1XFXO

Crystal structure of anthrax edema factor (ef) in complex with calmodulin in the presence of 10 millimolar exogenously added calcium chloride
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
146
structure length
146
Chain Sequence
QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDQMIREADIDGDGQVNYEEFVQMMTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin-sensitive adenylate cyclase
publication title Calcium-independent calmodulin binding and two-metal-ion catalytic mechanism of anthrax edema factor.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Lyase/metal binding protein
total genus 33
structure length 146
sequence length 146
chains with identical sequence P, Q, R, S, T
ec nomenclature
pdb deposition date 2004-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xfxO01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xfxO02
5IBWA 4ORAB 1IQ5A 1AJ4A 1PVAA 3ZNIA 1B9AA 2K7CA 4NQGA 2LLUA 1N2DA 4MSPA 2BL0B 1IG5A 1BT6A 3RM1A 4M2QA 1QIVA 2E30A 1QTXA 1SRAA 3KPXA 1M31A 4ORCB 3NSKA 1TNPA 1PALA 2KFFA 3DVJA 1UWOA 1KFXS 1NCXA 4PDZA 4U8DA 2MA2A 5CSJA 1PULA 3BYAA 1CTRA 1F70A 1AVSA 2KGRA 2CNPA 4WQ2A 4TNCA 1XFXO 3IQQA 4JWQA 3I5HC 2PVBA 2EC6B 1OMRA 1QVIY 3IQOA 1K90D 1LA0A 1TIZA 3E3RA 3TS5C 1BLQA 1BODA 1DJHA 4GBAA 1QX5B 1IJ6A 1WY9A 2KAXA 1JSAA 3DVEA 4N1GA 3TUYC 2R2IA 1QX2A 1OZSA 3O2PA 1FPWA 1OSAA 1OMVA 1XFZO 3VRRA 2GGMA 5HKWA 1S6JA 1JC2A 4GGFA 1PK0D 3TS5B 1DJWA 1AUIB 3NSIA 3CZTX 1L7ZA 2F3YA 3SJSA 1QS7A 2I94A 4PALA 2PRUA 1BR1B 2B1UA 2LVJA 5K89A 5HLVA 4CIDA 2LCPA 3OB2B 3GK2A 2SASA 3BUOB 1AP4A 5I2LA 1ZACA 2BBMA 3CGAA 3GK4X 1SCVA 1M46A 1IQ3A 3FWBA 5AEQA 2JRFA 1NX1A 2JNXA 4I5JA 2JU0A 4JQ0D 2AUCA 2HQWA 1TOPA 2M3WA 5GQQC 4YGCB 4MRXA 4NDBA 2I7AA 1FW4A 2KNEA 2LVVA 4JPZB 3I5FB 1QATA 5CSNA 1BR4B 3DF0A 2LANA 2A4JA 3BQ3A 1CFDA 1S26D 1IGVA 4YGAA 3TDIA 5AFPA 4OCIA 1DJYA 1NX3A 3NSOA 2V53A 1KQVA 1J55A 3I5IC 1GJYA 2LVKA 2M8UA 2PSRA 3GK1A 3O78A 4GFTA 5J3XA 1C07A 3EKHA 3KO0A 1B8LA 4YI8A 2L98A 2JTZA 2PASA 1CLBA 4MN0A 3OX5A 1KFXL 3CTNA 5KSZA 1IJ5A 1B8RA 1G8IA 1NWDA 1QXPA 1ZFSA 2JOJA 2NCOA 3JTDB 1ALVA 1FI5A 2Y4QA 1EG4A 2FCEA 4DUQA 3DF0B 1KSOA 2MLEC 5HYDA 1CMFA 1G33A 1NCZA 1B7TY 2I18A 1CLLA 1CNPA 1QX7A 3PLFB 1CKKA 2LMUA 3IF7A 1J7PA 3D0YA 1A2XA 1F71A 2KAVA 3LL8B 5ER4X 1S3PA 1SY9A 1XFVO 1MR8A 4AOMA 4Q04A 1XK4C 2M7NA 3SG6A 1KSMA 2KYFA 4PHMA 2CXJA 1WLZA 3SG2A 1CFFA 4ETOA 2ZFDA 4GUKA 2M1UA 1IKUA 1RECA 2M7LA 2BL0C 2WNDA 2Q91A 3OP0A 4QJ4B 5AERA 1KQMB 1OQPA 5CSIA 3CR5X 1CM1A 2IS9A 1DJIA 1KCYA 3EK4A 3D0YB 3NXAA 5TNCA 1Y1XA 1U5IB 5JJGA 2BCXA 4QJ3B 1KWOB 2MHHA 5D69A 2ZRSA 4WQ3A 1EJ3A 1ZUZA 1J7QA 1F55A 2JT8A 3H4SE 3VRPA 1UHIA 1BF5A 1OZOA 2EC6C 4D1EA 2G9BA 1SYMA 4YGEB 2BKHB 4QJ5B 2HPSA 1KFUL 3WXAA 4GPLB 1UHJA 4AQIA 1SCMB 3KF9A 3AKAA 4WRIA 4PE7A 3VROA 1CDPA 1AHRA 2Q4UA 1ODBA 2K7OA 5CSFA 1X02A 1M45A 2LV7A 2QACA 1YURA 3JVTC 3F45A 4ICBA 3OHMB 2ISDA 2KI6C 1CDNA 1SL9A 2JT0A 1JFKA 2JXCA 4ZCVA 2D8NA 1S5GY 1Y1AA 1Y6WA 4GAOA 2CBLA 4UPGA 2KGBC 4PHKA 1IWQA 1R2UA 2M29A 4CPVA 1K2HA 1DF0A 1G4YR 1GGZA 4NDCA 1SR6B 2FCDA 4PE0A 3SIAA 1QLKA 3JVTB 4PCWA 1A03A 2JZIA 2BCBA 2CCMA 2LMVA 4OR9B 2ZKMX 2K2FA 3PATA 1WDCB 3ICBA 5HLOA 2QPTA 1DVIA 1QV0A 1CDLA 1NYAA 2LHLA 3CR2A 1PRWA 3I5GB 1YVHA 4GGFC 2PMYA 2TN4A 1KK7Y 2KQYA 3M0WA 1F8HA 1DF0B 2JNFA 1LINA 1Y0VH 1XVJA 4L9MA 1XO5A 3WHUB 2NZ0A 3I5FC 4HRGA 2KI6D 1FF1A 3FS7A 4C0LA 1WLMA 1N0YA 2M9GA 1SNLA 1ZMZA 3EKJA 4M2OA 5DKRA 5I2QA 1SKTA 1J1DA 1YX7A 1TNQA 1SL8A 2KFGA 3BXKA 1KFUS 4YBHB 4DIRA 2MAZA 3LK1A 3RLZA 1YUUA 3KHEA 1S6IA 2BCAA 1TCOB 2LUCA 4MVFA 2K2AA 1YUTA 1H8BA 1M39A 2JWWA 1WRKA 3SG7A 2KAYA 5I2OA 1UHKA 2AAOA 3CLNA 5DKNA 2F33A 3JTDC 1B8CA 3A8RA 1QVIZ 1K9PA 2CTNA 2JULA 3PN7B 4I5NB 1F4OA 2LUXA 3DD4A 3OB1B 4MZJA 2LC5A 2EGDA 4PE1A 1YRTB 3AKBA 1MWNA 4DRWA 1S6CA 1XA5A 1B1GA 4P2YB 2L4IA 2NLNA 1AK8A 1C7VA 1A75A 5FYXA 3DVMA 2G2BA 2WORA 5HKZA 1QLSA 4XJKA 2PALA 1TNXA 2H61A 2LP3A 2BECA 1J7RA 2OS8C 3LLEA 2H61C 1VRKA 1JFJA 2WCFA 3O6BA 1YUSA 1FI6A 2K7BA 1JUOA 1KQMC 2JXLA 2KI4B 1K9KA 4BY5A 1RWYA 1U5IA 5HKYA 4CFRA 1JBAA 1A75B 4MLWA 3PFVA 1CLMA 1KWOC 5AANA 4YGDB 2L2EA 4XJKB 1YR5A 3HX4A 2OS8B 1K94A 1LVCD 5ER5A 1UP5A 1AJ5A 2BKIB 3BUXB 4PHJA 1EXRA 1XFWO 1DT7B 1E8AA 2MBXA 2JTTA 2I2RE 1LKJA 2COLB 3D10A 4BY4A 1JF2A 5D7FA 1RTP1 1SCMC 4IL1A 1BG1A 3A4UB 1R6PA 2MLFC 2LE9B 1EH2A 1M63B 1NSHA 2E6WA 1Y1UA 1CB1A 1OOJA 4OKHA 4DS7A 3KEVA 1CFPA 2K61A 3BUMB 3EVUA 2KDHA 1BJFA 1NIWA 2M97A 3SG5A 1QIWA 1SK6D 2WCEA 1RJVA 1SMGA 1RFJA 2K8MB 1NP8A 1MQ1A 1V1FA 3DVKA 2K0JA 2KBMA 1SL7A 2L5XB 4I5LB 4MRYA 1TNWA 1J1EA 1DGVA 4CFQA 3EVVA 1B47A 5KTYA 2LLSA 4ZCUA 1SR6C 4FQOA 2M49B 4ORBB 1JF0A 2FJUB 1CFCA 2JC2A 1DJXA 3BUWB 2M1KB 1DTLA 1B7TZ 2BE4A 1W7JB 1DGUA 1GQMA 3VRQA 1MXEA 1S1EA 1B4CA 4C0JA 3AAJA 3WNXB 4YGBB 1WDCC 1GGWA 4OV2A 1TRFA 5G08A 3I5GC 5AXIA 2LP2A 3OX6A 1ALWA 2NXQA 1BOCA 1KK8C 1FBVA 1HT9A 2JQ6A 4NDDA 1PSRA 3EK8A 1NPQA 1NX2A 1SBJA 4MBEA 1Q80A 4A4CA 1RROA 4AQJA 3SG3A 1PSBA 2WOSA 3ZWHA 3NSLA 2LM5A 4GGNA 3MSEB 1YVLA 3K21A 1K8UA 1JWDA 2VRGA 4HRHA 1QJTA 1TCFA 2MJWB 2OTGC 3VRNA 4N5XA 5JOLA 2KBIA 1KK8B 4F0ZB 3SIBA 3FWCA 4DCKA 5I8NA 1K93D 2LAPA 1OMDA 4I5KA 1YRUB 1SPYA 2L51A 1NX0A 4XYNA 3EVRA 1HQVA 3BOWA 2FOTA 1N65A 1DMOA 2KYCA 4YRUA 3GOFA 2LMTA 3PN7C 3CR4X 3VGOA 2ZNDA 2LLTA 2ZN9A 2LVIA 3I5HB 2L50A 1K95A 1F4QA 1UUSA 1C7WA 4M2PA 5B8IB 1YTZC 1L2OC 2OTGB 1A29A 4MZLA 1S36A 2P6BB 4FTGA 3TUYB 2WCBA 4C0KA 2OPOA 2CT9A 2NCPA 1S5GZ 3QRXA 2RGIA 2MRDA 4N1FA 1NCYA 2H2KA 3BOWB 5PALA 2AMIA 1CDMA 3TDUA 1CMGA 1OE9B 3HCMA 1CM4A 3PM8A 5KU1A 2GV5A 4HREE 1L2OB 2KI4C 4R1EA 1XFUO 2EHBA 3PSRA 4YI9A 1MF8B 2LNKA 2L0PA 2KQ6A 1W7IB 3SG4A 5BPJA 3O4YA 2ZRTA 3WHTB 2Y1NA 1NUBA 1IRJA 2K7DA 2HF5A 1UHNA 1TN4A 3CWGA 2KHNA 2KFHA 1PVBA 1K96A 1DJZA 4E68A 1KK7Z 2F3ZA 1V1GA 3C1VA 1BMOA 5CPVA 1UHHA 2BE6A 2GGZA 2HETA 2SCPA 4HSZA 2JT3A 2ZN8A 3TDZA 2JPTA 3LK0A 2KOTA 1LA3A 1SW8A 3PALA 3FIAA 5F6TA 2Y5IA 3CS1A 4MZKA 1MXLC 3LCPC 1BU3A 1MHOA 1D1OA 2F2PA 1TTXA 3BUNB 4A4BA 1H4BA 2DOQA 2KSPA 2HQ8A 3I5IB 1DJGA 1XK4A 1YX8A 4GNKB 4MEWA 2F8PA 1EL4A 1XYDA 2O5GA 5DKQA 1QASA 2BBNA 3AAKA 1K9UA 1WRZA 1LXFC 2WC8A 1J7OA 2M0RA 3EK7A 2L4HA 1IH0A 1RK9A 1ZOTB 1F54A 4PHNA 1XFYO 2F2OA 4CLNA 4PE4A 2O60A 4USLA 2LHIA 1UURA 1A4PA 2ZNEA 1MUXA 1QV1A 4OVNF 1WRLA 2Y1MA 1EG3A 4P5OE 3TZ1A
chains in the Genus database with same CATH superfamily
2PYQA 4ORAB 5IBWA 1IQ5A 1AJ4A 1W9ZA 1PVAA 3ZNIA 1B9AA 2K7CA 4NQGA 2LLUA 1N2DA 3Q8IA 2BL0B 4MSPA 1IG5A 1BT6A 4KYNA 3RM1A 1DELA 4M2QA 1QIVA 2E30A 1QTXA 2WCHA 1SRAA 3KPXA 1M31A 4ORCB 3NSKA 1TNPA 1PALA 2KFFA 3DVJA 1UWOA 3PJIA 1KFXS 1NCXA 4PDZA 1OOHA 4U8DA 2MA2A 5CSJA 1PULA 3BYAA 1CTRA 1F70A 1AVSA 2KGRA 2CNPA 4WQ2A 4TNCA 1CMFA 1XFXO 3EG5B 3IQQA 4JWQA 3I5HC 2PVBA 5HL1A 2EC6B 1OMRA 1QVIY 3IQOA 1K90D 1LA0A 1TIZA 3E3RA 3TS5C 1BLQA 1BODA 1DJHA 4GBAA 1QX5B 1IJ6A 1WY9A 2KAXA 1JSAA 3DVEA 4N1GA 3TUYC 2BNXA 2R2IA 4JD9A 1QX2A 1OZSA 3O2PA 1FPWA 1OSAA 1OMVA 1XFZO 2QEBA 3VRRA 2GGMA 5D3OA 5HKWA 1S6JA 1JC2A 3DZTA 4GGFA 1PK0D 3TS5B 1DJWA 1AUIB 3NSIA 3QMEA 3CZTX 1L7ZA 2F3YA 3SJSA 1QS7A 2I94A 4PALA 2PRUA 1BR1B 2B1UA 2LVJA 5K89A 5HLVA 4CIDA 2LCPA 3OB2B 3GK2A 3R1PA 2SASA 3BUOB 3RZSA 1AP4A 5I2LA 1Z2CB 1ZACA 2YGUA 3L4LA 2BBMA 3CGAA 3GK4X 1SCVA 1M46A 1IQ3A 3FWBA 5AEQA 2JRFA 3B7AA 1NX1A 2P70A 2BAPA 2JNXA 5I94A 4I5JA 2JU0A 4JQ0D 1Z4HA 1TUZA 2AUCA 2HQWA 1TOPA 2M3WA 4INXA 5GQQC 4YGCB 4MRXA 3OBVA 2I7AA 4NDBA 1FW4A 2KNEA 2LVVA 4JPZB 3I5FB 1QATA 5CSNA 1BR4B 3DF0A 2LANA 2KLDA 3DY9A 2A4JA 3BQ3A 1CFDA 1S26D 1IGVA 4YGAA 3TDIA 5AFPA 4OCIA 1DJYA 1NX3A 3NSOA 2V53A 1KQVA 1J55A 3I5IC 1GJYA 2LVKA 2M8UA 2PSRA 3GK1A 3O78A 4GFTA 5EL2A 5J3XA 2QEHA 1C07A 3EKHA 3KO0A 3L47A 1B8LA 4YI8A 2L98A 2JTZA 2PASA 1CLBA 4MN0A 3OX5A 1KFXL 3CTNA 5KSZA 1IJ5A 1B8RA 1G8IA 1NWDA 1QXPA 1ZFSA 2JOJA 3PM2A 2NCOA 3JTDB 1ALVA 1FI5A 2Y4QA 1EG4A 2FCEA 3IVTA 3DF0B 1KSOA 2MLEC 4DUQA 5HYDA 3FE8A 1G33A 1NCZA 1B7TY 2I18A 1CLLA 1CNPA 1QX7A 3PLFB 1CKKA 2LMUA 3IF7A 3CYZA 1J7PA 3S0BA 3D0YA 3UNWA 1A2XA 1F71A 2KAVA 3LL8B 5ER4X 1S3PA 1SY9A 1XFVO 1MR8A 4AOMA 2WCKA 4Q04A 1XK4C 2M7NA 3SG6A 1KSMA 2KYFA 4PHMA 2CXJA 1WLZA 3SG2A 2QEOA 3D76A 1CFFA 4ETOA 2ZFDA 4GUKA 2M1UA 1IKUA 1RECA 2M7LA 2BL0C 2WNDA 2Q91A 3OP0A 4QJ4B 5AERA 1KQMB 1OQPA 5CSIA 3CR5X 1CM1A 2IS9A 1DJIA 1KCYA 3EK4A 3D0YB 3NXAA 5TNCA 1Y1XA 1U5IB 5JJGA 2BCXA 4QJ3B 1KWOB 2MHHA 5D69A 2ZRSA 4WQ3A 1EJ3A 1ZUZA 1J7QA 1F55A 2JT8A 3H4SE 3VRPA 1UHIA 1BF5A 1OZOA 2EC6C 4D1EA 2G9BA 1SYMA 4YGEB 2BKHB 4QJ5B 2HPSA 1KFUL 3WXAA 4GPLB 1UHJA 4AQIA 1SCMB 3KF9A 3AKAA 4WRIA 4F7FA 4PE7A 3VROA 1CDPA 1AHRA 2Q4UA 1ODBA 2K7OA 5CSFA 1X02A 1M45A 2LV7A 2QACA 1YURA 3JVTC 3F45A 4ICBA 3OHMB 2ISDA 2KI6C 1CDNA 1SL9A 2JT0A 1JFKA 2JXCA 4ZCVA 2D8NA 1S5GY 1Y1AA 1Y6WA 3DYEA 4GAOA 2CBLA 4UPGA 2KGBC 4PHKA 1IWQA 1R2UA 2M29A 4CPVA 1K2HA 1DF0A 1G4YR 1GGZA 4NDCA 5FI6A 1SR6B 2FCDA 4PE0A 3SIAA 1QLKA 2GTEA 3JVTB 4PCWA 1A03A 2JZIA 2BCBA 2CCMA 2LMVA 4OR9B 2ZKMX 2K2FA 3PATA 5FI2A 1WDCB 3ICBA 5HLOA 2QPTA 1DVIA 1QV0A 1CDLA 1NYAA 3VB1A 2LHLA 3CR2A 1PRWA 3I5GB 1YVHA 4GGFC 2PMYA 2TN4A 1KK7Y 2KQYA 3M0WA 1F8HA 1DF0B 2JNFA 1LINA 1Y0VH 1XVJA 4L9MA 3S0AA 1XO5A 3WHUB 2NZ0A 3I5FC 4HRGA 2KI6D 1FF1A 3BJHA 3FS7A 3CZ1A 4C0LA 1WLMA 1LS8A 3O4XA 1N0YA 2M9GA 1SNLA 1ZMZA 3EKJA 4M2OA 4OZDA 5DKRA 5I2QA 1SKTA 1J1DA 1YX7A 1TNQA 1SL8A 2KFGA 3BXKA 1KFUS 4YBHB 4DIRA 2MAZA 3LK1A 3RLZA 1YUUA 3KHEA 1S6IA 2BCAA 1TCOB 2LUCA 2KPHA 4MVFA 2K2AA 1YUTA 3NHTA 1H8BA 1M39A 2JWWA 1WRKA 3SG7A 2KAYA 5I2OA 1UHKA 2AAOA 3CLNA 5DKNA 2F33A 3JTDC 1B8CA 3A8RA 1QVIZ 1K9PA 2CTNA 2JULA 3PN7B 4I5NB 1F4OA 2LUXA 3DD4A 3OB1B 4MZJA 2LC5A 2EGDA 4PE1A 1YRTB 3R72A 3AKBA 1MWNA 3DVKA 4DRWA 1S6CA 1XA5A 1B1GA 4P2YB 2L4IA 2NLNA 3S0GA 1AK8A 1C7VA 1A75A 5FYXA 1XFRA 3DVMA 2G2BA 2WORA 5HKZA 1QLSA 4XJKA 3D75A 2PALA 1TNXA 2H61A 2L2CA 3FE9A 2LP3A 2BECA 1J7RA 2OS8C 3BFAA 3LLEA 3S0FA 2H61C 1VRKA 3B88A 2WCFA 2WC6A 3O6BA 1JFJA 1YUSA 1FI6A 2K7BA 1JUOA 1KQMC 2JXLA 2KI4B 1K9KA 4BY5A 1RWYA 1U5IA 5HKYA 4CFRA 3CABA 1TWOA 1JBAA 1A75B 3UO9A 4MLWA 3PFVA 1CLMA 1KWOC 5AANA 4YGDB 2L2EA 4XJKB 1YR5A 3HX4A 2OS8B 1K94A 1LVCD 3S0EA 5ER5A 1UP5A 1AJ5A 2BKIB 3V2LA 3BUXB 4PHJA 1EXRA 1XFWO 3B87A 1DT7B 1E8AA 2MBXA 3NGVA 2JTTA 2I2RE 1LKJA 2COLB 3D10A 4BY4A 1JF2A 3D78A 5D7FA 1RTP1 1SCMC 4IL1A 1BG1A 3A4UB 1R6PA 1OOIX 2MLFC 2LE9B 1EH2A 1M63B 1NSHA 2PQLA 2E6WA 1Y1UA 3CZ2A 2WCMA 1CB1A 1OOJA 4OKHA 2QEVA 3KEVA 3SS3A 4DS7A 2K61A 1CFPA 1GM0A 3BUMB 2L5YA 3EVUA 2KDHA 1BJFA 1NIWA 4JKTA 2M97A 3SG5A 1QIWA 1SK6D 2WCEA 1RJVA 1SMGA 1ORGA 1RFJA 1NP8A 1MQ1A 1V1FA 2K8MB 2K0JA 2KBMA 1SL7A 2L5XB 2P71A 4I5LB 1TNWA 1J1EA 1DGVA 4MRYA 4CFQA 3EVVA 1B47A 5KTYA 2LLSA 4ZCUA 1SR6C 4FQOA 2M49B 4ORBB 1JF0A 2FJUB 1CFCA 2JC2A 1DJXA 3BUWB 2M1KB 3BFBA 1DTLA 1B7TZ 2BE4A 1W7JB 1DGUA 1GQMA 3VRQA 1MXEA 2WC5A 1S1EA 1B4CA 4C0JA 3AAJA 3WNXB 4YGBB 3S0DA 1WDCC 3NHIA 1GGWA 4OV2A 3FE6A 1TRFA 3K1EA 5G08A 3I5GC 5AXIA 2LP2A 3OX6A 3OGNA 1ALWA 2NXQA 1BOCA 1KK8C 1FBVA 1HT9A 2JQ6A 4NDDA 1PSRA 3EK8A 1NPQA 1NX2A 1SBJA 4MBEA 1Q80A 4IJ7A 1RROA 4A4CA 2QDIA 5DICA 4AQJA 3SG3A 1PSBA 2WOSA 3ZWHA 1IIOA 3NSLA 2LM5A 4GGNA 4FQTA 3MSEB 1YVLA 3K21A 1K8UA 1JWDA 2VRGA 3B86A 4HRHA 4INWA 1QJTA 1TCFA 2MJWB 2OTGC 3VRNA 3D73A 4N5XA 5JOLA 2KBIA 1KK8B 4F0ZB 3SIBA 3FWCA 4DCKA 5I8NA 1K93D 2LAPA 1OOGA 1OMDA 4I5KA 1YRUB 1SPYA 2L51A 1NX0A 4XYNA 3EVRA 1HQVA 3BOWA 2FOTA 1N65A 1DMOA 2KYCA 4YRUA 3GOFA 2LMTA 3PN7C 3CR4X 3VGOA 1DQEA 2ZNDA 2LLTA 2ZN9A 2LVIA 3I5HB 2JPOA 2L50A 1K95A 1F4QA 1OW4A 3N7HA 1P28A 1UUSA 1C7WA 4M2PA 5B8IB 1YTZC 1L2OC 2FJYA 2OTGB 3L4AA 3CDNA 1A29A 4MZLA 1S36A 3D77A 3SS5A 2P6BB 4FTGA 3TUYB 2WCBA 4C0KA 2OPOA 2CT9A 2NCPA 1S5GZ 3QRXA 2RGIA 2MRDA 4N1FA 5FI7A 1NCYA 2H2KA 3BOWB 5PALA 2AMIA 1CDMA 2K60A 2WCLA 3TDUA 1CMGA 2ERBA 1OE9B 3HCMA 1CM4A 3PM8A 5KU1A 2GV5A 4HREE 1L2OB 2KI4C 4R1EA 1XFUO 2EHBA 3DXLA 3PSRA 4YI9A 1MF8B 2LNKA 2L0PA 2KQ6A 1W7IB 3SG4A 5BPJA 3O4YA 1C3YA 2ZRTA 3WHTB 2Y1NA 1NUBA 1IRJA 2K7DA 2HF5A 1UHNA 1TN4A 1T14A 3CWGA 1SSEB 3CZ0A 2KHNA 2KFHA 2KLEA 1PVBA 1K96A 2H8VA 1DJZA 4E68A 1KK7Z 2F3ZA 1V1GA 3C1VA 1BMOA 5CPVA 1UHHA 2BE6A 2GGZA 2HETA 2SCPA 4HSZA 2JT3A 2ZN8A 1QWVA 1OOFA 2JPTA 3TDZA 3LK0A 2KOTA 1LA3A 1SW8A 3PALA 3FIAA 5F6TA 2Y5IA 3CS1A 4MZKA 1MXLC 3LCPC 1BU3A 1MHOA 1DC1A 1D1OA 2F2PA 3R1OA 1TTXA 3SS4A 3BUNB 4A4BA 1H4BA 2DOQA 2KSPA 2HQ8A 3I5IB 1C3ZA 1DJGA 3B6XA 1XK4A 1YX8A 4GNKB 4MEWA 2F8PA 1EL4A 1XYDA 2O5GA 5DKQA 3R1VA 1QASA 2BBNA 3AAKA 1K9UA 1WRZA 1LXFC 2WC8A 1J7OA 2M0RA 3EK7A 2WCJA 2L4HA 1IH0A 1RK9A 1ZOTB 1DEKA 3BFHA 1F54A 4PHNA 1XFYO 2F2OA 4CLNA 4PE4A 2O60A 4USLA 2LHIA 1UURA 1A4PA 2ZNEA 3D74A 1MUXA 1QV1A 4OVNF 1WRLA 4PT1A 2Y1MA 1EG3A 1TUJA 4P5OE 3TZ1A
chains in the Genus database with same CATH topology
5IBWA 4ORAB 1IQ5A 1AJ4A 1PVAA 3ZNIA 1B9AA 2K7CA 4NQGA 2LLUA 1N2DA 4MSPA 2BL0B 1IG5A 1BT6A 3RM1A 4M2QA 1QIVA 2E30A 1QTXA 1SRAA 3KPXA 1M31A 4ORCB 3NSKA 1TNPA 1PALA 2KFFA 3DVJA 1UWOA 1KFXS 1NCXA 4PDZA 4U8DA 2MA2A 5CSJA 1PULA 3BYAA 1CTRA 1F70A 1AVSA 2KGRA 2CNPA 4WQ2A 4TNCA 1XFXO 3IQQA 4JWQA 3I5HC 2PVBA 2EC6B 1OMRA 1QVIY 3IQOA 1K90D 1LA0A 1TIZA 3E3RA 3TS5C 1BLQA 1BODA 1DJHA 4GBAA 1QX5B 1IJ6A 1WY9A 2KAXA 1JSAA 3DVEA 4N1GA 3TUYC 2R2IA 1QX2A 1OZSA 3O2PA 1FPWA 1OSAA 1OMVA 1XFZO 3VRRA 2GGMA 5HKWA 1S6JA 1JC2A 4GGFA 1PK0D 3TS5B 1DJWA 1AUIB 3NSIA 3CZTX 1L7ZA 2F3YA 3SJSA 1QS7A 2I94A 4PALA 2PRUA 1BR1B 2B1UA 2LVJA 5K89A 5HLVA 4CIDA 2LCPA 3OB2B 3GK2A 2SASA 3BUOB 1AP4A 5I2LA 1ZACA 2BBMA 3CGAA 3GK4X 1SCVA 1M46A 1IQ3A 3FWBA 5AEQA 2JRFA 1NX1A 2JNXA 4I5JA 2JU0A 4JQ0D 2AUCA 2HQWA 1TOPA 2M3WA 5GQQC 4YGCB 4MRXA 4NDBA 2I7AA 1FW4A 2KNEA 2LVVA 4JPZB 3I5FB 1QATA 5CSNA 1BR4B 3DF0A 2LANA 2A4JA 3BQ3A 1CFDA 1S26D 1IGVA 4YGAA 3TDIA 5AFPA 4OCIA 1DJYA 1NX3A 3NSOA 2V53A 1KQVA 1J55A 3I5IC 1GJYA 2LVKA 2M8UA 2PSRA 3GK1A 3O78A 4GFTA 5J3XA 1C07A 3EKHA 3KO0A 1B8LA 4YI8A 2L98A 2JTZA 2PASA 1CLBA 4MN0A 3OX5A 1KFXL 3CTNA 5KSZA 1IJ5A 1B8RA 1G8IA 1NWDA 1QXPA 1ZFSA 2JOJA 2NCOA 3JTDB 1ALVA 1FI5A 2Y4QA 1EG4A 2FCEA 4DUQA 3DF0B 1KSOA 2MLEC 5HYDA 1CMFA 1G33A 1NCZA 1B7TY 2I18A 1CLLA 1CNPA 1QX7A 3PLFB 1CKKA 2LMUA 3IF7A 1J7PA 3D0YA 1A2XA 1F71A 2KAVA 3LL8B 5ER4X 1S3PA 1SY9A 1XFVO 1MR8A 4AOMA 4Q04A 1XK4C 2M7NA 3SG6A 1KSMA 2KYFA 4PHMA 2CXJA 1WLZA 3SG2A 1CFFA 4ETOA 2ZFDA 4GUKA 2M1UA 1IKUA 1RECA 2M7LA 2BL0C 2WNDA 2Q91A 3OP0A 4QJ4B 5AERA 1KQMB 1OQPA 5CSIA 3CR5X 1CM1A 2IS9A 1DJIA 1KCYA 3EK4A 3D0YB 3NXAA 5TNCA 1Y1XA 1U5IB 5JJGA 2BCXA 4QJ3B 1KWOB 2MHHA 5D69A 2ZRSA 4WQ3A 1EJ3A 1ZUZA 1J7QA 1F55A 2JT8A 3H4SE 3VRPA 1UHIA 1BF5A 1OZOA 2EC6C 4D1EA 2G9BA 1SYMA 4YGEB 2BKHB 4QJ5B 2HPSA 1KFUL 3WXAA 4GPLB 1UHJA 4AQIA 1SCMB 3KF9A 3AKAA 4WRIA 4PE7A 3VROA 1CDPA 1AHRA 2Q4UA 1ODBA 2K7OA 5CSFA 1X02A 1M45A 2LV7A 2QACA 1YURA 3JVTC 3F45A 4ICBA 3OHMB 2ISDA 2KI6C 1CDNA 1SL9A 2JT0A 1JFKA 2JXCA 4ZCVA 2D8NA 1S5GY 1Y1AA 1Y6WA 4GAOA 2CBLA 4UPGA 2KGBC 4PHKA 1IWQA 1R2UA 2M29A 4CPVA 1K2HA 1DF0A 1G4YR 1GGZA 4NDCA 1SR6B 2FCDA 4PE0A 3SIAA 1QLKA 3JVTB 4PCWA 1A03A 2JZIA 2BCBA 2CCMA 2LMVA 4OR9B 2ZKMX 2K2FA 3PATA 1WDCB 3ICBA 5HLOA 2QPTA 1DVIA 1QV0A 1CDLA 1NYAA 2LHLA 3CR2A 1PRWA 3I5GB 1YVHA 4GGFC 2PMYA 2TN4A 1KK7Y 2KQYA 3M0WA 1F8HA 1DF0B 2JNFA 1LINA 1Y0VH 1XVJA 4L9MA 1XO5A 3WHUB 2NZ0A 3I5FC 4HRGA 2KI6D 1FF1A 3FS7A 4C0LA 1WLMA 1N0YA 2M9GA 1SNLA 1ZMZA 3EKJA 4M2OA 5DKRA 5I2QA 1SKTA 1J1DA 1YX7A 1TNQA 1SL8A 2KFGA 3BXKA 1KFUS 4YBHB 4DIRA 2MAZA 3LK1A 3RLZA 1YUUA 3KHEA 1S6IA 2BCAA 1TCOB 2LUCA 4MVFA 2K2AA 1YUTA 1H8BA 1M39A 2JWWA 1WRKA 3SG7A 2KAYA 5I2OA 1UHKA 2AAOA 3CLNA 5DKNA 2F33A 3JTDC 1B8CA 3A8RA 1QVIZ 1K9PA 2CTNA 2JULA 3PN7B 4I5NB 1F4OA 2LUXA 3DD4A 3OB1B 4MZJA 2LC5A 2EGDA 4PE1A 1YRTB 3AKBA 1MWNA 4DRWA 1S6CA 1XA5A 1B1GA 4P2YB 2L4IA 2NLNA 1AK8A 1C7VA 1A75A 5FYXA 3DVMA 2G2BA 2WORA 5HKZA 1QLSA 4XJKA 2PALA 1TNXA 2H61A 2LP3A 2BECA 1J7RA 2OS8C 3LLEA 2H61C 1VRKA 1JFJA 2WCFA 3O6BA 1YUSA 1FI6A 2K7BA 1JUOA 1KQMC 2JXLA 2KI4B 1K9KA 4BY5A 1RWYA 1U5IA 5HKYA 4CFRA 1JBAA 1A75B 4MLWA 3PFVA 1CLMA 1KWOC 5AANA 4YGDB 2L2EA 4XJKB 1YR5A 3HX4A 2OS8B 1K94A 1LVCD 5ER5A 1UP5A 1AJ5A 2BKIB 3BUXB 4PHJA 1EXRA 1XFWO 1DT7B 1E8AA 2MBXA 2JTTA 2I2RE 1LKJA 2COLB 3D10A 4BY4A 1JF2A 5D7FA 1RTP1 1SCMC 4IL1A 1BG1A 3A4UB 1R6PA 2MLFC 2LE9B 1EH2A 1M63B 1NSHA 2E6WA 1Y1UA 1CB1A 1OOJA 4OKHA 4DS7A 3KEVA 1CFPA 2K61A 3BUMB 3EVUA 2KDHA 1BJFA 1NIWA 2M97A 3SG5A 1QIWA 1SK6D 2WCEA 1RJVA 1SMGA 1RFJA 2K8MB 1NP8A 1MQ1A 1V1FA 3DVKA 2K0JA 2KBMA 1SL7A 2L5XB 4I5LB 4MRYA 1TNWA 1J1EA 1DGVA 4CFQA 3EVVA 1B47A 5KTYA 2LLSA 4ZCUA 1SR6C 4FQOA 2M49B 4ORBB 1JF0A 2FJUB 1CFCA 2JC2A 1DJXA 3BUWB 2M1KB 1DTLA 1B7TZ 2BE4A 1W7JB 1DGUA 1GQMA 3VRQA 1MXEA 1S1EA 1B4CA 4C0JA 3AAJA 3WNXB 4YGBB 1WDCC 1GGWA 4OV2A 1TRFA 5G08A 3I5GC 5AXIA 2LP2A 3OX6A 1ALWA 2NXQA 1BOCA 1KK8C 1FBVA 1HT9A 2JQ6A 4NDDA 1PSRA 3EK8A 1NPQA 1NX2A 1SBJA 4MBEA 1Q80A 4A4CA 1RROA 4AQJA 3SG3A 1PSBA 2WOSA 3ZWHA 3NSLA 2LM5A 4GGNA 3MSEB 1YVLA 3K21A 1K8UA 1JWDA 2VRGA 4HRHA 1QJTA 1TCFA 2MJWB 2OTGC 3VRNA 4N5XA 5JOLA 2KBIA 1KK8B 4F0ZB 3SIBA 3FWCA 4DCKA 5I8NA 1K93D 2LAPA 1OMDA 4I5KA 1YRUB 1SPYA 2L51A 1NX0A 4XYNA 3EVRA 1HQVA 3BOWA 2FOTA 1N65A 1DMOA 2KYCA 4YRUA 3GOFA 2LMTA 3PN7C 3CR4X 3VGOA 2ZNDA 2LLTA 2ZN9A 2LVIA 3I5HB 2L50A 1K95A 1F4QA 1UUSA 1C7WA 4M2PA 5B8IB 1YTZC 1L2OC 2OTGB 1A29A 4MZLA 1S36A 2P6BB 4FTGA 3TUYB 2WCBA 4C0KA 2OPOA 2CT9A 2NCPA 1S5GZ 3QRXA 2RGIA 2MRDA 4N1FA 1NCYA 2H2KA 3BOWB 5PALA 2AMIA 1CDMA 3TDUA 1CMGA 1OE9B 3HCMA 1CM4A 3PM8A 5KU1A 2GV5A 4HREE 1L2OB 2KI4C 4R1EA 1XFUO 2EHBA 3PSRA 4YI9A 1MF8B 2LNKA 2L0PA 2KQ6A 1W7IB 3SG4A 5BPJA 3O4YA 2ZRTA 3WHTB 2Y1NA 1NUBA 1IRJA 2K7DA 2HF5A 1UHNA 1TN4A 3CWGA 2KHNA 2KFHA 1PVBA 1K96A 1DJZA 4E68A 1KK7Z 2F3ZA 1V1GA 3C1VA 1BMOA 5CPVA 1UHHA 2BE6A 2GGZA 2HETA 2SCPA 4HSZA 2JT3A 2ZN8A 3TDZA 2JPTA 3LK0A 2KOTA 1LA3A 1SW8A 3PALA 3FIAA 5F6TA 2Y5IA 3CS1A 4MZKA 1MXLC 3LCPC 1BU3A 1MHOA 1D1OA 2F2PA 1TTXA 3BUNB 4A4BA 1H4BA 2DOQA 2KSPA 2HQ8A 3I5IB 1DJGA 1XK4A 1YX8A 4GNKB 4MEWA 2F8PA 1EL4A 1XYDA 2O5GA 5DKQA 1QASA 2BBNA 3AAKA 1K9UA 1WRZA 1LXFC 2WC8A 1J7OA 2M0RA 3EK7A 2L4HA 1IH0A 1RK9A 1ZOTB 1F54A 4PHNA 1XFYO 2F2OA 4CLNA 4PE4A 2O60A 4USLA 2LHIA 1UURA 1A4PA 2ZNEA 1MUXA 1QV1A 4OVNF 1WRLA 2Y1MA 1EG3A 4P5OE 3TZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IBW A;  4ORA B;  1IQ5 A;  1AJ4 A;  1PVA A;  3ZNI A;  1B9A A;  2K7C A;  4NQG A;  2LLU A;  1N2D A;  4MSP A;  2BL0 B;  1IG5 A;  1BT6 A;  3RM1 A;  4M2Q A;  1QIV A;  2E30 A;  1QTX A;  1SRA A;  3KPX A;  1M31 A;  4ORC B;  3NSK A;  1TNP A;  1PAL A;  2KFF A;  3DVJ A;  1UWO A;  1KFX S;  1NCX A;  4PDZ A;  4U8D A;  2MA2 A;  5CSJ A;  1PUL A;  3BYA A;  1CTR A;  1F70 A;  1AVS A;  2KGR A;  2CNP A;  4WQ2 A;  4TNC A;  1XFX O;  3IQQ A;  4JWQ A;  3I5H C;  2PVB A;  2EC6 B;  1OMR A;  1QVI Y;  3IQO A;  1K90 D;  1LA0 A;  1TIZ A;  3E3R A;  3TS5 C;  1BLQ A;  1BOD A;  1DJH A;  4GBA A;  1QX5 B;  1IJ6 A;  1WY9 A;  2KAX A;  1JSA A;  3DVE A;  4N1G A;  3TUY C;  2R2I A;  1QX2 A;  1OZS A;  3O2P A;  1FPW A;  1OSA A;  1OMV A;  1XFZ O;  3VRR A;  2GGM A;  5HKW A;  1S6J A;  1JC2 A;  4GGF A;  1PK0 D;  3TS5 B;  1DJW A;  1AUI B;  3NSI A;  3CZT X;  1L7Z A;  2F3Y A;  3SJS A;  1QS7 A;  2I94 A;  4PAL A;  2PRU A;  1BR1 B;  2B1U A;  2LVJ A;  5K89 A;  5HLV A;  4CID A;  2LCP A;  3OB2 B;  3GK2 A;  2SAS A;  3BUO B;  1AP4 A;  5I2L A;  1ZAC A;  2BBM A;  3CGA A;  3GK4 X;  1SCV A;  1M46 A;  1IQ3 A;  3FWB A;  5AEQ A;  2JRF A;  1NX1 A;  2JNX A;  4I5J A;  2JU0 A;  4JQ0 D;  2AUC A;  2HQW A;  1TOP A;  2M3W A;  5GQQ C;  4YGC B;  4MRX A;  4NDB A;  2I7A A;  1FW4 A;  2KNE A;  2LVV A;  4JPZ B;  3I5F B;  1QAT A;  5CSN A;  1BR4 B;  3DF0 A;  2LAN A;  2A4J A;  3BQ3 A;  1CFD A;  1S26 D;  1IGV A;  4YGA A;  3TDI A;  5AFP A;  4OCI A;  1DJY A;  1NX3 A;  3NSO A;  2V53 A;  1KQV A;  1J55 A;  3I5I C;  1GJY A;  2LVK A;  2M8U A;  2PSR A;  3GK1 A;  3O78 A;  4GFT A;  5J3X A;  1C07 A;  3EKH A;  3KO0 A;  1B8L A;  4YI8 A;  2L98 A;  2JTZ A;  2PAS A;  1CLB A;  4MN0 A;  3OX5 A;  1KFX L;  3CTN A;  5KSZ A;  1IJ5 A;  1B8R A;  1G8I A;  1NWD A;  1QXP A;  1ZFS A;  2JOJ A;  2NCO A;  3JTD B;  1ALV A;  1FI5 A;  2Y4Q A;  1EG4 A;  2FCE A;  4DUQ A;  3DF0 B;  1KSO A;  2MLE C;  5HYD A;  1CMF A;  1G33 A;  1NCZ A;  1B7T Y;  2I18 A;  1CLL A;  1CNP A;  1QX7 A;  3PLF B;  1CKK A;  2LMU A;  3IF7 A;  1J7P A;  3D0Y A;  1A2X A;  1F71 A;  2KAV A;  3LL8 B;  5ER4 X;  1S3P A;  1SY9 A;  1XFV O;  1MR8 A;  4AOM A;  4Q04 A;  1XK4 C;  2M7N A;  3SG6 A;  1KSM A;  2KYF A;  4PHM A;  2CXJ A;  1WLZ A;  3SG2 A;  1CFF A;  4ETO A;  2ZFD A;  4GUK A;  2M1U A;  1IKU A;  1REC A;  2M7L A;  2BL0 C;  2WND A;  2Q91 A;  3OP0 A;  4QJ4 B;  5AER A;  1KQM B;  1OQP A;  5CSI A;  3CR5 X;  1CM1 A;  2IS9 A;  1DJI A;  1KCY A;  3EK4 A;  3D0Y B;  3NXA A;  5TNC A;  1Y1X A;  1U5I B;  5JJG A;  2BCX A;  4QJ3 B;  1KWO B;  2MHH A;  5D69 A;  2ZRS A;  4WQ3 A;  1EJ3 A;  1ZUZ A;  1J7Q A;  1F55 A;  2JT8 A;  3H4S E;  3VRP A;  1UHI A;  1BF5 A;  1OZO A;  2EC6 C;  4D1E A;  2G9B A;  1SYM A;  4YGE B;  2BKH B;  4QJ5 B;  2HPS A;  1KFU L;  3WXA A;  4GPL B;  1UHJ A;  4AQI A;  1SCM B;  3KF9 A;  3AKA A;  4WRI A;  4PE7 A;  3VRO A;  1CDP A;  1AHR A;  2Q4U A;  1ODB A;  2K7O A;  5CSF A;  1X02 A;  1M45 A;  2LV7 A;  2QAC A;  1YUR A;  3JVT C;  3F45 A;  4ICB A;  3OHM B;  2ISD A;  2KI6 C;  1CDN A;  1SL9 A;  2JT0 A;  1JFK A;  2JXC A;  4ZCV A;  2D8N A;  1S5G Y;  1Y1A A;  1Y6W A;  4GAO A;  2CBL A;  4UPG A;  2KGB C;  4PHK A;  1IWQ A;  1R2U A;  2M29 A;  4CPV A;  1K2H A;  1DF0 A;  1G4Y R;  1GGZ A;  4NDC A;  1SR6 B;  2FCD A;  4PE0 A;  3SIA A;  1QLK A;  3JVT B;  4PCW A;  1A03 A;  2JZI A;  2BCB A;  2CCM A;  2LMV A;  4OR9 B;  2ZKM X;  2K2F A;  3PAT A;  1WDC B;  3ICB A;  5HLO A;  2QPT A;  1DVI A;  1QV0 A;  1CDL A;  1NYA A;  2LHL A;  3CR2 A;  1PRW A;  3I5G B;  1YVH A;  4GGF C;  2PMY A;  2TN4 A;  1KK7 Y;  2KQY A;  3M0W A;  1F8H A;  1DF0 B;  2JNF A;  1LIN A;  1Y0V H;  1XVJ A;  4L9M A;  1XO5 A;  3WHU B;  2NZ0 A;  3I5F C;  4HRG A;  2KI6 D;  1FF1 A;  3FS7 A;  4C0L A;  1WLM A;  1N0Y A;  2M9G A;  1SNL A;  1ZMZ A;  3EKJ A;  4M2O A;  5DKR A;  5I2Q A;  1SKT A;  1J1D A;  1YX7 A;  1TNQ A;  1SL8 A;  2KFG A;  3BXK A;  1KFU S;  4YBH B;  4DIR A;  2MAZ A;  3LK1 A;  3RLZ A;  1YUU A;  3KHE A;  1S6I A;  2BCA A;  1TCO B;  2LUC A;  4MVF A;  2K2A A;  1YUT A;  1H8B A;  1M39 A;  2JWW A;  1WRK A;  3SG7 A;  2KAY A;  5I2O A;  1UHK A;  2AAO A;  3CLN A;  5DKN A;  2F33 A;  3JTD C;  1B8C A;  3A8R A;  1QVI Z;  1K9P A;  2CTN A;  2JUL A;  3PN7 B;  4I5N B;  1F4O A;  2LUX A;  3DD4 A;  3OB1 B;  4MZJ A;  2LC5 A;  2EGD A;  4PE1 A;  1YRT B;  3AKB A;  1MWN A;  4DRW A;  1S6C A;  1XA5 A;  1B1G A;  4P2Y B;  2L4I A;  2NLN A;  1AK8 A;  1C7V A;  1A75 A;  5FYX A;  3DVM A;  2G2B A;  2WOR A;  5HKZ A;  1QLS A;  4XJK A;  2PAL A;  1TNX A;  2H61 A;  2LP3 A;  2BEC A;  1J7R A;  2OS8 C;  3LLE A;  2H61 C;  1VRK A;  1JFJ A;  2WCF A;  3O6B A;  1YUS A;  1FI6 A;  2K7B A;  1JUO A;  1KQM C;  2JXL A;  2KI4 B;  1K9K A;  4BY5 A;  1RWY A;  1U5I A;  5HKY A;  4CFR A;  1JBA A;  1A75 B;  4MLW A;  3PFV A;  1CLM A;  1KWO C;  5AAN A;  4YGD B;  2L2E A;  4XJK B;  1YR5 A;  3HX4 A;  2OS8 B;  1K94 A;  1LVC D;  5ER5 A;  1UP5 A;  1AJ5 A;  2BKI B;  3BUX B;  4PHJ A;  1EXR A;  1XFW O;  1DT7 B;  1E8A A;  2MBX A;  2JTT A;  2I2R E;  1LKJ A;  2COL B;  3D10 A;  4BY4 A;  1JF2 A;  5D7F A;  1RTP 1;  1SCM C;  4IL1 A;  1BG1 A;  3A4U B;  1R6P A;  2MLF C;  2LE9 B;  1EH2 A;  1M63 B;  1NSH A;  2E6W A;  1Y1U A;  1CB1 A;  1OOJ A;  4OKH A;  4DS7 A;  3KEV A;  1CFP A;  2K61 A;  3BUM B;  3EVU A;  2KDH A;  1BJF A;  1NIW A;  2M97 A;  3SG5 A;  1QIW A;  1SK6 D;  2WCE A;  1RJV A;  1SMG A;  1RFJ A;  2K8M B;  1NP8 A;  1MQ1 A;  1V1F A;  3DVK A;  2K0J A;  2KBM A;  1SL7 A;  2L5X B;  4I5L B;  4MRY A;  1TNW A;  1J1E A;  1DGV A;  4CFQ A;  3EVV A;  1B47 A;  5KTY A;  2LLS A;  4ZCU A;  1SR6 C;  4FQO A;  2M49 B;  4ORB B;  1JF0 A;  2FJU B;  1CFC A;  2JC2 A;  1DJX A;  3BUW B;  2M1K B;  1DTL A;  1B7T Z;  2BE4 A;  1W7J B;  1DGU A;  1GQM A;  3VRQ A;  1MXE A;  1S1E A;  1B4C A;  4C0J A;  3AAJ A;  3WNX B;  4YGB B;  1WDC C;  1GGW A;  4OV2 A;  1TRF A;  5G08 A;  3I5G C;  5AXI A;  2LP2 A;  3OX6 A;  1ALW A;  2NXQ A;  1BOC A;  1KK8 C;  1FBV A;  1HT9 A;  2JQ6 A;  4NDD A;  1PSR A;  3EK8 A;  1NPQ A;  1NX2 A;  1SBJ A;  4MBE A;  1Q80 A;  4A4C A;  1RRO A;  4AQJ A;  3SG3 A;  1PSB A;  2WOS A;  3ZWH A;  3NSL A;  2LM5 A;  4GGN A;  3MSE B;  1YVL A;  3K21 A;  1K8U A;  1JWD A;  2VRG A;  4HRH A;  1QJT A;  1TCF A;  2MJW B;  2OTG C;  3VRN A;  4N5X A;  5JOL A;  2KBI A;  1KK8 B;  4F0Z B;  3SIB A;  3FWC A;  4DCK A;  5I8N A;  1K93 D;  2LAP A;  1OMD A;  4I5K A;  1YRU B;  1SPY A;  2L51 A;  1NX0 A;  4XYN A;  3EVR A;  1HQV A;  3BOW A;  2FOT A;  1N65 A;  1DMO A;  2KYC A;  4YRU A;  3GOF A;  2LMT A;  3PN7 C;  3CR4 X;  3VGO A;  2ZND A;  2LLT A;  2ZN9 A;  2LVI A;  3I5H B;  2L50 A;  1K95 A;  1F4Q A;  1UUS A;  1C7W A;  4M2P A;  5B8I B;  1YTZ C;  1L2O C;  2OTG B;  1A29 A;  4MZL A;  1S36 A;  2P6B B;  4FTG A;  3TUY B;  2WCB A;  4C0K A;  2OPO A;  2CT9 A;  2NCP A;  1S5G Z;  3QRX A;  2RGI A;  2MRD A;  4N1F A;  1NCY A;  2H2K A;  3BOW B;  5PAL A;  2AMI A;  1CDM A;  3TDU A;  1CMG A;  1OE9 B;  3HCM A;  1CM4 A;  3PM8 A;  5KU1 A;  2GV5 A;  4HRE E;  1L2O B;  2KI4 C;  4R1E A;  1XFU O;  2EHB A;  3PSR A;  4YI9 A;  1MF8 B;  2LNK A;  2L0P A;  2KQ6 A;  1W7I B;  3SG4 A;  5BPJ A;  3O4Y A;  2ZRT A;  3WHT B;  2Y1N A;  1NUB A;  1IRJ A;  2K7D A;  2HF5 A;  1UHN A;  1TN4 A;  3CWG A;  2KHN A;  2KFH A;  1PVB A;  1K96 A;  1DJZ A;  4E68 A;  1KK7 Z;  2F3Z A;  1V1G A;  3C1V A;  1BMO A;  5CPV A;  1UHH A;  2BE6 A;  2GGZ A;  2HET A;  2SCP A;  4HSZ A;  2JT3 A;  2ZN8 A;  3TDZ A;  2JPT A;  3LK0 A;  2KOT A;  1LA3 A;  1SW8 A;  3PAL A;  3FIA A;  5F6T A;  2Y5I A;  3CS1 A;  4MZK A;  1MXL C;  3LCP C;  1BU3 A;  1MHO A;  1D1O A;  2F2P A;  1TTX A;  3BUN B;  4A4B A;  1H4B A;  2DOQ A;  2KSP A;  2HQ8 A;  3I5I B;  1DJG A;  1XK4 A;  1YX8 A;  4GNK B;  4MEW A;  2F8P A;  1EL4 A;  1XYD A;  2O5G A;  5DKQ A;  1QAS A;  2BBN A;  3AAK A;  1K9U A;  1WRZ A;  1LXF C;  2WC8 A;  1J7O A;  2M0R A;  3EK7 A;  2L4H A;  1IH0 A;  1RK9 A;  1ZOT B;  1F54 A;  4PHN A;  1XFY O;  2F2O A;  4CLN A;  4PE4 A;  2O60 A;  4USL A;  2LHI A;  1UUR A;  1A4P A;  2ZNE A;  1MUX A;  1QV1 A;  4OVN F;  1WRL A;  2Y1M A;  1EG3 A;  4P5O E;  3TZ1 A; 
#chains in the Genus database with same CATH topology
 2PYQ A;  4ORA B;  5IBW A;  1IQ5 A;  1AJ4 A;  1W9Z A;  1PVA A;  3ZNI A;  1B9A A;  2K7C A;  4NQG A;  2LLU A;  1N2D A;  3Q8I A;  2BL0 B;  4MSP A;  1IG5 A;  1BT6 A;  4KYN A;  3RM1 A;  1DEL A;  4M2Q A;  1QIV A;  2E30 A;  1QTX A;  2WCH A;  1SRA A;  3KPX A;  1M31 A;  4ORC B;  3NSK A;  1TNP A;  1PAL A;  2KFF A;  3DVJ A;  1UWO A;  3PJI A;  1KFX S;  1NCX A;  4PDZ A;  1OOH A;  4U8D A;  2MA2 A;  5CSJ A;  1PUL A;  3BYA A;  1CTR A;  1F70 A;  1AVS A;  2KGR A;  2CNP A;  4WQ2 A;  4TNC A;  1CMF A;  1XFX O;  3EG5 B;  3IQQ A;  4JWQ A;  3I5H C;  2PVB A;  5HL1 A;  2EC6 B;  1OMR A;  1QVI Y;  3IQO A;  1K90 D;  1LA0 A;  1TIZ A;  3E3R A;  3TS5 C;  1BLQ A;  1BOD A;  1DJH A;  4GBA A;  1QX5 B;  1IJ6 A;  1WY9 A;  2KAX A;  1JSA A;  3DVE A;  4N1G A;  3TUY C;  2BNX A;  2R2I A;  4JD9 A;  1QX2 A;  1OZS A;  3O2P A;  1FPW A;  1OSA A;  1OMV A;  1XFZ O;  2QEB A;  3VRR A;  2GGM A;  5D3O A;  5HKW A;  1S6J A;  1JC2 A;  3DZT A;  4GGF A;  1PK0 D;  3TS5 B;  1DJW A;  1AUI B;  3NSI A;  3QME A;  3CZT X;  1L7Z A;  2F3Y A;  3SJS A;  1QS7 A;  2I94 A;  4PAL A;  2PRU A;  1BR1 B;  2B1U A;  2LVJ A;  5K89 A;  5HLV A;  4CID A;  2LCP A;  3OB2 B;  3GK2 A;  3R1P A;  2SAS A;  3BUO B;  3RZS A;  1AP4 A;  5I2L A;  1Z2C B;  1ZAC A;  2YGU A;  3L4L A;  2BBM A;  3CGA A;  3GK4 X;  1SCV A;  1M46 A;  1IQ3 A;  3FWB A;  5AEQ A;  2JRF A;  3B7A A;  1NX1 A;  2P70 A;  2BAP A;  2JNX A;  5I94 A;  4I5J A;  2JU0 A;  4JQ0 D;  1Z4H A;  1TUZ A;  2AUC A;  2HQW A;  1TOP A;  2M3W A;  4INX A;  5GQQ C;  4YGC B;  4MRX A;  3OBV A;  2I7A A;  4NDB A;  1FW4 A;  2KNE A;  2LVV A;  4JPZ B;  3I5F B;  1QAT A;  5CSN A;  1BR4 B;  3DF0 A;  2LAN A;  2KLD A;  3DY9 A;  2A4J A;  3BQ3 A;  1CFD A;  1S26 D;  1IGV A;  4YGA A;  3TDI A;  5AFP A;  4OCI A;  1DJY A;  1NX3 A;  3NSO A;  2V53 A;  1KQV A;  1J55 A;  3I5I C;  1GJY A;  2LVK A;  2M8U A;  2PSR A;  3GK1 A;  3O78 A;  4GFT A;  5EL2 A;  5J3X A;  2QEH A;  1C07 A;  3EKH A;  3KO0 A;  3L47 A;  1B8L A;  4YI8 A;  2L98 A;  2JTZ A;  2PAS A;  1CLB A;  4MN0 A;  3OX5 A;  1KFX L;  3CTN A;  5KSZ A;  1IJ5 A;  1B8R A;  1G8I A;  1NWD A;  1QXP A;  1ZFS A;  2JOJ A;  3PM2 A;  2NCO A;  3JTD B;  1ALV A;  1FI5 A;  2Y4Q A;  1EG4 A;  2FCE A;  3IVT A;  3DF0 B;  1KSO A;  2MLE C;  4DUQ A;  5HYD A;  3FE8 A;  1G33 A;  1NCZ A;  1B7T Y;  2I18 A;  1CLL A;  1CNP A;  1QX7 A;  3PLF B;  1CKK A;  2LMU A;  3IF7 A;  3CYZ A;  1J7P A;  3S0B A;  3D0Y A;  3UNW A;  1A2X A;  1F71 A;  2KAV A;  3LL8 B;  5ER4 X;  1S3P A;  1SY9 A;  1XFV O;  1MR8 A;  4AOM A;  2WCK A;  4Q04 A;  1XK4 C;  2M7N A;  3SG6 A;  1KSM A;  2KYF A;  4PHM A;  2CXJ A;  1WLZ A;  3SG2 A;  2QEO A;  3D76 A;  1CFF A;  4ETO A;  2ZFD A;  4GUK A;  2M1U A;  1IKU A;  1REC A;  2M7L A;  2BL0 C;  2WND A;  2Q91 A;  3OP0 A;  4QJ4 B;  5AER A;  1KQM B;  1OQP A;  5CSI A;  3CR5 X;  1CM1 A;  2IS9 A;  1DJI A;  1KCY A;  3EK4 A;  3D0Y B;  3NXA A;  5TNC A;  1Y1X A;  1U5I B;  5JJG A;  2BCX A;  4QJ3 B;  1KWO B;  2MHH A;  5D69 A;  2ZRS A;  4WQ3 A;  1EJ3 A;  1ZUZ A;  1J7Q A;  1F55 A;  2JT8 A;  3H4S E;  3VRP A;  1UHI A;  1BF5 A;  1OZO A;  2EC6 C;  4D1E A;  2G9B A;  1SYM A;  4YGE B;  2BKH B;  4QJ5 B;  2HPS A;  1KFU L;  3WXA A;  4GPL B;  1UHJ A;  4AQI A;  1SCM B;  3KF9 A;  3AKA A;  4WRI A;  4F7F A;  4PE7 A;  3VRO A;  1CDP A;  1AHR A;  2Q4U A;  1ODB A;  2K7O A;  5CSF A;  1X02 A;  1M45 A;  2LV7 A;  2QAC A;  1YUR A;  3JVT C;  3F45 A;  4ICB A;  3OHM B;  2ISD A;  2KI6 C;  1CDN A;  1SL9 A;  2JT0 A;  1JFK A;  2JXC A;  4ZCV A;  2D8N A;  1S5G Y;  1Y1A A;  1Y6W A;  3DYE A;  4GAO A;  2CBL A;  4UPG A;  2KGB C;  4PHK A;  1IWQ A;  1R2U A;  2M29 A;  4CPV A;  1K2H A;  1DF0 A;  1G4Y R;  1GGZ A;  4NDC A;  5FI6 A;  1SR6 B;  2FCD A;  4PE0 A;  3SIA A;  1QLK A;  2GTE A;  3JVT B;  4PCW A;  1A03 A;  2JZI A;  2BCB A;  2CCM A;  2LMV A;  4OR9 B;  2ZKM X;  2K2F A;  3PAT A;  5FI2 A;  1WDC B;  3ICB A;  5HLO A;  2QPT A;  1DVI A;  1QV0 A;  1CDL A;  1NYA A;  3VB1 A;  2LHL A;  3CR2 A;  1PRW A;  3I5G B;  1YVH A;  4GGF C;  2PMY A;  2TN4 A;  1KK7 Y;  2KQY A;  3M0W A;  1F8H A;  1DF0 B;  2JNF A;  1LIN A;  1Y0V H;  1XVJ A;  4L9M A;  3S0A A;  1XO5 A;  3WHU B;  2NZ0 A;  3I5F C;  4HRG A;  2KI6 D;  1FF1 A;  3BJH A;  3FS7 A;  3CZ1 A;  4C0L A;  1WLM A;  1LS8 A;  3O4X A;  1N0Y A;  2M9G A;  1SNL A;  1ZMZ A;  3EKJ A;  4M2O A;  4OZD A;  5DKR A;  5I2Q A;  1SKT A;  1J1D A;  1YX7 A;  1TNQ A;  1SL8 A;  2KFG A;  3BXK A;  1KFU S;  4YBH B;  4DIR A;  2MAZ A;  3LK1 A;  3RLZ A;  1YUU A;  3KHE A;  1S6I A;  2BCA A;  1TCO B;  2LUC A;  2KPH A;  4MVF A;  2K2A A;  1YUT A;  3NHT A;  1H8B A;  1M39 A;  2JWW A;  1WRK A;  3SG7 A;  2KAY A;  5I2O A;  1UHK A;  2AAO A;  3CLN A;  5DKN A;  2F33 A;  3JTD C;  1B8C A;  3A8R A;  1QVI Z;  1K9P A;  2CTN A;  2JUL A;  3PN7 B;  4I5N B;  1F4O A;  2LUX A;  3DD4 A;  3OB1 B;  4MZJ A;  2LC5 A;  2EGD A;  4PE1 A;  1YRT B;  3R72 A;  3AKB A;  1MWN A;  3DVK A;  4DRW A;  1S6C A;  1XA5 A;  1B1G A;  4P2Y B;  2L4I A;  2NLN A;  3S0G A;  1AK8 A;  1C7V A;  1A75 A;  5FYX A;  1XFR A;  3DVM A;  2G2B A;  2WOR A;  5HKZ A;  1QLS A;  4XJK A;  3D75 A;  2PAL A;  1TNX A;  2H61 A;  2L2C A;  3FE9 A;  2LP3 A;  2BEC A;  1J7R A;  2OS8 C;  3BFA A;  3LLE A;  3S0F A;  2H61 C;  1VRK A;  3B88 A;  2WCF A;  2WC6 A;  3O6B A;  1JFJ A;  1YUS A;  1FI6 A;  2K7B A;  1JUO A;  1KQM C;  2JXL A;  2KI4 B;  1K9K A;  4BY5 A;  1RWY A;  1U5I A;  5HKY A;  4CFR A;  3CAB A;  1TWO A;  1JBA A;  1A75 B;  3UO9 A;  4MLW A;  3PFV A;  1CLM A;  1KWO C;  5AAN A;  4YGD B;  2L2E A;  4XJK B;  1YR5 A;  3HX4 A;  2OS8 B;  1K94 A;  1LVC D;  3S0E A;  5ER5 A;  1UP5 A;  1AJ5 A;  2BKI B;  3V2L A;  3BUX B;  4PHJ A;  1EXR A;  1XFW O;  3B87 A;  1DT7 B;  1E8A A;  2MBX A;  3NGV A;  2JTT A;  2I2R E;  1LKJ A;  2COL B;  3D10 A;  4BY4 A;  1JF2 A;  3D78 A;  5D7F A;  1RTP 1;  1SCM C;  4IL1 A;  1BG1 A;  3A4U B;  1R6P A;  1OOI X;  2MLF C;  2LE9 B;  1EH2 A;  1M63 B;  1NSH A;  2PQL A;  2E6W A;  1Y1U A;  3CZ2 A;  2WCM A;  1CB1 A;  1OOJ A;  4OKH A;  2QEV A;  3KEV A;  3SS3 A;  4DS7 A;  2K61 A;  1CFP A;  1GM0 A;  3BUM B;  2L5Y A;  3EVU A;  2KDH A;  1BJF A;  1NIW A;  4JKT A;  2M97 A;  3SG5 A;  1QIW A;  1SK6 D;  2WCE A;  1RJV A;  1SMG A;  1ORG A;  1RFJ A;  1NP8 A;  1MQ1 A;  1V1F A;  2K8M B;  2K0J A;  2KBM A;  1SL7 A;  2L5X B;  2P71 A;  4I5L B;  1TNW A;  1J1E A;  1DGV A;  4MRY A;  4CFQ A;  3EVV A;  1B47 A;  5KTY A;  2LLS A;  4ZCU A;  1SR6 C;  4FQO A;  2M49 B;  4ORB B;  1JF0 A;  2FJU B;  1CFC A;  2JC2 A;  1DJX A;  3BUW B;  2M1K B;  3BFB A;  1DTL A;  1B7T Z;  2BE4 A;  1W7J B;  1DGU A;  1GQM A;  3VRQ A;  1MXE A;  2WC5 A;  1S1E A;  1B4C A;  4C0J A;  3AAJ A;  3WNX B;  4YGB B;  3S0D A;  1WDC C;  3NHI A;  1GGW A;  4OV2 A;  3FE6 A;  1TRF A;  3K1E A;  5G08 A;  3I5G C;  5AXI A;  2LP2 A;  3OX6 A;  3OGN A;  1ALW A;  2NXQ A;  1BOC A;  1KK8 C;  1FBV A;  1HT9 A;  2JQ6 A;  4NDD A;  1PSR A;  3EK8 A;  1NPQ A;  1NX2 A;  1SBJ A;  4MBE A;  1Q80 A;  4IJ7 A;  1RRO A;  4A4C A;  2QDI A;  5DIC A;  4AQJ A;  3SG3 A;  1PSB A;  2WOS A;  3ZWH A;  1IIO A;  3NSL A;  2LM5 A;  4GGN A;  4FQT A;  3MSE B;  1YVL A;  3K21 A;  1K8U A;  1JWD A;  2VRG A;  3B86 A;  4HRH A;  4INW A;  1QJT A;  1TCF A;  2MJW B;  2OTG C;  3VRN A;  3D73 A;  4N5X A;  5JOL A;  2KBI A;  1KK8 B;  4F0Z B;  3SIB A;  3FWC A;  4DCK A;  5I8N A;  1K93 D;  2LAP A;  1OOG A;  1OMD A;  4I5K A;  1YRU B;  1SPY A;  2L51 A;  1NX0 A;  4XYN A;  3EVR A;  1HQV A;  3BOW A;  2FOT A;  1N65 A;  1DMO A;  2KYC A;  4YRU A;  3GOF A;  2LMT A;  3PN7 C;  3CR4 X;  3VGO A;  1DQE A;  2ZND A;  2LLT A;  2ZN9 A;  2LVI A;  3I5H B;  2JPO A;  2L50 A;  1K95 A;  1F4Q A;  1OW4 A;  3N7H A;  1P28 A;  1UUS A;  1C7W A;  4M2P A;  5B8I B;  1YTZ C;  1L2O C;  2FJY A;  2OTG B;  3L4A A;  3CDN A;  1A29 A;  4MZL A;  1S36 A;  3D77 A;  3SS5 A;  2P6B B;  4FTG A;  3TUY B;  2WCB A;  4C0K A;  2OPO A;  2CT9 A;  2NCP A;  1S5G Z;  3QRX A;  2RGI A;  2MRD A;  4N1F A;  5FI7 A;  1NCY A;  2H2K A;  3BOW B;  5PAL A;  2AMI A;  1CDM A;  2K60 A;  2WCL A;  3TDU A;  1CMG A;  2ERB A;  1OE9 B;  3HCM A;  1CM4 A;  3PM8 A;  5KU1 A;  2GV5 A;  4HRE E;  1L2O B;  2KI4 C;  4R1E A;  1XFU O;  2EHB A;  3DXL A;  3PSR A;  4YI9 A;  1MF8 B;  2LNK A;  2L0P A;  2KQ6 A;  1W7I B;  3SG4 A;  5BPJ A;  3O4Y A;  1C3Y A;  2ZRT A;  3WHT B;  2Y1N A;  1NUB A;  1IRJ A;  2K7D A;  2HF5 A;  1UHN A;  1TN4 A;  1T14 A;  3CWG A;  1SSE B;  3CZ0 A;  2KHN A;  2KFH A;  2KLE A;  1PVB A;  1K96 A;  2H8V A;  1DJZ A;  4E68 A;  1KK7 Z;  2F3Z A;  1V1G A;  3C1V A;  1BMO A;  5CPV A;  1UHH A;  2BE6 A;  2GGZ A;  2HET A;  2SCP A;  4HSZ A;  2JT3 A;  2ZN8 A;  1QWV A;  1OOF A;  2JPT A;  3TDZ A;  3LK0 A;  2KOT A;  1LA3 A;  1SW8 A;  3PAL A;  3FIA A;  5F6T A;  2Y5I A;  3CS1 A;  4MZK A;  1MXL C;  3LCP C;  1BU3 A;  1MHO A;  1DC1 A;  1D1O A;  2F2P A;  3R1O A;  1TTX A;  3SS4 A;  3BUN B;  4A4B A;  1H4B A;  2DOQ A;  2KSP A;  2HQ8 A;  3I5I B;  1C3Z A;  1DJG A;  3B6X A;  1XK4 A;  1YX8 A;  4GNK B;  4MEW A;  2F8P A;  1EL4 A;  1XYD A;  2O5G A;  5DKQ A;  3R1V A;  1QAS A;  2BBN A;  3AAK A;  1K9U A;  1WRZ A;  1LXF C;  2WC8 A;  1J7O A;  2M0R A;  3EK7 A;  2WCJ A;  2L4H A;  1IH0 A;  1RK9 A;  1ZOT B;  1DEK A;  3BFH A;  1F54 A;  4PHN A;  1XFY O;  2F2O A;  4CLN A;  4PE4 A;  2O60 A;  4USL A;  2LHI A;  1UUR A;  1A4P A;  2ZNE A;  3D74 A;  1MUX A;  1QV1 A;  4OVN F;  1WRL A;  4PT1 A;  2Y1M A;  1EG3 A;  1TUJ A;  4P5O E;  3TZ1 A; 
#chains in the Genus database with same CATH homology
 5IBW A;  4ORA B;  1IQ5 A;  1AJ4 A;  1PVA A;  3ZNI A;  1B9A A;  2K7C A;  4NQG A;  2LLU A;  1N2D A;  4MSP A;  2BL0 B;  1IG5 A;  1BT6 A;  3RM1 A;  4M2Q A;  1QIV A;  2E30 A;  1QTX A;  1SRA A;  3KPX A;  1M31 A;  4ORC B;  3NSK A;  1TNP A;  1PAL A;  2KFF A;  3DVJ A;  1UWO A;  1KFX S;  1NCX A;  4PDZ A;  4U8D A;  2MA2 A;  5CSJ A;  1PUL A;  3BYA A;  1CTR A;  1F70 A;  1AVS A;  2KGR A;  2CNP A;  4WQ2 A;  4TNC A;  1XFX O;  3IQQ A;  4JWQ A;  3I5H C;  2PVB A;  2EC6 B;  1OMR A;  1QVI Y;  3IQO A;  1K90 D;  1LA0 A;  1TIZ A;  3E3R A;  3TS5 C;  1BLQ A;  1BOD A;  1DJH A;  4GBA A;  1QX5 B;  1IJ6 A;  1WY9 A;  2KAX A;  1JSA A;  3DVE A;  4N1G A;  3TUY C;  2R2I A;  1QX2 A;  1OZS A;  3O2P A;  1FPW A;  1OSA A;  1OMV A;  1XFZ O;  3VRR A;  2GGM A;  5HKW A;  1S6J A;  1JC2 A;  4GGF A;  1PK0 D;  3TS5 B;  1DJW A;  1AUI B;  3NSI A;  3CZT X;  1L7Z A;  2F3Y A;  3SJS A;  1QS7 A;  2I94 A;  4PAL A;  2PRU A;  1BR1 B;  2B1U A;  2LVJ A;  5K89 A;  5HLV A;  4CID A;  2LCP A;  3OB2 B;  3GK2 A;  2SAS A;  3BUO B;  1AP4 A;  5I2L A;  1ZAC A;  2BBM A;  3CGA A;  3GK4 X;  1SCV A;  1M46 A;  1IQ3 A;  3FWB A;  5AEQ A;  2JRF A;  1NX1 A;  2JNX A;  4I5J A;  2JU0 A;  4JQ0 D;  2AUC A;  2HQW A;  1TOP A;  2M3W A;  5GQQ C;  4YGC B;  4MRX A;  4NDB A;  2I7A A;  1FW4 A;  2KNE A;  2LVV A;  4JPZ B;  3I5F B;  1QAT A;  5CSN A;  1BR4 B;  3DF0 A;  2LAN A;  2A4J A;  3BQ3 A;  1CFD A;  1S26 D;  1IGV A;  4YGA A;  3TDI A;  5AFP A;  4OCI A;  1DJY A;  1NX3 A;  3NSO A;  2V53 A;  1KQV A;  1J55 A;  3I5I C;  1GJY A;  2LVK A;  2M8U A;  2PSR A;  3GK1 A;  3O78 A;  4GFT A;  5J3X A;  1C07 A;  3EKH A;  3KO0 A;  1B8L A;  4YI8 A;  2L98 A;  2JTZ A;  2PAS A;  1CLB A;  4MN0 A;  3OX5 A;  1KFX L;  3CTN A;  5KSZ A;  1IJ5 A;  1B8R A;  1G8I A;  1NWD A;  1QXP A;  1ZFS A;  2JOJ A;  2NCO A;  3JTD B;  1ALV A;  1FI5 A;  2Y4Q A;  1EG4 A;  2FCE A;  4DUQ A;  3DF0 B;  1KSO A;  2MLE C;  5HYD A;  1CMF A;  1G33 A;  1NCZ A;  1B7T Y;  2I18 A;  1CLL A;  1CNP A;  1QX7 A;  3PLF B;  1CKK A;  2LMU A;  3IF7 A;  1J7P A;  3D0Y A;  1A2X A;  1F71 A;  2KAV A;  3LL8 B;  5ER4 X;  1S3P A;  1SY9 A;  1XFV O;  1MR8 A;  4AOM A;  4Q04 A;  1XK4 C;  2M7N A;  3SG6 A;  1KSM A;  2KYF A;  4PHM A;  2CXJ A;  1WLZ A;  3SG2 A;  1CFF A;  4ETO A;  2ZFD A;  4GUK A;  2M1U A;  1IKU A;  1REC A;  2M7L A;  2BL0 C;  2WND A;  2Q91 A;  3OP0 A;  4QJ4 B;  5AER A;  1KQM B;  1OQP A;  5CSI A;  3CR5 X;  1CM1 A;  2IS9 A;  1DJI A;  1KCY A;  3EK4 A;  3D0Y B;  3NXA A;  5TNC A;  1Y1X A;  1U5I B;  5JJG A;  2BCX A;  4QJ3 B;  1KWO B;  2MHH A;  5D69 A;  2ZRS A;  4WQ3 A;  1EJ3 A;  1ZUZ A;  1J7Q A;  1F55 A;  2JT8 A;  3H4S E;  3VRP A;  1UHI A;  1BF5 A;  1OZO A;  2EC6 C;  4D1E A;  2G9B A;  1SYM A;  4YGE B;  2BKH B;  4QJ5 B;  2HPS A;  1KFU L;  3WXA A;  4GPL B;  1UHJ A;  4AQI A;  1SCM B;  3KF9 A;  3AKA A;  4WRI A;  4PE7 A;  3VRO A;  1CDP A;  1AHR A;  2Q4U A;  1ODB A;  2K7O A;  5CSF A;  1X02 A;  1M45 A;  2LV7 A;  2QAC A;  1YUR A;  3JVT C;  3F45 A;  4ICB A;  3OHM B;  2ISD A;  2KI6 C;  1CDN A;  1SL9 A;  2JT0 A;  1JFK A;  2JXC A;  4ZCV A;  2D8N A;  1S5G Y;  1Y1A A;  1Y6W A;  4GAO A;  2CBL A;  4UPG A;  2KGB C;  4PHK A;  1IWQ A;  1R2U A;  2M29 A;  4CPV A;  1K2H A;  1DF0 A;  1G4Y R;  1GGZ A;  4NDC A;  1SR6 B;  2FCD A;  4PE0 A;  3SIA A;  1QLK A;  3JVT B;  4PCW A;  1A03 A;  2JZI A;  2BCB A;  2CCM A;  2LMV A;  4OR9 B;  2ZKM X;  2K2F A;  3PAT A;  1WDC B;  3ICB A;  5HLO A;  2QPT A;  1DVI A;  1QV0 A;  1CDL A;  1NYA A;  2LHL A;  3CR2 A;  1PRW A;  3I5G B;  1YVH A;  4GGF C;  2PMY A;  2TN4 A;  1KK7 Y;  2KQY A;  3M0W A;  1F8H A;  1DF0 B;  2JNF A;  1LIN A;  1Y0V H;  1XVJ A;  4L9M A;  1XO5 A;  3WHU B;  2NZ0 A;  3I5F C;  4HRG A;  2KI6 D;  1FF1 A;  3FS7 A;  4C0L A;  1WLM A;  1N0Y A;  2M9G A;  1SNL A;  1ZMZ A;  3EKJ A;  4M2O A;  5DKR A;  5I2Q A;  1SKT A;  1J1D A;  1YX7 A;  1TNQ A;  1SL8 A;  2KFG A;  3BXK A;  1KFU S;  4YBH B;  4DIR A;  2MAZ A;  3LK1 A;  3RLZ A;  1YUU A;  3KHE A;  1S6I A;  2BCA A;  1TCO B;  2LUC A;  4MVF A;  2K2A A;  1YUT A;  1H8B A;  1M39 A;  2JWW A;  1WRK A;  3SG7 A;  2KAY A;  5I2O A;  1UHK A;  2AAO A;  3CLN A;  5DKN A;  2F33 A;  3JTD C;  1B8C A;  3A8R A;  1QVI Z;  1K9P A;  2CTN A;  2JUL A;  3PN7 B;  4I5N B;  1F4O A;  2LUX A;  3DD4 A;  3OB1 B;  4MZJ A;  2LC5 A;  2EGD A;  4PE1 A;  1YRT B;  3AKB A;  1MWN A;  4DRW A;  1S6C A;  1XA5 A;  1B1G A;  4P2Y B;  2L4I A;  2NLN A;  1AK8 A;  1C7V A;  1A75 A;  5FYX A;  3DVM A;  2G2B A;  2WOR A;  5HKZ A;  1QLS A;  4XJK A;  2PAL A;  1TNX A;  2H61 A;  2LP3 A;  2BEC A;  1J7R A;  2OS8 C;  3LLE A;  2H61 C;  1VRK A;  1JFJ A;  2WCF A;  3O6B A;  1YUS A;  1FI6 A;  2K7B A;  1JUO A;  1KQM C;  2JXL A;  2KI4 B;  1K9K A;  4BY5 A;  1RWY A;  1U5I A;  5HKY A;  4CFR A;  1JBA A;  1A75 B;  4MLW A;  3PFV A;  1CLM A;  1KWO C;  5AAN A;  4YGD B;  2L2E A;  4XJK B;  1YR5 A;  3HX4 A;  2OS8 B;  1K94 A;  1LVC D;  5ER5 A;  1UP5 A;  1AJ5 A;  2BKI B;  3BUX B;  4PHJ A;  1EXR A;  1XFW O;  1DT7 B;  1E8A A;  2MBX A;  2JTT A;  2I2R E;  1LKJ A;  2COL B;  3D10 A;  4BY4 A;  1JF2 A;  5D7F A;  1RTP 1;  1SCM C;  4IL1 A;  1BG1 A;  3A4U B;  1R6P A;  2MLF C;  2LE9 B;  1EH2 A;  1M63 B;  1NSH A;  2E6W A;  1Y1U A;  1CB1 A;  1OOJ A;  4OKH A;  4DS7 A;  3KEV A;  1CFP A;  2K61 A;  3BUM B;  3EVU A;  2KDH A;  1BJF A;  1NIW A;  2M97 A;  3SG5 A;  1QIW A;  1SK6 D;  2WCE A;  1RJV A;  1SMG A;  1RFJ A;  2K8M B;  1NP8 A;  1MQ1 A;  1V1F A;  3DVK A;  2K0J A;  2KBM A;  1SL7 A;  2L5X B;  4I5L B;  4MRY A;  1TNW A;  1J1E A;  1DGV A;  4CFQ A;  3EVV A;  1B47 A;  5KTY A;  2LLS A;  4ZCU A;  1SR6 C;  4FQO A;  2M49 B;  4ORB B;  1JF0 A;  2FJU B;  1CFC A;  2JC2 A;  1DJX A;  3BUW B;  2M1K B;  1DTL A;  1B7T Z;  2BE4 A;  1W7J B;  1DGU A;  1GQM A;  3VRQ A;  1MXE A;  1S1E A;  1B4C A;  4C0J A;  3AAJ A;  3WNX B;  4YGB B;  1WDC C;  1GGW A;  4OV2 A;  1TRF A;  5G08 A;  3I5G C;  5AXI A;  2LP2 A;  3OX6 A;  1ALW A;  2NXQ A;  1BOC A;  1KK8 C;  1FBV A;  1HT9 A;  2JQ6 A;  4NDD A;  1PSR A;  3EK8 A;  1NPQ A;  1NX2 A;  1SBJ A;  4MBE A;  1Q80 A;  4A4C A;  1RRO A;  4AQJ A;  3SG3 A;  1PSB A;  2WOS A;  3ZWH A;  3NSL A;  2LM5 A;  4GGN A;  3MSE B;  1YVL A;  3K21 A;  1K8U A;  1JWD A;  2VRG A;  4HRH A;  1QJT A;  1TCF A;  2MJW B;  2OTG C;  3VRN A;  4N5X A;  5JOL A;  2KBI A;  1KK8 B;  4F0Z B;  3SIB A;  3FWC A;  4DCK A;  5I8N A;  1K93 D;  2LAP A;  1OMD A;  4I5K A;  1YRU B;  1SPY A;  2L51 A;  1NX0 A;  4XYN A;  3EVR A;  1HQV A;  3BOW A;  2FOT A;  1N65 A;  1DMO A;  2KYC A;  4YRU A;  3GOF A;  2LMT A;  3PN7 C;  3CR4 X;  3VGO A;  2ZND A;  2LLT A;  2ZN9 A;  2LVI A;  3I5H B;  2L50 A;  1K95 A;  1F4Q A;  1UUS A;  1C7W A;  4M2P A;  5B8I B;  1YTZ C;  1L2O C;  2OTG B;  1A29 A;  4MZL A;  1S36 A;  2P6B B;  4FTG A;  3TUY B;  2WCB A;  4C0K A;  2OPO A;  2CT9 A;  2NCP A;  1S5G Z;  3QRX A;  2RGI A;  2MRD A;  4N1F A;  1NCY A;  2H2K A;  3BOW B;  5PAL A;  2AMI A;  1CDM A;  3TDU A;  1CMG A;  1OE9 B;  3HCM A;  1CM4 A;  3PM8 A;  5KU1 A;  2GV5 A;  4HRE E;  1L2O B;  2KI4 C;  4R1E A;  1XFU O;  2EHB A;  3PSR A;  4YI9 A;  1MF8 B;  2LNK A;  2L0P A;  2KQ6 A;  1W7I B;  3SG4 A;  5BPJ A;  3O4Y A;  2ZRT A;  3WHT B;  2Y1N A;  1NUB A;  1IRJ A;  2K7D A;  2HF5 A;  1UHN A;  1TN4 A;  3CWG A;  2KHN A;  2KFH A;  1PVB A;  1K96 A;  1DJZ A;  4E68 A;  1KK7 Z;  2F3Z A;  1V1G A;  3C1V A;  1BMO A;  5CPV A;  1UHH A;  2BE6 A;  2GGZ A;  2HET A;  2SCP A;  4HSZ A;  2JT3 A;  2ZN8 A;  3TDZ A;  2JPT A;  3LK0 A;  2KOT A;  1LA3 A;  1SW8 A;  3PAL A;  3FIA A;  5F6T A;  2Y5I A;  3CS1 A;  4MZK A;  1MXL C;  3LCP C;  1BU3 A;  1MHO A;  1D1O A;  2F2P A;  1TTX A;  3BUN B;  4A4B A;  1H4B A;  2DOQ A;  2KSP A;  2HQ8 A;  3I5I B;  1DJG A;  1XK4 A;  1YX8 A;  4GNK B;  4MEW A;  2F8P A;  1EL4 A;  1XYD A;  2O5G A;  5DKQ A;  1QAS A;  2BBN A;  3AAK A;  1K9U A;  1WRZ A;  1LXF C;  2WC8 A;  1J7O A;  2M0R A;  3EK7 A;  2L4H A;  1IH0 A;  1RK9 A;  1ZOT B;  1F54 A;  4PHN A;  1XFY O;  2F2O A;  4CLN A;  4PE4 A;  2O60 A;  4USL A;  2LHI A;  1UUR A;  1A4P A;  2ZNE A;  1MUX A;  1QV1 A;  4OVN F;  1WRL A;  2Y1M A;  1EG3 A;  4P5O E;  3TZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...