2K7OA

Ca2+-s100b, refined with rdcs
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
91
structure length
91
Chain Sequence
SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVSMVTTACHEFFEHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title Refinement of the solution structure and dynamic properties of Ca(2+)-bound rat S100B.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal binding protein
total genus 24
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2k7oA00
1QX2A 2BBNA 1YR5A 1B4CA 4HREE 1SBJA 4ORBB 5CSJA 3TUYB 4I5JA 2EHBA 1Y6WA 1SPYA 2M8UA 1EXRA 3EVVA 1QX7A 1FBVA 3I5GB 2KFHA 3OX6A 4PDZA 2PASA 4YGEB 2WC8A 3PALA 1ALVA 3RLZA 5I2OA 1KK7Z 1H4BA 2KHNA 2PSRA 1NSHA 1SCMC 5CPVA 1QVIY 2I7AA 1BT6A 2ZN9A 1QV0A 4UPGA 2LANA 2LHLA 2MAZA 3A4UB 3EK7A 1L2OC 3AKAA 3SJSA 4C0JA 1B8RA 4GGFC 2M0RA 3TDZA 4YBHB 2H2KA 2L98A 4IL1A 1IH0A 1UHJA 1U5IB 2TN4A 4XYNA 1CMGA 5KTYA 1KFUS 1H8BA 2KI6C 4GUKA 2LAPA 2ZFDA 4MBEA 1F4OA 2KI4C 2LUCA 5K89A 1EG4A 2WCFA 1WLZA 2OPOA 5JOLA 1RWYA 3AAJA 3TS5C 3FIAA 3CLNA 1KQVA 3WHUB 1CTRA 3KPXA 1K8UA 1NCZA 1S36A 2G2BA 1AJ4A 4GPLB 3QRXA 1YVLA 2KAYA 3CS1A 2K2AA 3RM1A 1JC2A 4GBAA 2M7LA 1J1DA 2M97A 1C7WA 2K0JA 1TCOB 1XFXO 1SK6D 2CXJA 3F45A 1SCVA 2KGBC 1NYAA 3PN7C 2KQ6A 2LMTA 3PLFB 4YI8A 1N65A 3SIBA 5J3XA 4PALA 3K21A 3VRNA 2F3ZA 1KSOA 1YUSA 1PULA 4MRXA 4CFQA 1KFXL 4GGFA 2FCDA 1WRZA 3LK0A 1W7JB 1FI6A 1BF5A 1UUSA 1PK0D 3WXAA 4DUQA 1F8HA 1CLMA 1RECA 2KQYA 2L4HA 1OMRA 1ZOTB 4ICBA 1CM4A 1K94A 2JQ6A 4PE4A 1FW4A 4PHJA 1AP4A 2IS9A 1XYDA 3DF0A 5FYXA 3EVRA 1QLSA 4D1EA 1LA0A 1J7RA 1MR8A 2KI6D 2JTTA 1YRUB 4GAOA 2E6WA 1RJVA 4I5NB 2ZNEA 1KK8C 1QASA 4PHKA 2OTGC 4GFTA 1AUIB 1EJ3A 1YUUA 1XFYO 1NIWA 1CM1A 1AK8A 3TDUA 2R2IA 2GV5A 2GGZA 3JTDB 4N1FA 1PALA 2WCBA 1V1GA 2MLEC 1EL4A 1DGUA 2F8PA 1M39A 2L2EA 2NCPA 4MRYA 3CR5X 3BUNB 1DTLA 3EK8A 1GGWA 1Y1UA 2QPTA 1OOJA 2WOSA 1QATA 4YGCB 1YX8A 3MSEB 5G08A 2V53A 2LVJA 1KWOC 2JU0A 1R2UA 5PALA 3DVKA 1N0YA 1KFXS 2EGDA 3BUXB 2KYCA 4NDCA 1A4PA 4QJ3B 2JZIA 1TTXA 1CFFA 3VRPA 1J55A 1XO5A 4DRWA 4HRGA 3BOWA 1TNQA 3TDIA 2F2PA 1KK7Y 2L4IA 4CLNA 3KF9A 2O5GA 1QJTA 1UHIA 3FS7A 3OP0A 4PE0A 5AXIA 4NDBA 4CFRA 1OSAA 2MA2A 4MEWA 4PHMA 1A2XA 2NXQA 3CTNA 2PALA 1XA5A 3GK4X 2L50A 1SR6C 1YX7A 1DF0A 3PN7B 4MN0A 3O2PA 1SMGA 2M3WA 4YI9A 4MZLA 1NWDA 3IF7A 4AQJA 2MJWB 4YGAA 1DJYA 1EH2A 2JWWA 5D7FA 2P6BB 1CFDA 2RGIA 3H4SE 1BOCA 2LV7A 4M2OA 1SL9A 5ER5A 2F33A 4YRUA 3EKHA 4NDDA 3BOWB 2GGMA 4QJ4B 3AAKA 3NSOA 2FOTA 1NCXA 2BBMA 1A29A 2CCMA 2BL0C 2EC6B 3BUMB 1TIZA 2AUCA 3CR2A 2QACA 2K7BA 1IJ5A 1LKJA 1DVIA 1Y1XA 3JVTC 1MQ1A 2I18A 3AKBA 1DJIA 1MUXA 1MXEA 4JWQA 2JNFA 4YGBB 1ZFSA 3CWGA 2KSPA 1CNPA 1TRFA 4N1GA 2BKHB 1BU3A 1OZSA 2PVBA 3O4YA 3EKJA 1G4YR 2Y1MA 5JJGA 3PM8A 4ZCVA 3BUWB 3NSLA 1QS7A 1IGVA 1S5GZ 2BCBA 1AHRA 4BY4A 2Y5IA 1YVHA 2BCAA 4WRIA 1HQVA 1NP8A 2OS8C 2O60A 2NZ0A 5AEQA 2BE4A 3PSRA 1CFPA 2CNPA 1B47A 1ZMZA 1QIVA 3BQ3A 1J7QA 3D0YA 2ZRTA 1TN4A 4QJ5B 1JFJA 2KGRA 1L7ZA 2Q91A 3I5HC 5DKRA 1D1OA 3I5FC 1XK4C 1WDCC 1QVIZ 1WY9A 2JRFA 1WRLA 5CSNA 1KQMC 4M2PA 2JC2A 3VRQA 4AQIA 1J7PA 4E68A 1JSAA 2BECA 1CDMA 2KNEA 1SL8A 1NX0A 3CR4X 4PE7A 5AERA 1XFZO 1DJHA 2CTNA 2DOQA 1B7TZ 3LCPC 5KSZA 1N2DA 5AANA 2M49B 2B1UA 1DJZA 1PRWA 1EG3A 3I5IC 1SCMB 1K96A 2LE9B 1SL7A 1M45A 2KFFA 3OB1B 3TUYC 1SW8A 4MVFA 4NQGA 2LVIA 1L2OB 4L9MA 1TNWA 3JVTB 3PFVA 4XJKA 2NLNA 5CSFA 2PMYA 4ZCUA 3VRRA 3DD4A 2Y4QA 4F0ZB 3DF0B 1F54A 1MXLC 2JTZA 3VROA 4P5OE 2WCEA 4OV2A 1OZOA 1XK4A 2ZRSA 4P2YB 1BR1B 1UWOA 2KI4B 4FTGA 3ICBA 5BPJA 1ODBA 3NXAA 2M7NA 2M29A 2ZN8A 1JUOA 3TS5B 5B8IB 2K8MB 4WQ3A 1UP5A 2I2RE 3SG7A 2M1KB 5TNCA 2LVKA 4JQ0D 4A4BA 5CSIA 1SNLA 2LUXA 2D8NA 1IRJA 5HKYA 3SG6A 2BKIB 1M63B 3LLEA 1A03A 1F55A 3NSKA 1B9AA 4XJKB 1DT7B 5KU1A 2LCPA 2H61C 1NX2A 2BCXA 1VRKA 3HX4A 2LMUA 1SY9A 1S6IA 1S3PA 5HLVA 3SG4A 1UHNA 1QXPA 1A75A 1UHKA 2K7DA 1JFKA 1B8CA 3OHMB 3SIAA 1WDCB 5I2QA 1KQMB 1CFCA 2KDHA 2KYFA 4YGDB 1B1GA 4GGNA 1UHHA 2HETA 2M1UA 4N5XA 2F3YA 3VGOA 2SASA 5HKWA 4I5LB 1TNXA 1Y1AA 1S5GY 1ZUZA 4U8DA 1OMDA 4MZKA 3CGAA 2MLFC 2K61A 1KK8B 1DJWA 2KAXA 3PATA 2LHIA 2OTGB 1PSBA 4DIRA 1QX5B 5I2LA 4PE1A 3I5IB 4CPVA 2KBIA 3IQQA 5D69A 1DF0B 2HQWA 1LINA 1QTXA 1UURA 1XFVO 1RK9A 2M9GA 3CZTX 2PRUA 4I5KA 4PCWA 1GGZA 1A75B 2KFGA 1RFJA 4M2QA 1LVCD 2Q4UA 3FWCA 2H61A 1PVAA 1QLKA 1KSMA 3JTDC 4OKHA 2WNDA 1F71A 1PSRA 1KWOB 4DS7A 2JNXA 1Y0VH 1C7VA 2JOJA 2CBLA 3EK4A 1K9PA 1YTZC 3GK2A 2K2FA 1DMOA 1QV1A 1B7TY 1S26D 4BY5A 1F70A 2I94A 4FQOA 1CLLA 2JT3A 1BG1A 2MRDA 1TCFA 1M46A 1C07A 2F2OA 1K9KA 1NX1A 2FCEA 5HYDA 2LVVA 2MBXA 1SKTA 2KBMA 1BR4B 2JXLA 4USLA 4CIDA 2LLUA 2LM5A 1SR6B 5DKQA 1SRAA 1YUTA 4HRHA 1X02A 2LP2A 4OVNF 3ZNIA 2WORA 4ORAB 1MHOA 2L5XB 1FI5A 3DVMA 1AJ5A 1NPQA 1AVSA 1R6PA 1IKUA 4MLWA 4HSZA 1YURA 1K90D 1F4QA 3A8RA 3SG2A 2BE6A 1FPWA 1LXFC 1DJGA 1BJFA 2L51A 4C0LA 2VRGA 1FF1A 2JT0A 1V1FA 5HLOA 1TOPA 1RTP1 1BLQA 3M0WA 4MZJA 4MSPA 5HKZA 2LNKA 4WQ2A 2KOTA 1Q80A 3O78A 1JBAA 1WLMA 1HT9A 3D0YB 3I5GC 3SG5A 2BL0B 5IBWA 1M31A 3LK1A 1DJXA 2HQ8A 2JXCA 3BXKA 2LLTA 1OE9B 3OX5A 2MHHA 4PHNA 1E8AA 2LC5A 1IG5A 2EC6C 3ZWHA 4AOMA 2E30A 1GJYA 5AFPA 1ZACA 3WHTB 1CDNA 1BODA 1CDLA 3DVEA 2L0PA 1JWDA 4A4CA 2CT9A 3DVJA 2JPTA 1S6CA 5ER4X 2ISDA 1NX3A 1IQ3A 1JF2A 4DCKA 2NCOA 3KO0A 2G9BA 5DKNA 2JT8A 3GK1A 2LMVA 1K9UA 4R1EA 3NSIA 2K7CA 4GNKB 2JULA 1J7OA 3O6BA 1G33A 1NUBA 3HCMA 3FWBA 2SCPA 2LP3A 2FJUB 2OS8B 1TNPA 3KEVA 1CDPA 1CLBA 1KCYA 1QIWA 1S6JA 4OR9B 1CMFA 4Q04A 1XVJA 1YRTB 1XFWO 3BUOB 1SYMA 3C1VA 1GQMA 1BMOA 3IQOA 2AMIA 1K93D 2A4JA 1RROA 1CKKA 1CB1A 1MWNA 1S1EA 3D10A 3I5HB 3LL8B 2K7OA 1LA3A 4OCIA 1ALWA 2ZNDA 1IQ5A 3I5FB 3SG3A 3GOFA 1OQPA 1K95A 2KAVA 1J1EA 2ZKMX 2COLB 1B8LA 1KFUL 4ORCB 1MF8B 1K2HA 5I8NA 3KHEA 3OB2B 3EVUA 2Y1NA 1NCYA 1G8IA 5GQQC 1IWQA 1XFUO 2LLSA 4TNCA 3TZ1A 2HF5A 1OMVA 1WRKA 5F6TA 2AAOA 1DGVA 4C0KA 1U5IA 1IJ6A 1W7IB 1PVBA 1JF0A 3BYAA 4ETOA 3WNXB 2HPSA 4JPZB 3E3RA
chains in the Genus database with same CATH superfamily
1QX2A 2BBNA 1YR5A 1B4CA 4HREE 1SBJA 4ORBB 5CSJA 3TUYB 4I5JA 2EHBA 1Y6WA 1SPYA 2M8UA 1EXRA 3EVVA 1QX7A 1FBVA 3I5GB 2KFHA 3OX6A 4PDZA 2PASA 4YGEB 2WC8A 2QDIA 3S0EA 3PALA 1ALVA 3RLZA 5I2OA 1KK7Z 1H4BA 2KHNA 2PSRA 1NSHA 1SCMC 5CPVA 1QVIY 2I7AA 1BT6A 2ZN9A 1QV0A 4UPGA 2LANA 2LHLA 2MAZA 3A4UB 3EK7A 2FJYA 1L2OC 3AKAA 3SJSA 4C0JA 1B8RA 4GGFC 2M0RA 3TDZA 4YBHB 2H2KA 2L98A 4IL1A 1IH0A 1UHJA 1U5IB 2TN4A 4XYNA 1CMGA 3OBVA 5KTYA 1KFUS 1H8BA 2KI6C 4GUKA 2LAPA 2ZFDA 4MBEA 1F4OA 2KI4C 2BNXA 2LUCA 5K89A 1EG4A 2WCFA 1WLZA 2OPOA 5JOLA 1RWYA 3AAJA 3TS5C 3FIAA 3CLNA 1KQVA 3WHUB 1CTRA 3KPXA 1K8UA 1NCZA 1S36A 2G2BA 1AJ4A 3D76A 4GPLB 3QRXA 1YVLA 2KAYA 3CS1A 2K2AA 3RM1A 1JC2A 4GBAA 2M7LA 1J1DA 2M97A 3OGNA 1C7WA 2K0JA 1TCOB 1XFXO 1SK6D 2CXJA 3B7AA 3F45A 1SCVA 2ERBA 1NYAA 2KGBC 2KQ6A 2LMTA 3B6XA 3PLFB 1N65A 3PN7C 4YI8A 4PALA 3K21A 5J3XA 3VRNA 2F3ZA 1KSOA 1YUSA 1PULA 4MRXA 4CFQA 1KFXL 4GGFA 2FCDA 5EL2A 1WRZA 3LK0A 1W7JB 1FI6A 1BF5A 1UUSA 1PK0D 3WXAA 4DUQA 3BFHA 1F8HA 1CLMA 1DELA 1RECA 2KQYA 2L4HA 1ZOTB 1OMRA 1TUZA 3CDNA 4ICBA 1CM4A 1K94A 2JQ6A 2QEBA 1FW4A 4PE4A 4PHJA 2IS9A 1XYDA 3DF0A 5FYXA 3DZTA 3EVRA 1QLSA 3UNWA 1LA0A 4D1EA 1J7RA 1MR8A 2KI6D 2JTTA 1YRUB 2P70A 4GAOA 2E6WA 1P28A 1RJVA 4I5NB 2ZNEA 1KK8C 1QASA 3L4LA 4PHKA 2OTGC 1T14A 4GFTA 1AUIB 1EJ3A 1YUUA 1XFYO 1NIWA 1CM1A 2WC5A 1AK8A 3TDUA 2R2IA 2GV5A 2GGZA 1OOGA 3JTDB 4N1FA 1PALA 3CZ0A 2WCBA 1V1GA 2MLEC 1EL4A 1DGUA 2F8PA 1M39A 2L2EA 2NCPA 4MRYA 3CR5X 3BUNB 3VB1A 1DTLA 3EK8A 1GGWA 1Y1UA 2QPTA 1OOJA 2WOSA 3FE9A 1QATA 3NHTA 1YX8A 3MSEB 4YGCB 3B88A 2V53A 5G08A 2LVJA 1KWOC 2JU0A 1R2UA 2L5YA 5PALA 3DVKA 1N0YA 1KFXS 2EGDA 3BUXB 2KYCA 4NDCA 1A4PA 4QJ3B 2JZIA 1TTXA 1CFFA 3VRPA 1J55A 1XO5A 4DRWA 4HRGA 3BOWA 1TNQA 3TDIA 2F2PA 1KK7Y 2L4IA 4CLNA 3KF9A 2KPHA 2O5GA 1QJTA 1UHIA 3FS7A 4OZDA 3OP0A 4PE0A 5AXIA 4NDBA 4CFRA 1OSAA 2MA2A 4MEWA 4PHMA 1A2XA 3D73A 2NXQA 3CTNA 1C3YA 2PALA 2WCKA 1DEKA 1XA5A 3GK4X 2L50A 1SR6C 1YX7A 1DF0A 3PN7B 4MN0A 3O2PA 1SMGA 2M3WA 4INXA 4MZLA 4YI9A 1NWDA 3IF7A 4AQJA 2MJWB 4YGAA 1DJYA 4KYNA 1EH2A 4PT1A 2JWWA 5D7FA 2P6BB 1CFDA 2RGIA 3H4SE 1BOCA 2LV7A 4M2OA 1SL9A 5ER5A 2F33A 4YRUA 3DYEA 2L2CA 3BOWB 3D77A 3EKHA 4NDDA 2GGMA 3R1PA 3S0GA 4QJ4B 3AAKA 3NSOA 2FOTA 1NCXA 2BBMA 1A29A 2JPOA 2CCMA 2BL0C 2EC6B 3BUMB 1TIZA 2AUCA 3CR2A 2QACA 2K7BA 1IJ5A 1LKJA 3O4XA 1DVIA 1Y1XA 3JVTC 1MQ1A 2I18A 3AKBA 1DJIA 1MUXA 1OOHA 1MXEA 3FE8A 4JWQA 2JNFA 2KLEA 4YGBB 1ZFSA 3CWGA 2KSPA 1CNPA 3IVTA 1TRFA 1CB1A 4N1GA 2BKHB 1BU3A 1OZSA 3D75A 2PVBA 3O4YA 3EKJA 1G4YR 2Y1MA 5JJGA 3PM8A 4ZCVA 1XFRA 3BUWB 3NSLA 3CABA 1QS7A 1IGVA 1S5GZ 2BCBA 1AHRA 4BY4A 2Y5IA 1OOIX 1YVHA 2BCAA 4WRIA 1HQVA 1NP8A 2OS8C 2O60A 2NZ0A 3EG5B 3SS3A 5AEQA 2BE4A 3BFAA 3R72A 3PSRA 1CFPA 1B47A 2CNPA 1ZMZA 1QIVA 3BQ3A 1J7QA 3D0YA 2ZRTA 1SSEB 1TN4A 1OOFA 4QJ5B 1JFJA 3L47A 2KGRA 1L7ZA 2Q91A 3I5HC 5DKRA 2GTEA 1D1OA 1ORGA 3I5FC 1XK4C 1WDCC 1QVIZ 1WY9A 2JRFA 1WRLA 5CSNA 1KQMC 4M2PA 2JC2A 3VRQA 3NHIA 4AQIA 3NGVA 4E68A 1J7PA 1JSAA 2BECA 1CDMA 3R1OA 2KNEA 1SL8A 1NX0A 3CR4X 4PE7A 5AERA 3B86A 2P71A 1XFZO 1DJHA 2CTNA 2DOQA 1B7TZ 3LCPC 5KSZA 1N2DA 5AANA 2BAPA 1GM0A 2M49B 2B1UA 1DJZA 1PRWA 2YGUA 1EG3A 3I5IC 1SCMB 1K96A 2LE9B 1SL7A 1M45A 2KFFA 3OB1B 3TUYC 2K60A 1SW8A 4MVFA 4NQGA 2LVIA 1L2OB 4F7FA 5FI6A 4L9MA 1TNWA 3JVTB 3DXLA 3PFVA 4XJKA 2NLNA 5CSFA 3L4AA 2PMYA 4ZCUA 3VRRA 3DD4A 2Y4QA 4F0ZB 3DF0B 1AP4A 1F54A 1MXLC 2JTZA 3BFBA 3VROA 4P5OE 2WCEA 4OV2A 1OZOA 1XK4A 2ZRSA 4P2YB 1BR1B 1UWOA 2KI4B 4FTGA 2WCHA 3ICBA 3R1VA 5BPJA 1ODBA 2H8VA 2M7NA 3NXAA 2M29A 2ZN8A 1JUOA 5FI2A 3TS5B 5B8IB 2K8MB 4WQ3A 1UP5A 2I2RE 3SG7A 2M1KB 5TNCA 2LVKA 4JQ0D 4A4BA 5CSIA 1SNLA 2LUXA 5FI7A 3Q8IA 2D8NA 1IRJA 5HKYA 3SG6A 2BKIB 1M63B 3LLEA 1A03A 1F55A 3NSKA 3UO9A 1B9AA 4XJKB 5HL1A 1DT7B 5KU1A 2LCPA 2H61C 1LS8A 1NX2A 2WC6A 2BCXA 1VRKA 3HX4A 3V2LA 2LMUA 1SY9A 1S6IA 1S3PA 5HLVA 3SG4A 1UHNA 1QXPA 5I94A 1A75A 1UHKA 2K7DA 1JFKA 1B8CA 3OHMB 3SIAA 1WDCB 1TWOA 5I2QA 3S0BA 1KQMB 1CFCA 2KDHA 2KYFA 4YGDB 1B1GA 4GGNA 1UHHA 2HETA 2M1UA 4N5XA 3BJHA 2F3YA 3VGOA 2SASA 5HKWA 4I5LB 1TNXA 1Y1AA 1S5GY 1ZUZA 4U8DA 1OMDA 4MZKA 3CGAA 2MLFC 2K61A 1KK8B 1DJWA 2KAXA 3PATA 3S0DA 2LHIA 2OTGB 3D78A 1PSBA 3B87A 4DIRA 3K1EA 2WCMA 1QX5B 5I2LA 4PE1A 3I5IB 4CPVA 2KBIA 3IQQA 5D69A 1DF0B 2HQWA 1LINA 1QTXA 1UURA 1XFVO 1RK9A 2M9GA 3CZTX 2PRUA 4I5KA 4PCWA 1GGZA 1A75B 2KFGA 1RFJA 4M2QA 1LVCD 2Q4UA 3FWCA 2H61A 1PVAA 1QLKA 1KSMA 3JTDC 4OKHA 2WNDA 1F71A 1PSRA 1KWOB 4DS7A 2JNXA 1Y0VH 1C7VA 1QWVA 2JOJA 2CBLA 3EK4A 1K9PA 1YTZC 3DY9A 3GK2A 2K2FA 1DMOA 1QV1A 1B7TY 1S26D 4BY5A 1F70A 2I94A 4FQOA 1CLLA 2JT3A 1DQEA 2MRDA 1TCFA 1BG1A 1M46A 1C07A 2F2OA 1IIOA 1K9KA 1NX1A 2FCEA 5HYDA 2LVVA 2MBXA 1SKTA 2KBMA 1BR4B 4IJ7A 2JXLA 4USLA 4CIDA 2LLUA 2LM5A 1SR6B 2QEOA 5DKQA 1SRAA 1YUTA 4HRHA 1X02A 2LP2A 4OVNF 3ZNIA 2WORA 4ORAB 1MHOA 2L5XB 1FI5A 3DVMA 1AJ5A 1NPQA 1AVSA 1R6PA 1IKUA 4MLWA 4HSZA 1YURA 3FE6A 1K90D 1F4QA 3A8RA 3SG2A 2BE6A 1FPWA 2QEVA 1LXFC 3S0FA 1DJGA 1BJFA 1W9ZA 2L51A 5DICA 2VRGA 4C0LA 1FF1A 2JT0A 1V1FA 5HLOA 1TOPA 1RTP1 1BLQA 3M0WA 4MZJA 4MSPA 5HKZA 3S0AA 2LNKA 4WQ2A 2KOTA 1Q80A 3O78A 2WCLA 1JBAA 3SS5A 1WLMA 1HT9A 3D0YB 3I5GC 3SG5A 2BL0B 3CZ1A 2PYQA 5IBWA 1OW4A 1M31A 4INWA 5D3OA 3LK1A 1DJXA 2HQ8A 2JXCA 3BXKA 1Z2CB 1OE9B 2LLTA 2KLDA 3OX5A 2MHHA 4PHNA 1E8AA 2LC5A 1IG5A 2EC6C 3ZWHA 4AOMA 2E30A 1GJYA 3SS4A 1ZACA 3WHTB 5AFPA 1C3ZA 1CDNA 1BODA 1CDLA 3DVEA 2L0PA 1JWDA 4A4CA 2CT9A 3DVJA 2JPTA 1S6CA 5ER4X 2ISDA 2PQLA 1NX3A 4JKTA 1IQ3A 1JF2A 3PJIA 2NCOA 4DCKA 3KO0A 2G9BA 5DKNA 3D74A 2JT8A 3GK1A 2LMVA 1K9UA 4R1EA 3NSIA 2K7CA 4GNKB 1Z4HA 2JULA 3PM2A 1J7OA 3O6BA 1G33A 1NUBA 3HCMA 3FWBA 3CYZA 2SCPA 2LP3A 2FJUB 2OS8B 1TNPA 3KEVA 1CDPA 1CLBA 1KCYA 3SIBA 1QIWA 1S6JA 4OR9B 1CMFA 4Q04A 2QEHA 1XVJA 1YRTB 1XFWO 3BUOB 3N7HA 1SYMA 3C1VA 1GQMA 1BMOA 3IQOA 3QMEA 2AMIA 1K93D 2A4JA 1RROA 4FQTA 1TUJA 1MWNA 1S1EA 3D10A 3I5HB 3LL8B 2K7OA 1LA3A 4OCIA 1ALWA 2ZNDA 1IQ5A 3I5FB 3SG3A 1CKKA 3GOFA 1OQPA 1K95A 2KAVA 1J1EA 2ZKMX 2COLB 1B8LA 1KFUL 4ORCB 3RZSA 2WCJA 1MF8B 1K2HA 5I8NA 3KHEA 3OB2B 3EVUA 2Y1NA 4JD9A 1NCYA 1G8IA 5GQQC 1IWQA 3CZ2A 1XFUO 2LLSA 4TNCA 3TZ1A 2HF5A 1OMVA 1WRKA 5F6TA 2AAOA 1DGVA 4C0KA 1U5IA 1IJ6A 1W7IB 1PVBA 1JF0A 3BYAA 4ETOA 3WNXB 2HPSA 4JPZB 3E3RA 1DC1A
chains in the Genus database with same CATH topology
1QX2A 2BBNA 1YR5A 1B4CA 4HREE 1SBJA 4ORBB 5CSJA 3TUYB 4I5JA 2EHBA 1Y6WA 1SPYA 2M8UA 1EXRA 3EVVA 1QX7A 1FBVA 3I5GB 2KFHA 3OX6A 4PDZA 2PASA 4YGEB 2WC8A 3PALA 1ALVA 3RLZA 5I2OA 1KK7Z 1H4BA 2KHNA 2PSRA 1NSHA 1SCMC 5CPVA 1QVIY 2I7AA 1BT6A 2ZN9A 1QV0A 4UPGA 2LANA 2LHLA 2MAZA 3A4UB 3EK7A 1L2OC 3AKAA 3SJSA 4C0JA 1B8RA 4GGFC 2M0RA 3TDZA 4YBHB 2H2KA 2L98A 4IL1A 1IH0A 1UHJA 1U5IB 2TN4A 4XYNA 1CMGA 5KTYA 1KFUS 1H8BA 2KI6C 4GUKA 2LAPA 2ZFDA 4MBEA 1F4OA 2KI4C 2LUCA 5K89A 1EG4A 2WCFA 1WLZA 2OPOA 5JOLA 1RWYA 3AAJA 3TS5C 3FIAA 3CLNA 1KQVA 3WHUB 1CTRA 3KPXA 1K8UA 1NCZA 1S36A 2G2BA 1AJ4A 4GPLB 3QRXA 1YVLA 2KAYA 3CS1A 2K2AA 3RM1A 1JC2A 4GBAA 2M7LA 1J1DA 2M97A 1C7WA 2K0JA 1TCOB 1XFXO 1SK6D 2CXJA 3F45A 1SCVA 2KGBC 1NYAA 3PN7C 2KQ6A 2LMTA 3PLFB 4YI8A 1N65A 3SIBA 5J3XA 4PALA 3K21A 3VRNA 2F3ZA 1KSOA 1YUSA 1PULA 4MRXA 4CFQA 1KFXL 4GGFA 2FCDA 1WRZA 3LK0A 1W7JB 1FI6A 1BF5A 1UUSA 1PK0D 3WXAA 4DUQA 1F8HA 1CLMA 1RECA 2KQYA 2L4HA 1OMRA 1ZOTB 4ICBA 1CM4A 1K94A 2JQ6A 4PE4A 1FW4A 4PHJA 1AP4A 2IS9A 1XYDA 3DF0A 5FYXA 3EVRA 1QLSA 4D1EA 1LA0A 1J7RA 1MR8A 2KI6D 2JTTA 1YRUB 4GAOA 2E6WA 1RJVA 4I5NB 2ZNEA 1KK8C 1QASA 4PHKA 2OTGC 4GFTA 1AUIB 1EJ3A 1YUUA 1XFYO 1NIWA 1CM1A 1AK8A 3TDUA 2R2IA 2GV5A 2GGZA 3JTDB 4N1FA 1PALA 2WCBA 1V1GA 2MLEC 1EL4A 1DGUA 2F8PA 1M39A 2L2EA 2NCPA 4MRYA 3CR5X 3BUNB 1DTLA 3EK8A 1GGWA 1Y1UA 2QPTA 1OOJA 2WOSA 1QATA 4YGCB 1YX8A 3MSEB 5G08A 2V53A 2LVJA 1KWOC 2JU0A 1R2UA 5PALA 3DVKA 1N0YA 1KFXS 2EGDA 3BUXB 2KYCA 4NDCA 1A4PA 4QJ3B 2JZIA 1TTXA 1CFFA 3VRPA 1J55A 1XO5A 4DRWA 4HRGA 3BOWA 1TNQA 3TDIA 2F2PA 1KK7Y 2L4IA 4CLNA 3KF9A 2O5GA 1QJTA 1UHIA 3FS7A 3OP0A 4PE0A 5AXIA 4NDBA 4CFRA 1OSAA 2MA2A 4MEWA 4PHMA 1A2XA 2NXQA 3CTNA 2PALA 1XA5A 3GK4X 2L50A 1SR6C 1YX7A 1DF0A 3PN7B 4MN0A 3O2PA 1SMGA 2M3WA 4YI9A 4MZLA 1NWDA 3IF7A 4AQJA 2MJWB 4YGAA 1DJYA 1EH2A 2JWWA 5D7FA 2P6BB 1CFDA 2RGIA 3H4SE 1BOCA 2LV7A 4M2OA 1SL9A 5ER5A 2F33A 4YRUA 3EKHA 4NDDA 3BOWB 2GGMA 4QJ4B 3AAKA 3NSOA 2FOTA 1NCXA 2BBMA 1A29A 2CCMA 2BL0C 2EC6B 3BUMB 1TIZA 2AUCA 3CR2A 2QACA 2K7BA 1IJ5A 1LKJA 1DVIA 1Y1XA 3JVTC 1MQ1A 2I18A 3AKBA 1DJIA 1MUXA 1MXEA 4JWQA 2JNFA 4YGBB 1ZFSA 3CWGA 2KSPA 1CNPA 1TRFA 4N1GA 2BKHB 1BU3A 1OZSA 2PVBA 3O4YA 3EKJA 1G4YR 2Y1MA 5JJGA 3PM8A 4ZCVA 3BUWB 3NSLA 1QS7A 1IGVA 1S5GZ 2BCBA 1AHRA 4BY4A 2Y5IA 1YVHA 2BCAA 4WRIA 1HQVA 1NP8A 2OS8C 2O60A 2NZ0A 5AEQA 2BE4A 3PSRA 1CFPA 2CNPA 1B47A 1ZMZA 1QIVA 3BQ3A 1J7QA 3D0YA 2ZRTA 1TN4A 4QJ5B 1JFJA 2KGRA 1L7ZA 2Q91A 3I5HC 5DKRA 1D1OA 3I5FC 1XK4C 1WDCC 1QVIZ 1WY9A 2JRFA 1WRLA 5CSNA 1KQMC 4M2PA 2JC2A 3VRQA 4AQIA 1J7PA 4E68A 1JSAA 2BECA 1CDMA 2KNEA 1SL8A 1NX0A 3CR4X 4PE7A 5AERA 1XFZO 1DJHA 2CTNA 2DOQA 1B7TZ 3LCPC 5KSZA 1N2DA 5AANA 2M49B 2B1UA 1DJZA 1PRWA 1EG3A 3I5IC 1SCMB 1K96A 2LE9B 1SL7A 1M45A 2KFFA 3OB1B 3TUYC 1SW8A 4MVFA 4NQGA 2LVIA 1L2OB 4L9MA 1TNWA 3JVTB 3PFVA 4XJKA 2NLNA 5CSFA 2PMYA 4ZCUA 3VRRA 3DD4A 2Y4QA 4F0ZB 3DF0B 1F54A 1MXLC 2JTZA 3VROA 4P5OE 2WCEA 4OV2A 1OZOA 1XK4A 2ZRSA 4P2YB 1BR1B 1UWOA 2KI4B 4FTGA 3ICBA 5BPJA 1ODBA 3NXAA 2M7NA 2M29A 2ZN8A 1JUOA 3TS5B 5B8IB 2K8MB 4WQ3A 1UP5A 2I2RE 3SG7A 2M1KB 5TNCA 2LVKA 4JQ0D 4A4BA 5CSIA 1SNLA 2LUXA 2D8NA 1IRJA 5HKYA 3SG6A 2BKIB 1M63B 3LLEA 1A03A 1F55A 3NSKA 1B9AA 4XJKB 1DT7B 5KU1A 2LCPA 2H61C 1NX2A 2BCXA 1VRKA 3HX4A 2LMUA 1SY9A 1S6IA 1S3PA 5HLVA 3SG4A 1UHNA 1QXPA 1A75A 1UHKA 2K7DA 1JFKA 1B8CA 3OHMB 3SIAA 1WDCB 5I2QA 1KQMB 1CFCA 2KDHA 2KYFA 4YGDB 1B1GA 4GGNA 1UHHA 2HETA 2M1UA 4N5XA 2F3YA 3VGOA 2SASA 5HKWA 4I5LB 1TNXA 1Y1AA 1S5GY 1ZUZA 4U8DA 1OMDA 4MZKA 3CGAA 2MLFC 2K61A 1KK8B 1DJWA 2KAXA 3PATA 2LHIA 2OTGB 1PSBA 4DIRA 1QX5B 5I2LA 4PE1A 3I5IB 4CPVA 2KBIA 3IQQA 5D69A 1DF0B 2HQWA 1LINA 1QTXA 1UURA 1XFVO 1RK9A 2M9GA 3CZTX 2PRUA 4I5KA 4PCWA 1GGZA 1A75B 2KFGA 1RFJA 4M2QA 1LVCD 2Q4UA 3FWCA 2H61A 1PVAA 1QLKA 1KSMA 3JTDC 4OKHA 2WNDA 1F71A 1PSRA 1KWOB 4DS7A 2JNXA 1Y0VH 1C7VA 2JOJA 2CBLA 3EK4A 1K9PA 1YTZC 3GK2A 2K2FA 1DMOA 1QV1A 1B7TY 1S26D 4BY5A 1F70A 2I94A 4FQOA 1CLLA 2JT3A 1BG1A 2MRDA 1TCFA 1M46A 1C07A 2F2OA 1K9KA 1NX1A 2FCEA 5HYDA 2LVVA 2MBXA 1SKTA 2KBMA 1BR4B 2JXLA 4USLA 4CIDA 2LLUA 2LM5A 1SR6B 5DKQA 1SRAA 1YUTA 4HRHA 1X02A 2LP2A 4OVNF 3ZNIA 2WORA 4ORAB 1MHOA 2L5XB 1FI5A 3DVMA 1AJ5A 1NPQA 1AVSA 1R6PA 1IKUA 4MLWA 4HSZA 1YURA 1K90D 1F4QA 3A8RA 3SG2A 2BE6A 1FPWA 1LXFC 1DJGA 1BJFA 2L51A 4C0LA 2VRGA 1FF1A 2JT0A 1V1FA 5HLOA 1TOPA 1RTP1 1BLQA 3M0WA 4MZJA 4MSPA 5HKZA 2LNKA 4WQ2A 2KOTA 1Q80A 3O78A 1JBAA 1WLMA 1HT9A 3D0YB 3I5GC 3SG5A 2BL0B 5IBWA 1M31A 3LK1A 1DJXA 2HQ8A 2JXCA 3BXKA 2LLTA 1OE9B 3OX5A 2MHHA 4PHNA 1E8AA 2LC5A 1IG5A 2EC6C 3ZWHA 4AOMA 2E30A 1GJYA 5AFPA 1ZACA 3WHTB 1CDNA 1BODA 1CDLA 3DVEA 2L0PA 1JWDA 4A4CA 2CT9A 3DVJA 2JPTA 1S6CA 5ER4X 2ISDA 1NX3A 1IQ3A 1JF2A 4DCKA 2NCOA 3KO0A 2G9BA 5DKNA 2JT8A 3GK1A 2LMVA 1K9UA 4R1EA 3NSIA 2K7CA 4GNKB 2JULA 1J7OA 3O6BA 1G33A 1NUBA 3HCMA 3FWBA 2SCPA 2LP3A 2FJUB 2OS8B 1TNPA 3KEVA 1CDPA 1CLBA 1KCYA 1QIWA 1S6JA 4OR9B 1CMFA 4Q04A 1XVJA 1YRTB 1XFWO 3BUOB 1SYMA 3C1VA 1GQMA 1BMOA 3IQOA 2AMIA 1K93D 2A4JA 1RROA 1CKKA 1CB1A 1MWNA 1S1EA 3D10A 3I5HB 3LL8B 2K7OA 1LA3A 4OCIA 1ALWA 2ZNDA 1IQ5A 3I5FB 3SG3A 3GOFA 1OQPA 1K95A 2KAVA 1J1EA 2ZKMX 2COLB 1B8LA 1KFUL 4ORCB 1MF8B 1K2HA 5I8NA 3KHEA 3OB2B 3EVUA 2Y1NA 1NCYA 1G8IA 5GQQC 1IWQA 1XFUO 2LLSA 4TNCA 3TZ1A 2HF5A 1OMVA 1WRKA 5F6TA 2AAOA 1DGVA 4C0KA 1U5IA 1IJ6A 1W7IB 1PVBA 1JF0A 3BYAA 4ETOA 3WNXB 2HPSA 4JPZB 3E3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QX2 A;  2BBN A;  1YR5 A;  1B4C A;  4HRE E;  1SBJ A;  4ORB B;  5CSJ A;  3TUY B;  4I5J A;  2EHB A;  1Y6W A;  1SPY A;  2M8U A;  1EXR A;  3EVV A;  1QX7 A;  1FBV A;  3I5G B;  2KFH A;  3OX6 A;  4PDZ A;  2PAS A;  4YGE B;  2WC8 A;  3PAL A;  1ALV A;  3RLZ A;  5I2O A;  1KK7 Z;  1H4B A;  2KHN A;  2PSR A;  1NSH A;  1SCM C;  5CPV A;  1QVI Y;  2I7A A;  1BT6 A;  2ZN9 A;  1QV0 A;  4UPG A;  2LAN A;  2LHL A;  2MAZ A;  3A4U B;  3EK7 A;  1L2O C;  3AKA A;  3SJS A;  4C0J A;  1B8R A;  4GGF C;  2M0R A;  3TDZ A;  4YBH B;  2H2K A;  2L98 A;  4IL1 A;  1IH0 A;  1UHJ A;  1U5I B;  2TN4 A;  4XYN A;  1CMG A;  5KTY A;  1KFU S;  1H8B A;  2KI6 C;  4GUK A;  2LAP A;  2ZFD A;  4MBE A;  1F4O A;  2KI4 C;  2LUC A;  5K89 A;  1EG4 A;  2WCF A;  1WLZ A;  2OPO A;  5JOL A;  1RWY A;  3AAJ A;  3TS5 C;  3FIA A;  3CLN A;  1KQV A;  3WHU B;  1CTR A;  3KPX A;  1K8U A;  1NCZ A;  1S36 A;  2G2B A;  1AJ4 A;  4GPL B;  3QRX A;  1YVL A;  2KAY A;  3CS1 A;  2K2A A;  3RM1 A;  1JC2 A;  4GBA A;  2M7L A;  1J1D A;  2M97 A;  1C7W A;  2K0J A;  1TCO B;  1XFX O;  1SK6 D;  2CXJ A;  3F45 A;  1SCV A;  2KGB C;  1NYA A;  3PN7 C;  2KQ6 A;  2LMT A;  3PLF B;  4YI8 A;  1N65 A;  3SIB A;  5J3X A;  4PAL A;  3K21 A;  3VRN A;  2F3Z A;  1KSO A;  1YUS A;  1PUL A;  4MRX A;  4CFQ A;  1KFX L;  4GGF A;  2FCD A;  1WRZ A;  3LK0 A;  1W7J B;  1FI6 A;  1BF5 A;  1UUS A;  1PK0 D;  3WXA A;  4DUQ A;  1F8H A;  1CLM A;  1REC A;  2KQY A;  2L4H A;  1OMR A;  1ZOT B;  4ICB A;  1CM4 A;  1K94 A;  2JQ6 A;  4PE4 A;  1FW4 A;  4PHJ A;  1AP4 A;  2IS9 A;  1XYD A;  3DF0 A;  5FYX A;  3EVR A;  1QLS A;  4D1E A;  1LA0 A;  1J7R A;  1MR8 A;  2KI6 D;  2JTT A;  1YRU B;  4GAO A;  2E6W A;  1RJV A;  4I5N B;  2ZNE A;  1KK8 C;  1QAS A;  4PHK A;  2OTG C;  4GFT A;  1AUI B;  1EJ3 A;  1YUU A;  1XFY O;  1NIW A;  1CM1 A;  1AK8 A;  3TDU A;  2R2I A;  2GV5 A;  2GGZ A;  3JTD B;  4N1F A;  1PAL A;  2WCB A;  1V1G A;  2MLE C;  1EL4 A;  1DGU A;  2F8P A;  1M39 A;  2L2E A;  2NCP A;  4MRY A;  3CR5 X;  3BUN B;  1DTL A;  3EK8 A;  1GGW A;  1Y1U A;  2QPT A;  1OOJ A;  2WOS A;  1QAT A;  4YGC B;  1YX8 A;  3MSE B;  5G08 A;  2V53 A;  2LVJ A;  1KWO C;  2JU0 A;  1R2U A;  5PAL A;  3DVK A;  1N0Y A;  1KFX S;  2EGD A;  3BUX B;  2KYC A;  4NDC A;  1A4P A;  4QJ3 B;  2JZI A;  1TTX A;  1CFF A;  3VRP A;  1J55 A;  1XO5 A;  4DRW A;  4HRG A;  3BOW A;  1TNQ A;  3TDI A;  2F2P A;  1KK7 Y;  2L4I A;  4CLN A;  3KF9 A;  2O5G A;  1QJT A;  1UHI A;  3FS7 A;  3OP0 A;  4PE0 A;  5AXI A;  4NDB A;  4CFR A;  1OSA A;  2MA2 A;  4MEW A;  4PHM A;  1A2X A;  2NXQ A;  3CTN A;  2PAL A;  1XA5 A;  3GK4 X;  2L50 A;  1SR6 C;  1YX7 A;  1DF0 A;  3PN7 B;  4MN0 A;  3O2P A;  1SMG A;  2M3W A;  4YI9 A;  4MZL A;  1NWD A;  3IF7 A;  4AQJ A;  2MJW B;  4YGA A;  1DJY A;  1EH2 A;  2JWW A;  5D7F A;  2P6B B;  1CFD A;  2RGI A;  3H4S E;  1BOC A;  2LV7 A;  4M2O A;  1SL9 A;  5ER5 A;  2F33 A;  4YRU A;  3EKH A;  4NDD A;  3BOW B;  2GGM A;  4QJ4 B;  3AAK A;  3NSO A;  2FOT A;  1NCX A;  2BBM A;  1A29 A;  2CCM A;  2BL0 C;  2EC6 B;  3BUM B;  1TIZ A;  2AUC A;  3CR2 A;  2QAC A;  2K7B A;  1IJ5 A;  1LKJ A;  1DVI A;  1Y1X A;  3JVT C;  1MQ1 A;  2I18 A;  3AKB A;  1DJI A;  1MUX A;  1MXE A;  4JWQ A;  2JNF A;  4YGB B;  1ZFS A;  3CWG A;  2KSP A;  1CNP A;  1TRF A;  4N1G A;  2BKH B;  1BU3 A;  1OZS A;  2PVB A;  3O4Y A;  3EKJ A;  1G4Y R;  2Y1M A;  5JJG A;  3PM8 A;  4ZCV A;  3BUW B;  3NSL A;  1QS7 A;  1IGV A;  1S5G Z;  2BCB A;  1AHR A;  4BY4 A;  2Y5I A;  1YVH A;  2BCA A;  4WRI A;  1HQV A;  1NP8 A;  2OS8 C;  2O60 A;  2NZ0 A;  5AEQ A;  2BE4 A;  3PSR A;  1CFP A;  2CNP A;  1B47 A;  1ZMZ A;  1QIV A;  3BQ3 A;  1J7Q A;  3D0Y A;  2ZRT A;  1TN4 A;  4QJ5 B;  1JFJ A;  2KGR A;  1L7Z A;  2Q91 A;  3I5H C;  5DKR A;  1D1O A;  3I5F C;  1XK4 C;  1WDC C;  1QVI Z;  1WY9 A;  2JRF A;  1WRL A;  5CSN A;  1KQM C;  4M2P A;  2JC2 A;  3VRQ A;  4AQI A;  1J7P A;  4E68 A;  1JSA A;  2BEC A;  1CDM A;  2KNE A;  1SL8 A;  1NX0 A;  3CR4 X;  4PE7 A;  5AER A;  1XFZ O;  1DJH A;  2CTN A;  2DOQ A;  1B7T Z;  3LCP C;  5KSZ A;  1N2D A;  5AAN A;  2M49 B;  2B1U A;  1DJZ A;  1PRW A;  1EG3 A;  3I5I C;  1SCM B;  1K96 A;  2LE9 B;  1SL7 A;  1M45 A;  2KFF A;  3OB1 B;  3TUY C;  1SW8 A;  4MVF A;  4NQG A;  2LVI A;  1L2O B;  4L9M A;  1TNW A;  3JVT B;  3PFV A;  4XJK A;  2NLN A;  5CSF A;  2PMY A;  4ZCU A;  3VRR A;  3DD4 A;  2Y4Q A;  4F0Z B;  3DF0 B;  1F54 A;  1MXL C;  2JTZ A;  3VRO A;  4P5O E;  2WCE A;  4OV2 A;  1OZO A;  1XK4 A;  2ZRS A;  4P2Y B;  1BR1 B;  1UWO A;  2KI4 B;  4FTG A;  3ICB A;  5BPJ A;  1ODB A;  3NXA A;  2M7N A;  2M29 A;  2ZN8 A;  1JUO A;  3TS5 B;  5B8I B;  2K8M B;  4WQ3 A;  1UP5 A;  2I2R E;  3SG7 A;  2M1K B;  5TNC A;  2LVK A;  4JQ0 D;  4A4B A;  5CSI A;  1SNL A;  2LUX A;  2D8N A;  1IRJ A;  5HKY A;  3SG6 A;  2BKI B;  1M63 B;  3LLE A;  1A03 A;  1F55 A;  3NSK A;  1B9A A;  4XJK B;  1DT7 B;  5KU1 A;  2LCP A;  2H61 C;  1NX2 A;  2BCX A;  1VRK A;  3HX4 A;  2LMU A;  1SY9 A;  1S6I A;  1S3P A;  5HLV A;  3SG4 A;  1UHN A;  1QXP A;  1A75 A;  1UHK A;  2K7D A;  1JFK A;  1B8C A;  3OHM B;  3SIA A;  1WDC B;  5I2Q A;  1KQM B;  1CFC A;  2KDH A;  2KYF A;  4YGD B;  1B1G A;  4GGN A;  1UHH A;  2HET A;  2M1U A;  4N5X A;  2F3Y A;  3VGO A;  2SAS A;  5HKW A;  4I5L B;  1TNX A;  1Y1A A;  1S5G Y;  1ZUZ A;  4U8D A;  1OMD A;  4MZK A;  3CGA A;  2MLF C;  2K61 A;  1KK8 B;  1DJW A;  2KAX A;  3PAT A;  2LHI A;  2OTG B;  1PSB A;  4DIR A;  1QX5 B;  5I2L A;  4PE1 A;  3I5I B;  4CPV A;  2KBI A;  3IQQ A;  5D69 A;  1DF0 B;  2HQW A;  1LIN A;  1QTX A;  1UUR A;  1XFV O;  1RK9 A;  2M9G A;  3CZT X;  2PRU A;  4I5K A;  4PCW A;  1GGZ A;  1A75 B;  2KFG A;  1RFJ A;  4M2Q A;  1LVC D;  2Q4U A;  3FWC A;  2H61 A;  1PVA A;  1QLK A;  1KSM A;  3JTD C;  4OKH A;  2WND A;  1F71 A;  1PSR A;  1KWO B;  4DS7 A;  2JNX A;  1Y0V H;  1C7V A;  2JOJ A;  2CBL A;  3EK4 A;  1K9P A;  1YTZ C;  3GK2 A;  2K2F A;  1DMO A;  1QV1 A;  1B7T Y;  1S26 D;  4BY5 A;  1F70 A;  2I94 A;  4FQO A;  1CLL A;  2JT3 A;  1BG1 A;  2MRD A;  1TCF A;  1M46 A;  1C07 A;  2F2O A;  1K9K A;  1NX1 A;  2FCE A;  5HYD A;  2LVV A;  2MBX A;  1SKT A;  2KBM A;  1BR4 B;  2JXL A;  4USL A;  4CID A;  2LLU A;  2LM5 A;  1SR6 B;  5DKQ A;  1SRA A;  1YUT A;  4HRH A;  1X02 A;  2LP2 A;  4OVN F;  3ZNI A;  2WOR A;  4ORA B;  1MHO A;  2L5X B;  1FI5 A;  3DVM A;  1AJ5 A;  1NPQ A;  1AVS A;  1R6P A;  1IKU A;  4MLW A;  4HSZ A;  1YUR A;  1K90 D;  1F4Q A;  3A8R A;  3SG2 A;  2BE6 A;  1FPW A;  1LXF C;  1DJG A;  1BJF A;  2L51 A;  4C0L A;  2VRG A;  1FF1 A;  2JT0 A;  1V1F A;  5HLO A;  1TOP A;  1RTP 1;  1BLQ A;  3M0W A;  4MZJ A;  4MSP A;  5HKZ A;  2LNK A;  4WQ2 A;  2KOT A;  1Q80 A;  3O78 A;  1JBA A;  1WLM A;  1HT9 A;  3D0Y B;  3I5G C;  3SG5 A;  2BL0 B;  5IBW A;  1M31 A;  3LK1 A;  1DJX A;  2HQ8 A;  2JXC A;  3BXK A;  2LLT A;  1OE9 B;  3OX5 A;  2MHH A;  4PHN A;  1E8A A;  2LC5 A;  1IG5 A;  2EC6 C;  3ZWH A;  4AOM A;  2E30 A;  1GJY A;  5AFP A;  1ZAC A;  3WHT B;  1CDN A;  1BOD A;  1CDL A;  3DVE A;  2L0P A;  1JWD A;  4A4C A;  2CT9 A;  3DVJ A;  2JPT A;  1S6C A;  5ER4 X;  2ISD A;  1NX3 A;  1IQ3 A;  1JF2 A;  4DCK A;  2NCO A;  3KO0 A;  2G9B A;  5DKN A;  2JT8 A;  3GK1 A;  2LMV A;  1K9U A;  4R1E A;  3NSI A;  2K7C A;  4GNK B;  2JUL A;  1J7O A;  3O6B A;  1G33 A;  1NUB A;  3HCM A;  3FWB A;  2SCP A;  2LP3 A;  2FJU B;  2OS8 B;  1TNP A;  3KEV A;  1CDP A;  1CLB A;  1KCY A;  1QIW A;  1S6J A;  4OR9 B;  1CMF A;  4Q04 A;  1XVJ A;  1YRT B;  1XFW O;  3BUO B;  1SYM A;  3C1V A;  1GQM A;  1BMO A;  3IQO A;  2AMI A;  1K93 D;  2A4J A;  1RRO A;  1CKK A;  1CB1 A;  1MWN A;  1S1E A;  3D10 A;  3I5H B;  3LL8 B;  2K7O A;  1LA3 A;  4OCI A;  1ALW A;  2ZND A;  1IQ5 A;  3I5F B;  3SG3 A;  3GOF A;  1OQP A;  1K95 A;  2KAV A;  1J1E A;  2ZKM X;  2COL B;  1B8L A;  1KFU L;  4ORC B;  1MF8 B;  1K2H A;  5I8N A;  3KHE A;  3OB2 B;  3EVU A;  2Y1N A;  1NCY A;  1G8I A;  5GQQ C;  1IWQ A;  1XFU O;  2LLS A;  4TNC A;  3TZ1 A;  2HF5 A;  1OMV A;  1WRK A;  5F6T A;  2AAO A;  1DGV A;  4C0K A;  1U5I A;  1IJ6 A;  1W7I B;  1PVB A;  1JF0 A;  3BYA A;  4ETO A;  3WNX B;  2HPS A;  4JPZ B;  3E3R A; 
#chains in the Genus database with same CATH topology
 1QX2 A;  2BBN A;  1YR5 A;  1B4C A;  4HRE E;  1SBJ A;  4ORB B;  5CSJ A;  3TUY B;  4I5J A;  2EHB A;  1Y6W A;  1SPY A;  2M8U A;  1EXR A;  3EVV A;  1QX7 A;  1FBV A;  3I5G B;  2KFH A;  3OX6 A;  4PDZ A;  2PAS A;  4YGE B;  2WC8 A;  2QDI A;  3S0E A;  3PAL A;  1ALV A;  3RLZ A;  5I2O A;  1KK7 Z;  1H4B A;  2KHN A;  2PSR A;  1NSH A;  1SCM C;  5CPV A;  1QVI Y;  2I7A A;  1BT6 A;  2ZN9 A;  1QV0 A;  4UPG A;  2LAN A;  2LHL A;  2MAZ A;  3A4U B;  3EK7 A;  2FJY A;  1L2O C;  3AKA A;  3SJS A;  4C0J A;  1B8R A;  4GGF C;  2M0R A;  3TDZ A;  4YBH B;  2H2K A;  2L98 A;  4IL1 A;  1IH0 A;  1UHJ A;  1U5I B;  2TN4 A;  4XYN A;  1CMG A;  3OBV A;  5KTY A;  1KFU S;  1H8B A;  2KI6 C;  4GUK A;  2LAP A;  2ZFD A;  4MBE A;  1F4O A;  2KI4 C;  2BNX A;  2LUC A;  5K89 A;  1EG4 A;  2WCF A;  1WLZ A;  2OPO A;  5JOL A;  1RWY A;  3AAJ A;  3TS5 C;  3FIA A;  3CLN A;  1KQV A;  3WHU B;  1CTR A;  3KPX A;  1K8U A;  1NCZ A;  1S36 A;  2G2B A;  1AJ4 A;  3D76 A;  4GPL B;  3QRX A;  1YVL A;  2KAY A;  3CS1 A;  2K2A A;  3RM1 A;  1JC2 A;  4GBA A;  2M7L A;  1J1D A;  2M97 A;  3OGN A;  1C7W A;  2K0J A;  1TCO B;  1XFX O;  1SK6 D;  2CXJ A;  3B7A A;  3F45 A;  1SCV A;  2ERB A;  1NYA A;  2KGB C;  2KQ6 A;  2LMT A;  3B6X A;  3PLF B;  1N65 A;  3PN7 C;  4YI8 A;  4PAL A;  3K21 A;  5J3X A;  3VRN A;  2F3Z A;  1KSO A;  1YUS A;  1PUL A;  4MRX A;  4CFQ A;  1KFX L;  4GGF A;  2FCD A;  5EL2 A;  1WRZ A;  3LK0 A;  1W7J B;  1FI6 A;  1BF5 A;  1UUS A;  1PK0 D;  3WXA A;  4DUQ A;  3BFH A;  1F8H A;  1CLM A;  1DEL A;  1REC A;  2KQY A;  2L4H A;  1ZOT B;  1OMR A;  1TUZ A;  3CDN A;  4ICB A;  1CM4 A;  1K94 A;  2JQ6 A;  2QEB A;  1FW4 A;  4PE4 A;  4PHJ A;  2IS9 A;  1XYD A;  3DF0 A;  5FYX A;  3DZT A;  3EVR A;  1QLS A;  3UNW A;  1LA0 A;  4D1E A;  1J7R A;  1MR8 A;  2KI6 D;  2JTT A;  1YRU B;  2P70 A;  4GAO A;  2E6W A;  1P28 A;  1RJV A;  4I5N B;  2ZNE A;  1KK8 C;  1QAS A;  3L4L A;  4PHK A;  2OTG C;  1T14 A;  4GFT A;  1AUI B;  1EJ3 A;  1YUU A;  1XFY O;  1NIW A;  1CM1 A;  2WC5 A;  1AK8 A;  3TDU A;  2R2I A;  2GV5 A;  2GGZ A;  1OOG A;  3JTD B;  4N1F A;  1PAL A;  3CZ0 A;  2WCB A;  1V1G A;  2MLE C;  1EL4 A;  1DGU A;  2F8P A;  1M39 A;  2L2E A;  2NCP A;  4MRY A;  3CR5 X;  3BUN B;  3VB1 A;  1DTL A;  3EK8 A;  1GGW A;  1Y1U A;  2QPT A;  1OOJ A;  2WOS A;  3FE9 A;  1QAT A;  3NHT A;  1YX8 A;  3MSE B;  4YGC B;  3B88 A;  2V53 A;  5G08 A;  2LVJ A;  1KWO C;  2JU0 A;  1R2U A;  2L5Y A;  5PAL A;  3DVK A;  1N0Y A;  1KFX S;  2EGD A;  3BUX B;  2KYC A;  4NDC A;  1A4P A;  4QJ3 B;  2JZI A;  1TTX A;  1CFF A;  3VRP A;  1J55 A;  1XO5 A;  4DRW A;  4HRG A;  3BOW A;  1TNQ A;  3TDI A;  2F2P A;  1KK7 Y;  2L4I A;  4CLN A;  3KF9 A;  2KPH A;  2O5G A;  1QJT A;  1UHI A;  3FS7 A;  4OZD A;  3OP0 A;  4PE0 A;  5AXI A;  4NDB A;  4CFR A;  1OSA A;  2MA2 A;  4MEW A;  4PHM A;  1A2X A;  3D73 A;  2NXQ A;  3CTN A;  1C3Y A;  2PAL A;  2WCK A;  1DEK A;  1XA5 A;  3GK4 X;  2L50 A;  1SR6 C;  1YX7 A;  1DF0 A;  3PN7 B;  4MN0 A;  3O2P A;  1SMG A;  2M3W A;  4INX A;  4MZL A;  4YI9 A;  1NWD A;  3IF7 A;  4AQJ A;  2MJW B;  4YGA A;  1DJY A;  4KYN A;  1EH2 A;  4PT1 A;  2JWW A;  5D7F A;  2P6B B;  1CFD A;  2RGI A;  3H4S E;  1BOC A;  2LV7 A;  4M2O A;  1SL9 A;  5ER5 A;  2F33 A;  4YRU A;  3DYE A;  2L2C A;  3BOW B;  3D77 A;  3EKH A;  4NDD A;  2GGM A;  3R1P A;  3S0G A;  4QJ4 B;  3AAK A;  3NSO A;  2FOT A;  1NCX A;  2BBM A;  1A29 A;  2JPO A;  2CCM A;  2BL0 C;  2EC6 B;  3BUM B;  1TIZ A;  2AUC A;  3CR2 A;  2QAC A;  2K7B A;  1IJ5 A;  1LKJ A;  3O4X A;  1DVI A;  1Y1X A;  3JVT C;  1MQ1 A;  2I18 A;  3AKB A;  1DJI A;  1MUX A;  1OOH A;  1MXE A;  3FE8 A;  4JWQ A;  2JNF A;  2KLE A;  4YGB B;  1ZFS A;  3CWG A;  2KSP A;  1CNP A;  3IVT A;  1TRF A;  1CB1 A;  4N1G A;  2BKH B;  1BU3 A;  1OZS A;  3D75 A;  2PVB A;  3O4Y A;  3EKJ A;  1G4Y R;  2Y1M A;  5JJG A;  3PM8 A;  4ZCV A;  1XFR A;  3BUW B;  3NSL A;  3CAB A;  1QS7 A;  1IGV A;  1S5G Z;  2BCB A;  1AHR A;  4BY4 A;  2Y5I A;  1OOI X;  1YVH A;  2BCA A;  4WRI A;  1HQV A;  1NP8 A;  2OS8 C;  2O60 A;  2NZ0 A;  3EG5 B;  3SS3 A;  5AEQ A;  2BE4 A;  3BFA A;  3R72 A;  3PSR A;  1CFP A;  1B47 A;  2CNP A;  1ZMZ A;  1QIV A;  3BQ3 A;  1J7Q A;  3D0Y A;  2ZRT A;  1SSE B;  1TN4 A;  1OOF A;  4QJ5 B;  1JFJ A;  3L47 A;  2KGR A;  1L7Z A;  2Q91 A;  3I5H C;  5DKR A;  2GTE A;  1D1O A;  1ORG A;  3I5F C;  1XK4 C;  1WDC C;  1QVI Z;  1WY9 A;  2JRF A;  1WRL A;  5CSN A;  1KQM C;  4M2P A;  2JC2 A;  3VRQ A;  3NHI A;  4AQI A;  3NGV A;  4E68 A;  1J7P A;  1JSA A;  2BEC A;  1CDM A;  3R1O A;  2KNE A;  1SL8 A;  1NX0 A;  3CR4 X;  4PE7 A;  5AER A;  3B86 A;  2P71 A;  1XFZ O;  1DJH A;  2CTN A;  2DOQ A;  1B7T Z;  3LCP C;  5KSZ A;  1N2D A;  5AAN A;  2BAP A;  1GM0 A;  2M49 B;  2B1U A;  1DJZ A;  1PRW A;  2YGU A;  1EG3 A;  3I5I C;  1SCM B;  1K96 A;  2LE9 B;  1SL7 A;  1M45 A;  2KFF A;  3OB1 B;  3TUY C;  2K60 A;  1SW8 A;  4MVF A;  4NQG A;  2LVI A;  1L2O B;  4F7F A;  5FI6 A;  4L9M A;  1TNW A;  3JVT B;  3DXL A;  3PFV A;  4XJK A;  2NLN A;  5CSF A;  3L4A A;  2PMY A;  4ZCU A;  3VRR A;  3DD4 A;  2Y4Q A;  4F0Z B;  3DF0 B;  1AP4 A;  1F54 A;  1MXL C;  2JTZ A;  3BFB A;  3VRO A;  4P5O E;  2WCE A;  4OV2 A;  1OZO A;  1XK4 A;  2ZRS A;  4P2Y B;  1BR1 B;  1UWO A;  2KI4 B;  4FTG A;  2WCH A;  3ICB A;  3R1V A;  5BPJ A;  1ODB A;  2H8V A;  2M7N A;  3NXA A;  2M29 A;  2ZN8 A;  1JUO A;  5FI2 A;  3TS5 B;  5B8I B;  2K8M B;  4WQ3 A;  1UP5 A;  2I2R E;  3SG7 A;  2M1K B;  5TNC A;  2LVK A;  4JQ0 D;  4A4B A;  5CSI A;  1SNL A;  2LUX A;  5FI7 A;  3Q8I A;  2D8N A;  1IRJ A;  5HKY A;  3SG6 A;  2BKI B;  1M63 B;  3LLE A;  1A03 A;  1F55 A;  3NSK A;  3UO9 A;  1B9A A;  4XJK B;  5HL1 A;  1DT7 B;  5KU1 A;  2LCP A;  2H61 C;  1LS8 A;  1NX2 A;  2WC6 A;  2BCX A;  1VRK A;  3HX4 A;  3V2L A;  2LMU A;  1SY9 A;  1S6I A;  1S3P A;  5HLV A;  3SG4 A;  1UHN A;  1QXP A;  5I94 A;  1A75 A;  1UHK A;  2K7D A;  1JFK A;  1B8C A;  3OHM B;  3SIA A;  1WDC B;  1TWO A;  5I2Q A;  3S0B A;  1KQM B;  1CFC A;  2KDH A;  2KYF A;  4YGD B;  1B1G A;  4GGN A;  1UHH A;  2HET A;  2M1U A;  4N5X A;  3BJH A;  2F3Y A;  3VGO A;  2SAS A;  5HKW A;  4I5L B;  1TNX A;  1Y1A A;  1S5G Y;  1ZUZ A;  4U8D A;  1OMD A;  4MZK A;  3CGA A;  2MLF C;  2K61 A;  1KK8 B;  1DJW A;  2KAX A;  3PAT A;  3S0D A;  2LHI A;  2OTG B;  3D78 A;  1PSB A;  3B87 A;  4DIR A;  3K1E A;  2WCM A;  1QX5 B;  5I2L A;  4PE1 A;  3I5I B;  4CPV A;  2KBI A;  3IQQ A;  5D69 A;  1DF0 B;  2HQW A;  1LIN A;  1QTX A;  1UUR A;  1XFV O;  1RK9 A;  2M9G A;  3CZT X;  2PRU A;  4I5K A;  4PCW A;  1GGZ A;  1A75 B;  2KFG A;  1RFJ A;  4M2Q A;  1LVC D;  2Q4U A;  3FWC A;  2H61 A;  1PVA A;  1QLK A;  1KSM A;  3JTD C;  4OKH A;  2WND A;  1F71 A;  1PSR A;  1KWO B;  4DS7 A;  2JNX A;  1Y0V H;  1C7V A;  1QWV A;  2JOJ A;  2CBL A;  3EK4 A;  1K9P A;  1YTZ C;  3DY9 A;  3GK2 A;  2K2F A;  1DMO A;  1QV1 A;  1B7T Y;  1S26 D;  4BY5 A;  1F70 A;  2I94 A;  4FQO A;  1CLL A;  2JT3 A;  1DQE A;  2MRD A;  1TCF A;  1BG1 A;  1M46 A;  1C07 A;  2F2O A;  1IIO A;  1K9K A;  1NX1 A;  2FCE A;  5HYD A;  2LVV A;  2MBX A;  1SKT A;  2KBM A;  1BR4 B;  4IJ7 A;  2JXL A;  4USL A;  4CID A;  2LLU A;  2LM5 A;  1SR6 B;  2QEO A;  5DKQ A;  1SRA A;  1YUT A;  4HRH A;  1X02 A;  2LP2 A;  4OVN F;  3ZNI A;  2WOR A;  4ORA B;  1MHO A;  2L5X B;  1FI5 A;  3DVM A;  1AJ5 A;  1NPQ A;  1AVS A;  1R6P A;  1IKU A;  4MLW A;  4HSZ A;  1YUR A;  3FE6 A;  1K90 D;  1F4Q A;  3A8R A;  3SG2 A;  2BE6 A;  1FPW A;  2QEV A;  1LXF C;  3S0F A;  1DJG A;  1BJF A;  1W9Z A;  2L51 A;  5DIC A;  2VRG A;  4C0L A;  1FF1 A;  2JT0 A;  1V1F A;  5HLO A;  1TOP A;  1RTP 1;  1BLQ A;  3M0W A;  4MZJ A;  4MSP A;  5HKZ A;  3S0A A;  2LNK A;  4WQ2 A;  2KOT A;  1Q80 A;  3O78 A;  2WCL A;  1JBA A;  3SS5 A;  1WLM A;  1HT9 A;  3D0Y B;  3I5G C;  3SG5 A;  2BL0 B;  3CZ1 A;  2PYQ A;  5IBW A;  1OW4 A;  1M31 A;  4INW A;  5D3O A;  3LK1 A;  1DJX A;  2HQ8 A;  2JXC A;  3BXK A;  1Z2C B;  1OE9 B;  2LLT A;  2KLD A;  3OX5 A;  2MHH A;  4PHN A;  1E8A A;  2LC5 A;  1IG5 A;  2EC6 C;  3ZWH A;  4AOM A;  2E30 A;  1GJY A;  3SS4 A;  1ZAC A;  3WHT B;  5AFP A;  1C3Z A;  1CDN A;  1BOD A;  1CDL A;  3DVE A;  2L0P A;  1JWD A;  4A4C A;  2CT9 A;  3DVJ A;  2JPT A;  1S6C A;  5ER4 X;  2ISD A;  2PQL A;  1NX3 A;  4JKT A;  1IQ3 A;  1JF2 A;  3PJI A;  2NCO A;  4DCK A;  3KO0 A;  2G9B A;  5DKN A;  3D74 A;  2JT8 A;  3GK1 A;  2LMV A;  1K9U A;  4R1E A;  3NSI A;  2K7C A;  4GNK B;  1Z4H A;  2JUL A;  3PM2 A;  1J7O A;  3O6B A;  1G33 A;  1NUB A;  3HCM A;  3FWB A;  3CYZ A;  2SCP A;  2LP3 A;  2FJU B;  2OS8 B;  1TNP A;  3KEV A;  1CDP A;  1CLB A;  1KCY A;  3SIB A;  1QIW A;  1S6J A;  4OR9 B;  1CMF A;  4Q04 A;  2QEH A;  1XVJ A;  1YRT B;  1XFW O;  3BUO B;  3N7H A;  1SYM A;  3C1V A;  1GQM A;  1BMO A;  3IQO A;  3QME A;  2AMI A;  1K93 D;  2A4J A;  1RRO A;  4FQT A;  1TUJ A;  1MWN A;  1S1E A;  3D10 A;  3I5H B;  3LL8 B;  2K7O A;  1LA3 A;  4OCI A;  1ALW A;  2ZND A;  1IQ5 A;  3I5F B;  3SG3 A;  1CKK A;  3GOF A;  1OQP A;  1K95 A;  2KAV A;  1J1E A;  2ZKM X;  2COL B;  1B8L A;  1KFU L;  4ORC B;  3RZS A;  2WCJ A;  1MF8 B;  1K2H A;  5I8N A;  3KHE A;  3OB2 B;  3EVU A;  2Y1N A;  4JD9 A;  1NCY A;  1G8I A;  5GQQ C;  1IWQ A;  3CZ2 A;  1XFU O;  2LLS A;  4TNC A;  3TZ1 A;  2HF5 A;  1OMV A;  1WRK A;  5F6T A;  2AAO A;  1DGV A;  4C0K A;  1U5I A;  1IJ6 A;  1W7I B;  1PVB A;  1JF0 A;  3BYA A;  4ETO A;  3WNX B;  2HPS A;  4JPZ B;  3E3R A;  1DC1 A; 
#chains in the Genus database with same CATH homology
 1QX2 A;  2BBN A;  1YR5 A;  1B4C A;  4HRE E;  1SBJ A;  4ORB B;  5CSJ A;  3TUY B;  4I5J A;  2EHB A;  1Y6W A;  1SPY A;  2M8U A;  1EXR A;  3EVV A;  1QX7 A;  1FBV A;  3I5G B;  2KFH A;  3OX6 A;  4PDZ A;  2PAS A;  4YGE B;  2WC8 A;  3PAL A;  1ALV A;  3RLZ A;  5I2O A;  1KK7 Z;  1H4B A;  2KHN A;  2PSR A;  1NSH A;  1SCM C;  5CPV A;  1QVI Y;  2I7A A;  1BT6 A;  2ZN9 A;  1QV0 A;  4UPG A;  2LAN A;  2LHL A;  2MAZ A;  3A4U B;  3EK7 A;  1L2O C;  3AKA A;  3SJS A;  4C0J A;  1B8R A;  4GGF C;  2M0R A;  3TDZ A;  4YBH B;  2H2K A;  2L98 A;  4IL1 A;  1IH0 A;  1UHJ A;  1U5I B;  2TN4 A;  4XYN A;  1CMG A;  5KTY A;  1KFU S;  1H8B A;  2KI6 C;  4GUK A;  2LAP A;  2ZFD A;  4MBE A;  1F4O A;  2KI4 C;  2LUC A;  5K89 A;  1EG4 A;  2WCF A;  1WLZ A;  2OPO A;  5JOL A;  1RWY A;  3AAJ A;  3TS5 C;  3FIA A;  3CLN A;  1KQV A;  3WHU B;  1CTR A;  3KPX A;  1K8U A;  1NCZ A;  1S36 A;  2G2B A;  1AJ4 A;  4GPL B;  3QRX A;  1YVL A;  2KAY A;  3CS1 A;  2K2A A;  3RM1 A;  1JC2 A;  4GBA A;  2M7L A;  1J1D A;  2M97 A;  1C7W A;  2K0J A;  1TCO B;  1XFX O;  1SK6 D;  2CXJ A;  3F45 A;  1SCV A;  2KGB C;  1NYA A;  3PN7 C;  2KQ6 A;  2LMT A;  3PLF B;  4YI8 A;  1N65 A;  3SIB A;  5J3X A;  4PAL A;  3K21 A;  3VRN A;  2F3Z A;  1KSO A;  1YUS A;  1PUL A;  4MRX A;  4CFQ A;  1KFX L;  4GGF A;  2FCD A;  1WRZ A;  3LK0 A;  1W7J B;  1FI6 A;  1BF5 A;  1UUS A;  1PK0 D;  3WXA A;  4DUQ A;  1F8H A;  1CLM A;  1REC A;  2KQY A;  2L4H A;  1OMR A;  1ZOT B;  4ICB A;  1CM4 A;  1K94 A;  2JQ6 A;  4PE4 A;  1FW4 A;  4PHJ A;  1AP4 A;  2IS9 A;  1XYD A;  3DF0 A;  5FYX A;  3EVR A;  1QLS A;  4D1E A;  1LA0 A;  1J7R A;  1MR8 A;  2KI6 D;  2JTT A;  1YRU B;  4GAO A;  2E6W A;  1RJV A;  4I5N B;  2ZNE A;  1KK8 C;  1QAS A;  4PHK A;  2OTG C;  4GFT A;  1AUI B;  1EJ3 A;  1YUU A;  1XFY O;  1NIW A;  1CM1 A;  1AK8 A;  3TDU A;  2R2I A;  2GV5 A;  2GGZ A;  3JTD B;  4N1F A;  1PAL A;  2WCB A;  1V1G A;  2MLE C;  1EL4 A;  1DGU A;  2F8P A;  1M39 A;  2L2E A;  2NCP A;  4MRY A;  3CR5 X;  3BUN B;  1DTL A;  3EK8 A;  1GGW A;  1Y1U A;  2QPT A;  1OOJ A;  2WOS A;  1QAT A;  4YGC B;  1YX8 A;  3MSE B;  5G08 A;  2V53 A;  2LVJ A;  1KWO C;  2JU0 A;  1R2U A;  5PAL A;  3DVK A;  1N0Y A;  1KFX S;  2EGD A;  3BUX B;  2KYC A;  4NDC A;  1A4P A;  4QJ3 B;  2JZI A;  1TTX A;  1CFF A;  3VRP A;  1J55 A;  1XO5 A;  4DRW A;  4HRG A;  3BOW A;  1TNQ A;  3TDI A;  2F2P A;  1KK7 Y;  2L4I A;  4CLN A;  3KF9 A;  2O5G A;  1QJT A;  1UHI A;  3FS7 A;  3OP0 A;  4PE0 A;  5AXI A;  4NDB A;  4CFR A;  1OSA A;  2MA2 A;  4MEW A;  4PHM A;  1A2X A;  2NXQ A;  3CTN A;  2PAL A;  1XA5 A;  3GK4 X;  2L50 A;  1SR6 C;  1YX7 A;  1DF0 A;  3PN7 B;  4MN0 A;  3O2P A;  1SMG A;  2M3W A;  4YI9 A;  4MZL A;  1NWD A;  3IF7 A;  4AQJ A;  2MJW B;  4YGA A;  1DJY A;  1EH2 A;  2JWW A;  5D7F A;  2P6B B;  1CFD A;  2RGI A;  3H4S E;  1BOC A;  2LV7 A;  4M2O A;  1SL9 A;  5ER5 A;  2F33 A;  4YRU A;  3EKH A;  4NDD A;  3BOW B;  2GGM A;  4QJ4 B;  3AAK A;  3NSO A;  2FOT A;  1NCX A;  2BBM A;  1A29 A;  2CCM A;  2BL0 C;  2EC6 B;  3BUM B;  1TIZ A;  2AUC A;  3CR2 A;  2QAC A;  2K7B A;  1IJ5 A;  1LKJ A;  1DVI A;  1Y1X A;  3JVT C;  1MQ1 A;  2I18 A;  3AKB A;  1DJI A;  1MUX A;  1MXE A;  4JWQ A;  2JNF A;  4YGB B;  1ZFS A;  3CWG A;  2KSP A;  1CNP A;  1TRF A;  4N1G A;  2BKH B;  1BU3 A;  1OZS A;  2PVB A;  3O4Y A;  3EKJ A;  1G4Y R;  2Y1M A;  5JJG A;  3PM8 A;  4ZCV A;  3BUW B;  3NSL A;  1QS7 A;  1IGV A;  1S5G Z;  2BCB A;  1AHR A;  4BY4 A;  2Y5I A;  1YVH A;  2BCA A;  4WRI A;  1HQV A;  1NP8 A;  2OS8 C;  2O60 A;  2NZ0 A;  5AEQ A;  2BE4 A;  3PSR A;  1CFP A;  2CNP A;  1B47 A;  1ZMZ A;  1QIV A;  3BQ3 A;  1J7Q A;  3D0Y A;  2ZRT A;  1TN4 A;  4QJ5 B;  1JFJ A;  2KGR A;  1L7Z A;  2Q91 A;  3I5H C;  5DKR A;  1D1O A;  3I5F C;  1XK4 C;  1WDC C;  1QVI Z;  1WY9 A;  2JRF A;  1WRL A;  5CSN A;  1KQM C;  4M2P A;  2JC2 A;  3VRQ A;  4AQI A;  1J7P A;  4E68 A;  1JSA A;  2BEC A;  1CDM A;  2KNE A;  1SL8 A;  1NX0 A;  3CR4 X;  4PE7 A;  5AER A;  1XFZ O;  1DJH A;  2CTN A;  2DOQ A;  1B7T Z;  3LCP C;  5KSZ A;  1N2D A;  5AAN A;  2M49 B;  2B1U A;  1DJZ A;  1PRW A;  1EG3 A;  3I5I C;  1SCM B;  1K96 A;  2LE9 B;  1SL7 A;  1M45 A;  2KFF A;  3OB1 B;  3TUY C;  1SW8 A;  4MVF A;  4NQG A;  2LVI A;  1L2O B;  4L9M A;  1TNW A;  3JVT B;  3PFV A;  4XJK A;  2NLN A;  5CSF A;  2PMY A;  4ZCU A;  3VRR A;  3DD4 A;  2Y4Q A;  4F0Z B;  3DF0 B;  1F54 A;  1MXL C;  2JTZ A;  3VRO A;  4P5O E;  2WCE A;  4OV2 A;  1OZO A;  1XK4 A;  2ZRS A;  4P2Y B;  1BR1 B;  1UWO A;  2KI4 B;  4FTG A;  3ICB A;  5BPJ A;  1ODB A;  3NXA A;  2M7N A;  2M29 A;  2ZN8 A;  1JUO A;  3TS5 B;  5B8I B;  2K8M B;  4WQ3 A;  1UP5 A;  2I2R E;  3SG7 A;  2M1K B;  5TNC A;  2LVK A;  4JQ0 D;  4A4B A;  5CSI A;  1SNL A;  2LUX A;  2D8N A;  1IRJ A;  5HKY A;  3SG6 A;  2BKI B;  1M63 B;  3LLE A;  1A03 A;  1F55 A;  3NSK A;  1B9A A;  4XJK B;  1DT7 B;  5KU1 A;  2LCP A;  2H61 C;  1NX2 A;  2BCX A;  1VRK A;  3HX4 A;  2LMU A;  1SY9 A;  1S6I A;  1S3P A;  5HLV A;  3SG4 A;  1UHN A;  1QXP A;  1A75 A;  1UHK A;  2K7D A;  1JFK A;  1B8C A;  3OHM B;  3SIA A;  1WDC B;  5I2Q A;  1KQM B;  1CFC A;  2KDH A;  2KYF A;  4YGD B;  1B1G A;  4GGN A;  1UHH A;  2HET A;  2M1U A;  4N5X A;  2F3Y A;  3VGO A;  2SAS A;  5HKW A;  4I5L B;  1TNX A;  1Y1A A;  1S5G Y;  1ZUZ A;  4U8D A;  1OMD A;  4MZK A;  3CGA A;  2MLF C;  2K61 A;  1KK8 B;  1DJW A;  2KAX A;  3PAT A;  2LHI A;  2OTG B;  1PSB A;  4DIR A;  1QX5 B;  5I2L A;  4PE1 A;  3I5I B;  4CPV A;  2KBI A;  3IQQ A;  5D69 A;  1DF0 B;  2HQW A;  1LIN A;  1QTX A;  1UUR A;  1XFV O;  1RK9 A;  2M9G A;  3CZT X;  2PRU A;  4I5K A;  4PCW A;  1GGZ A;  1A75 B;  2KFG A;  1RFJ A;  4M2Q A;  1LVC D;  2Q4U A;  3FWC A;  2H61 A;  1PVA A;  1QLK A;  1KSM A;  3JTD C;  4OKH A;  2WND A;  1F71 A;  1PSR A;  1KWO B;  4DS7 A;  2JNX A;  1Y0V H;  1C7V A;  2JOJ A;  2CBL A;  3EK4 A;  1K9P A;  1YTZ C;  3GK2 A;  2K2F A;  1DMO A;  1QV1 A;  1B7T Y;  1S26 D;  4BY5 A;  1F70 A;  2I94 A;  4FQO A;  1CLL A;  2JT3 A;  1BG1 A;  2MRD A;  1TCF A;  1M46 A;  1C07 A;  2F2O A;  1K9K A;  1NX1 A;  2FCE A;  5HYD A;  2LVV A;  2MBX A;  1SKT A;  2KBM A;  1BR4 B;  2JXL A;  4USL A;  4CID A;  2LLU A;  2LM5 A;  1SR6 B;  5DKQ A;  1SRA A;  1YUT A;  4HRH A;  1X02 A;  2LP2 A;  4OVN F;  3ZNI A;  2WOR A;  4ORA B;  1MHO A;  2L5X B;  1FI5 A;  3DVM A;  1AJ5 A;  1NPQ A;  1AVS A;  1R6P A;  1IKU A;  4MLW A;  4HSZ A;  1YUR A;  1K90 D;  1F4Q A;  3A8R A;  3SG2 A;  2BE6 A;  1FPW A;  1LXF C;  1DJG A;  1BJF A;  2L51 A;  4C0L A;  2VRG A;  1FF1 A;  2JT0 A;  1V1F A;  5HLO A;  1TOP A;  1RTP 1;  1BLQ A;  3M0W A;  4MZJ A;  4MSP A;  5HKZ A;  2LNK A;  4WQ2 A;  2KOT A;  1Q80 A;  3O78 A;  1JBA A;  1WLM A;  1HT9 A;  3D0Y B;  3I5G C;  3SG5 A;  2BL0 B;  5IBW A;  1M31 A;  3LK1 A;  1DJX A;  2HQ8 A;  2JXC A;  3BXK A;  2LLT A;  1OE9 B;  3OX5 A;  2MHH A;  4PHN A;  1E8A A;  2LC5 A;  1IG5 A;  2EC6 C;  3ZWH A;  4AOM A;  2E30 A;  1GJY A;  5AFP A;  1ZAC A;  3WHT B;  1CDN A;  1BOD A;  1CDL A;  3DVE A;  2L0P A;  1JWD A;  4A4C A;  2CT9 A;  3DVJ A;  2JPT A;  1S6C A;  5ER4 X;  2ISD A;  1NX3 A;  1IQ3 A;  1JF2 A;  4DCK A;  2NCO A;  3KO0 A;  2G9B A;  5DKN A;  2JT8 A;  3GK1 A;  2LMV A;  1K9U A;  4R1E A;  3NSI A;  2K7C A;  4GNK B;  2JUL A;  1J7O A;  3O6B A;  1G33 A;  1NUB A;  3HCM A;  3FWB A;  2SCP A;  2LP3 A;  2FJU B;  2OS8 B;  1TNP A;  3KEV A;  1CDP A;  1CLB A;  1KCY A;  1QIW A;  1S6J A;  4OR9 B;  1CMF A;  4Q04 A;  1XVJ A;  1YRT B;  1XFW O;  3BUO B;  1SYM A;  3C1V A;  1GQM A;  1BMO A;  3IQO A;  2AMI A;  1K93 D;  2A4J A;  1RRO A;  1CKK A;  1CB1 A;  1MWN A;  1S1E A;  3D10 A;  3I5H B;  3LL8 B;  2K7O A;  1LA3 A;  4OCI A;  1ALW A;  2ZND A;  1IQ5 A;  3I5F B;  3SG3 A;  3GOF A;  1OQP A;  1K95 A;  2KAV A;  1J1E A;  2ZKM X;  2COL B;  1B8L A;  1KFU L;  4ORC B;  1MF8 B;  1K2H A;  5I8N A;  3KHE A;  3OB2 B;  3EVU A;  2Y1N A;  1NCY A;  1G8I A;  5GQQ C;  1IWQ A;  1XFU O;  2LLS A;  4TNC A;  3TZ1 A;  2HF5 A;  1OMV A;  1WRK A;  5F6T A;  2AAO A;  1DGV A;  4C0K A;  1U5I A;  1IJ6 A;  1W7I B;  1PVB A;  1JF0 A;  3BYA A;  4ETO A;  3WNX B;  2HPS A;  4JPZ B;  3E3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...