1XFXO

Crystal structure of anthrax edema factor (ef) in complex with calmodulin in the presence of 10 millimolar exogenously added calcium chloride
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
146
structure length
146
Chain Sequence
QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDQMIREADIDGDGQVNYEEFVQMMTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Calcium-independent calmodulin binding and two-metal-ion catalytic mechanism of anthrax edema factor.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Lyase/metal binding protein
molecule keywords Calmodulin-sensitive adenylate cyclase
total genus 33
structure length 146
sequence length 146
chains with identical sequence P, Q, R, S, T
ec nomenclature
pdb deposition date 2004-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xfxO01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xfxO02
5I2OA 2JNXA 4M2QA 5ER4X 1XFXO 1UP5A 1CTRA 1JFKA 5B8IB 4PHMA 1F71A 4DS7A 1DJYA 1QLKA 3LCPC 2KYFA 1MWNA 2Y4QA 4MVFA 3SIAA 2ZRTA 4MRYA 2MJWB 4CIDA 1JF0A 4AQJA 1S5GZ 2K8MB 2GV5A 1KK7Z 1TNPA 1Y6WA 1WRLA 2JXCA 3GK1A 1UHKA 4PDZA 1B8CA 3GOFA 4PHNA 1F4QA 2KFHA 2M9GA 2ZN8A 2OS8B 4WQ3A 4HSZA 2PSRA 1F54A 2L98A 1SPYA 1QTXA 1QXPA 3SG5A 3NXAA 1SCMB 4DIRA 4E68A 1DMOA 1ZFSA 4GGFA 1AJ4A 1MF8B 1Y1UA 1LA0A 1OMVA 2JU0A 2LC5A 3NSOA 3WHTB 1UHNA 1RWYA 2ZNEA 2O5GA 3JTDB 4WRIA 1GGWA 2LUCA 3I5GB 1ZACA 2LLTA 1WLZA 4OV2A 2NLNA 2OS8C 2JQ6A 3EK7A 2BECA 5DKNA 3C1VA 4IL1A 4YI9A 1DT7B 1SY9A 3BUMB 4PALA 2CBLA 3BUOB 1NYAA 1RECA 3CR2A 3EK8A 3EVRA 3BUNB 3I5GC 4PE7A 4NDBA 3SIBA 1C7WA 1YUSA 1K94A 3JTDC 1F55A 3CWGA 1YRTB 2WOSA 4JPZB 2E30A 1SRAA 4XYNA 1XYDA 2BE4A 3SG6A 1KFXS 1QS7A 4HRGA 4OCIA 1XFVO 1CFPA 1GGZA 2NCPA 3CS1A 3M0WA 2K2AA 1CKKA 4GNKB 2F2PA 1CM4A 1ODBA 2JOJA 2KAYA 4F0ZB 3OHMB 2WNDA 2CCMA 2M1UA 3IQOA 5AERA 1TNQA 1SNLA 1TTXA 2WCEA 1XO5A 1TN4A 3CR5X 2ZN9A 3D0YA 1QLSA 2ZNDA 1QV1A 3ZWHA 2JC2A 4ORAB 4PCWA 1UUSA 3FIAA 3SG3A 1SKTA 3TDUA 3RM1A 4YRUA 1XFZO 3TUYC 3DD4A 2JULA 2FOTA 1J7PA 1H4BA 2FCDA 1KK8B 1YVLA 2AAOA 2E6WA 1NPQA 1CNPA 4PHKA 1A29A 5ER5A 1YUUA 4GUKA 2K7OA 5AFPA 3PATA 5AXIA 1IGVA 3VRRA 1B8LA 1X02A 3RLZA 1LA3A 1L7ZA 1H8BA 1FPWA 1DF0B 4NDDA 1B47A 1KFUS 1LKJA 1LXFC 1TRFA 3TS5B 1BG1A 2L2EA 1SCMC 5BPJA 2EC6B 1F4OA 3FS7A 5HKZA 1MHOA 1QVIZ 1IRJA 3DVKA 3FWCA 2JTZA 4DUQA 2BBNA 2LUXA 3PALA 1QV0A 1XK4A 3K21A 2LANA 1Y0VH 2NCOA 1CM1A 1J1EA 2BCAA 2F33A 2M49B 2FCEA 2M3WA 2WC8A 2MLEC 3VRPA 1NCXA 4YGAA 1GJYA 1W7IB 3DF0A 3LL8B 1DGUA 2JXLA 3O6BA 1S6IA 4MBEA 5KU1A 1TCFA 2KYCA 2K7BA 1IG5A 3OP0A 1QX2A 4QJ4B 2NXQA 4HREE 1K8UA 4C0JA 1A75A 4BY5A 1BODA 1SW8A 5CSNA 1CDLA 1YUTA 1BU3A 2L4IA 3HX4A 1SR6C 4D1EA 4N1GA 2L50A 1U5IA 1G8IA 3EVUA 2HETA 1K2HA 3I5IB 5J3XA 1UHJA 3O4YA 1EG3A 3BUWB 1EH2A 1QX5B 4ZCVA 1S26D 2L5XB 2OPOA 5HKWA 4MZLA 1KWOB 1KQVA 1J7RA 1QX7A 2LCPA 4R1EA 4ETOA 1TOPA 1QASA 2KQ6A 4GBAA 1RROA 2HPSA 2Y1MA 3NSIA 4PHJA 2JPTA 2KI6D 3CTNA 1CFDA 3ZNIA 2PASA 1V1FA 5DKQA 1PRWA 5CPVA 2I7AA 1HT9A 4CPVA 1UURA 3TUYB 1QIWA 2JNFA 3LK1A 2CNPA 2KI4C 3OX6A 1K9UA 2NZ0A 5IBWA 1E8AA 3OB1B 1JBAA 4USLA 2KBIA 1B1GA 5KTYA 1YX7A 2LVVA 1CMGA 1K93D 1XA5A 3D10A 2KHNA 3TS5C 1OE9B 3PFVA 1FI5A 1V1GA 3EKHA 5DKRA 1R2UA 2EC6C 2KI6C 1XVJA 2L0PA 1FBVA 1UHHA 4MZKA 3O78A 3CLNA 1NUBA 1KK8C 3HCMA 5HLOA 1K96A 2K7CA 2LAPA 1S3PA 4DCKA 2IS9A 4JWQA 4ORCB 1S1EA 1BOCA 5CSJA 1N0YA 4HRHA 4MN0A 2WORA 1D1OA 4CLNA 2JTTA 4NQGA 1ZUZA 5JJGA 1PULA 1KFXL 1YX8A 1PVAA 1LINA 1JWDA 4DRWA 2A4JA 1RJVA 2JRFA 1S6CA 4P5OE 3KF9A 1FW4A 4PE1A 5I2QA 1KFUL 3I5FC 4ORBB 2BKIB 2V53A 1RK9A 3IQQA 4YGBB 1YR5A 2HQ8A 2WCFA 2WCBA 4NDCA 2Q91A 5GQQC 1JFJA 4AOMA 2L51A 2PMYA 1KQMC 1K9PA 2ZRSA 2M0RA 4C0KA 1AJ5A 1QATA 4YGEB 2CTNA 2OTGC 1YTZC 3AAKA 5G08A 2KAVA 1QIVA 1ZOTB 2BKHB 1MR8A 4M2OA 2LVJA 4CFRA 2KGBC 1F8HA 1YRUB 4P2YB 4YI8A 3CGAA 4UPGA 5AEQA 2ISDA 1OSAA 1A4PA 5FYXA 2AMIA 5JOLA 3E3RA 1CFCA 3KEVA 1NWDA 2GGMA 3PSRA 4FQOA 2JT3A 1KSOA 2M29A 4MEWA 1UHIA 3SG4A 1B7TY 4MRXA 2LLUA 1U5IB 2KFGA 2LV7A 5D7FA 2ZFDA 2LMVA 4ZCUA 2M7NA 2JWWA 4M2PA 2H2KA 2MBXA 2H61A 1DVIA 1ZMZA 2B1UA 3VROA 2MHHA 3BXKA 2LE9B 1TNWA 5HYDA 1RFJA 3CR4X 3OX5A 2KI4B 2SCPA 2ZKMX 2LVKA 3SG7A 3GK4X 1C07A 2MA2A 3FWBA 4I5KA 4GAOA 4C0LA 1CFFA 4XJKA 3TDIA 1AVSA 1NX1A 2QPTA 3BOWA 2K0JA 1J7QA 2LP3A 4YGDB 2TN4A 1A2XA 1BJFA 4PE4A 3AKAA 2M1KB 1A03A 4PE0A 1AHRA 1SL7A 1XFYO 3I5HB 2M7LA 1SK6D 1OZOA 1WDCB 4N1FA 1IQ3A 1FF1A 1KWOC 2F3ZA 1RTP1 3KPXA 1DJIA 1DJZA 1EXRA 3I5FB 2LLSA 2MAZA 1SCVA 1B9AA 3BYAA 4YBHB 2KOTA 2M8UA 1TIZA 1KSMA 4GPLB 1LVCD 1K90D 2K7DA 3A8RA 1CB1A 1JSAA 2I2RE 1J7OA 1GQMA 1AP4A 1PALA 3TZ1A 1WY9A 2VRGA 1B7TZ 3VRNA 1M63B 1F70A 3KO0A 2L4HA 2K61A 1PVBA 2JT8A 1DGVA 1SR6B 3PN7C 1MQ1A 2Y1NA 1TNXA 3LLEA 1EJ3A 4CFQA 4A4BA 1CLMA 2KDHA 3CZTX 1WRZA 1N2DA 1XFUO 2LVIA 5HKYA 1S5GY 3BUXB 1Y1AA 3AAJA 1CLBA 2OTGB 2KBMA 5I8NA 1AK8A 4L9MA 2BCXA 3NSKA 4I5NB 1IJ6A 1JUOA 1G4YR 2G2BA 1KQMB 3BQ3A 1SL8A 1A75B 1MUXA 1EG4A 1M45A 2BBMA 1UWOA 3TDZA 1BLQA 1CDPA 1J1DA 1S6JA 2F8PA 2KGRA 1M46A 3DVMA 4MLWA 4QJ3B 3EK4A 5CSIA 1DJGA 2LMTA 1NCZA 4OR9B 4BY4A 2GGZA 2HQWA 1NIWA 1PSBA 3F45A 2HF5A 1NCYA 1N65A 1MXEA 3GK2A 3I5IC 3IF7A 2H61C 2MRDA 1PK0D 1WRKA 1K9KA 2LHIA 2O60A 3PLFB 4XJKB 2I18A 1FI6A 3DF0B 1Y1XA 2KNEA 1IKUA 2CXJA 4WQ2A 2M97A 3JVTB 1BR4B 1SMGA 1SYMA 3OB2B 1NSHA 1IQ5A 3D0YB 1R6PA 1EL4A 2MLFC 5CSFA 1S36A 4Q04A 2KAXA 1IH0A 1K95A 2FJUB 1BMOA 2BCBA 2BL0C 1L2OC 1IJ5A 1OOJA 1OMRA 3AKBA 4OVNF 2Y5IA 4I5LB 1VRKA 1OQPA 4JQ0D 3DVEA 3H4SE 1CDMA 3MSEB 3SJSA 1ALVA 1DJWA 3PN7B 5AANA 3PM8A 4A4CA 2P6BB 1G33A 2SASA 1WLMA 2LHLA 1BF5A 5KSZA 4GGNA 1TCOB 1CMFA 1SBJA 1C7VA 3BOWB 2LMUA 3O2PA 3KHEA 1DF0A 2KQYA 1Q80A 1NP8A 1QVIY 5I2LA 4ICBA 3EVVA 3EKJA 2R2IA 3LK0A 1DTLA 1OMDA 1PSRA 2QACA 1CDNA 5F6TA 4AQIA 1AUIB 3SG2A 2F2OA 3A4UB 1NX0A 2PVBA 2JZIA 4GFTA 4QJ5B 3I5HC 1L2OB 2BL0B 1KK7Y 2EGDA 1HQVA 1IWQA 3WNXB 4FTGA 2I94A 1XK4C 1BT6A 1JC2A 1OZSA 3DVJA 4MSPA 2PRUA 1CLLA 2LP2A 1J55A 2CT9A 3JVTC 4N5XA 3VGOA 1YURA 1XFWO 3WHUB 5D69A 2AUCA 5HLVA 2KFFA 2LNKA 4YGCB 1DJHA 1SL9A 1B8RA 1NX2A 4U8DA 2K2FA 1BR1B 1W7JB 4GGFC 2KSPA 1QJTA 2Q4UA 5K89A 1B4CA 4MZJA 3QRXA 2BE6A 2D8NA 2LM5A 3VRQA 2F3YA 2RGIA 5PALA 5TNCA 1WDCC 4TNCA 1NX3A 3NSLA 1M39A 1ALWA 2COLB 4OKHA 3ICBA 2PALA 1DJXA 1M31A 2G9BA 2JT0A 4I5JA 3WXAA 1YVHA 1KCYA 1JF2A 2DOQA 2EHBA 1MXLC
chains in the Genus database with same CATH superfamily
1Z4HA 5I2OA 3FE8A 2JNXA 4M2QA 5ER4X 1XFXO 1UP5A 1CTRA 1JFKA 1QWVA 4PHMA 5B8IB 1F71A 4DS7A 1DJYA 1QLKA 3LCPC 2KYFA 1MWNA 2Y4QA 4MVFA 3SIAA 2FJYA 2ZRTA 4MRYA 2MJWB 1C3ZA 1JF0A 4AQJA 4CIDA 1S5GZ 2K8MB 2GV5A 1KK7Z 1TNPA 1Y6WA 1WRLA 2JXCA 3GK1A 1UHKA 4PDZA 1B8CA 3GOFA 4INWA 4PHNA 1F4QA 2KFHA 2M9GA 1Z2CB 2ZN8A 2OS8B 4WQ3A 4HSZA 2PSRA 2QEVA 5FI6A 1F54A 2L98A 1SPYA 1QTXA 1QXPA 3SG5A 3NXAA 1SCMB 4DIRA 4E68A 1DMOA 1ZFSA 4INXA 4GGFA 3NHTA 1AJ4A 1MF8B 1Y1UA 1LA0A 1OW4A 1OMVA 2JU0A 2LC5A 3NSOA 3WHTB 1UHNA 1RWYA 2ZNEA 2O5GA 3JTDB 4WRIA 1GGWA 2LUCA 3I5GB 1ZACA 2LLTA 1WLZA 2WCKA 4OV2A 2NLNA 3S0EA 2OS8C 2JQ6A 3EK7A 2BECA 5DKNA 3C1VA 4IL1A 4YI9A 1DT7B 1SY9A 3BUMB 4PALA 2CBLA 3BUOB 3FE9A 1NYAA 1RECA 3V2LA 3CR2A 3EK8A 3EVRA 1SSEB 3BUNB 3I5GC 4PE7A 4NDBA 3SIBA 1C7WA 1YUSA 1K94A 3JTDC 1F55A 3CWGA 1YRTB 2WOSA 4JPZB 2E30A 1SRAA 4XYNA 3N7HA 1P28A 1XYDA 1W9ZA 2BE4A 1KFXS 3SG6A 1QS7A 4HRGA 4OCIA 1XFVO 1CFPA 1GGZA 2NCPA 3CS1A 3M0WA 2K2AA 1CKKA 4GNKB 2F2PA 1CM4A 1ODBA 2JOJA 2KAYA 4F0ZB 3OHMB 2L2CA 5D3OA 3BFAA 2WNDA 2CCMA 2M1UA 3IQOA 3DYEA 4OZDA 5AERA 1TNQA 1SNLA 1TTXA 2WCEA 1XO5A 1TN4A 3CR5X 3B7AA 2ZN9A 3D0YA 1QLSA 2ZNDA 1QV1A 3ZWHA 2JC2A 2P71A 3OGNA 1UUSA 3FIAA 4ORAB 4PCWA 3SG3A 1SKTA 3TDUA 3QMEA 3RM1A 1XFZO 4YRUA 3TUYC 3DD4A 2JULA 2FOTA 2YGUA 1J7PA 1H4BA 2GTEA 2FCDA 1KK8B 1YVLA 2AAOA 2E6WA 3RZSA 1NPQA 1CNPA 4PHKA 1A29A 5ER5A 1YUUA 4GUKA 2K7OA 5AFPA 3PATA 5AXIA 1IGVA 3VRRA 1B8LA 1X02A 2KPHA 3RLZA 1LA3A 1L7ZA 1H8BA 1FPWA 1DF0B 4NDDA 1B47A 1KFUS 1TRFA 1LKJA 1LXFC 3D76A 3TS5B 1BG1A 2L2EA 3BJHA 1SCMC 4KYNA 5BPJA 2EC6B 1F4OA 3FS7A 5HKZA 3SS5A 1MHOA 1QVIZ 1IRJA 3DVKA 3FWCA 3R1OA 2JTZA 4DUQA 1OOIX 2QDIA 2BBNA 3B6XA 2LUXA 3PALA 1DC1A 1QV0A 1XK4A 3K21A 2LANA 1Y0VH 2NCOA 1CM1A 1J1EA 2BCAA 2F33A 2M49B 2FCEA 2M3WA 2WC8A 2MLEC 3VRPA 1NCXA 4YGAA 1GJYA 3NHIA 1W7IB 3DF0A 3LL8B 1DGUA 2JXLA 3O6BA 1S6IA 4MBEA 5FI2A 1TCFA 5KU1A 2KYCA 2K7BA 1IG5A 3OP0A 1QX2A 4QJ4B 2NXQA 4HREE 1K8UA 4C0JA 1A75A 4BY5A 1BODA 1SW8A 5CSNA 1CDLA 1YUTA 1BU3A 2L4IA 3HX4A 1SR6C 4D1EA 4N1GA 2L50A 1U5IA 1G8IA 3EVUA 2HETA 1K2HA 3I5IB 5J3XA 1UHJA 3O4YA 1EG3A 3BUWB 1EH2A 1QX5B 4ZCVA 1S26D 2L5XB 2OPOA 5HKWA 4MZLA 1KWOB 1KQVA 1J7RA 1QX7A 2LCPA 3R72A 4R1EA 4ETOA 1TOPA 3CABA 3B86A 3CZ0A 1QASA 2KQ6A 4GBAA 1RROA 2HPSA 2Y1MA 3NSIA 4PHJA 2JPTA 2KI6D 3CTNA 1CFDA 2WCHA 2PASA 1V1FA 3ZNIA 4F7FA 5DKQA 1PRWA 5CPVA 2QEHA 3D73A 2I7AA 1HT9A 5FI7A 1C3YA 3VB1A 4CPVA 1UURA 3TUYB 1QIWA 1XFRA 2JNFA 3LK1A 2CNPA 2KI4C 3OX6A 1K9UA 2NZ0A 5IBWA 1E8AA 3OB1B 1JBAA 4USLA 2KBIA 1B1GA 5KTYA 1YX7A 2LVVA 1CMGA 1K93D 1XA5A 3D10A 2KHNA 3TS5C 1OE9B 3PFVA 1FI5A 1V1GA 3EKHA 1OOFA 5DKRA 1R2UA 2EC6C 2KI6C 1XVJA 2L0PA 1FBVA 1UHHA 4MZKA 3O78A 3CLNA 1NUBA 1KK8C 3DZTA 3HCMA 5HLOA 3S0AA 1K96A 2K7CA 2LAPA 1S3PA 4DCKA 2IS9A 4JWQA 4ORCB 3SS3A 1S1EA 1BOCA 5CSJA 1N0YA 4HRHA 4MN0A 1T14A 3PJIA 2PYQA 2WORA 3D78A 4CLNA 2JTTA 4NQGA 1D1OA 1ZUZA 5JJGA 1ORGA 1PULA 1KFXL 1YX8A 1PVAA 1LINA 1JWDA 4DRWA 2A4JA 1RJVA 2JRFA 1S6CA 4P5OE 3CZ1A 3KF9A 1FW4A 4PE1A 5I2QA 1KFUL 3I5FC 4ORBB 2BKIB 2V53A 1RK9A 3IQQA 4YGBB 1YR5A 2HQ8A 2WCFA 2WCBA 4NDCA 2Q91A 5GQQC 1JFJA 4AOMA 1TUZA 1TWOA 2L51A 2PMYA 4FQTA 1KQMC 1K9PA 2ZRSA 2M0RA 4C0KA 1AJ5A 2JPOA 1QATA 2WC5A 4YGEB 2CTNA 3L47A 2OTGC 1YTZC 3AAKA 3OBVA 5G08A 5DICA 2KAVA 4IJ7A 1QIVA 1ZOTB 2BKHB 1MR8A 4M2OA 2LVJA 4CFRA 2KGBC 3L4AA 1F8HA 3S0FA 2KLDA 1YRUB 4P2YB 4YI8A 3CGAA 4UPGA 3R1PA 5AEQA 2ISDA 1OSAA 3SS4A 1A4PA 5FYXA 2WCJA 2AMIA 5JOLA 3E3RA 4JD9A 1CFCA 3KEVA 1NWDA 2GGMA 3PSRA 4FQOA 5HL1A 2JT3A 1KSOA 2M29A 4MEWA 1UHIA 3SG4A 4JKTA 1B7TY 4MRXA 2LLUA 1U5IB 2KFGA 2LV7A 5D7FA 2ZFDA 2LMVA 4ZCUA 2M7NA 2JWWA 4M2PA 2H2KA 2MBXA 3CDNA 1OOHA 1DVIA 2H61A 1ZMZA 2B1UA 3VROA 2MHHA 3BXKA 2LE9B 1DELA 1DQEA 1TNWA 5HYDA 1RFJA 3CR4X 3OX5A 3R1VA 2KI4B 2SCPA 2ZKMX 2LVKA 3SG7A 3GK4X 1C07A 2MA2A 3FWBA 3O4XA 4I5KA 4GAOA 4C0LA 1CFFA 4XJKA 3TDIA 1AVSA 1NX1A 2QPTA 3BOWA 2K0JA 1J7QA 2LP3A 4YGDB 2TN4A 1A2XA 1BJFA 4PE4A 1LS8A 3AKAA 3K1EA 2M1KB 1A03A 4PE0A 1AHRA 1SL7A 4PT1A 3CYZA 1XFYO 3I5HB 2M7LA 1SK6D 1OZOA 1WDCB 4N1FA 1DEKA 1IQ3A 1FF1A 1KWOC 3FE6A 2F3ZA 1RTP1 3KPXA 1DJIA 1DJZA 1EXRA 2PQLA 2LLSA 2MAZA 3I5FB 1SCVA 1B9AA 3BYAA 4YBHB 2KOTA 2M8UA 1TIZA 1KSMA 2QEOA 4GPLB 1LVCD 1K90D 2K7DA 3A8RA 1CB1A 1JSAA 2I2RE 1J7OA 3PM2A 1GQMA 1AP4A 1PALA 3TZ1A 3B87A 3UNWA 1WY9A 2VRGA 2K60A 1B7TZ 3UO9A 3VRNA 1M63B 1F70A 3KO0A 2L4HA 2K61A 1PVBA 2JT8A 1DGVA 1SR6B 3PN7C 1MQ1A 1OOGA 2Y1NA 1TNXA 1TUJA 1EJ3A 2BNXA 3LLEA 4A4BA 4CFQA 3S0BA 1CLMA 2KDHA 3CZTX 1WRZA 1N2DA 1XFUO 2LVIA 3D75A 5HKYA 1S5GY 3IVTA 3BUXB 1Y1AA 3AAJA 1CLBA 2OTGB 2KBMA 5I8NA 1AK8A 4L9MA 2BCXA 3NSKA 4I5NB 1IJ6A 1JUOA 1G4YR 2G2BA 1KQMB 3BQ3A 1SL8A 1A75B 1MUXA 1EG4A 1M45A 2ERBA 2BBMA 1UWOA 3TDZA 1BLQA 1CDPA 1J1DA 1S6JA 2F8PA 2KGRA 1M46A 3DVMA 4MLWA 4QJ3B 3EK4A 5CSIA 1DJGA 2LMTA 1NCZA 4OR9B 4BY4A 2GGZA 2HQWA 1NIWA 1PSBA 3F45A 2HF5A 1NCYA 2WCMA 1N65A 1MXEA 3GK2A 3I5IC 3IF7A 2H61C 2MRDA 1PK0D 1WRKA 1K9KA 2LHIA 2O60A 3PLFB 4XJKB 2I18A 1FI6A 3DF0B 1Y1XA 2KNEA 1IKUA 2CXJA 4WQ2A 3DXLA 2M97A 3EG5B 3JVTB 1BR4B 1SMGA 1SYMA 3OB2B 1NSHA 1IQ5A 3D0YB 1R6PA 1EL4A 2MLFC 2WC6A 5CSFA 1S36A 3BFHA 2KAXA 4Q04A 1IH0A 1K95A 2FJUB 1BMOA 2BCBA 3S0DA 2BL0C 1L2OC 1IJ5A 1OOJA 2BAPA 3S0GA 1OMRA 3AKBA 4OVNF 2Y5IA 4I5LB 1VRKA 1OQPA 4JQ0D 3DVEA 3H4SE 1CDMA 3MSEB 3SJSA 1ALVA 3NGVA 1DJWA 3PN7B 5AANA 2L5YA 3PM8A 4A4CA 2P6BB 1G33A 2SASA 1WLMA 2LHLA 1BF5A 5KSZA 4GGNA 1TCOB 1CMFA 1SBJA 1C7VA 3BOWB 2LMUA 3O2PA 3KHEA 1DF0A 2KQYA 1Q80A 1NP8A 1QVIY 2P70A 5I2LA 4ICBA 3EVVA 3EKJA 2R2IA 3LK0A 1DTLA 1OMDA 1PSRA 2QACA 1CDNA 5F6TA 4AQIA 1AUIB 3SG2A 2F2OA 3A4UB 2WCLA 1NX0A 2PVBA 2JZIA 4GFTA 4QJ5B 3I5HC 1L2OB 2BL0B 3BFBA 1KK7Y 2EGDA 1HQVA 1IWQA 3WNXB 4FTGA 3D77A 2I94A 1XK4C 1BT6A 1JC2A 1OZSA 1IIOA 3DVJA 4MSPA 2PRUA 1CLLA 2LP2A 1J55A 2CT9A 3JVTC 2QEBA 4N5XA 3VGOA 1YURA 1XFWO 3WHUB 5D69A 2AUCA 5HLVA 2KFFA 2LNKA 4YGCB 1DJHA 1SL9A 1B8RA 1NX2A 2KLEA 2K2FA 1BR1B 4U8DA 1W7JB 4GGFC 3DY9A 2KSPA 1GM0A 1QJTA 2Q4UA 3CZ2A 5K89A 1B4CA 4MZJA 3QRXA 2BE6A 2D8NA 2LM5A 3Q8IA 3VRQA 2F3YA 2RGIA 5PALA 5TNCA 1WDCC 4TNCA 3B88A 1NX3A 3NSLA 5EL2A 1M39A 1ALWA 5I94A 2COLB 4OKHA 3ICBA 2PALA 2H8VA 1DJXA 1M31A 2G9BA 2JT0A 4I5JA 3WXAA 3D74A 1YVHA 1KCYA 1JF2A 3L4LA 2DOQA 2EHBA 1MXLC
chains in the Genus database with same CATH topology
5I2OA 2JNXA 4M2QA 5ER4X 1XFXO 1UP5A 1CTRA 1JFKA 5B8IB 4PHMA 1F71A 4DS7A 1DJYA 1QLKA 3LCPC 2KYFA 1MWNA 2Y4QA 4MVFA 3SIAA 2ZRTA 4MRYA 2MJWB 4CIDA 1JF0A 4AQJA 1S5GZ 2K8MB 2GV5A 1KK7Z 1TNPA 1Y6WA 1WRLA 2JXCA 3GK1A 1UHKA 4PDZA 1B8CA 3GOFA 4PHNA 1F4QA 2KFHA 2M9GA 2ZN8A 2OS8B 4WQ3A 4HSZA 2PSRA 1F54A 2L98A 1SPYA 1QTXA 1QXPA 3SG5A 3NXAA 1SCMB 4DIRA 4E68A 1DMOA 1ZFSA 4GGFA 1AJ4A 1MF8B 1Y1UA 1LA0A 1OMVA 2JU0A 2LC5A 3NSOA 3WHTB 1UHNA 1RWYA 2ZNEA 2O5GA 3JTDB 4WRIA 1GGWA 2LUCA 3I5GB 1ZACA 2LLTA 1WLZA 4OV2A 2NLNA 2OS8C 2JQ6A 3EK7A 2BECA 5DKNA 3C1VA 4IL1A 4YI9A 1DT7B 1SY9A 3BUMB 4PALA 2CBLA 3BUOB 1NYAA 1RECA 3CR2A 3EK8A 3EVRA 3BUNB 3I5GC 4PE7A 4NDBA 3SIBA 1C7WA 1YUSA 1K94A 3JTDC 1F55A 3CWGA 1YRTB 2WOSA 4JPZB 2E30A 1SRAA 4XYNA 1XYDA 2BE4A 3SG6A 1KFXS 1QS7A 4HRGA 4OCIA 1XFVO 1CFPA 1GGZA 2NCPA 3CS1A 3M0WA 2K2AA 1CKKA 4GNKB 2F2PA 1CM4A 1ODBA 2JOJA 2KAYA 4F0ZB 3OHMB 2WNDA 2CCMA 2M1UA 3IQOA 5AERA 1TNQA 1SNLA 1TTXA 2WCEA 1XO5A 1TN4A 3CR5X 2ZN9A 3D0YA 1QLSA 2ZNDA 1QV1A 3ZWHA 2JC2A 4ORAB 4PCWA 1UUSA 3FIAA 3SG3A 1SKTA 3TDUA 3RM1A 4YRUA 1XFZO 3TUYC 3DD4A 2JULA 2FOTA 1J7PA 1H4BA 2FCDA 1KK8B 1YVLA 2AAOA 2E6WA 1NPQA 1CNPA 4PHKA 1A29A 5ER5A 1YUUA 4GUKA 2K7OA 5AFPA 3PATA 5AXIA 1IGVA 3VRRA 1B8LA 1X02A 3RLZA 1LA3A 1L7ZA 1H8BA 1FPWA 1DF0B 4NDDA 1B47A 1KFUS 1LKJA 1LXFC 1TRFA 3TS5B 1BG1A 2L2EA 1SCMC 5BPJA 2EC6B 1F4OA 3FS7A 5HKZA 1MHOA 1QVIZ 1IRJA 3DVKA 3FWCA 2JTZA 4DUQA 2BBNA 2LUXA 3PALA 1QV0A 1XK4A 3K21A 2LANA 1Y0VH 2NCOA 1CM1A 1J1EA 2BCAA 2F33A 2M49B 2FCEA 2M3WA 2WC8A 2MLEC 3VRPA 1NCXA 4YGAA 1GJYA 1W7IB 3DF0A 3LL8B 1DGUA 2JXLA 3O6BA 1S6IA 4MBEA 5KU1A 1TCFA 2KYCA 2K7BA 1IG5A 3OP0A 1QX2A 4QJ4B 2NXQA 4HREE 1K8UA 4C0JA 1A75A 4BY5A 1BODA 1SW8A 5CSNA 1CDLA 1YUTA 1BU3A 2L4IA 3HX4A 1SR6C 4D1EA 4N1GA 2L50A 1U5IA 1G8IA 3EVUA 2HETA 1K2HA 3I5IB 5J3XA 1UHJA 3O4YA 1EG3A 3BUWB 1EH2A 1QX5B 4ZCVA 1S26D 2L5XB 2OPOA 5HKWA 4MZLA 1KWOB 1KQVA 1J7RA 1QX7A 2LCPA 4R1EA 4ETOA 1TOPA 1QASA 2KQ6A 4GBAA 1RROA 2HPSA 2Y1MA 3NSIA 4PHJA 2JPTA 2KI6D 3CTNA 1CFDA 3ZNIA 2PASA 1V1FA 5DKQA 1PRWA 5CPVA 2I7AA 1HT9A 4CPVA 1UURA 3TUYB 1QIWA 2JNFA 3LK1A 2CNPA 2KI4C 3OX6A 1K9UA 2NZ0A 5IBWA 1E8AA 3OB1B 1JBAA 4USLA 2KBIA 1B1GA 5KTYA 1YX7A 2LVVA 1CMGA 1K93D 1XA5A 3D10A 2KHNA 3TS5C 1OE9B 3PFVA 1FI5A 1V1GA 3EKHA 5DKRA 1R2UA 2EC6C 2KI6C 1XVJA 2L0PA 1FBVA 1UHHA 4MZKA 3O78A 3CLNA 1NUBA 1KK8C 3HCMA 5HLOA 1K96A 2K7CA 2LAPA 1S3PA 4DCKA 2IS9A 4JWQA 4ORCB 1S1EA 1BOCA 5CSJA 1N0YA 4HRHA 4MN0A 2WORA 1D1OA 4CLNA 2JTTA 4NQGA 1ZUZA 5JJGA 1PULA 1KFXL 1YX8A 1PVAA 1LINA 1JWDA 4DRWA 2A4JA 1RJVA 2JRFA 1S6CA 4P5OE 3KF9A 1FW4A 4PE1A 5I2QA 1KFUL 3I5FC 4ORBB 2BKIB 2V53A 1RK9A 3IQQA 4YGBB 1YR5A 2HQ8A 2WCFA 2WCBA 4NDCA 2Q91A 5GQQC 1JFJA 4AOMA 2L51A 2PMYA 1KQMC 1K9PA 2ZRSA 2M0RA 4C0KA 1AJ5A 1QATA 4YGEB 2CTNA 2OTGC 1YTZC 3AAKA 5G08A 2KAVA 1QIVA 1ZOTB 2BKHB 1MR8A 4M2OA 2LVJA 4CFRA 2KGBC 1F8HA 1YRUB 4P2YB 4YI8A 3CGAA 4UPGA 5AEQA 2ISDA 1OSAA 1A4PA 5FYXA 2AMIA 5JOLA 3E3RA 1CFCA 3KEVA 1NWDA 2GGMA 3PSRA 4FQOA 2JT3A 1KSOA 2M29A 4MEWA 1UHIA 3SG4A 1B7TY 4MRXA 2LLUA 1U5IB 2KFGA 2LV7A 5D7FA 2ZFDA 2LMVA 4ZCUA 2M7NA 2JWWA 4M2PA 2H2KA 2MBXA 2H61A 1DVIA 1ZMZA 2B1UA 3VROA 2MHHA 3BXKA 2LE9B 1TNWA 5HYDA 1RFJA 3CR4X 3OX5A 2KI4B 2SCPA 2ZKMX 2LVKA 3SG7A 3GK4X 1C07A 2MA2A 3FWBA 4I5KA 4GAOA 4C0LA 1CFFA 4XJKA 3TDIA 1AVSA 1NX1A 2QPTA 3BOWA 2K0JA 1J7QA 2LP3A 4YGDB 2TN4A 1A2XA 1BJFA 4PE4A 3AKAA 2M1KB 1A03A 4PE0A 1AHRA 1SL7A 1XFYO 3I5HB 2M7LA 1SK6D 1OZOA 1WDCB 4N1FA 1IQ3A 1FF1A 1KWOC 2F3ZA 1RTP1 3KPXA 1DJIA 1DJZA 1EXRA 3I5FB 2LLSA 2MAZA 1SCVA 1B9AA 3BYAA 4YBHB 2KOTA 2M8UA 1TIZA 1KSMA 4GPLB 1LVCD 1K90D 2K7DA 3A8RA 1CB1A 1JSAA 2I2RE 1J7OA 1GQMA 1AP4A 1PALA 3TZ1A 1WY9A 2VRGA 1B7TZ 3VRNA 1M63B 1F70A 3KO0A 2L4HA 2K61A 1PVBA 2JT8A 1DGVA 1SR6B 3PN7C 1MQ1A 2Y1NA 1TNXA 3LLEA 1EJ3A 4CFQA 4A4BA 1CLMA 2KDHA 3CZTX 1WRZA 1N2DA 1XFUO 2LVIA 5HKYA 1S5GY 3BUXB 1Y1AA 3AAJA 1CLBA 2OTGB 2KBMA 5I8NA 1AK8A 4L9MA 2BCXA 3NSKA 4I5NB 1IJ6A 1JUOA 1G4YR 2G2BA 1KQMB 3BQ3A 1SL8A 1A75B 1MUXA 1EG4A 1M45A 2BBMA 1UWOA 3TDZA 1BLQA 1CDPA 1J1DA 1S6JA 2F8PA 2KGRA 1M46A 3DVMA 4MLWA 4QJ3B 3EK4A 5CSIA 1DJGA 2LMTA 1NCZA 4OR9B 4BY4A 2GGZA 2HQWA 1NIWA 1PSBA 3F45A 2HF5A 1NCYA 1N65A 1MXEA 3GK2A 3I5IC 3IF7A 2H61C 2MRDA 1PK0D 1WRKA 1K9KA 2LHIA 2O60A 3PLFB 4XJKB 2I18A 1FI6A 3DF0B 1Y1XA 2KNEA 1IKUA 2CXJA 4WQ2A 2M97A 3JVTB 1BR4B 1SMGA 1SYMA 3OB2B 1NSHA 1IQ5A 3D0YB 1R6PA 1EL4A 2MLFC 5CSFA 1S36A 4Q04A 2KAXA 1IH0A 1K95A 2FJUB 1BMOA 2BCBA 2BL0C 1L2OC 1IJ5A 1OOJA 1OMRA 3AKBA 4OVNF 2Y5IA 4I5LB 1VRKA 1OQPA 4JQ0D 3DVEA 3H4SE 1CDMA 3MSEB 3SJSA 1ALVA 1DJWA 3PN7B 5AANA 3PM8A 4A4CA 2P6BB 1G33A 2SASA 1WLMA 2LHLA 1BF5A 5KSZA 4GGNA 1TCOB 1CMFA 1SBJA 1C7VA 3BOWB 2LMUA 3O2PA 3KHEA 1DF0A 2KQYA 1Q80A 1NP8A 1QVIY 5I2LA 4ICBA 3EVVA 3EKJA 2R2IA 3LK0A 1DTLA 1OMDA 1PSRA 2QACA 1CDNA 5F6TA 4AQIA 1AUIB 3SG2A 2F2OA 3A4UB 1NX0A 2PVBA 2JZIA 4GFTA 4QJ5B 3I5HC 1L2OB 2BL0B 1KK7Y 2EGDA 1HQVA 1IWQA 3WNXB 4FTGA 2I94A 1XK4C 1BT6A 1JC2A 1OZSA 3DVJA 4MSPA 2PRUA 1CLLA 2LP2A 1J55A 2CT9A 3JVTC 4N5XA 3VGOA 1YURA 1XFWO 3WHUB 5D69A 2AUCA 5HLVA 2KFFA 2LNKA 4YGCB 1DJHA 1SL9A 1B8RA 1NX2A 4U8DA 2K2FA 1BR1B 1W7JB 4GGFC 2KSPA 1QJTA 2Q4UA 5K89A 1B4CA 4MZJA 3QRXA 2BE6A 2D8NA 2LM5A 3VRQA 2F3YA 2RGIA 5PALA 5TNCA 1WDCC 4TNCA 1NX3A 3NSLA 1M39A 1ALWA 2COLB 4OKHA 3ICBA 2PALA 1DJXA 1M31A 2G9BA 2JT0A 4I5JA 3WXAA 1YVHA 1KCYA 1JF2A 2DOQA 2EHBA 1MXLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I2O A;  2JNX A;  4M2Q A;  5ER4 X;  1XFX O;  1UP5 A;  1CTR A;  1JFK A;  5B8I B;  4PHM A;  1F71 A;  4DS7 A;  1DJY A;  1QLK A;  3LCP C;  2KYF A;  1MWN A;  2Y4Q A;  4MVF A;  3SIA A;  2ZRT A;  4MRY A;  2MJW B;  4CID A;  1JF0 A;  4AQJ A;  1S5G Z;  2K8M B;  2GV5 A;  1KK7 Z;  1TNP A;  1Y6W A;  1WRL A;  2JXC A;  3GK1 A;  1UHK A;  4PDZ A;  1B8C A;  3GOF A;  4PHN A;  1F4Q A;  2KFH A;  2M9G A;  2ZN8 A;  2OS8 B;  4WQ3 A;  4HSZ A;  2PSR A;  1F54 A;  2L98 A;  1SPY A;  1QTX A;  1QXP A;  3SG5 A;  3NXA A;  1SCM B;  4DIR A;  4E68 A;  1DMO A;  1ZFS A;  4GGF A;  1AJ4 A;  1MF8 B;  1Y1U A;  1LA0 A;  1OMV A;  2JU0 A;  2LC5 A;  3NSO A;  3WHT B;  1UHN A;  1RWY A;  2ZNE A;  2O5G A;  3JTD B;  4WRI A;  1GGW A;  2LUC A;  3I5G B;  1ZAC A;  2LLT A;  1WLZ A;  4OV2 A;  2NLN A;  2OS8 C;  2JQ6 A;  3EK7 A;  2BEC A;  5DKN A;  3C1V A;  4IL1 A;  4YI9 A;  1DT7 B;  1SY9 A;  3BUM B;  4PAL A;  2CBL A;  3BUO B;  1NYA A;  1REC A;  3CR2 A;  3EK8 A;  3EVR A;  3BUN B;  3I5G C;  4PE7 A;  4NDB A;  3SIB A;  1C7W A;  1YUS A;  1K94 A;  3JTD C;  1F55 A;  3CWG A;  1YRT B;  2WOS A;  4JPZ B;  2E30 A;  1SRA A;  4XYN A;  1XYD A;  2BE4 A;  3SG6 A;  1KFX S;  1QS7 A;  4HRG A;  4OCI A;  1XFV O;  1CFP A;  1GGZ A;  2NCP A;  3CS1 A;  3M0W A;  2K2A A;  1CKK A;  4GNK B;  2F2P A;  1CM4 A;  1ODB A;  2JOJ A;  2KAY A;  4F0Z B;  3OHM B;  2WND A;  2CCM A;  2M1U A;  3IQO A;  5AER A;  1TNQ A;  1SNL A;  1TTX A;  2WCE A;  1XO5 A;  1TN4 A;  3CR5 X;  2ZN9 A;  3D0Y A;  1QLS A;  2ZND A;  1QV1 A;  3ZWH A;  2JC2 A;  4ORA B;  4PCW A;  1UUS A;  3FIA A;  3SG3 A;  1SKT A;  3TDU A;  3RM1 A;  4YRU A;  1XFZ O;  3TUY C;  3DD4 A;  2JUL A;  2FOT A;  1J7P A;  1H4B A;  2FCD A;  1KK8 B;  1YVL A;  2AAO A;  2E6W A;  1NPQ A;  1CNP A;  4PHK A;  1A29 A;  5ER5 A;  1YUU A;  4GUK A;  2K7O A;  5AFP A;  3PAT A;  5AXI A;  1IGV A;  3VRR A;  1B8L A;  1X02 A;  3RLZ A;  1LA3 A;  1L7Z A;  1H8B A;  1FPW A;  1DF0 B;  4NDD A;  1B47 A;  1KFU S;  1LKJ A;  1LXF C;  1TRF A;  3TS5 B;  1BG1 A;  2L2E A;  1SCM C;  5BPJ A;  2EC6 B;  1F4O A;  3FS7 A;  5HKZ A;  1MHO A;  1QVI Z;  1IRJ A;  3DVK A;  3FWC A;  2JTZ A;  4DUQ A;  2BBN A;  2LUX A;  3PAL A;  1QV0 A;  1XK4 A;  3K21 A;  2LAN A;  1Y0V H;  2NCO A;  1CM1 A;  1J1E A;  2BCA A;  2F33 A;  2M49 B;  2FCE A;  2M3W A;  2WC8 A;  2MLE C;  3VRP A;  1NCX A;  4YGA A;  1GJY A;  1W7I B;  3DF0 A;  3LL8 B;  1DGU A;  2JXL A;  3O6B A;  1S6I A;  4MBE A;  5KU1 A;  1TCF A;  2KYC A;  2K7B A;  1IG5 A;  3OP0 A;  1QX2 A;  4QJ4 B;  2NXQ A;  4HRE E;  1K8U A;  4C0J A;  1A75 A;  4BY5 A;  1BOD A;  1SW8 A;  5CSN A;  1CDL A;  1YUT A;  1BU3 A;  2L4I A;  3HX4 A;  1SR6 C;  4D1E A;  4N1G A;  2L50 A;  1U5I A;  1G8I A;  3EVU A;  2HET A;  1K2H A;  3I5I B;  5J3X A;  1UHJ A;  3O4Y A;  1EG3 A;  3BUW B;  1EH2 A;  1QX5 B;  4ZCV A;  1S26 D;  2L5X B;  2OPO A;  5HKW A;  4MZL A;  1KWO B;  1KQV A;  1J7R A;  1QX7 A;  2LCP A;  4R1E A;  4ETO A;  1TOP A;  1QAS A;  2KQ6 A;  4GBA A;  1RRO A;  2HPS A;  2Y1M A;  3NSI A;  4PHJ A;  2JPT A;  2KI6 D;  3CTN A;  1CFD A;  3ZNI A;  2PAS A;  1V1F A;  5DKQ A;  1PRW A;  5CPV A;  2I7A A;  1HT9 A;  4CPV A;  1UUR A;  3TUY B;  1QIW A;  2JNF A;  3LK1 A;  2CNP A;  2KI4 C;  3OX6 A;  1K9U A;  2NZ0 A;  5IBW A;  1E8A A;  3OB1 B;  1JBA A;  4USL A;  2KBI A;  1B1G A;  5KTY A;  1YX7 A;  2LVV A;  1CMG A;  1K93 D;  1XA5 A;  3D10 A;  2KHN A;  3TS5 C;  1OE9 B;  3PFV A;  1FI5 A;  1V1G A;  3EKH A;  5DKR A;  1R2U A;  2EC6 C;  2KI6 C;  1XVJ A;  2L0P A;  1FBV A;  1UHH A;  4MZK A;  3O78 A;  3CLN A;  1NUB A;  1KK8 C;  3HCM A;  5HLO A;  1K96 A;  2K7C A;  2LAP A;  1S3P A;  4DCK A;  2IS9 A;  4JWQ A;  4ORC B;  1S1E A;  1BOC A;  5CSJ A;  1N0Y A;  4HRH A;  4MN0 A;  2WOR A;  1D1O A;  4CLN A;  2JTT A;  4NQG A;  1ZUZ A;  5JJG A;  1PUL A;  1KFX L;  1YX8 A;  1PVA A;  1LIN A;  1JWD A;  4DRW A;  2A4J A;  1RJV A;  2JRF A;  1S6C A;  4P5O E;  3KF9 A;  1FW4 A;  4PE1 A;  5I2Q A;  1KFU L;  3I5F C;  4ORB B;  2BKI B;  2V53 A;  1RK9 A;  3IQQ A;  4YGB B;  1YR5 A;  2HQ8 A;  2WCF A;  2WCB A;  4NDC A;  2Q91 A;  5GQQ C;  1JFJ A;  4AOM A;  2L51 A;  2PMY A;  1KQM C;  1K9P A;  2ZRS A;  2M0R A;  4C0K A;  1AJ5 A;  1QAT A;  4YGE B;  2CTN A;  2OTG C;  1YTZ C;  3AAK A;  5G08 A;  2KAV A;  1QIV A;  1ZOT B;  2BKH B;  1MR8 A;  4M2O A;  2LVJ A;  4CFR A;  2KGB C;  1F8H A;  1YRU B;  4P2Y B;  4YI8 A;  3CGA A;  4UPG A;  5AEQ A;  2ISD A;  1OSA A;  1A4P A;  5FYX A;  2AMI A;  5JOL A;  3E3R A;  1CFC A;  3KEV A;  1NWD A;  2GGM A;  3PSR A;  4FQO A;  2JT3 A;  1KSO A;  2M29 A;  4MEW A;  1UHI A;  3SG4 A;  1B7T Y;  4MRX A;  2LLU A;  1U5I B;  2KFG A;  2LV7 A;  5D7F A;  2ZFD A;  2LMV A;  4ZCU A;  2M7N A;  2JWW A;  4M2P A;  2H2K A;  2MBX A;  2H61 A;  1DVI A;  1ZMZ A;  2B1U A;  3VRO A;  2MHH A;  3BXK A;  2LE9 B;  1TNW A;  5HYD A;  1RFJ A;  3CR4 X;  3OX5 A;  2KI4 B;  2SCP A;  2ZKM X;  2LVK A;  3SG7 A;  3GK4 X;  1C07 A;  2MA2 A;  3FWB A;  4I5K A;  4GAO A;  4C0L A;  1CFF A;  4XJK A;  3TDI A;  1AVS A;  1NX1 A;  2QPT A;  3BOW A;  2K0J A;  1J7Q A;  2LP3 A;  4YGD B;  2TN4 A;  1A2X A;  1BJF A;  4PE4 A;  3AKA A;  2M1K B;  1A03 A;  4PE0 A;  1AHR A;  1SL7 A;  1XFY O;  3I5H B;  2M7L A;  1SK6 D;  1OZO A;  1WDC B;  4N1F A;  1IQ3 A;  1FF1 A;  1KWO C;  2F3Z A;  1RTP 1;  3KPX A;  1DJI A;  1DJZ A;  1EXR A;  3I5F B;  2LLS A;  2MAZ A;  1SCV A;  1B9A A;  3BYA A;  4YBH B;  2KOT A;  2M8U A;  1TIZ A;  1KSM A;  4GPL B;  1LVC D;  1K90 D;  2K7D A;  3A8R A;  1CB1 A;  1JSA A;  2I2R E;  1J7O A;  1GQM A;  1AP4 A;  1PAL A;  3TZ1 A;  1WY9 A;  2VRG A;  1B7T Z;  3VRN A;  1M63 B;  1F70 A;  3KO0 A;  2L4H A;  2K61 A;  1PVB A;  2JT8 A;  1DGV A;  1SR6 B;  3PN7 C;  1MQ1 A;  2Y1N A;  1TNX A;  3LLE A;  1EJ3 A;  4CFQ A;  4A4B A;  1CLM A;  2KDH A;  3CZT X;  1WRZ A;  1N2D A;  1XFU O;  2LVI A;  5HKY A;  1S5G Y;  3BUX B;  1Y1A A;  3AAJ A;  1CLB A;  2OTG B;  2KBM A;  5I8N A;  1AK8 A;  4L9M A;  2BCX A;  3NSK A;  4I5N B;  1IJ6 A;  1JUO A;  1G4Y R;  2G2B A;  1KQM B;  3BQ3 A;  1SL8 A;  1A75 B;  1MUX A;  1EG4 A;  1M45 A;  2BBM A;  1UWO A;  3TDZ A;  1BLQ A;  1CDP A;  1J1D A;  1S6J A;  2F8P A;  2KGR A;  1M46 A;  3DVM A;  4MLW A;  4QJ3 B;  3EK4 A;  5CSI A;  1DJG A;  2LMT A;  1NCZ A;  4OR9 B;  4BY4 A;  2GGZ A;  2HQW A;  1NIW A;  1PSB A;  3F45 A;  2HF5 A;  1NCY A;  1N65 A;  1MXE A;  3GK2 A;  3I5I C;  3IF7 A;  2H61 C;  2MRD A;  1PK0 D;  1WRK A;  1K9K A;  2LHI A;  2O60 A;  3PLF B;  4XJK B;  2I18 A;  1FI6 A;  3DF0 B;  1Y1X A;  2KNE A;  1IKU A;  2CXJ A;  4WQ2 A;  2M97 A;  3JVT B;  1BR4 B;  1SMG A;  1SYM A;  3OB2 B;  1NSH A;  1IQ5 A;  3D0Y B;  1R6P A;  1EL4 A;  2MLF C;  5CSF A;  1S36 A;  4Q04 A;  2KAX A;  1IH0 A;  1K95 A;  2FJU B;  1BMO A;  2BCB A;  2BL0 C;  1L2O C;  1IJ5 A;  1OOJ A;  1OMR A;  3AKB A;  4OVN F;  2Y5I A;  4I5L B;  1VRK A;  1OQP A;  4JQ0 D;  3DVE A;  3H4S E;  1CDM A;  3MSE B;  3SJS A;  1ALV A;  1DJW A;  3PN7 B;  5AAN A;  3PM8 A;  4A4C A;  2P6B B;  1G33 A;  2SAS A;  1WLM A;  2LHL A;  1BF5 A;  5KSZ A;  4GGN A;  1TCO B;  1CMF A;  1SBJ A;  1C7V A;  3BOW B;  2LMU A;  3O2P A;  3KHE A;  1DF0 A;  2KQY A;  1Q80 A;  1NP8 A;  1QVI Y;  5I2L A;  4ICB A;  3EVV A;  3EKJ A;  2R2I A;  3LK0 A;  1DTL A;  1OMD A;  1PSR A;  2QAC A;  1CDN A;  5F6T A;  4AQI A;  1AUI B;  3SG2 A;  2F2O A;  3A4U B;  1NX0 A;  2PVB A;  2JZI A;  4GFT A;  4QJ5 B;  3I5H C;  1L2O B;  2BL0 B;  1KK7 Y;  2EGD A;  1HQV A;  1IWQ A;  3WNX B;  4FTG A;  2I94 A;  1XK4 C;  1BT6 A;  1JC2 A;  1OZS A;  3DVJ A;  4MSP A;  2PRU A;  1CLL A;  2LP2 A;  1J55 A;  2CT9 A;  3JVT C;  4N5X A;  3VGO A;  1YUR A;  1XFW O;  3WHU B;  5D69 A;  2AUC A;  5HLV A;  2KFF A;  2LNK A;  4YGC B;  1DJH A;  1SL9 A;  1B8R A;  1NX2 A;  4U8D A;  2K2F A;  1BR1 B;  1W7J B;  4GGF C;  2KSP A;  1QJT A;  2Q4U A;  5K89 A;  1B4C A;  4MZJ A;  3QRX A;  2BE6 A;  2D8N A;  2LM5 A;  3VRQ A;  2F3Y A;  2RGI A;  5PAL A;  5TNC A;  1WDC C;  4TNC A;  1NX3 A;  3NSL A;  1M39 A;  1ALW A;  2COL B;  4OKH A;  3ICB A;  2PAL A;  1DJX A;  1M31 A;  2G9B A;  2JT0 A;  4I5J A;  3WXA A;  1YVH A;  1KCY A;  1JF2 A;  2DOQ A;  2EHB A;  1MXL C; 
#chains in the Genus database with same CATH topology
 1Z4H A;  5I2O A;  3FE8 A;  2JNX A;  4M2Q A;  5ER4 X;  1XFX O;  1UP5 A;  1CTR A;  1JFK A;  1QWV A;  4PHM A;  5B8I B;  1F71 A;  4DS7 A;  1DJY A;  1QLK A;  3LCP C;  2KYF A;  1MWN A;  2Y4Q A;  4MVF A;  3SIA A;  2FJY A;  2ZRT A;  4MRY A;  2MJW B;  1C3Z A;  1JF0 A;  4AQJ A;  4CID A;  1S5G Z;  2K8M B;  2GV5 A;  1KK7 Z;  1TNP A;  1Y6W A;  1WRL A;  2JXC A;  3GK1 A;  1UHK A;  4PDZ A;  1B8C A;  3GOF A;  4INW A;  4PHN A;  1F4Q A;  2KFH A;  2M9G A;  1Z2C B;  2ZN8 A;  2OS8 B;  4WQ3 A;  4HSZ A;  2PSR A;  2QEV A;  5FI6 A;  1F54 A;  2L98 A;  1SPY A;  1QTX A;  1QXP A;  3SG5 A;  3NXA A;  1SCM B;  4DIR A;  4E68 A;  1DMO A;  1ZFS A;  4INX A;  4GGF A;  3NHT A;  1AJ4 A;  1MF8 B;  1Y1U A;  1LA0 A;  1OW4 A;  1OMV A;  2JU0 A;  2LC5 A;  3NSO A;  3WHT B;  1UHN A;  1RWY A;  2ZNE A;  2O5G A;  3JTD B;  4WRI A;  1GGW A;  2LUC A;  3I5G B;  1ZAC A;  2LLT A;  1WLZ A;  2WCK A;  4OV2 A;  2NLN A;  3S0E A;  2OS8 C;  2JQ6 A;  3EK7 A;  2BEC A;  5DKN A;  3C1V A;  4IL1 A;  4YI9 A;  1DT7 B;  1SY9 A;  3BUM B;  4PAL A;  2CBL A;  3BUO B;  3FE9 A;  1NYA A;  1REC A;  3V2L A;  3CR2 A;  3EK8 A;  3EVR A;  1SSE B;  3BUN B;  3I5G C;  4PE7 A;  4NDB A;  3SIB A;  1C7W A;  1YUS A;  1K94 A;  3JTD C;  1F55 A;  3CWG A;  1YRT B;  2WOS A;  4JPZ B;  2E30 A;  1SRA A;  4XYN A;  3N7H A;  1P28 A;  1XYD A;  1W9Z A;  2BE4 A;  1KFX S;  3SG6 A;  1QS7 A;  4HRG A;  4OCI A;  1XFV O;  1CFP A;  1GGZ A;  2NCP A;  3CS1 A;  3M0W A;  2K2A A;  1CKK A;  4GNK B;  2F2P A;  1CM4 A;  1ODB A;  2JOJ A;  2KAY A;  4F0Z B;  3OHM B;  2L2C A;  5D3O A;  3BFA A;  2WND A;  2CCM A;  2M1U A;  3IQO A;  3DYE A;  4OZD A;  5AER A;  1TNQ A;  1SNL A;  1TTX A;  2WCE A;  1XO5 A;  1TN4 A;  3CR5 X;  3B7A A;  2ZN9 A;  3D0Y A;  1QLS A;  2ZND A;  1QV1 A;  3ZWH A;  2JC2 A;  2P71 A;  3OGN A;  1UUS A;  3FIA A;  4ORA B;  4PCW A;  3SG3 A;  1SKT A;  3TDU A;  3QME A;  3RM1 A;  1XFZ O;  4YRU A;  3TUY C;  3DD4 A;  2JUL A;  2FOT A;  2YGU A;  1J7P A;  1H4B A;  2GTE A;  2FCD A;  1KK8 B;  1YVL A;  2AAO A;  2E6W A;  3RZS A;  1NPQ A;  1CNP A;  4PHK A;  1A29 A;  5ER5 A;  1YUU A;  4GUK A;  2K7O A;  5AFP A;  3PAT A;  5AXI A;  1IGV A;  3VRR A;  1B8L A;  1X02 A;  2KPH A;  3RLZ A;  1LA3 A;  1L7Z A;  1H8B A;  1FPW A;  1DF0 B;  4NDD A;  1B47 A;  1KFU S;  1TRF A;  1LKJ A;  1LXF C;  3D76 A;  3TS5 B;  1BG1 A;  2L2E A;  3BJH A;  1SCM C;  4KYN A;  5BPJ A;  2EC6 B;  1F4O A;  3FS7 A;  5HKZ A;  3SS5 A;  1MHO A;  1QVI Z;  1IRJ A;  3DVK A;  3FWC A;  3R1O A;  2JTZ A;  4DUQ A;  1OOI X;  2QDI A;  2BBN A;  3B6X A;  2LUX A;  3PAL A;  1DC1 A;  1QV0 A;  1XK4 A;  3K21 A;  2LAN A;  1Y0V H;  2NCO A;  1CM1 A;  1J1E A;  2BCA A;  2F33 A;  2M49 B;  2FCE A;  2M3W A;  2WC8 A;  2MLE C;  3VRP A;  1NCX A;  4YGA A;  1GJY A;  3NHI A;  1W7I B;  3DF0 A;  3LL8 B;  1DGU A;  2JXL A;  3O6B A;  1S6I A;  4MBE A;  5FI2 A;  1TCF A;  5KU1 A;  2KYC A;  2K7B A;  1IG5 A;  3OP0 A;  1QX2 A;  4QJ4 B;  2NXQ A;  4HRE E;  1K8U A;  4C0J A;  1A75 A;  4BY5 A;  1BOD A;  1SW8 A;  5CSN A;  1CDL A;  1YUT A;  1BU3 A;  2L4I A;  3HX4 A;  1SR6 C;  4D1E A;  4N1G A;  2L50 A;  1U5I A;  1G8I A;  3EVU A;  2HET A;  1K2H A;  3I5I B;  5J3X A;  1UHJ A;  3O4Y A;  1EG3 A;  3BUW B;  1EH2 A;  1QX5 B;  4ZCV A;  1S26 D;  2L5X B;  2OPO A;  5HKW A;  4MZL A;  1KWO B;  1KQV A;  1J7R A;  1QX7 A;  2LCP A;  3R72 A;  4R1E A;  4ETO A;  1TOP A;  3CAB A;  3B86 A;  3CZ0 A;  1QAS A;  2KQ6 A;  4GBA A;  1RRO A;  2HPS A;  2Y1M A;  3NSI A;  4PHJ A;  2JPT A;  2KI6 D;  3CTN A;  1CFD A;  2WCH A;  2PAS A;  1V1F A;  3ZNI A;  4F7F A;  5DKQ A;  1PRW A;  5CPV A;  2QEH A;  3D73 A;  2I7A A;  1HT9 A;  5FI7 A;  1C3Y A;  3VB1 A;  4CPV A;  1UUR A;  3TUY B;  1QIW A;  1XFR A;  2JNF A;  3LK1 A;  2CNP A;  2KI4 C;  3OX6 A;  1K9U A;  2NZ0 A;  5IBW A;  1E8A A;  3OB1 B;  1JBA A;  4USL A;  2KBI A;  1B1G A;  5KTY A;  1YX7 A;  2LVV A;  1CMG A;  1K93 D;  1XA5 A;  3D10 A;  2KHN A;  3TS5 C;  1OE9 B;  3PFV A;  1FI5 A;  1V1G A;  3EKH A;  1OOF A;  5DKR A;  1R2U A;  2EC6 C;  2KI6 C;  1XVJ A;  2L0P A;  1FBV A;  1UHH A;  4MZK A;  3O78 A;  3CLN A;  1NUB A;  1KK8 C;  3DZT A;  3HCM A;  5HLO A;  3S0A A;  1K96 A;  2K7C A;  2LAP A;  1S3P A;  4DCK A;  2IS9 A;  4JWQ A;  4ORC B;  3SS3 A;  1S1E A;  1BOC A;  5CSJ A;  1N0Y A;  4HRH A;  4MN0 A;  1T14 A;  3PJI A;  2PYQ A;  2WOR A;  3D78 A;  4CLN A;  2JTT A;  4NQG A;  1D1O A;  1ZUZ A;  5JJG A;  1ORG A;  1PUL A;  1KFX L;  1YX8 A;  1PVA A;  1LIN A;  1JWD A;  4DRW A;  2A4J A;  1RJV A;  2JRF A;  1S6C A;  4P5O E;  3CZ1 A;  3KF9 A;  1FW4 A;  4PE1 A;  5I2Q A;  1KFU L;  3I5F C;  4ORB B;  2BKI B;  2V53 A;  1RK9 A;  3IQQ A;  4YGB B;  1YR5 A;  2HQ8 A;  2WCF A;  2WCB A;  4NDC A;  2Q91 A;  5GQQ C;  1JFJ A;  4AOM A;  1TUZ A;  1TWO A;  2L51 A;  2PMY A;  4FQT A;  1KQM C;  1K9P A;  2ZRS A;  2M0R A;  4C0K A;  1AJ5 A;  2JPO A;  1QAT A;  2WC5 A;  4YGE B;  2CTN A;  3L47 A;  2OTG C;  1YTZ C;  3AAK A;  3OBV A;  5G08 A;  5DIC A;  2KAV A;  4IJ7 A;  1QIV A;  1ZOT B;  2BKH B;  1MR8 A;  4M2O A;  2LVJ A;  4CFR A;  2KGB C;  3L4A A;  1F8H A;  3S0F A;  2KLD A;  1YRU B;  4P2Y B;  4YI8 A;  3CGA A;  4UPG A;  3R1P A;  5AEQ A;  2ISD A;  1OSA A;  3SS4 A;  1A4P A;  5FYX A;  2WCJ A;  2AMI A;  5JOL A;  3E3R A;  4JD9 A;  1CFC A;  3KEV A;  1NWD A;  2GGM A;  3PSR A;  4FQO A;  5HL1 A;  2JT3 A;  1KSO A;  2M29 A;  4MEW A;  1UHI A;  3SG4 A;  4JKT A;  1B7T Y;  4MRX A;  2LLU A;  1U5I B;  2KFG A;  2LV7 A;  5D7F A;  2ZFD A;  2LMV A;  4ZCU A;  2M7N A;  2JWW A;  4M2P A;  2H2K A;  2MBX A;  3CDN A;  1OOH A;  1DVI A;  2H61 A;  1ZMZ A;  2B1U A;  3VRO A;  2MHH A;  3BXK A;  2LE9 B;  1DEL A;  1DQE A;  1TNW A;  5HYD A;  1RFJ A;  3CR4 X;  3OX5 A;  3R1V A;  2KI4 B;  2SCP A;  2ZKM X;  2LVK A;  3SG7 A;  3GK4 X;  1C07 A;  2MA2 A;  3FWB A;  3O4X A;  4I5K A;  4GAO A;  4C0L A;  1CFF A;  4XJK A;  3TDI A;  1AVS A;  1NX1 A;  2QPT A;  3BOW A;  2K0J A;  1J7Q A;  2LP3 A;  4YGD B;  2TN4 A;  1A2X A;  1BJF A;  4PE4 A;  1LS8 A;  3AKA A;  3K1E A;  2M1K B;  1A03 A;  4PE0 A;  1AHR A;  1SL7 A;  4PT1 A;  3CYZ A;  1XFY O;  3I5H B;  2M7L A;  1SK6 D;  1OZO A;  1WDC B;  4N1F A;  1DEK A;  1IQ3 A;  1FF1 A;  1KWO C;  3FE6 A;  2F3Z A;  1RTP 1;  3KPX A;  1DJI A;  1DJZ A;  1EXR A;  2PQL A;  2LLS A;  2MAZ A;  3I5F B;  1SCV A;  1B9A A;  3BYA A;  4YBH B;  2KOT A;  2M8U A;  1TIZ A;  1KSM A;  2QEO A;  4GPL B;  1LVC D;  1K90 D;  2K7D A;  3A8R A;  1CB1 A;  1JSA A;  2I2R E;  1J7O A;  3PM2 A;  1GQM A;  1AP4 A;  1PAL A;  3TZ1 A;  3B87 A;  3UNW A;  1WY9 A;  2VRG A;  2K60 A;  1B7T Z;  3UO9 A;  3VRN A;  1M63 B;  1F70 A;  3KO0 A;  2L4H A;  2K61 A;  1PVB A;  2JT8 A;  1DGV A;  1SR6 B;  3PN7 C;  1MQ1 A;  1OOG A;  2Y1N A;  1TNX A;  1TUJ A;  1EJ3 A;  2BNX A;  3LLE A;  4A4B A;  4CFQ A;  3S0B A;  1CLM A;  2KDH A;  3CZT X;  1WRZ A;  1N2D A;  1XFU O;  2LVI A;  3D75 A;  5HKY A;  1S5G Y;  3IVT A;  3BUX B;  1Y1A A;  3AAJ A;  1CLB A;  2OTG B;  2KBM A;  5I8N A;  1AK8 A;  4L9M A;  2BCX A;  3NSK A;  4I5N B;  1IJ6 A;  1JUO A;  1G4Y R;  2G2B A;  1KQM B;  3BQ3 A;  1SL8 A;  1A75 B;  1MUX A;  1EG4 A;  1M45 A;  2ERB A;  2BBM A;  1UWO A;  3TDZ A;  1BLQ A;  1CDP A;  1J1D A;  1S6J A;  2F8P A;  2KGR A;  1M46 A;  3DVM A;  4MLW A;  4QJ3 B;  3EK4 A;  5CSI A;  1DJG A;  2LMT A;  1NCZ A;  4OR9 B;  4BY4 A;  2GGZ A;  2HQW A;  1NIW A;  1PSB A;  3F45 A;  2HF5 A;  1NCY A;  2WCM A;  1N65 A;  1MXE A;  3GK2 A;  3I5I C;  3IF7 A;  2H61 C;  2MRD A;  1PK0 D;  1WRK A;  1K9K A;  2LHI A;  2O60 A;  3PLF B;  4XJK B;  2I18 A;  1FI6 A;  3DF0 B;  1Y1X A;  2KNE A;  1IKU A;  2CXJ A;  4WQ2 A;  3DXL A;  2M97 A;  3EG5 B;  3JVT B;  1BR4 B;  1SMG A;  1SYM A;  3OB2 B;  1NSH A;  1IQ5 A;  3D0Y B;  1R6P A;  1EL4 A;  2MLF C;  2WC6 A;  5CSF A;  1S36 A;  3BFH A;  2KAX A;  4Q04 A;  1IH0 A;  1K95 A;  2FJU B;  1BMO A;  2BCB A;  3S0D A;  2BL0 C;  1L2O C;  1IJ5 A;  1OOJ A;  2BAP A;  3S0G A;  1OMR A;  3AKB A;  4OVN F;  2Y5I A;  4I5L B;  1VRK A;  1OQP A;  4JQ0 D;  3DVE A;  3H4S E;  1CDM A;  3MSE B;  3SJS A;  1ALV A;  3NGV A;  1DJW A;  3PN7 B;  5AAN A;  2L5Y A;  3PM8 A;  4A4C A;  2P6B B;  1G33 A;  2SAS A;  1WLM A;  2LHL A;  1BF5 A;  5KSZ A;  4GGN A;  1TCO B;  1CMF A;  1SBJ A;  1C7V A;  3BOW B;  2LMU A;  3O2P A;  3KHE A;  1DF0 A;  2KQY A;  1Q80 A;  1NP8 A;  1QVI Y;  2P70 A;  5I2L A;  4ICB A;  3EVV A;  3EKJ A;  2R2I A;  3LK0 A;  1DTL A;  1OMD A;  1PSR A;  2QAC A;  1CDN A;  5F6T A;  4AQI A;  1AUI B;  3SG2 A;  2F2O A;  3A4U B;  2WCL A;  1NX0 A;  2PVB A;  2JZI A;  4GFT A;  4QJ5 B;  3I5H C;  1L2O B;  2BL0 B;  3BFB A;  1KK7 Y;  2EGD A;  1HQV A;  1IWQ A;  3WNX B;  4FTG A;  3D77 A;  2I94 A;  1XK4 C;  1BT6 A;  1JC2 A;  1OZS A;  1IIO A;  3DVJ A;  4MSP A;  2PRU A;  1CLL A;  2LP2 A;  1J55 A;  2CT9 A;  3JVT C;  2QEB A;  4N5X A;  3VGO A;  1YUR A;  1XFW O;  3WHU B;  5D69 A;  2AUC A;  5HLV A;  2KFF A;  2LNK A;  4YGC B;  1DJH A;  1SL9 A;  1B8R A;  1NX2 A;  2KLE A;  2K2F A;  1BR1 B;  4U8D A;  1W7J B;  4GGF C;  3DY9 A;  2KSP A;  1GM0 A;  1QJT A;  2Q4U A;  3CZ2 A;  5K89 A;  1B4C A;  4MZJ A;  3QRX A;  2BE6 A;  2D8N A;  2LM5 A;  3Q8I A;  3VRQ A;  2F3Y A;  2RGI A;  5PAL A;  5TNC A;  1WDC C;  4TNC A;  3B88 A;  1NX3 A;  3NSL A;  5EL2 A;  1M39 A;  1ALW A;  5I94 A;  2COL B;  4OKH A;  3ICB A;  2PAL A;  2H8V A;  1DJX A;  1M31 A;  2G9B A;  2JT0 A;  4I5J A;  3WXA A;  3D74 A;  1YVH A;  1KCY A;  1JF2 A;  3L4L A;  2DOQ A;  2EHB A;  1MXL C; 
#chains in the Genus database with same CATH homology
 5I2O A;  2JNX A;  4M2Q A;  5ER4 X;  1XFX O;  1UP5 A;  1CTR A;  1JFK A;  5B8I B;  4PHM A;  1F71 A;  4DS7 A;  1DJY A;  1QLK A;  3LCP C;  2KYF A;  1MWN A;  2Y4Q A;  4MVF A;  3SIA A;  2ZRT A;  4MRY A;  2MJW B;  4CID A;  1JF0 A;  4AQJ A;  1S5G Z;  2K8M B;  2GV5 A;  1KK7 Z;  1TNP A;  1Y6W A;  1WRL A;  2JXC A;  3GK1 A;  1UHK A;  4PDZ A;  1B8C A;  3GOF A;  4PHN A;  1F4Q A;  2KFH A;  2M9G A;  2ZN8 A;  2OS8 B;  4WQ3 A;  4HSZ A;  2PSR A;  1F54 A;  2L98 A;  1SPY A;  1QTX A;  1QXP A;  3SG5 A;  3NXA A;  1SCM B;  4DIR A;  4E68 A;  1DMO A;  1ZFS A;  4GGF A;  1AJ4 A;  1MF8 B;  1Y1U A;  1LA0 A;  1OMV A;  2JU0 A;  2LC5 A;  3NSO A;  3WHT B;  1UHN A;  1RWY A;  2ZNE A;  2O5G A;  3JTD B;  4WRI A;  1GGW A;  2LUC A;  3I5G B;  1ZAC A;  2LLT A;  1WLZ A;  4OV2 A;  2NLN A;  2OS8 C;  2JQ6 A;  3EK7 A;  2BEC A;  5DKN A;  3C1V A;  4IL1 A;  4YI9 A;  1DT7 B;  1SY9 A;  3BUM B;  4PAL A;  2CBL A;  3BUO B;  1NYA A;  1REC A;  3CR2 A;  3EK8 A;  3EVR A;  3BUN B;  3I5G C;  4PE7 A;  4NDB A;  3SIB A;  1C7W A;  1YUS A;  1K94 A;  3JTD C;  1F55 A;  3CWG A;  1YRT B;  2WOS A;  4JPZ B;  2E30 A;  1SRA A;  4XYN A;  1XYD A;  2BE4 A;  3SG6 A;  1KFX S;  1QS7 A;  4HRG A;  4OCI A;  1XFV O;  1CFP A;  1GGZ A;  2NCP A;  3CS1 A;  3M0W A;  2K2A A;  1CKK A;  4GNK B;  2F2P A;  1CM4 A;  1ODB A;  2JOJ A;  2KAY A;  4F0Z B;  3OHM B;  2WND A;  2CCM A;  2M1U A;  3IQO A;  5AER A;  1TNQ A;  1SNL A;  1TTX A;  2WCE A;  1XO5 A;  1TN4 A;  3CR5 X;  2ZN9 A;  3D0Y A;  1QLS A;  2ZND A;  1QV1 A;  3ZWH A;  2JC2 A;  4ORA B;  4PCW A;  1UUS A;  3FIA A;  3SG3 A;  1SKT A;  3TDU A;  3RM1 A;  4YRU A;  1XFZ O;  3TUY C;  3DD4 A;  2JUL A;  2FOT A;  1J7P A;  1H4B A;  2FCD A;  1KK8 B;  1YVL A;  2AAO A;  2E6W A;  1NPQ A;  1CNP A;  4PHK A;  1A29 A;  5ER5 A;  1YUU A;  4GUK A;  2K7O A;  5AFP A;  3PAT A;  5AXI A;  1IGV A;  3VRR A;  1B8L A;  1X02 A;  3RLZ A;  1LA3 A;  1L7Z A;  1H8B A;  1FPW A;  1DF0 B;  4NDD A;  1B47 A;  1KFU S;  1LKJ A;  1LXF C;  1TRF A;  3TS5 B;  1BG1 A;  2L2E A;  1SCM C;  5BPJ A;  2EC6 B;  1F4O A;  3FS7 A;  5HKZ A;  1MHO A;  1QVI Z;  1IRJ A;  3DVK A;  3FWC A;  2JTZ A;  4DUQ A;  2BBN A;  2LUX A;  3PAL A;  1QV0 A;  1XK4 A;  3K21 A;  2LAN A;  1Y0V H;  2NCO A;  1CM1 A;  1J1E A;  2BCA A;  2F33 A;  2M49 B;  2FCE A;  2M3W A;  2WC8 A;  2MLE C;  3VRP A;  1NCX A;  4YGA A;  1GJY A;  1W7I B;  3DF0 A;  3LL8 B;  1DGU A;  2JXL A;  3O6B A;  1S6I A;  4MBE A;  5KU1 A;  1TCF A;  2KYC A;  2K7B A;  1IG5 A;  3OP0 A;  1QX2 A;  4QJ4 B;  2NXQ A;  4HRE E;  1K8U A;  4C0J A;  1A75 A;  4BY5 A;  1BOD A;  1SW8 A;  5CSN A;  1CDL A;  1YUT A;  1BU3 A;  2L4I A;  3HX4 A;  1SR6 C;  4D1E A;  4N1G A;  2L50 A;  1U5I A;  1G8I A;  3EVU A;  2HET A;  1K2H A;  3I5I B;  5J3X A;  1UHJ A;  3O4Y A;  1EG3 A;  3BUW B;  1EH2 A;  1QX5 B;  4ZCV A;  1S26 D;  2L5X B;  2OPO A;  5HKW A;  4MZL A;  1KWO B;  1KQV A;  1J7R A;  1QX7 A;  2LCP A;  4R1E A;  4ETO A;  1TOP A;  1QAS A;  2KQ6 A;  4GBA A;  1RRO A;  2HPS A;  2Y1M A;  3NSI A;  4PHJ A;  2JPT A;  2KI6 D;  3CTN A;  1CFD A;  3ZNI A;  2PAS A;  1V1F A;  5DKQ A;  1PRW A;  5CPV A;  2I7A A;  1HT9 A;  4CPV A;  1UUR A;  3TUY B;  1QIW A;  2JNF A;  3LK1 A;  2CNP A;  2KI4 C;  3OX6 A;  1K9U A;  2NZ0 A;  5IBW A;  1E8A A;  3OB1 B;  1JBA A;  4USL A;  2KBI A;  1B1G A;  5KTY A;  1YX7 A;  2LVV A;  1CMG A;  1K93 D;  1XA5 A;  3D10 A;  2KHN A;  3TS5 C;  1OE9 B;  3PFV A;  1FI5 A;  1V1G A;  3EKH A;  5DKR A;  1R2U A;  2EC6 C;  2KI6 C;  1XVJ A;  2L0P A;  1FBV A;  1UHH A;  4MZK A;  3O78 A;  3CLN A;  1NUB A;  1KK8 C;  3HCM A;  5HLO A;  1K96 A;  2K7C A;  2LAP A;  1S3P A;  4DCK A;  2IS9 A;  4JWQ A;  4ORC B;  1S1E A;  1BOC A;  5CSJ A;  1N0Y A;  4HRH A;  4MN0 A;  2WOR A;  1D1O A;  4CLN A;  2JTT A;  4NQG A;  1ZUZ A;  5JJG A;  1PUL A;  1KFX L;  1YX8 A;  1PVA A;  1LIN A;  1JWD A;  4DRW A;  2A4J A;  1RJV A;  2JRF A;  1S6C A;  4P5O E;  3KF9 A;  1FW4 A;  4PE1 A;  5I2Q A;  1KFU L;  3I5F C;  4ORB B;  2BKI B;  2V53 A;  1RK9 A;  3IQQ A;  4YGB B;  1YR5 A;  2HQ8 A;  2WCF A;  2WCB A;  4NDC A;  2Q91 A;  5GQQ C;  1JFJ A;  4AOM A;  2L51 A;  2PMY A;  1KQM C;  1K9P A;  2ZRS A;  2M0R A;  4C0K A;  1AJ5 A;  1QAT A;  4YGE B;  2CTN A;  2OTG C;  1YTZ C;  3AAK A;  5G08 A;  2KAV A;  1QIV A;  1ZOT B;  2BKH B;  1MR8 A;  4M2O A;  2LVJ A;  4CFR A;  2KGB C;  1F8H A;  1YRU B;  4P2Y B;  4YI8 A;  3CGA A;  4UPG A;  5AEQ A;  2ISD A;  1OSA A;  1A4P A;  5FYX A;  2AMI A;  5JOL A;  3E3R A;  1CFC A;  3KEV A;  1NWD A;  2GGM A;  3PSR A;  4FQO A;  2JT3 A;  1KSO A;  2M29 A;  4MEW A;  1UHI A;  3SG4 A;  1B7T Y;  4MRX A;  2LLU A;  1U5I B;  2KFG A;  2LV7 A;  5D7F A;  2ZFD A;  2LMV A;  4ZCU A;  2M7N A;  2JWW A;  4M2P A;  2H2K A;  2MBX A;  2H61 A;  1DVI A;  1ZMZ A;  2B1U A;  3VRO A;  2MHH A;  3BXK A;  2LE9 B;  1TNW A;  5HYD A;  1RFJ A;  3CR4 X;  3OX5 A;  2KI4 B;  2SCP A;  2ZKM X;  2LVK A;  3SG7 A;  3GK4 X;  1C07 A;  2MA2 A;  3FWB A;  4I5K A;  4GAO A;  4C0L A;  1CFF A;  4XJK A;  3TDI A;  1AVS A;  1NX1 A;  2QPT A;  3BOW A;  2K0J A;  1J7Q A;  2LP3 A;  4YGD B;  2TN4 A;  1A2X A;  1BJF A;  4PE4 A;  3AKA A;  2M1K B;  1A03 A;  4PE0 A;  1AHR A;  1SL7 A;  1XFY O;  3I5H B;  2M7L A;  1SK6 D;  1OZO A;  1WDC B;  4N1F A;  1IQ3 A;  1FF1 A;  1KWO C;  2F3Z A;  1RTP 1;  3KPX A;  1DJI A;  1DJZ A;  1EXR A;  3I5F B;  2LLS A;  2MAZ A;  1SCV A;  1B9A A;  3BYA A;  4YBH B;  2KOT A;  2M8U A;  1TIZ A;  1KSM A;  4GPL B;  1LVC D;  1K90 D;  2K7D A;  3A8R A;  1CB1 A;  1JSA A;  2I2R E;  1J7O A;  1GQM A;  1AP4 A;  1PAL A;  3TZ1 A;  1WY9 A;  2VRG A;  1B7T Z;  3VRN A;  1M63 B;  1F70 A;  3KO0 A;  2L4H A;  2K61 A;  1PVB A;  2JT8 A;  1DGV A;  1SR6 B;  3PN7 C;  1MQ1 A;  2Y1N A;  1TNX A;  3LLE A;  1EJ3 A;  4CFQ A;  4A4B A;  1CLM A;  2KDH A;  3CZT X;  1WRZ A;  1N2D A;  1XFU O;  2LVI A;  5HKY A;  1S5G Y;  3BUX B;  1Y1A A;  3AAJ A;  1CLB A;  2OTG B;  2KBM A;  5I8N A;  1AK8 A;  4L9M A;  2BCX A;  3NSK A;  4I5N B;  1IJ6 A;  1JUO A;  1G4Y R;  2G2B A;  1KQM B;  3BQ3 A;  1SL8 A;  1A75 B;  1MUX A;  1EG4 A;  1M45 A;  2BBM A;  1UWO A;  3TDZ A;  1BLQ A;  1CDP A;  1J1D A;  1S6J A;  2F8P A;  2KGR A;  1M46 A;  3DVM A;  4MLW A;  4QJ3 B;  3EK4 A;  5CSI A;  1DJG A;  2LMT A;  1NCZ A;  4OR9 B;  4BY4 A;  2GGZ A;  2HQW A;  1NIW A;  1PSB A;  3F45 A;  2HF5 A;  1NCY A;  1N65 A;  1MXE A;  3GK2 A;  3I5I C;  3IF7 A;  2H61 C;  2MRD A;  1PK0 D;  1WRK A;  1K9K A;  2LHI A;  2O60 A;  3PLF B;  4XJK B;  2I18 A;  1FI6 A;  3DF0 B;  1Y1X A;  2KNE A;  1IKU A;  2CXJ A;  4WQ2 A;  2M97 A;  3JVT B;  1BR4 B;  1SMG A;  1SYM A;  3OB2 B;  1NSH A;  1IQ5 A;  3D0Y B;  1R6P A;  1EL4 A;  2MLF C;  5CSF A;  1S36 A;  4Q04 A;  2KAX A;  1IH0 A;  1K95 A;  2FJU B;  1BMO A;  2BCB A;  2BL0 C;  1L2O C;  1IJ5 A;  1OOJ A;  1OMR A;  3AKB A;  4OVN F;  2Y5I A;  4I5L B;  1VRK A;  1OQP A;  4JQ0 D;  3DVE A;  3H4S E;  1CDM A;  3MSE B;  3SJS A;  1ALV A;  1DJW A;  3PN7 B;  5AAN A;  3PM8 A;  4A4C A;  2P6B B;  1G33 A;  2SAS A;  1WLM A;  2LHL A;  1BF5 A;  5KSZ A;  4GGN A;  1TCO B;  1CMF A;  1SBJ A;  1C7V A;  3BOW B;  2LMU A;  3O2P A;  3KHE A;  1DF0 A;  2KQY A;  1Q80 A;  1NP8 A;  1QVI Y;  5I2L A;  4ICB A;  3EVV A;  3EKJ A;  2R2I A;  3LK0 A;  1DTL A;  1OMD A;  1PSR A;  2QAC A;  1CDN A;  5F6T A;  4AQI A;  1AUI B;  3SG2 A;  2F2O A;  3A4U B;  1NX0 A;  2PVB A;  2JZI A;  4GFT A;  4QJ5 B;  3I5H C;  1L2O B;  2BL0 B;  1KK7 Y;  2EGD A;  1HQV A;  1IWQ A;  3WNX B;  4FTG A;  2I94 A;  1XK4 C;  1BT6 A;  1JC2 A;  1OZS A;  3DVJ A;  4MSP A;  2PRU A;  1CLL A;  2LP2 A;  1J55 A;  2CT9 A;  3JVT C;  4N5X A;  3VGO A;  1YUR A;  1XFW O;  3WHU B;  5D69 A;  2AUC A;  5HLV A;  2KFF A;  2LNK A;  4YGC B;  1DJH A;  1SL9 A;  1B8R A;  1NX2 A;  4U8D A;  2K2F A;  1BR1 B;  1W7J B;  4GGF C;  2KSP A;  1QJT A;  2Q4U A;  5K89 A;  1B4C A;  4MZJ A;  3QRX A;  2BE6 A;  2D8N A;  2LM5 A;  3VRQ A;  2F3Y A;  2RGI A;  5PAL A;  5TNC A;  1WDC C;  4TNC A;  1NX3 A;  3NSL A;  1M39 A;  1ALW A;  2COL B;  4OKH A;  3ICB A;  2PAL A;  1DJX A;  1M31 A;  2G9B A;  2JT0 A;  4I5J A;  3WXA A;  1YVH A;  1KCY A;  1JF2 A;  2DOQ A;  2EHB A;  1MXL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...