I94 A;  1K9K A;  2L2E A;  2EHB A;  2ZNE A;  1Q80 A;  1AVS A;  2JRF A;  1M39 A;  2BCA A;  3O6B A;  1ODB A;  1UHN A;  1IRJ A;  1BR4 B;  2JWW A;  3C1V A;  1FF1 A;  3SG3 A;  4AQI A;  1QS7 A;  2KYC A;  1UWO A;  2WOR A;  4HRE E;  2M8U A;  1IH0 A;  5DKQ A;  2BE6 A;  1DJG A;  2KFF A;  3KO0 A;  1DJX A;  1SL7 A;  2JT3 A;  4DS7 A;  2F8P A;  1FI5 A;  3O2P A;  1IJ6 A;  1D1O A;  4JQ0 D;  1SR6 C;  2MHH A;  2AMI A;  1Y0V H;  2EGD A;  2IS9 A;  1C07 A;  1EXR A;  3KEV A;  2KDH A;  4CID A;  2LV7 A;  1QVI Z;  1UHK A;  1K8U A;  1YUT A;  4NDD A;  1PAL A;  4USL A;  4ETO A;  5I2O A;  5K89 A;  1SYM A;  4ORC B;  3IF7 A;  1CM4 A;  3KHE A;  5AER A;  2JOJ A;  2K8M B;  5D7F A;  1CFP A;  2M49 B;  2ZN9 A;  2OPO A;  1SMG A;  3WXA A;  5IBW A;  1SNL A;  1YR5 A;  2KGB C;  1MWN A;  1SL9 A;  2HQ8 A;  2JNF A;  2WC8 A;  3DD4 A;  4MBE A;  4N1F A;  3OB2 B;  2G2B A;  1K90 D;  1SCM C;  1BG1 A;  4R1E A;  2LLU A;  4FTG A;  1QIV A;  2CXJ A;  2BL0 B;  2LUX A;  1OZS A;  3PAL A;  5FYX A;  4UPG A;  2JT8 A;  4ZCV A;  1KWO C;  1KSM A;  1N65 A;  1F54 A;  3OP0 A;  1K9U A;  2PRU A;  2LMV A;  1NWD A;  1IWQ A;  2D8N A;  4HRG A;  1H8B A;  1PSB A;  2OTG C;  1A2X A;  4OR9 B;  4YGE B;  5AFP A;  4QJ3 B;  4PE0 A;  1BOC A;  3OX6 A;  2JU0 A;  3VGO A;  1J55 A;  3M0W A;  2JQ6 A;  1DGU A;  1EL4 A;  3GOF A;  2E30 A;  2LNK A;  5DKN A;  3CLN A;  2BKH B;  2V53 A;  3SJS A;  1B4C A;  2KFG A;  2E6W A;  2KBI A;  5CSN A;  3CR5 X;  4PE1 A;  3AKB A;  2O60 A;  4A4C A;  5F6T A;  1KK7 Z;  1SCM B;  1S36 A;  2Y1N A;  3DVK A;  3QRX A;  1S26 D;  1DVI A;  4HSZ A;  3OB1 B;  2FJU B;  1AK8 A;  1GGZ A;  1KFU L;  4MLW A;  2K7C A;  1JUO A;  1S6I A;  1L7Z A;  1XFY O;  5I2L A;  3SIA A;  1TNX A;  2JXL A;  4CFR A;  4WQ3 A;  1YUU A;  1EG4 A;  1C7V A;  2AUC A;  2LUC A;  1K2H A;  2PAL A;  3NXA A;  1B8C A;  3ZNI A;  5G08 A;  1XO5 A;  5HYD A;  2OTG B;  1TNP A;  3SG7 A;  1DJW A;  1OZO A;  1QJT A;  2M29 A;  3I5I B;  4C0J A;  1NCX A;  1Y6W A;  1QX2 A;  1SL8 A;  3CR2 A;  1E8A A;  5DKR A;  3DF0 A;  1TCF A;  1N0Y A;  2L4I A;  4PDZ A;  1S6J A;  3D0Y A;  1MQ1 A;  1K96 A;  1CTR A;  3LLE A;  5KSZ A;  5KTY A;  1CMG A;  2JZI A;  2MLF C;  2NCO A;  1REC A;  1SBJ A;  2L98 A;  4D1E A;  3NSL A;  4GGF A;  4M2Q A;  4CFQ A;  1YX8 A;  2ZFD A;  3D10 A;  4MZL A;  2BBN A;  4DIR A;  1K94 A;  1FW4 A;  1YRU B;  2F3Z A;  2WOS A;  2B1U A;  2QPT A;  1JSA A;  1PRW A;  3LCP C;  1SRA A;  3PLF B;  3FWC A;  1CFF A;  2PAS A;  2HF5 A;  2LHL A;  3WHU B;  1DT7 B;  1WRL A;  1DF0 A;  1NX0 A;  1SKT A;  2WND A;  4FQO A;  4Q04 A;  2KOT A;  4GUK A;  5JJG A;  1CFC A;  5GQQ C;  1LA0 A;  2JT0 A;  2L50 A;  1QLK A;  2KAY A;  1S5G Z;  1MXL C;  1QXP A;  2LMU A;  3BOW A;  3PSR A;  4PHN A;  3TDI A;  1B9A A;  1ZMZ A;  2BKI B;  2FCD A;  1FI6 A;  1J7O A;  1KCY A;  4AOM A;  2LLT A;  4GNK B;  1ZAC A;  2LVV A;  2F2P A;  3BUW B;  2BL0 C;  2LCP A;  4M2P A;  4OV2 A;  3OX5 A;  2ZND A;  1A29 A;  2JTT A;  2FCE A;  1B8R A;  1EJ3 A;  2LE9 B;  1UUR A;  2DOQ A;  1BF5 A;  2H61 C;  2H2K A;  1M45 A;  3PAT A;  3E3R A;  1C7W A;  4NQG A;  1ALV A;  1KQM C;  1OE9 B;  1QV1 A;  2KYF A;  1KK8 B;  1WDC B;  1B7T Z;  1OMD A;  2CNP A;  2HPS A;  2WCF A;  3BQ3 A;  3NSI A;  1JWD A;  5CSI A;  2MLE C;  3RM1 A;  1H4B A;  3LK0 A;  3PM8 A;  3BUN B;  4HRH A;  5CPV A;  5B8I B;  1BJF A;  3DF0 B;  1BOD A;  3SG6 A;  2SCP A;  3DVJ A;  4ZCU A;  4PE4 A;  3JTD B;  3KF9 A;  1CLL A;  1BT6 A;  2M9G A;  3D0Y B;  1Y1U A;  4JWQ A;  4YBH B;  4YRU A;  1EG3 A;  1GGW A;  1RTP 1;  1L2O C;  1IQ5 A;  4PCW A;  1A75 A;  3VRQ A;  2L51 A;  2LLS A;  2ZN8 A;  1X02 A;  1DGV A;  2M3W A;  2I2R E;  2KQY A;  1CDM A;  1HT9 A;  1NYA A;  1K95 A;  1QTX A;  1NPQ A;  4L9M A;  5I2Q A;  1QVI Y;  1F55 A;  3RLZ A;  1M46 A;  1RK9 A;  2KGR A;  2LVJ A;  1PUL A;  5HLV A;  1WRZ A;  1M31 A;  3GK4 X;  4ORA B;  1PVB A;  2KHN A;  2JNX A;  1NX1 A;  3EVV A;  2M97 A;  4PHM A;  1KQM B;  4PHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...