2K7OA

Ca2+-s100b, refined with rdcs
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
91
structure length
91
Chain Sequence
SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVSMVTTACHEFFEHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Protein S100-B
publication title Refinement of the solution structure and dynamic properties of Ca(2+)-bound rat S100B.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 24
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2k7oA00
2LP3A 4JPZB 1KSMA 2NXQA 4NDDA 1ZFSA 1J7OA 3AAKA 3BUOB 1HT9A 2CXJA 2L4IA 1Q80A 1RK9A 4Q04A 4TNCA 3SG6A 1H4BA 1N65A 4F0ZB 1CFCA 2COLB 3OP0A 4GGFA 2LNKA 1QVIY 3FWCA 3WHTB 4ETOA 2KDHA 2KAYA 3GK2A 1OOJA 4WRIA 2R2IA 1CFPA 3I5GC 5FYXA 2ISDA 1OZOA 4HRHA 1DGVA 2QPTA 2BE6A 1CFDA 4DS7A 2BCBA 3VRRA 1X02A 2PRUA 5CSJA 2L51A 1CNPA 1WDCB 4PE4A 2WCBA 2JT8A 1E8AA 5KTYA 2KSPA 1MUXA 2JOJA 1QIWA 3LK0A 2OPOA 1MWNA 1OMVA 2V53A 2BCXA 3SG7A 3EVUA 2FCEA 3I5FB 2O5GA 4P5OE 5GQQC 1SK6D 2ZN8A 1FF1A 4OV2A 1BR1B 1KFXS 1RTP1 2MBXA 1Y0VH 1SR6C 1NSHA 1PRWA 3PSRA 5JJGA 1TN4A 2DOQA 1CDPA 1IRJA 2M1UA 3E3RA 1BR4B 4FTGA 2KQ6A 2JULA 3OB2B 1AJ4A 4ORAB 1MQ1A 1DF0B 1F8HA 2QACA 2LMTA 3QRXA 1OE9B 1WY9A 1OMRA 2JRFA 2L2EA 4YGAA 1XK4A 1NX2A 1UP5A 1UHHA 2A4JA 1YX7A 1EL4A 2K7DA 3EKJA 2PSRA 4PCWA 1SNLA 3HX4A 3HCMA 1LXFC 2PVBA 4GFTA 1ALVA 4GBAA 5F6TA 3O4YA 3SJSA 4CFQA 1RJVA 2MRDA 2KI6D 2LHLA 2PASA 1IGVA 2JZIA 3LLEA 4XYNA 4YGDB 1S5GZ 1FPWA 4P2YB 2LP2A 2HETA 3TZ1A 1B7TZ 2K2FA 2MLEC 2JNFA 1JUOA 4OCIA 3H4SE 1DVIA 2MAZA 1JBAA 2SASA 1K9PA 4YGBB 1IG5A 2K61A 1C7VA 1KK8C 1S36A 5DKNA 3PALA 2BKHB 2I2RE 1Y1AA 1JWDA 1M45A 3AKBA 1ZUZA 1RROA 1LKJA 3O2PA 4GPLB 1CLMA 1F55A 1TRFA 1SCMC 1K90D 1L2OB 1QJTA 1UWOA 1KK7Z 2IS9A 1NUBA 1B47A 3GOFA 3AKAA 4ICBA 1JC2A 2AMIA 5DKRA 2MHHA 2NZ0A 3DVMA 3D10A 1K96A 1BODA 1GJYA 2M0RA 5AFPA 4UPGA 5ER4X 2EGDA 1TOPA 2PMYA 1B8CA 1UHIA 4A4CA 1SKTA 3LL8B 4PHJA 4AOMA 5KSZA 4I5LB 2LMVA 3A4UB 1UHNA 1CKKA 1F71A 3BUXB 4A4BA 5HLVA 2KFGA 1XFZO 1MHOA 1JFKA 3TUYC 2LC5A 1K2HA 1UHJA 2LVVA 2FOTA 1TCOB 2GGZA 5HKWA 3ICBA 2OTGC 1B9AA 1QTXA 2BECA 4IL1A 1F54A 1QV1A 1XK4C 2CCMA 5CSFA 2Q4UA 4N1FA 3TDZA 3FWBA 4MRXA 1PULA 4I5KA 4NQGA 2LCPA 1KFUL 1NX3A 1NYAA 3JTDB 1BF5A 1Y6WA 2K7BA 1KQVA 2O60A 1DJXA 1EH2A 1J7PA 1NCZA 1M63B 1TIZA 2K7CA 2KOTA 5KU1A 4BY4A 1DT7B 1NWDA 2G2BA 1C7WA 3BQ3A 2CT9A 3FIAA 2NCPA 1R2UA 1JSAA 3PN7B 1F4OA 1IQ5A 2LE9B 2MJWB 2K7OA 4OKHA 1NPQA 1SPYA 4PE1A 4DIRA 2I18A 1SRAA 2KFHA 1CM4A 1KQMB 1WRLA 3EK4A 4PHKA 1XFUO 2MLFC 1CLLA 1B1GA 3OB1B 1EG4A 1G4YR 1NCYA 2AAOA 4GUKA 2OS8B 1J1EA 4M2QA 1CLBA 4YRUA 1SMGA 1AP4A 3NSOA 3M0WA 1ZOTB 4AQJA 4I5NB 1DF0A 3O78A 1OZSA 3DVKA 1J55A 3D0YB 2KAVA 3TDUA 3SG4A 3IF7A 3JVTB 5AANA 1BU3A 2Y1NA 3KHEA 2ZFDA 2CNPA 1RWYA 2M7LA 1A03A 1JFJA 2M1KB 2WCFA 1WLMA 1DTLA 4NDBA 3BUNB 2LLUA 4YBHB 2E30A 3LCPC 4USLA 2E6WA 2Y4QA 3I5HB 2JC2A 2WNDA 1L7ZA 2CBLA 1F70A 3I5IB 2EC6B 2JU0A 3WNXB 2LMUA 2WORA 4GGNA 2L4HA 2LUXA 2F33A 4PE7A 1KFUS 4AQIA 1S1EA 3EK7A 1V1GA 2NCOA 3JTDC 3KEVA 2JPTA 3BOWB 4N5XA 2JXCA 1GGWA 3C1VA 2F2PA 2K2AA 1YX8A 2KYCA 5ER5A 4MZKA 2B1UA 1SCVA 1WLZA 4I5JA 5DKQA 1W7JB 3IQOA 1PVAA 1CDMA 5HKYA 3BYAA 4PHNA 5BPJA 1ODBA 4MBEA 5I2LA 1QX2A 2ZN9A 1XFYO 2LHIA 1EJ3A 2K8MB 1WDCC 1PVBA 3RLZA 1QX7A 1FBVA 2H61A 3DF0A 4GGFC 4YI8A 1M31A 2OS8C 1DJWA 3CWGA 5AERA 1AK8A 1GQMA 3I5FC 4QJ4B 1KWOB 2BL0B 2LVJA 3PFVA 1PSRA 1SL9A 1J7RA 2F2OA 1A2XA 1DGUA 2HF5A 3TS5B 3VRPA 1EG3A 1K93D 2LV7A 5K89A 1LA3A 2KI4B 2D8NA 4GNKB 1ALWA 2KGBC 3CS1A 2Q91A 3EKHA 2ZNDA 4MLWA 1DJHA 3I5HC 3DF0B 1NCXA 2AUCA 2VRGA 4QJ3B 3VRNA 2ZRSA 4XJKA 4C0KA 1KSOA 3SG2A 2Y1MA 1QX5B 4CLNA 2L5XB 3PATA 3VGOA 1BJFA 1K8UA 3AAJA 3CGAA 1NX0A 3KO0A 4N1GA 2KI6C 3KPXA 1FI5A 1XFXO 1ZACA 1S5GY 1CM1A 2M29A 1PSBA 2KFFA 1U5IA 1B7TY 2JXLA 2JTTA 3I5GB 4MRYA 2GGMA 4ORBB 1SL7A 3IQQA 1IQ3A 5CSIA 4XJKB 4MN0A 2F3ZA 1S26D 4DRWA 1CMGA 1YVHA 2KGRA 1QVIZ 1BG1A 2HPSA 3SIBA 1SY9A 4JQ0D 1AVSA 1CTRA 3SG3A 1SBJA 3CR5X 2GV5A 4PHMA 2G9BA 4CFRA 1U5IB 1KK7Y 1IJ6A 2FCDA 1FW4A 1NIWA 3ZNIA 1CFFA 3K21A 1K9KA 1NX1A 2H2KA 2KNEA 5D69A 1SR6B 4M2OA 1B8RA 4YGCB 1UURA 1M39A 1B4CA 1LINA 4ZCUA 2I94A 2PALA 2LVIA 5CSNA 2RGIA 1L2OC 1XFVO 1A75A 2BKIB 3D0YA 3EK8A 3SIAA 5AXIA 2F8PA 4YI9A 1XA5A 1B8LA 2H61C 2BBNA 1YUSA 2K0JA 2LLSA 3BUWB 3OX6A 4DCKA 4PE0A 1WRKA 3CR4X 3EVVA 1C07A 1K9UA 1QXPA 2M9GA 4OVNF 2I7AA 1F4QA 1QLKA 1TNWA 1XVJA 3BUMB 4JWQA 1IH0A 2M49B 3DVJA 4HRGA 1PK0D 2L98A 1K95A 1N2DA 1QIVA 2ZRTA 4C0LA 4GAOA 4ZCVA 1J1DA 3DD4A 1A75B 1IJ5A 1M46A 1S3PA 3NXAA 2TN4A 1A4PA 3BOWA 1DJIA 2WOSA 1UHKA 3BXKA 3FS7A 4PALA 2KHNA 1CDNA 1MXLC 1WRZA 1XYDA 4HSZA 4YGEB 2JQ6A 1QS7A 3WXAA 4CIDA 3F45A 1QV0A 2FJUB 1QLSA 3RM1A 4M2PA 1KK8B 2LUCA 1XFWO 1KCYA 1UUSA 2LLTA 1AUIB 3CZTX 1D1OA 1TTXA 4HREE 1YRTB 3VRQA 5AEQA 1OMDA 2Y5IA 1OSAA 2JT3A 1CDLA 1GGZA 3NSKA 4OR9B 4BY5A 1TNQA 1Y1UA 2KAXA 5B8IB 5I2QA 1SCMB 1K94A 2JWWA 1S6JA 3PN7C 5TNCA 4DUQA 1YURA 1IWQA 5I2OA 1AJ5A 1YRUB 4MVFA 2M3WA 1DJZA 4L9MA 1KQMC 2HQ8A 2BCAA 2KYFA 5HKZA 3CR2A 2M8UA 3OX5A 4MZLA 3O6BA 1G8IA 2F3YA 4NDCA 1LVCD 3NSLA 1MR8A 1TCFA 1EXRA 1MF8B 4C0JA 2NLNA 3DVEA 2CTNA 1NP8A 1HQVA 2JTZA 3VROA 4R1EA 1JF2A 1VRKA 1YUUA 2JNXA 3NSIA 1R6PA 3A8RA 1SL8A 1CMFA 1SW8A 1SYMA 3TUYB 1MXEA 1IKUA 1A29A 4D1EA 2HQWA 5PALA 1H8BA 2BE4A 2WCEA 1BLQA 2EHBA 3JVTC 1J7QA 3PLFB 2M7NA 3PM8A 4FQOA 2OTGB 3OHMB 4PDZA 3ZWHA 1DJYA 2L50A 1YVLA 3LK1A 4WQ3A 1YTZC 2ZKMX 1QASA 1YR5A 1FI6A 3GK1A 4U8DA 3I5IC 2LVKA 2EC6C 3WHUB 1TNPA 3GK4X 4E68A 5I8NA 3MSEB 1OQPA 1JF0A 1N0YA 1YUTA 1BT6A 5HLOA 2KBMA 2ZNEA 2BBMA 5CPVA 2LAPA 3KF9A 5JOLA 1LA0A 4QJ5B 3SG5A 1W7IB 1CB1A 1BOCA 1TNXA 3EVRA 1AHRA 2SCPA 1BMOA 3CTNA 2KQYA 1V1FA 5J3XA 1S6IA 1QATA 1PALA 5IBWA 3CLNA 2L0PA 4MSPA 2JT0A 2WC8A 4CPVA 1S6CA 1DJGA 2KBIA 2LANA 1G33A 2M97A 1KFXL 4MZJA 4WQ2A 2P6BB 1KWOC 2BL0C 2LM5A 1Y1XA 2MA2A 5D7FA 1RECA 3TS5C 4MEWA 1ZMZA 1DMOA 4ORCB 5HYDA 1RFJA 2KI4C 1XO5A 3TDIA 5G08A
chains in the Genus database with same CATH superfamily
2LP3A 4JPZB 3V2LA 1OOIX 1KSMA 2NXQA 4NDDA 1ZFSA 1J7OA 3AAKA 1OOGA 3BUOB 1HT9A 2CXJA 2L4IA 1Q80A 1RK9A 4Q04A 4TNCA 3SG6A 1H4BA 1N65A 4F0ZB 1CFCA 2COLB 3OP0A 4GGFA 2LNKA 1QVIY 1DEKA 3FWCA 3WHTB 4ETOA 2KDHA 2KAYA 2QEOA 2WCKA 3GK2A 1OOJA 4WRIA 2R2IA 1CFPA 3I5GC 5FYXA 2ISDA 1OZOA 4HRHA 1DGVA 3D74A 2QPTA 2BE6A 1CFDA 4DS7A 2BCBA 3VRRA 1X02A 2PRUA 3B86A 3D76A 5CSJA 2L51A 1CNPA 1WDCB 3BFHA 4PE4A 2WCBA 2JT8A 1E8AA 5KTYA 2KSPA 1MUXA 2JOJA 1QIWA 3LK0A 2OPOA 1MWNA 1OMVA 2V53A 2BCXA 3SG7A 3EVUA 2FCEA 4OZDA 3I5FB 2O5GA 4P5OE 5GQQC 1SK6D 2ZN8A 1FF1A 4OV2A 1BR1B 1KFXS 1RTP1 2MBXA 1Y0VH 1SR6C 1OOFA 1NSHA 1PRWA 3PSRA 3S0BA 1TN4A 2DOQA 5JJGA 1CDPA 2P71A 1IRJA 2M1UA 3CABA 3E3RA 1BR4B 4FTGA 2ERBA 2KQ6A 2JULA 3OB2B 1AJ4A 4ORAB 1MQ1A 1DF0B 1F8HA 2QACA 3RZSA 2LMTA 3QRXA 1OE9B 1WY9A 1OMRA 2JRFA 1Z2CB 2L2EA 4YGAA 1XK4A 1NX2A 1UP5A 1UHHA 3OGNA 2A4JA 1YX7A 2H8VA 3D77A 1EL4A 2K7DA 3BJHA 2PSRA 3EKJA 1SNLA 4PCWA 3HX4A 3HCMA 1LXFC 2PVBA 4GFTA 1ALVA 4GBAA 5F6TA 3O4YA 3SJSA 4CFQA 1RJVA 2MRDA 2KI6D 2LHLA 2PASA 1IGVA 2JZIA 3CZ2A 3L4LA 3LLEA 4XYNA 1S5GZ 4YGDB 1FPWA 4P2YB 2LP2A 2HETA 3TZ1A 1B7TZ 2K2FA 5I94A 2MLEC 2JNFA 1JUOA 4OCIA 3H4SE 1DVIA 2MAZA 1JBAA 2SASA 1K9PA 4IJ7A 1IG5A 4YGBB 2K61A 2FJYA 1C7VA 1KK8C 1S36A 5DKNA 3PALA 2BKHB 2I2RE 1Y1AA 1JWDA 1M45A 3AKBA 3Q8IA 1ZUZA 1RROA 1LKJA 3S0DA 3O2PA 4GPLB 1CLMA 1F55A 1TRFA 1SCMC 1K90D 1L2OB 1QJTA 1UWOA 1KK7Z 2IS9A 1NUBA 1B47A 3GOFA 3AKAA 4ICBA 1JC2A 2AMIA 5D3OA 5DKRA 2MHHA 2NZ0A 3DVMA 3D10A 1K96A 1BODA 1GJYA 2M0RA 5AFPA 4UPGA 5ER4X 2EGDA 1TOPA 2PMYA 1B8CA 1UHIA 4A4CA 1SKTA 3LL8B 4PHJA 4AOMA 5KSZA 4I5LB 2LMVA 3A4UB 1UHNA 3SS4A 1CKKA 1F71A 3BUXB 4A4BA 5HLVA 2KFGA 1XFZO 1MHOA 1JFKA 3CDNA 4FQTA 3BFAA 3TUYC 2LC5A 1K2HA 1UHJA 2LVVA 2FOTA 1TCOB 2GGZA 5HKWA 3ICBA 1QWVA 2OTGC 1B9AA 1QTXA 2BECA 4IL1A 1F54A 1QV1A 1XK4C 5FI7A 2CCMA 5CSFA 2Q4UA 4N1FA 3TDZA 3FWBA 3K1EA 4MRXA 1PULA 4I5KA 4NQGA 2LCPA 1KFUL 1NX3A 1NYAA 3JTDB 1BF5A 1Y6WA 2K7BA 1KQVA 2O60A 1DJXA 1EH2A 1J7PA 1NCZA 1M63B 1TIZA 2K7CA 2KOTA 5KU1A 4BY4A 1DT7B 1NWDA 1GM0A 2G2BA 1C7WA 3BQ3A 2CT9A 3FIAA 2NCPA 1OW4A 1R2UA 3PN7B 1JSAA 1F4OA 1IQ5A 2LE9B 2MJWB 2K7OA 3R72A 4OKHA 1NPQA 1SPYA 3BFBA 4PE1A 2I18A 1SRAA 2KFHA 4DIRA 1CM4A 3UO9A 2QDIA 1KQMB 1WRLA 2L2CA 3EK4A 4PHKA 1XFUO 2MLFC 1CLLA 1B1GA 3OB1B 1EG4A 1G4YR 1NCYA 2AAOA 4GUKA 1XFRA 2OS8B 1J1EA 4M2QA 4JKTA 4YRUA 1SMGA 1AP4A 1CLBA 3L47A 3NSOA 3M0WA 1ZOTB 4AQJA 4I5NB 1DF0A 3O78A 1OZSA 3DVKA 1J55A 2WCJA 3D0YB 3FE8A 1T14A 2KAVA 3TDUA 3R1VA 3SG4A 3IF7A 3JVTB 5AANA 1BU3A 2Y1NA 3KHEA 2ZFDA 2CNPA 1RWYA 2M7LA 1A03A 1JFJA 2M1KB 2WCFA 1WLMA 1DTLA 4NDBA 3BUNB 2LLUA 4YBHB 2E30A 3LCPC 4USLA 2E6WA 2Y4QA 3I5HB 2JC2A 1IIOA 2WNDA 1L7ZA 2CBLA 1F70A 3I5IB 2EC6B 2JU0A 3WNXB 3SS5A 2LMUA 2WORA 4GGNA 5I2QA 2L4HA 2LUXA 2F33A 4PE7A 1Z4HA 1KFUS 5EL2A 5FI2A 4AQIA 1S1EA 3EK7A 1V1GA 2NCOA 3JTDC 3KEVA 1C3ZA 2JPTA 3BOWB 4N5XA 2JXCA 1GGWA 3C1VA 2F2PA 2K2AA 1YX8A 2KYCA 5ER5A 1W9ZA 4MZKA 2B1UA 1SCVA 1WLZA 4I5JA 5DKQA 1W7JB 3IQOA 1PVAA 1SSEB 1CDMA 2KLDA 5HKYA 4C0KA 3B88A 3BYAA 4PHNA 5BPJA 1ODBA 4MBEA 5I2LA 1QX2A 2ZN9A 1XFYO 2LHIA 2WC6A 1EJ3A 2K8MB 3VB1A 1WDCC 1PVBA 3RLZA 1QX7A 1FBVA 2H61A 3DF0A 4GGFC 4YI8A 1M31A 2OS8C 1DJWA 3CWGA 5AERA 1AK8A 1GQMA 3I5FC 1DQEA 4QJ4B 1KWOB 2BL0B 2LVJA 3PFVA 1PSRA 1SL9A 2GTEA 1J7RA 2F2OA 1A2XA 1DGUA 2HF5A 3TS5B 3VRPA 1EG3A 1K93D 2LV7A 5K89A 1LA3A 2KI4B 2D8NA 4GNKB 1ALWA 2KGBC 3CS1A 2Q91A 3EKHA 2ZNDA 4MLWA 1DJHA 3I5HC 2KPHA 3DF0B 1NCXA 2AUCA 2VRGA 4QJ3B 3VRNA 2ZRSA 1TUZA 2BNXA 1KSOA 4XJKA 3SG2A 2Y1MA 3S0FA 1QX5B 3NHTA 4CLNA 2L5XB 3PATA 3VGOA 1BJFA 1K8UA 3AAJA 3CGAA 1NX0A 3KO0A 4N1GA 2KI6C 2P70A 3KPXA 1FI5A 1XFXO 4JD9A 1ZACA 1S5GY 1CM1A 2M29A 1PSBA 2KFFA 1U5IA 1B7TY 2JXLA 2JTTA 3I5GB 3FE6A 4MRYA 2GGMA 4ORBB 1SL7A 3IQQA 1IQ3A 5CSIA 4PT1A 4XJKB 4MN0A 2F3ZA 1S26D 4DRWA 1CMGA 1YVHA 2KGRA 1QVIZ 1BG1A 2BAPA 2HPSA 4KYNA 1SY9A 3SIBA 4JQ0D 1AVSA 4INXA 1CTRA 3SG3A 1SBJA 3CYZA 3CR5X 2GV5A 4PHMA 3FE9A 2G9BA 4CFRA 1U5IB 1KK7Y 1IJ6A 1DELA 2FCDA 1FW4A 1NIWA 3S0EA 3ZNIA 1CFFA 3K21A 1K9KA 1NX1A 2H2KA 3B7AA 3N7HA 2KNEA 5D69A 1SR6B 3PJIA 2WCHA 3B87A 4M2OA 1B8RA 4YGCB 1UURA 1M39A 3L4AA 4F7FA 1B4CA 1LINA 4ZCUA 2I94A 2PALA 2LVIA 5CSNA 2WCMA 2RGIA 1L2OC 1XFVO 1A75A 2BKIB 3D0YA 3EK8A 3SIAA 5AXIA 2F8PA 4YI9A 1XA5A 1C3YA 1B8LA 2H61C 2BBNA 1YUSA 2K0JA 2LLSA 3BUWB 3OX6A 4DCKA 4PE0A 1WRKA 2K60A 3CR4X 3EVVA 1C07A 1K9UA 1QXPA 2M9GA 4OVNF 2I7AA 1F4QA 1QLKA 1TNWA 1XVJA 3BUMB 3CZ1A 4JWQA 1IH0A 2M49B 3DVJA 4HRGA 1PK0D 2L98A 4INWA 1K95A 1N2DA 3S0GA 1QIVA 2ZRTA 4C0LA 4GAOA 4ZCVA 3D73A 1J1DA 3DD4A 3DXLA 1P28A 1A75B 1IJ5A 1M46A 1S3PA 3NXAA 2TN4A 1A4PA 3BOWA 1DJIA 2WOSA 1UHKA 3BXKA 3FS7A 3EG5B 4PALA 2KHNA 1CDNA 1MXLC 3S0AA 1WRZA 1XYDA 4HSZA 4YGEB 2JQ6A 2QEHA 1QS7A 3OBVA 3WXAA 4CIDA 3F45A 1QV0A 2FJUB 1QLSA 3RM1A 4M2PA 1KK8B 2LUCA 1XFWO 1KCYA 1UUSA 2LLTA 1AUIB 3CZTX 1D1OA 1TTXA 3DYEA 4HREE 1DC1A 1YRTB 1ORGA 3VRQA 2PYQA 5AEQA 1OMDA 2Y5IA 3NHIA 1OSAA 2JT3A 1CDLA 1GGZA 2QEVA 3NSKA 3PM2A 1TNQA 1Y1UA 2KAXA 4OR9B 3SS3A 4BY5A 1SCMB 1K94A 5B8IB 2JWWA 1S6JA 3PN7C 5TNCA 2WCLA 4DUQA 3IVTA 1TWOA 1YURA 3D75A 1IWQA 5I2OA 1AJ5A 1YRUB 4MVFA 2M3WA 1DJZA 4L9MA 1KQMC 2HQ8A 2BCAA 2KYFA 5HKZA 3CR2A 2M8UA 3OX5A 4MZLA 3O6BA 1G8IA 2F3YA 4NDCA 3B6XA 1LVCD 3NSLA 1MR8A 1TCFA 1EXRA 1MF8B 4C0JA 2NLNA 3DVEA 2CTNA 1NP8A 1HQVA 2JTZA 3VROA 4R1EA 1JF2A 1VRKA 1YUUA 2JNXA 3NSIA 1R6PA 5FI6A 3A8RA 1SL8A 1CMFA 1SW8A 1SYMA 3TUYB 1MXEA 1IKUA 1A29A 4D1EA 2HQWA 5PALA 2QEBA 5HL1A 1H8BA 2BE4A 2WCEA 3O4XA 1BLQA 2EHBA 1OOHA 3JVTC 1J7QA 3PLFB 3CZ0A 2M7NA 3PM8A 4FQOA 2OTGB 3OHMB 4PDZA 3ZWHA 1DJYA 3D78A 2L50A 1YVLA 3LK1A 3DY9A 4WQ3A 1YTZC 2PQLA 2ZKMX 1QASA 1YR5A 1FI6A 3GK1A 4U8DA 3I5IC 2LVKA 2EC6C 1LS8A 3WHUB 1TNPA 3GK4X 4E68A 3DZTA 5I8NA 3MSEB 1OQPA 1JF0A 2WC5A 1N0YA 1YUTA 1BT6A 5HLOA 2KBMA 2ZNEA 2BBMA 5CPVA 2LAPA 3KF9A 2L5YA 5JOLA 1LA0A 3R1OA 4QJ5B 3SG5A 1W7IB 1CB1A 1BOCA 1TNXA 2JPOA 3EVRA 1AHRA 2KLEA 2SCPA 1BMOA 3CTNA 2KQYA 1V1FA 5J3XA 1S6IA 1QATA 1PALA 5IBWA 3CLNA 2L0PA 3QMEA 4MSPA 2JT0A 2WC8A 4CPVA 1S6CA 1DJGA 2KBIA 1TUJA 2LANA 3UNWA 1G33A 2M97A 1KFXL 4MZJA 4WQ2A 2P6BB 1KWOC 2BL0C 2LM5A 1Y1XA 2MA2A 5D7FA 1RECA 3R1PA 3NGVA 3TS5C 4MEWA 2YGUA 1ZMZA 1DMOA 4ORCB 5HYDA 1RFJA 5DICA 2KI4C 1XO5A 3TDIA 5G08A
chains in the Genus database with same CATH topology
2LP3A 4JPZB 1KSMA 2NXQA 4NDDA 1ZFSA 1J7OA 3AAKA 3BUOB 1HT9A 2CXJA 2L4IA 1Q80A 1RK9A 4Q04A 4TNCA 3SG6A 1H4BA 1N65A 4F0ZB 1CFCA 2COLB 3OP0A 4GGFA 2LNKA 1QVIY 3FWCA 3WHTB 4ETOA 2KDHA 2KAYA 3GK2A 1OOJA 4WRIA 2R2IA 1CFPA 3I5GC 5FYXA 2ISDA 1OZOA 4HRHA 1DGVA 2QPTA 2BE6A 1CFDA 4DS7A 2BCBA 3VRRA 1X02A 2PRUA 5CSJA 2L51A 1CNPA 1WDCB 4PE4A 2WCBA 2JT8A 1E8AA 5KTYA 2KSPA 1MUXA 2JOJA 1QIWA 3LK0A 2OPOA 1MWNA 1OMVA 2V53A 2BCXA 3SG7A 3EVUA 2FCEA 3I5FB 2O5GA 4P5OE 5GQQC 1SK6D 2ZN8A 1FF1A 4OV2A 1BR1B 1KFXS 1RTP1 2MBXA 1Y0VH 1SR6C 1NSHA 1PRWA 3PSRA 5JJGA 1TN4A 2DOQA 1CDPA 1IRJA 2M1UA 3E3RA 1BR4B 4FTGA 2KQ6A 2JULA 3OB2B 1AJ4A 4ORAB 1MQ1A 1DF0B 1F8HA 2QACA 2LMTA 3QRXA 1OE9B 1WY9A 1OMRA 2JRFA 2L2EA 4YGAA 1XK4A 1NX2A 1UP5A 1UHHA 2A4JA 1YX7A 1EL4A 2K7DA 3EKJA 2PSRA 4PCWA 1SNLA 3HX4A 3HCMA 1LXFC 2PVBA 4GFTA 1ALVA 4GBAA 5F6TA 3O4YA 3SJSA 4CFQA 1RJVA 2MRDA 2KI6D 2LHLA 2PASA 1IGVA 2JZIA 3LLEA 4XYNA 4YGDB 1S5GZ 1FPWA 4P2YB 2LP2A 2HETA 3TZ1A 1B7TZ 2K2FA 2MLEC 2JNFA 1JUOA 4OCIA 3H4SE 1DVIA 2MAZA 1JBAA 2SASA 1K9PA 4YGBB 1IG5A 2K61A 1C7VA 1KK8C 1S36A 5DKNA 3PALA 2BKHB 2I2RE 1Y1AA 1JWDA 1M45A 3AKBA 1ZUZA 1RROA 1LKJA 3O2PA 4GPLB 1CLMA 1F55A 1TRFA 1SCMC 1K90D 1L2OB 1QJTA 1UWOA 1KK7Z 2IS9A 1NUBA 1B47A 3GOFA 3AKAA 4ICBA 1JC2A 2AMIA 5DKRA 2MHHA 2NZ0A 3DVMA 3D10A 1K96A 1BODA 1GJYA 2M0RA 5AFPA 4UPGA 5ER4X 2EGDA 1TOPA 2PMYA 1B8CA 1UHIA 4A4CA 1SKTA 3LL8B 4PHJA 4AOMA 5KSZA 4I5LB 2LMVA 3A4UB 1UHNA 1CKKA 1F71A 3BUXB 4A4BA 5HLVA 2KFGA 1XFZO 1MHOA 1JFKA 3TUYC 2LC5A 1K2HA 1UHJA 2LVVA 2FOTA 1TCOB 2GGZA 5HKWA 3ICBA 2OTGC 1B9AA 1QTXA 2BECA 4IL1A 1F54A 1QV1A 1XK4C 2CCMA 5CSFA 2Q4UA 4N1FA 3TDZA 3FWBA 4MRXA 1PULA 4I5KA 4NQGA 2LCPA 1KFUL 1NX3A 1NYAA 3JTDB 1BF5A 1Y6WA 2K7BA 1KQVA 2O60A 1DJXA 1EH2A 1J7PA 1NCZA 1M63B 1TIZA 2K7CA 2KOTA 5KU1A 4BY4A 1DT7B 1NWDA 2G2BA 1C7WA 3BQ3A 2CT9A 3FIAA 2NCPA 1R2UA 1JSAA 3PN7B 1F4OA 1IQ5A 2LE9B 2MJWB 2K7OA 4OKHA 1NPQA 1SPYA 4PE1A 4DIRA 2I18A 1SRAA 2KFHA 1CM4A 1KQMB 1WRLA 3EK4A 4PHKA 1XFUO 2MLFC 1CLLA 1B1GA 3OB1B 1EG4A 1G4YR 1NCYA 2AAOA 4GUKA 2OS8B 1J1EA 4M2QA 1CLBA 4YRUA 1SMGA 1AP4A 3NSOA 3M0WA 1ZOTB 4AQJA 4I5NB 1DF0A 3O78A 1OZSA 3DVKA 1J55A 3D0YB 2KAVA 3TDUA 3SG4A 3IF7A 3JVTB 5AANA 1BU3A 2Y1NA 3KHEA 2ZFDA 2CNPA 1RWYA 2M7LA 1A03A 1JFJA 2M1KB 2WCFA 1WLMA 1DTLA 4NDBA 3BUNB 2LLUA 4YBHB 2E30A 3LCPC 4USLA 2E6WA 2Y4QA 3I5HB 2JC2A 2WNDA 1L7ZA 2CBLA 1F70A 3I5IB 2EC6B 2JU0A 3WNXB 2LMUA 2WORA 4GGNA 2L4HA 2LUXA 2F33A 4PE7A 1KFUS 4AQIA 1S1EA 3EK7A 1V1GA 2NCOA 3JTDC 3KEVA 2JPTA 3BOWB 4N5XA 2JXCA 1GGWA 3C1VA 2F2PA 2K2AA 1YX8A 2KYCA 5ER5A 4MZKA 2B1UA 1SCVA 1WLZA 4I5JA 5DKQA 1W7JB 3IQOA 1PVAA 1CDMA 5HKYA 3BYAA 4PHNA 5BPJA 1ODBA 4MBEA 5I2LA 1QX2A 2ZN9A 1XFYO 2LHIA 1EJ3A 2K8MB 1WDCC 1PVBA 3RLZA 1QX7A 1FBVA 2H61A 3DF0A 4GGFC 4YI8A 1M31A 2OS8C 1DJWA 3CWGA 5AERA 1AK8A 1GQMA 3I5FC 4QJ4B 1KWOB 2BL0B 2LVJA 3PFVA 1PSRA 1SL9A 1J7RA 2F2OA 1A2XA 1DGUA 2HF5A 3TS5B 3VRPA 1EG3A 1K93D 2LV7A 5K89A 1LA3A 2KI4B 2D8NA 4GNKB 1ALWA 2KGBC 3CS1A 2Q91A 3EKHA 2ZNDA 4MLWA 1DJHA 3I5HC 3DF0B 1NCXA 2AUCA 2VRGA 4QJ3B 3VRNA 2ZRSA 4XJKA 4C0KA 1KSOA 3SG2A 2Y1MA 1QX5B 4CLNA 2L5XB 3PATA 3VGOA 1BJFA 1K8UA 3AAJA 3CGAA 1NX0A 3KO0A 4N1GA 2KI6C 3KPXA 1FI5A 1XFXO 1ZACA 1S5GY 1CM1A 2M29A 1PSBA 2KFFA 1U5IA 1B7TY 2JXLA 2JTTA 3I5GB 4MRYA 2GGMA 4ORBB 1SL7A 3IQQA 1IQ3A 5CSIA 4XJKB 4MN0A 2F3ZA 1S26D 4DRWA 1CMGA 1YVHA 2KGRA 1QVIZ 1BG1A 2HPSA 3SIBA 1SY9A 4JQ0D 1AVSA 1CTRA 3SG3A 1SBJA 3CR5X 2GV5A 4PHMA 2G9BA 4CFRA 1U5IB 1KK7Y 1IJ6A 2FCDA 1FW4A 1NIWA 3ZNIA 1CFFA 3K21A 1K9KA 1NX1A 2H2KA 2KNEA 5D69A 1SR6B 4M2OA 1B8RA 4YGCB 1UURA 1M39A 1B4CA 1LINA 4ZCUA 2I94A 2PALA 2LVIA 5CSNA 2RGIA 1L2OC 1XFVO 1A75A 2BKIB 3D0YA 3EK8A 3SIAA 5AXIA 2F8PA 4YI9A 1XA5A 1B8LA 2H61C 2BBNA 1YUSA 2K0JA 2LLSA 3BUWB 3OX6A 4DCKA 4PE0A 1WRKA 3CR4X 3EVVA 1C07A 1K9UA 1QXPA 2M9GA 4OVNF 2I7AA 1F4QA 1QLKA 1TNWA 1XVJA 3BUMB 4JWQA 1IH0A 2M49B 3DVJA 4HRGA 1PK0D 2L98A 1K95A 1N2DA 1QIVA 2ZRTA 4C0LA 4GAOA 4ZCVA 1J1DA 3DD4A 1A75B 1IJ5A 1M46A 1S3PA 3NXAA 2TN4A 1A4PA 3BOWA 1DJIA 2WOSA 1UHKA 3BXKA 3FS7A 4PALA 2KHNA 1CDNA 1MXLC 1WRZA 1XYDA 4HSZA 4YGEB 2JQ6A 1QS7A 3WXAA 4CIDA 3F45A 1QV0A 2FJUB 1QLSA 3RM1A 4M2PA 1KK8B 2LUCA 1XFWO 1KCYA 1UUSA 2LLTA 1AUIB 3CZTX 1D1OA 1TTXA 4HREE 1YRTB 3VRQA 5AEQA 1OMDA 2Y5IA 1OSAA 2JT3A 1CDLA 1GGZA 3NSKA 4OR9B 4BY5A 1TNQA 1Y1UA 2KAXA 5B8IB 5I2QA 1SCMB 1K94A 2JWWA 1S6JA 3PN7C 5TNCA 4DUQA 1YURA 1IWQA 5I2OA 1AJ5A 1YRUB 4MVFA 2M3WA 1DJZA 4L9MA 1KQMC 2HQ8A 2BCAA 2KYFA 5HKZA 3CR2A 2M8UA 3OX5A 4MZLA 3O6BA 1G8IA 2F3YA 4NDCA 1LVCD 3NSLA 1MR8A 1TCFA 1EXRA 1MF8B 4C0JA 2NLNA 3DVEA 2CTNA 1NP8A 1HQVA 2JTZA 3VROA 4R1EA 1JF2A 1VRKA 1YUUA 2JNXA 3NSIA 1R6PA 3A8RA 1SL8A 1CMFA 1SW8A 1SYMA 3TUYB 1MXEA 1IKUA 1A29A 4D1EA 2HQWA 5PALA 1H8BA 2BE4A 2WCEA 1BLQA 2EHBA 3JVTC 1J7QA 3PLFB 2M7NA 3PM8A 4FQOA 2OTGB 3OHMB 4PDZA 3ZWHA 1DJYA 2L50A 1YVLA 3LK1A 4WQ3A 1YTZC 2ZKMX 1QASA 1YR5A 1FI6A 3GK1A 4U8DA 3I5IC 2LVKA 2EC6C 3WHUB 1TNPA 3GK4X 4E68A 5I8NA 3MSEB 1OQPA 1JF0A 1N0YA 1YUTA 1BT6A 5HLOA 2KBMA 2ZNEA 2BBMA 5CPVA 2LAPA 3KF9A 5JOLA 1LA0A 4QJ5B 3SG5A 1W7IB 1CB1A 1BOCA 1TNXA 3EVRA 1AHRA 2SCPA 1BMOA 3CTNA 2KQYA 1V1FA 5J3XA 1S6IA 1QATA 1PALA 5IBWA 3CLNA 2L0PA 4MSPA 2JT0A 2WC8A 4CPVA 1S6CA 1DJGA 2KBIA 2LANA 1G33A 2M97A 1KFXL 4MZJA 4WQ2A 2P6BB 1KWOC 2BL0C 2LM5A 1Y1XA 2MA2A 5D7FA 1RECA 3TS5C 4MEWA 1ZMZA 1DMOA 4ORCB 5HYDA 1RFJA 2KI4C 1XO5A 3TDIA 5G08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LP3 A;  4JPZ B;  1KSM A;  2NXQ A;  4NDD A;  1ZFS A;  1J7O A;  3AAK A;  3BUO B;  1HT9 A;  2CXJ A;  2L4I A;  1Q80 A;  1RK9 A;  4Q04 A;  4TNC A;  3SG6 A;  1H4B A;  1N65 A;  4F0Z B;  1CFC A;  2COL B;  3OP0 A;  4GGF A;  2LNK A;  1QVI Y;  3FWC A;  3WHT B;  4ETO A;  2KDH A;  2KAY A;  3GK2 A;  1OOJ A;  4WRI A;  2R2I A;  1CFP A;  3I5G C;  5FYX A;  2ISD A;  1OZO A;  4HRH A;  1DGV A;  2QPT A;  2BE6 A;  1CFD A;  4DS7 A;  2BCB A;  3VRR A;  1X02 A;  2PRU A;  5CSJ A;  2L51 A;  1CNP A;  1WDC B;  4PE4 A;  2WCB A;  2JT8 A;  1E8A A;  5KTY A;  2KSP A;  1MUX A;  2JOJ A;  1QIW A;  3LK0 A;  2OPO A;  1MWN A;  1OMV A;  2V53 A;  2BCX A;  3SG7 A;  3EVU A;  2FCE A;  3I5F B;  2O5G A;  4P5O E;  5GQQ C;  1SK6 D;  2ZN8 A;  1FF1 A;  4OV2 A;  1BR1 B;  1KFX S;  1RTP 1;  2MBX A;  1Y0V H;  1SR6 C;  1NSH A;  1PRW A;  3PSR A;  5JJG A;  1TN4 A;  2DOQ A;  1CDP A;  1IRJ A;  2M1U A;  3E3R A;  1BR4 B;  4FTG A;  2KQ6 A;  2JUL A;  3OB2 B;  1AJ4 A;  4ORA B;  1MQ1 A;  1DF0 B;  1F8H A;  2QAC A;  2LMT A;  3QRX A;  1OE9 B;  1WY9 A;  1OMR A;  2JRF A;  2L2E A;  4YGA A;  1XK4 A;  1NX2 A;  1UP5 A;  1UHH A;  2A4J A;  1YX7 A;  1EL4 A;  2K7D A;  3EKJ A;  2PSR A;  4PCW A;  1SNL A;  3HX4 A;  3HCM A;  1LXF C;  2PVB A;  4GFT A;  1ALV A;  4GBA A;  5F6T A;  3O4Y A;  3SJS A;  4CFQ A;  1RJV A;  2MRD A;  2KI6 D;  2LHL A;  2PAS A;  1IGV A;  2JZI A;  3LLE A;  4XYN A;  4YGD B;  1S5G Z;  1FPW A;  4P2Y B;  2LP2 A;  2HET A;  3TZ1 A;  1B7T Z;  2K2F A;  2MLE C;  2JNF A;  1JUO A;  4OCI A;  3H4S E;  1DVI A;  2MAZ A;  1JBA A;  2SAS A;  1K9P A;  4YGB B;  1IG5 A;  2K61 A;  1C7V A;  1KK8 C;  1S36 A;  5DKN A;  3PAL A;  2BKH B;  2I2R E;  1Y1A A;  1JWD A;  1M45 A;  3AKB A;  1ZUZ A;  1RRO A;  1LKJ A;  3O2P A;  4GPL B;  1CLM A;  1F55 A;  1TRF A;  1SCM C;  1K90 D;  1L2O B;  1QJT A;  1UWO A;  1KK7 Z;  2IS9 A;  1NUB A;  1B47 A;  3GOF A;  3AKA A;  4ICB A;  1JC2 A;  2AMI A;  5DKR A;  2MHH A;  2NZ0 A;  3DVM A;  3D10 A;  1K96 A;  1BOD A;  1GJY A;  2M0R A;  5AFP A;  4UPG A;  5ER4 X;  2EGD A;  1TOP A;  2PMY A;  1B8C A;  1UHI A;  4A4C A;  1SKT A;  3LL8 B;  4PHJ A;  4AOM A;  5KSZ A;  4I5L B;  2LMV A;  3A4U B;  1UHN A;  1CKK A;  1F71 A;  3BUX B;  4A4B A;  5HLV A;  2KFG A;  1XFZ O;  1MHO A;  1JFK A;  3TUY C;  2LC5 A;  1K2H A;  1UHJ A;  2LVV A;  2FOT A;  1TCO B;  2GGZ A;  5HKW A;  3ICB A;  2OTG C;  1B9A A;  1QTX A;  2BEC A;  4IL1 A;  1F54 A;  1QV1 A;  1XK4 C;  2CCM A;  5CSF A;  2Q4U A;  4N1F A;  3TDZ A;  3FWB A;  4MRX A;  1PUL A;  4I5K A;  4NQG A;  2LCP A;  1KFU L;  1NX3 A;  1NYA A;  3JTD B;  1BF5 A;  1Y6W A;  2K7B A;  1KQV A;  2O60 A;  1DJX A;  1EH2 A;  1J7P A;  1NCZ A;  1M63 B;  1TIZ A;  2K7C A;  2KOT A;  5KU1 A;  4BY4 A;  1DT7 B;  1NWD A;  2G2B A;  1C7W A;  3BQ3 A;  2CT9 A;  3FIA A;  2NCP A;  1R2U A;  1JSA A;  3PN7 B;  1F4O A;  1IQ5 A;  2LE9 B;  2MJW B;  2K7O A;  4OKH A;  1NPQ A;  1SPY A;  4PE1 A;  4DIR A;  2I18 A;  1SRA A;  2KFH A;  1CM4 A;  1KQM B;  1WRL A;  3EK4 A;  4PHK A;  1XFU O;  2MLF C;  1CLL A;  1B1G A;  3OB1 B;  1EG4 A;  1G4Y R;  1NCY A;  2AAO A;  4GUK A;  2OS8 B;  1J1E A;  4M2Q A;  1CLB A;  4YRU A;  1SMG A;  1AP4 A;  3NSO A;  3M0W A;  1ZOT B;  4AQJ A;  4I5N B;  1DF0 A;  3O78 A;  1OZS A;  3DVK A;  1J55 A;  3D0Y B;  2KAV A;  3TDU A;  3SG4 A;  3IF7 A;  3JVT B;  5AAN A;  1BU3 A;  2Y1N A;  3KHE A;  2ZFD A;  2CNP A;  1RWY A;  2M7L A;  1A03 A;  1JFJ A;  2M1K B;  2WCF A;  1WLM A;  1DTL A;  4NDB A;  3BUN B;  2LLU A;  4YBH B;  2E30 A;  3LCP C;  4USL A;  2E6W A;  2Y4Q A;  3I5H B;  2JC2 A;  2WND A;  1L7Z A;  2CBL A;  1F70 A;  3I5I B;  2EC6 B;  2JU0 A;  3WNX B;  2LMU A;  2WOR A;  4GGN A;  2L4H A;  2LUX A;  2F33 A;  4PE7 A;  1KFU S;  4AQI A;  1S1E A;  3EK7 A;  1V1G A;  2NCO A;  3JTD C;  3KEV A;  2JPT A;  3BOW B;  4N5X A;  2JXC A;  1GGW A;  3C1V A;  2F2P A;  2K2A A;  1YX8 A;  2KYC A;  5ER5 A;  4MZK A;  2B1U A;  1SCV A;  1WLZ A;  4I5J A;  5DKQ A;  1W7J B;  3IQO A;  1PVA A;  1CDM A;  5HKY A;  3BYA A;  4PHN A;  5BPJ A;  1ODB A;  4MBE A;  5I2L A;  1QX2 A;  2ZN9 A;  1XFY O;  2LHI A;  1EJ3 A;  2K8M B;  1WDC C;  1PVB A;  3RLZ A;  1QX7 A;  1FBV A;  2H61 A;  3DF0 A;  4GGF C;  4YI8 A;  1M31 A;  2OS8 C;  1DJW A;  3CWG A;  5AER A;  1AK8 A;  1GQM A;  3I5F C;  4QJ4 B;  1KWO B;  2BL0 B;  2LVJ A;  3PFV A;  1PSR A;  1SL9 A;  1J7R A;  2F2O A;  1A2X A;  1DGU A;  2HF5 A;  3TS5 B;  3VRP A;  1EG3 A;  1K93 D;  2LV7 A;  5K89 A;  1LA3 A;  2KI4 B;  2D8N A;  4GNK B;  1ALW A;  2KGB C;  3CS1 A;  2Q91 A;  3EKH A;  2ZND A;  4MLW A;  1DJH A;  3I5H C;  3DF0 B;  1NCX A;  2AUC A;  2VRG A;  4QJ3 B;  3VRN A;  2ZRS A;  4XJK A;  4C0K A;  1KSO A;  3SG2 A;  2Y1M A;  1QX5 B;  4CLN A;  2L5X B;  3PAT A;  3VGO A;  1BJF A;  1K8U A;  3AAJ A;  3CGA A;  1NX0 A;  3KO0 A;  4N1G A;  2KI6 C;  3KPX A;  1FI5 A;  1XFX O;  1ZAC A;  1S5G Y;  1CM1 A;  2M29 A;  1PSB A;  2KFF A;  1U5I A;  1B7T Y;  2JXL A;  2JTT A;  3I5G B;  4MRY A;  2GGM A;  4ORB B;  1SL7 A;  3IQQ A;  1IQ3 A;  5CSI A;  4XJK B;  4MN0 A;  2F3Z A;  1S26 D;  4DRW A;  1CMG A;  1YVH A;  2KGR A;  1QVI Z;  1BG1 A;  2HPS A;  3SIB A;  1SY9 A;  4JQ0 D;  1AVS A;  1CTR A;  3SG3 A;  1SBJ A;  3CR5 X;  2GV5 A;  4PHM A;  2G9B A;  4CFR A;  1U5I B;  1KK7 Y;  1IJ6 A;  2FCD A;  1FW4 A;  1NIW A;  3ZNI A;  1CFF A;  3K21 A;  1K9K A;  1NX1 A;  2H2K A;  2KNE A;  5D69 A;  1SR6 B;  4M2O A;  1B8R A;  4YGC B;  1UUR A;  1M39 A;  1B4C A;  1LIN A;  4ZCU A;  2I94 A;  2PAL A;  2LVI A;  5CSN A;  2RGI A;  1L2O C;  1XFV O;  1A75 A;  2BKI B;  3D0Y A;  3EK8 A;  3SIA A;  5AXI A;  2F8P A;  4YI9 A;  1XA5 A;  1B8L A;  2H61 C;  2BBN A;  1YUS A;  2K0J A;  2LLS A;  3BUW B;  3OX6 A;  4DCK A;  4PE0 A;  1WRK A;  3CR4 X;  3EVV A;  1C07 A;  1K9U A;  1QXP A;  2M9G A;  4OVN F;  2I7A A;  1F4Q A;  1QLK A;  1TNW A;  1XVJ A;  3BUM B;  4JWQ A;  1IH0 A;  2M49 B;  3DVJ A;  4HRG A;  1PK0 D;  2L98 A;  1K95 A;  1N2D A;  1QIV A;  2ZRT A;  4C0L A;  4GAO A;  4ZCV A;  1J1D A;  3DD4 A;  1A75 B;  1IJ5 A;  1M46 A;  1S3P A;  3NXA A;  2TN4 A;  1A4P A;  3BOW A;  1DJI A;  2WOS A;  1UHK A;  3BXK A;  3FS7 A;  4PAL A;  2KHN A;  1CDN A;  1MXL C;  1WRZ A;  1XYD A;  4HSZ A;  4YGE B;  2JQ6 A;  1QS7 A;  3WXA A;  4CID A;  3F45 A;  1QV0 A;  2FJU B;  1QLS A;  3RM1 A;  4M2P A;  1KK8 B;  2LUC A;  1XFW O;  1KCY A;  1UUS A;  2LLT A;  1AUI B;  3CZT X;  1D1O A;  1TTX A;  4HRE E;  1YRT B;  3VRQ A;  5AEQ A;  1OMD A;  2Y5I A;  1OSA A;  2JT3 A;  1CDL A;  1GGZ A;  3NSK A;  4OR9 B;  4BY5 A;  1TNQ A;  1Y1U A;  2KAX A;  5B8I B;  5I2Q A;  1SCM B;  1K94 A;  2JWW A;  1S6J A;  3PN7 C;  5TNC A;  4DUQ A;  1YUR A;  1IWQ A;  5I2O A;  1AJ5 A;  1YRU B;  4MVF A;  2M3W A;  1DJZ A;  4L9M A;  1KQM C;  2HQ8 A;  2BCA A;  2KYF A;  5HKZ A;  3CR2 A;  2M8U A;  3OX5 A;  4MZL A;  3O6B A;  1G8I A;  2F3Y A;  4NDC A;  1LVC D;  3NSL A;  1MR8 A;  1TCF A;  1EXR A;  1MF8 B;  4C0J A;  2NLN A;  3DVE A;  2CTN A;  1NP8 A;  1HQV A;  2JTZ A;  3VRO A;  4R1E A;  1JF2 A;  1VRK A;  1YUU A;  2JNX A;  3NSI A;  1R6P A;  3A8R A;  1SL8 A;  1CMF A;  1SW8 A;  1SYM A;  3TUY B;  1MXE A;  1IKU A;  1A29 A;  4D1E A;  2HQW A;  5PAL A;  1H8B A;  2BE4 A;  2WCE A;  1BLQ A;  2EHB A;  3JVT C;  1J7Q A;  3PLF B;  2M7N A;  3PM8 A;  4FQO A;  2OTG B;  3OHM B;  4PDZ A;  3ZWH A;  1DJY A;  2L50 A;  1YVL A;  3LK1 A;  4WQ3 A;  1YTZ C;  2ZKM X;  1QAS A;  1YR5 A;  1FI6 A;  3GK1 A;  4U8D A;  3I5I C;  2LVK A;  2EC6 C;  3WHU B;  1TNP A;  3GK4 X;  4E68 A;  5I8N A;  3MSE B;  1OQP A;  1JF0 A;  1N0Y A;  1YUT A;  1BT6 A;  5HLO A;  2KBM A;  2ZNE A;  2BBM A;  5CPV A;  2LAP A;  3KF9 A;  5JOL A;  1LA0 A;  4QJ5 B;  3SG5 A;  1W7I B;  1CB1 A;  1BOC A;  1TNX A;  3EVR A;  1AHR A;  2SCP A;  1BMO A;  3CTN A;  2KQY A;  1V1F A;  5J3X A;  1S6I A;  1QAT A;  1PAL A;  5IBW A;  3CLN A;  2L0P A;  4MSP A;  2JT0 A;  2WC8 A;  4CPV A;  1S6C A;  1DJG A;  2KBI A;  2LAN A;  1G33 A;  2M97 A;  1KFX L;  4MZJ A;  4WQ2 A;  2P6B B;  1KWO C;  2BL0 C;  2LM5 A;  1Y1X A;  2MA2 A;  5D7F A;  1REC A;  3TS5 C;  4MEW A;  1ZMZ A;  1DMO A;  4ORC B;  5HYD A;  1RFJ A;  2KI4 C;  1XO5 A;  3TDI A;  5G08 A; 
#chains in the Genus database with same CATH topology
 2LP3 A;  4JPZ B;  3V2L A;  1OOI X;  1KSM A;  2NXQ A;  4NDD A;  1ZFS A;  1J7O A;  3AAK A;  1OOG A;  3BUO B;  1HT9 A;  2CXJ A;  2L4I A;  1Q80 A;  1RK9 A;  4Q04 A;  4TNC A;  3SG6 A;  1H4B A;  1N65 A;  4F0Z B;  1CFC A;  2COL B;  3OP0 A;  4GGF A;  2LNK A;  1QVI Y;  1DEK A;  3FWC A;  3WHT B;  4ETO A;  2KDH A;  2KAY A;  2QEO A;  2WCK A;  3GK2 A;  1OOJ A;  4WRI A;  2R2I A;  1CFP A;  3I5G C;  5FYX A;  2ISD A;  1OZO A;  4HRH A;  1DGV A;  3D74 A;  2QPT A;  2BE6 A;  1CFD A;  4DS7 A;  2BCB A;  3VRR A;  1X02 A;  2PRU A;  3B86 A;  3D76 A;  5CSJ A;  2L51 A;  1CNP A;  1WDC B;  3BFH A;  4PE4 A;  2WCB A;  2JT8 A;  1E8A A;  5KTY A;  2KSP A;  1MUX A;  2JOJ A;  1QIW A;  3LK0 A;  2OPO A;  1MWN A;  1OMV A;  2V53 A;  2BCX A;  3SG7 A;  3EVU A;  2FCE A;  4OZD A;  3I5F B;  2O5G A;  4P5O E;  5GQQ C;  1SK6 D;  2ZN8 A;  1FF1 A;  4OV2 A;  1BR1 B;  1KFX S;  1RTP 1;  2MBX A;  1Y0V H;  1SR6 C;  1OOF A;  1NSH A;  1PRW A;  3PSR A;  3S0B A;  1TN4 A;  2DOQ A;  5JJG A;  1CDP A;  2P71 A;  1IRJ A;  2M1U A;  3CAB A;  3E3R A;  1BR4 B;  4FTG A;  2ERB A;  2KQ6 A;  2JUL A;  3OB2 B;  1AJ4 A;  4ORA B;  1MQ1 A;  1DF0 B;  1F8H A;  2QAC A;  3RZS A;  2LMT A;  3QRX A;  1OE9 B;  1WY9 A;  1OMR A;  2JRF A;  1Z2C B;  2L2E A;  4YGA A;  1XK4 A;  1NX2 A;  1UP5 A;  1UHH A;  3OGN A;  2A4J A;  1YX7 A;  2H8V A;  3D77 A;  1EL4 A;  2K7D A;  3BJH A;  2PSR A;  3EKJ A;  1SNL A;  4PCW A;  3HX4 A;  3HCM A;  1LXF C;  2PVB A;  4GFT A;  1ALV A;  4GBA A;  5F6T A;  3O4Y A;  3SJS A;  4CFQ A;  1RJV A;  2MRD A;  2KI6 D;  2LHL A;  2PAS A;  1IGV A;  2JZI A;  3CZ2 A;  3L4L A;  3LLE A;  4XYN A;  1S5G Z;  4YGD B;  1FPW A;  4P2Y B;  2LP2 A;  2HET A;  3TZ1 A;  1B7T Z;  2K2F A;  5I94 A;  2MLE C;  2JNF A;  1JUO A;  4OCI A;  3H4S E;  1DVI A;  2MAZ A;  1JBA A;  2SAS A;  1K9P A;  4IJ7 A;  1IG5 A;  4YGB B;  2K61 A;  2FJY A;  1C7V A;  1KK8 C;  1S36 A;  5DKN A;  3PAL A;  2BKH B;  2I2R E;  1Y1A A;  1JWD A;  1M45 A;  3AKB A;  3Q8I A;  1ZUZ A;  1RRO A;  1LKJ A;  3S0D A;  3O2P A;  4GPL B;  1CLM A;  1F55 A;  1TRF A;  1SCM C;  1K90 D;  1L2O B;  1QJT A;  1UWO A;  1KK7 Z;  2IS9 A;  1NUB A;  1B47 A;  3GOF A;  3AKA A;  4ICB A;  1JC2 A;  2AMI A;  5D3O A;  5DKR A;  2MHH A;  2NZ0 A;  3DVM A;  3D10 A;  1K96 A;  1BOD A;  1GJY A;  2M0R A;  5AFP A;  4UPG A;  5ER4 X;  2EGD A;  1TOP A;  2PMY A;  1B8C A;  1UHI A;  4A4C A;  1SKT A;  3LL8 B;  4PHJ A;  4AOM A;  5KSZ A;  4I5L B;  2LMV A;  3A4U B;  1UHN A;  3SS4 A;  1CKK A;  1F71 A;  3BUX B;  4A4B A;  5HLV A;  2KFG A;  1XFZ O;  1MHO A;  1JFK A;  3CDN A;  4FQT A;  3BFA A;  3TUY C;  2LC5 A;  1K2H A;  1UHJ A;  2LVV A;  2FOT A;  1TCO B;  2GGZ A;  5HKW A;  3ICB A;  1QWV A;  2OTG C;  1B9A A;  1QTX A;  2BEC A;  4IL1 A;  1F54 A;  1QV1 A;  1XK4 C;  5FI7 A;  2CCM A;  5CSF A;  2Q4U A;  4N1F A;  3TDZ A;  3FWB A;  3K1E A;  4MRX A;  1PUL A;  4I5K A;  4NQG A;  2LCP A;  1KFU L;  1NX3 A;  1NYA A;  3JTD B;  1BF5 A;  1Y6W A;  2K7B A;  1KQV A;  2O60 A;  1DJX A;  1EH2 A;  1J7P A;  1NCZ A;  1M63 B;  1TIZ A;  2K7C A;  2KOT A;  5KU1 A;  4BY4 A;  1DT7 B;  1NWD A;  1GM0 A;  2G2B A;  1C7W A;  3BQ3 A;  2CT9 A;  3FIA A;  2NCP A;  1OW4 A;  1R2U A;  3PN7 B;  1JSA A;  1F4O A;  1IQ5 A;  2LE9 B;  2MJW B;  2K7O A;  3R72 A;  4OKH A;  1NPQ A;  1SPY A;  3BFB A;  4PE1 A;  2I18 A;  1SRA A;  2KFH A;  4DIR A;  1CM4 A;  3UO9 A;  2QDI A;  1KQM B;  1WRL A;  2L2C A;  3EK4 A;  4PHK A;  1XFU O;  2MLF C;  1CLL A;  1B1G A;  3OB1 B;  1EG4 A;  1G4Y R;  1NCY A;  2AAO A;  4GUK A;  1XFR A;  2OS8 B;  1J1E A;  4M2Q A;  4JKT A;  4YRU A;  1SMG A;  1AP4 A;  1CLB A;  3L47 A;  3NSO A;  3M0W A;  1ZOT B;  4AQJ A;  4I5N B;  1DF0 A;  3O78 A;  1OZS A;  3DVK A;  1J55 A;  2WCJ A;  3D0Y B;  3FE8 A;  1T14 A;  2KAV A;  3TDU A;  3R1V A;  3SG4 A;  3IF7 A;  3JVT B;  5AAN A;  1BU3 A;  2Y1N A;  3KHE A;  2ZFD A;  2CNP A;  1RWY A;  2M7L A;  1A03 A;  1JFJ A;  2M1K B;  2WCF A;  1WLM A;  1DTL A;  4NDB A;  3BUN B;  2LLU A;  4YBH B;  2E30 A;  3LCP C;  4USL A;  2E6W A;  2Y4Q A;  3I5H B;  2JC2 A;  1IIO A;  2WND A;  1L7Z A;  2CBL A;  1F70 A;  3I5I B;  2EC6 B;  2JU0 A;  3WNX B;  3SS5 A;  2LMU A;  2WOR A;  4GGN A;  5I2Q A;  2L4H A;  2LUX A;  2F33 A;  4PE7 A;  1Z4H A;  1KFU S;  5EL2 A;  5FI2 A;  4AQI A;  1S1E A;  3EK7 A;  1V1G A;  2NCO A;  3JTD C;  3KEV A;  1C3Z A;  2JPT A;  3BOW B;  4N5X A;  2JXC A;  1GGW A;  3C1V A;  2F2P A;  2K2A A;  1YX8 A;  2KYC A;  5ER5 A;  1W9Z A;  4MZK A;  2B1U A;  1SCV A;  1WLZ A;  4I5J A;  5DKQ A;  1W7J B;  3IQO A;  1PVA A;  1SSE B;  1CDM A;  2KLD A;  5HKY A;  4C0K A;  3B88 A;  3BYA A;  4PHN A;  5BPJ A;  1ODB A;  4MBE A;  5I2L A;  1QX2 A;  2ZN9 A;  1XFY O;  2LHI A;  2WC6 A;  1EJ3 A;  2K8M B;  3VB1 A;  1WDC C;  1PVB A;  3RLZ A;  1QX7 A;  1FBV A;  2H61 A;  3DF0 A;  4GGF C;  4YI8 A;  1M31 A;  2OS8 C;  1DJW A;  3CWG A;  5AER A;  1AK8 A;  1GQM A;  3I5F C;  1DQE A;  4QJ4 B;  1KWO B;  2BL0 B;  2LVJ A;  3PFV A;  1PSR A;  1SL9 A;  2GTE A;  1J7R A;  2F2O A;  1A2X A;  1DGU A;  2HF5 A;  3TS5 B;  3VRP A;  1EG3 A;  1K93 D;  2LV7 A;  5K89 A;  1LA3 A;  2KI4 B;  2D8N A;  4GNK B;  1ALW A;  2KGB C;  3CS1 A;  2Q91 A;  3EKH A;  2ZND A;  4MLW A;  1DJH A;  3I5H C;  2KPH A;  3DF0 B;  1NCX A;  2AUC A;  2VRG A;  4QJ3 B;  3VRN A;  2ZRS A;  1TUZ A;  2BNX A;  1KSO A;  4XJK A;  3SG2 A;  2Y1M A;  3S0F A;  1QX5 B;  3NHT A;  4CLN A;  2L5X B;  3PAT A;  3VGO A;  1BJF A;  1K8U A;  3AAJ A;  3CGA A;  1NX0 A;  3KO0 A;  4N1G A;  2KI6 C;  2P70 A;  3KPX A;  1FI5 A;  1XFX O;  4JD9 A;  1ZAC A;  1S5G Y;  1CM1 A;  2M29 A;  1PSB A;  2KFF A;  1U5I A;  1B7T Y;  2JXL A;  2JTT A;  3I5G B;  3FE6 A;  4MRY A;  2GGM A;  4ORB B;  1SL7 A;  3IQQ A;  1IQ3 A;  5CSI A;  4PT1 A;  4XJK B;  4MN0 A;  2F3Z A;  1S26 D;  4DRW A;  1CMG A;  1YVH A;  2KGR A;  1QVI Z;  1BG1 A;  2BAP A;  2HPS A;  4KYN A;  1SY9 A;  3SIB A;  4JQ0 D;  1AVS A;  4INX A;  1CTR A;  3SG3 A;  1SBJ A;  3CYZ A;  3CR5 X;  2GV5 A;  4PHM A;  3FE9 A;  2G9B A;  4CFR A;  1U5I B;  1KK7 Y;  1IJ6 A;  1DEL A;  2FCD A;  1FW4 A;  1NIW A;  3S0E A;  3ZNI A;  1CFF A;  3K21 A;  1K9K A;  1NX1 A;  2H2K A;  3B7A A;  3N7H A;  2KNE A;  5D69 A;  1SR6 B;  3PJI A;  2WCH A;  3B87 A;  4M2O A;  1B8R A;  4YGC B;  1UUR A;  1M39 A;  3L4A A;  4F7F A;  1B4C A;  1LIN A;  4ZCU A;  2I94 A;  2PAL A;  2LVI A;  5CSN A;  2WCM A;  2RGI A;  1L2O C;  1XFV O;  1A75 A;  2BKI B;  3D0Y A;  3EK8 A;  3SIA A;  5AXI A;  2F8P A;  4YI9 A;  1XA5 A;  1C3Y A;  1B8L A;  2H61 C;  2BBN A;  1YUS A;  2K0J A;  2LLS A;  3BUW B;  3OX6 A;  4DCK A;  4PE0 A;  1WRK A;  2K60 A;  3CR4 X;  3EVV A;  1C07 A;  1K9U A;  1QXP A;  2M9G A;  4OVN F;  2I7A A;  1F4Q A;  1QLK A;  1TNW A;  1XVJ A;  3BUM B;  3CZ1 A;  4JWQ A;  1IH0 A;  2M49 B;  3DVJ A;  4HRG A;  1PK0 D;  2L98 A;  4INW A;  1K95 A;  1N2D A;  3S0G A;  1QIV A;  2ZRT A;  4C0L A;  4GAO A;  4ZCV A;  3D73 A;  1J1D A;  3DD4 A;  3DXL A;  1P28 A;  1A75 B;  1IJ5 A;  1M46 A;  1S3P A;  3NXA A;  2TN4 A;  1A4P A;  3BOW A;  1DJI A;  2WOS A;  1UHK A;  3BXK A;  3FS7 A;  3EG5 B;  4PAL A;  2KHN A;  1CDN A;  1MXL C;  3S0A A;  1WRZ A;  1XYD A;  4HSZ A;  4YGE B;  2JQ6 A;  2QEH A;  1QS7 A;  3OBV A;  3WXA A;  4CID A;  3F45 A;  1QV0 A;  2FJU B;  1QLS A;  3RM1 A;  4M2P A;  1KK8 B;  2LUC A;  1XFW O;  1KCY A;  1UUS A;  2LLT A;  1AUI B;  3CZT X;  1D1O A;  1TTX A;  3DYE A;  4HRE E;  1DC1 A;  1YRT B;  1ORG A;  3VRQ A;  2PYQ A;  5AEQ A;  1OMD A;  2Y5I A;  3NHI A;  1OSA A;  2JT3 A;  1CDL A;  1GGZ A;  2QEV A;  3NSK A;  3PM2 A;  1TNQ A;  1Y1U A;  2KAX A;  4OR9 B;  3SS3 A;  4BY5 A;  1SCM B;  1K94 A;  5B8I B;  2JWW A;  1S6J A;  3PN7 C;  5TNC A;  2WCL A;  4DUQ A;  3IVT A;  1TWO A;  1YUR A;  3D75 A;  1IWQ A;  5I2O A;  1AJ5 A;  1YRU B;  4MVF A;  2M3W A;  1DJZ A;  4L9M A;  1KQM C;  2HQ8 A;  2BCA A;  2KYF A;  5HKZ A;  3CR2 A;  2M8U A;  3OX5 A;  4MZL A;  3O6B A;  1G8I A;  2F3Y A;  4NDC A;  3B6X A;  1LVC D;  3NSL A;  1MR8 A;  1TCF A;  1EXR A;  1MF8 B;  4C0J A;  2NLN A;  3DVE A;  2CTN A;  1NP8 A;  1HQV A;  2JTZ A;  3VRO A;  4R1E A;  1JF2 A;  1VRK A;  1YUU A;  2JNX A;  3NSI A;  1R6P A;  5FI6 A;  3A8R A;  1SL8 A;  1CMF A;  1SW8 A;  1SYM A;  3TUY B;  1MXE A;  1IKU A;  1A29 A;  4D1E A;  2HQW A;  5PAL A;  2QEB A;  5HL1 A;  1H8B A;  2BE4 A;  2WCE A;  3O4X A;  1BLQ A;  2EHB A;  1OOH A;  3JVT C;  1J7Q A;  3PLF B;  3CZ0 A;  2M7N A;  3PM8 A;  4FQO A;  2OTG B;  3OHM B;  4PDZ A;  3ZWH A;  1DJY A;  3D78 A;  2L50 A;  1YVL A;  3LK1 A;  3DY9 A;  4WQ3 A;  1YTZ C;  2PQL A;  2ZKM X;  1QAS A;  1YR5 A;  1FI6 A;  3GK1 A;  4U8D A;  3I5I C;  2LVK A;  2EC6 C;  1LS8 A;  3WHU B;  1TNP A;  3GK4 X;  4E68 A;  3DZT A;  5I8N A;  3MSE B;  1OQP A;  1JF0 A;  2WC5 A;  1N0Y A;  1YUT A;  1BT6 A;  5HLO A;  2KBM A;  2ZNE A;  2BBM A;  5CPV A;  2LAP A;  3KF9 A;  2L5Y A;  5JOL A;  1LA0 A;  3R1O A;  4QJ5 B;  3SG5 A;  1W7I B;  1CB1 A;  1BOC A;  1TNX A;  2JPO A;  3EVR A;  1AHR A;  2KLE A;  2SCP A;  1BMO A;  3CTN A;  2KQY A;  1V1F A;  5J3X A;  1S6I A;  1QAT A;  1PAL A;  5IBW A;  3CLN A;  2L0P A;  3QME A;  4MSP A;  2JT0 A;  2WC8 A;  4CPV A;  1S6C A;  1DJG A;  2KBI A;  1TUJ A;  2LAN A;  3UNW A;  1G33 A;  2M97 A;  1KFX L;  4MZJ A;  4WQ2 A;  2P6B B;  1KWO C;  2BL0 C;  2LM5 A;  1Y1X A;  2MA2 A;  5D7F A;  1REC A;  3R1P A;  3NGV A;  3TS5 C;  4MEW A;  2YGU A;  1ZMZ A;  1DMO A;  4ORC B;  5HYD A;  1RFJ A;  5DIC A;  2KI4 C;  1XO5 A;  3TDI A;  5G08 A; 
#chains in the Genus database with same CATH homology
 2LP3 A;  4JPZ B;  1KSM A;  2NXQ A;  4NDD A;  1ZFS A;  1J7O A;  3AAK A;  3BUO B;  1HT9 A;  2CXJ A;  2L4I A;  1Q80 A;  1RK9 A;  4Q04 A;  4TNC A;  3SG6 A;  1H4B A;  1N65 A;  4F0Z B;  1CFC A;  2COL B;  3OP0 A;  4GGF A;  2LNK A;  1QVI Y;  3FWC A;  3WHT B;  4ETO A;  2KDH A;  2KAY A;  3GK2 A;  1OOJ A;  4WRI A;  2R2I A;  1CFP A;  3I5G C;  5FYX A;  2ISD A;  1OZO A;  4HRH A;  1DGV A;  2QPT A;  2BE6 A;  1CFD A;  4DS7 A;  2BCB A;  3VRR A;  1X02 A;  2PRU A;  5CSJ A;  2L51 A;  1CNP A;  1WDC B;  4PE4 A;  2WCB A;  2JT8 A;  1E8A A;  5KTY A;  2KSP A;  1MUX A;  2JOJ A;  1QIW A;  3LK0 A;  2OPO A;  1MWN A;  1OMV A;  2V53 A;  2BCX A;  3SG7 A;  3EVU A;  2FCE A;  3I5F B;  2O5G A;  4P5O E;  5GQQ C;  1SK6 D;  2ZN8 A;  1FF1 A;  4OV2 A;  1BR1 B;  1KFX S;  1RTP 1;  2MBX A;  1Y0V H;  1SR6 C;  1NSH A;  1PRW A;  3PSR A;  5JJG A;  1TN4 A;  2DOQ A;  1CDP A;  1IRJ A;  2M1U A;  3E3R A;  1BR4 B;  4FTG A;  2KQ6 A;  2JUL A;  3OB2 B;  1AJ4 A;  4ORA B;  1MQ1 A;  1DF0 B;  1F8H A;  2QAC A;  2LMT A;  3QRX A;  1OE9 B;  1WY9 A;  1OMR A;  2JRF A;  2L2E A;  4YGA A;  1XK4 A;  1NX2 A;  1UP5 A;  1UHH A;  2A4J A;  1YX7 A;  1EL4 A;  2K7D A;  3EKJ A;  2PSR A;  4PCW A;  1SNL A;  3HX4 A;  3HCM A;  1LXF C;  2PVB A;  4GFT A;  1ALV A;  4GBA A;  5F6T A;  3O4Y A;  3SJS A;  4CFQ A;  1RJV A;  2MRD A;  2KI6 D;  2LHL A;  2PAS A;  1IGV A;  2JZI A;  3LLE A;  4XYN A;  4YGD B;  1S5G Z;  1FPW A;  4P2Y B;  2LP2 A;  2HET A;  3TZ1 A;  1B7T Z;  2K2F A;  2MLE C;  2JNF A;  1JUO A;  4OCI A;  3H4S E;  1DVI A;  2MAZ A;  1JBA A;  2SAS A;  1K9P A;  4YGB B;  1IG5 A;  2K61 A;  1C7V A;  1KK8 C;  1S36 A;  5DKN A;  3PAL A;  2BKH B;  2I2R E;  1Y1A A;  1JWD A;  1M45 A;  3AKB A;  1ZUZ A;  1RRO A;  1LKJ A;  3O2P A;  4GPL B;  1CLM A;  1F55 A;  1TRF A;  1SCM C;  1K90 D;  1L2O B;  1QJT A;  1UWO A;  1KK7 Z;  2IS9 A;  1NUB A;  1B47 A;  3GOF A;  3AKA A;  4ICB A;  1JC2 A;  2AMI A;  5DKR A;  2MHH A;  2NZ0 A;  3DVM A;  3D10 A;  1K96 A;  1BOD A;  1GJY A;  2M0R A;  5AFP A;  4UPG A;  5ER4 X;  2EGD A;  1TOP A;  2PMY A;  1B8C A;  1UHI A;  4A4C A;  1SKT A;  3LL8 B;  4PHJ A;  4AOM A;  5KSZ A;  4I5L B;  2LMV A;  3A4U B;  1UHN A;  1CKK A;  1F71 A;  3BUX B;  4A4B A;  5HLV A;  2KFG A;  1XFZ O;  1MHO A;  1JFK A;  3TUY C;  2LC5 A;  1K2H A;  1UHJ A;  2LVV A;  2FOT A;  1TCO B;  2GGZ A;  5HKW A;  3ICB A;  2OTG C;  1B9A A;  1QTX A;  2BEC A;  4IL1 A;  1F54 A;  1QV1 A;  1XK4 C;  2CCM A;  5CSF A;  2Q4U A;  4N1F A;  3TDZ A;  3FWB A;  4MRX A;  1PUL A;  4I5K A;  4NQG A;  2LCP A;  1KFU L;  1NX3 A;  1NYA A;  3JTD B;  1BF5 A;  1Y6W A;  2K7B A;  1KQV A;  2O60 A;  1DJX A;  1EH2 A;  1J7P A;  1NCZ A;  1M63 B;  1TIZ A;  2K7C A;  2KOT A;  5KU1 A;  4BY4 A;  1DT7 B;  1NWD A;  2G2B A;  1C7W A;  3BQ3 A;  2CT9 A;  3FIA A;  2NCP A;  1R2U A;  1JSA A;  3PN7 B;  1F4O A;  1IQ5 A;  2LE9 B;  2MJW B;  2K7O A;  4OKH A;  1NPQ A;  1SPY A;  4PE1 A;  4DIR A;  2I18 A;  1SRA A;  2KFH A;  1CM4 A;  1KQM B;  1WRL A;  3EK4 A;  4PHK A;  1XFU O;  2MLF C;  1CLL A;  1B1G A;  3OB1 B;  1EG4 A;  1G4Y R;  1NCY A;  2AAO A;  4GUK A;  2OS8 B;  1J1E A;  4M2Q A;  1CLB A;  4YRU A;  1SMG A;  1AP4 A;  3NSO A;  3M0W A;  1ZOT B;  4AQJ A;  4I5N B;  1DF0 A;  3O78 A;  1OZS A;  3DVK A;  1J55 A;  3D0Y B;  2KAV A;  3TDU A;  3SG4 A;  3IF7 A;  3JVT B;  5AAN A;  1BU3 A;  2Y1N A;  3KHE A;  2ZFD A;  2CNP A;  1RWY A;  2M7L A;  1A03 A;  1JFJ A;  2M1K B;  2WCF A;  1WLM A;  1DTL A;  4NDB A;  3BUN B;  2LLU A;  4YBH B;  2E30 A;  3LCP C;  4USL A;  2E6W A;  2Y4Q A;  3I5H B;  2JC2 A;  2WND A;  1L7Z A;  2CBL A;  1F70 A;  3I5I B;  2EC6 B;  2JU0 A;  3WNX B;  2LMU A;  2WOR A;  4GGN A;  2L4H A;  2LUX A;  2F33 A;  4PE7 A;  1KFU S;  4AQI A;  1S1E A;  3EK7 A;  1V1G A;  2NCO A;  3JTD C;  3KEV A;  2JPT A;  3BOW B;  4N5X A;  2JXC A;  1GGW A;  3C1V A;  2F2P A;  2K2A A;  1YX8 A;  2KYC A;  5ER5 A;  4MZK A;  2B1U A;  1SCV A;  1WLZ A;  4I5J A;  5DKQ A;  1W7J B;  3IQO A;  1PVA A;  1CDM A;  5HKY A;  3BYA A;  4PHN A;  5BPJ A;  1ODB A;  4MBE A;  5I2L A;  1QX2 A;  2ZN9 A;  1XFY O;  2LHI A;  1EJ3 A;  2K8M B;  1WDC C;  1PVB A;  3RLZ A;  1QX7 A;  1FBV A;  2H61 A;  3DF0 A;  4GGF C;  4YI8 A;  1M31 A;  2OS8 C;  1DJW A;  3CWG A;  5AER A;  1AK8 A;  1GQM A;  3I5F C;  4QJ4 B;  1KWO B;  2BL0 B;  2LVJ A;  3PFV A;  1PSR A;  1SL9 A;  1J7R A;  2F2O A;  1A2X A;  1DGU A;  2HF5 A;  3TS5 B;  3VRP A;  1EG3 A;  1K93 D;  2LV7 A;  5K89 A;  1LA3 A;  2KI4 B;  2D8N A;  4GNK B;  1ALW A;  2KGB C;  3CS1 A;  2Q91 A;  3EKH A;  2ZND A;  4MLW A;  1DJH A;  3I5H C;  3DF0 B;  1NCX A;  2AUC A;  2VRG A;  4QJ3 B;  3VRN A;  2ZRS A;  4XJK A;  4C0K A;  1KSO A;  3SG2 A;  2Y1M A;  1QX5 B;  4CLN A;  2L5X B;  3PAT A;  3VGO A;  1BJF A;  1K8U A;  3AAJ A;  3CGA A;  1NX0 A;  3KO0 A;  4N1G A;  2KI6 C;  3KPX A;  1FI5 A;  1XFX O;  1ZAC A;  1S5G Y;  1CM1 A;  2M29 A;  1PSB A;  2KFF A;  1U5I A;  1B7T Y;  2JXL A;  2JTT A;  3I5G B;  4MRY A;  2GGM A;  4ORB B;  1SL7 A;  3IQQ A;  1IQ3 A;  5CSI A;  4XJK B;  4MN0 A;  2F3Z A;  1S26 D;  4DRW A;  1CMG A;  1YVH A;  2KGR A;  1QVI Z;  1BG1 A;  2HPS A;  3SIB A;  1SY9 A;  4JQ0 D;  1AVS A;  1CTR A;  3SG3 A;  1SBJ A;  3CR5 X;  2GV5 A;  4PHM A;  2G9B A;  4CFR A;  1U5I B;  1KK7 Y;  1IJ6 A;  2FCD A;  1FW4 A;  1NIW A;  3ZNI A;  1CFF A;  3K21 A;  1K9K A;  1NX1 A;  2H2K A;  2KNE A;  5D69 A;  1SR6 B;  4M2O A;  1B8R A;  4YGC B;  1UUR A;  1M39 A;  1B4C A;  1LIN A;  4ZCU A;  2I94 A;  2PAL A;  2LVI A;  5CSN A;  2RGI A;  1L2O C;  1XFV O;  1A75 A;  2BKI B;  3D0Y A;  3EK8 A;  3SIA A;  5AXI A;  2F8P A;  4YI9 A;  1XA5 A;  1B8L A;  2H61 C;  2BBN A;  1YUS A;  2K0J A;  2LLS A;  3BUW B;  3OX6 A;  4DCK A;  4PE0 A;  1WRK A;  3CR4 X;  3EVV A;  1C07 A;  1K9U A;  1QXP A;  2M9G A;  4OVN F;  2I7A A;  1F4Q A;  1QLK A;  1TNW A;  1XVJ A;  3BUM B;  4JWQ A;  1IH0 A;  2M49 B;  3DVJ A;  4HRG A;  1PK0 D;  2L98 A;  1K95 A;  1N2D A;  1QIV A;  2ZRT A;  4C0L A;  4GAO A;  4ZCV A;  1J1D A;  3DD4 A;  1A75 B;  1IJ5 A;  1M46 A;  1S3P A;  3NXA A;  2TN4 A;  1A4P A;  3BOW A;  1DJI A;  2WOS A;  1UHK A;  3BXK A;  3FS7 A;  4PAL A;  2KHN A;  1CDN A;  1MXL C;  1WRZ A;  1XYD A;  4HSZ A;  4YGE B;  2JQ6 A;  1QS7 A;  3WXA A;  4CID A;  3F45 A;  1QV0 A;  2FJU B;  1QLS A;  3RM1 A;  4M2P A;  1KK8 B;  2LUC A;  1XFW O;  1KCY A;  1UUS A;  2LLT A;  1AUI B;  3CZT X;  1D1O A;  1TTX A;  4HRE E;  1YRT B;  3VRQ A;  5AEQ A;  1OMD A;  2Y5I A;  1OSA A;  2JT3 A;  1CDL A;  1GGZ A;  3NSK A;  4OR9 B;  4BY5 A;  1TNQ A;  1Y1U A;  2KAX A;  5B8I B;  5I2Q A;  1SCM B;  1K94 A;  2JWW A;  1S6J A;  3PN7 C;  5TNC A;  4DUQ A;  1YUR A;  1IWQ A;  5I2O A;  1AJ5 A;  1YRU B;  4MVF A;  2M3W A;  1DJZ A;  4L9M A;  1KQM C;  2HQ8 A;  2BCA A;  2KYF A;  5HKZ A;  3CR2 A;  2M8U A;  3OX5 A;  4MZL A;  3O6B A;  1G8I A;  2F3Y A;  4NDC A;  1LVC D;  3NSL A;  1MR8 A;  1TCF A;  1EXR A;  1MF8 B;  4C0J A;  2NLN A;  3DVE A;  2CTN A;  1NP8 A;  1HQV A;  2JTZ A;  3VRO A;  4R1E A;  1JF2 A;  1VRK A;  1YUU A;  2JNX A;  3NSI A;  1R6P A;  3A8R A;  1SL8 A;  1CMF A;  1SW8 A;  1SYM A;  3TUY B;  1MXE A;  1IKU A;  1A29 A;  4D1E A;  2HQW A;  5PAL A;  1H8B A;  2BE4 A;  2WCE A;  1BLQ A;  2EHB A;  3JVT C;  1J7Q A;  3PLF B;  2M7N A;  3PM8 A;  4FQO A;  2OTG B;  3OHM B;  4PDZ A;  3ZWH A;  1DJY A;  2L50 A;  1YVL A;  3LK1 A;  4WQ3 A;  1YTZ C;  2ZKM X;  1QAS A;  1YR5 A;  1FI6 A;  3GK1 A;  4U8D A;  3I5I C;  2LVK A;  2EC6 C;  3WHU B;  1TNP A;  3GK4 X;  4E68 A;  5I8N A;  3MSE B;  1OQP A;  1JF0 A;  1N0Y A;  1YUT A;  1BT6 A;  5HLO A;  2KBM A;  2ZNE A;  2BBM A;  5CPV A;  2LAP A;  3KF9 A;  5JOL A;  1LA0 A;  4QJ5 B;  3SG5 A;  1W7I B;  1CB1 A;  1BOC A;  1TNX A;  3EVR A;  1AHR A;  2SCP A;  1BMO A;  3CTN A;  2KQY A;  1V1F A;  5J3X A;  1S6I A;  1QAT A;  1PAL A;  5IBW A;  3CLN A;  2L0P A;  4MSP A;  2JT0 A;  2WC8 A;  4CPV A;  1S6C A;  1DJG A;  2KBI A;  2LAN A;  1G33 A;  2M97 A;  1KFX L;  4MZJ A;  4WQ2 A;  2P6B B;  1KWO C;  2BL0 C;  2LM5 A;  1Y1X A;  2MA2 A;  5D7F A;  1REC A;  3TS5 C;  4MEW A;  1ZMZ A;  1DMO A;  4ORC B;  5HYD A;  1RFJ A;  2KI4 C;  1XO5 A;  3TDI A;  5G08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...