3S0AA

Apis mellifera obp14, native apo-protein
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
119
structure length
119
Chain Sequence
MTIEELKTRLHTEQSVCKTETGIDQQKANDVIEGNIDVEDKKVQLYCECILKNFNILDKNNVFKPQGIKAVMELLIDENSVKQLVSDCSTISEENPHLKASKLVQCVSKYKTMKSVDFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords OBP14
publication title Crystal structure of Apis mellifera OBP14, a C-minus odorant-binding protein, and its complexes with odorant molecules.
pubmed doi rcsb
source organism Apis mellifera
total genus 49
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3s0aA00
2WC5A 3CZ2A 3R1PA 4JD9A 3D77A 3B88A 3FE6A 1TUJA 3L47A 3B6XA 3BFAA 1OOGA 2H8VA 3S0EA 3R72A 5EL2A 2P71A 1OOFA 3NGVA 4PT1A 3PJIA 3FE9A 3NHTA 1P28A 2QEBA 2FJYA 3VB1A 3B87A 1OOIX 4F7FA 3L4AA 1C3YA 3BFHA 1TWOA 2WC6A 3D74A 4INXA 1DQEA 3CZ1A 3QMEA 2QEHA 2JPOA 2PQLA 1QWVA 1LS8A 2GTEA 2KPHA 3K1EA 2WCLA 2QEOA 2QEVA 3Q8IA 4INWA 1GM0A 1OW4A 3S0FA 3BJHA 2WCKA 3DY9A 3FE8A 4OZDA 3CYZA 3DXLA 2P70A 2WCMA 3L4LA 3V2LA 1ORGA 2QDIA 3OGNA 2WCHA 3S0AA 3NHIA 3B86A 3CDNA 3BFBA 1XFRA 3CZ0A 4FQTA 3S0DA 3R1OA 3B7AA 5DICA 3D73A 3DZTA 1C3ZA 1T14A 3S0BA 2ERBA 3D76A 3R1VA 3RZSA 2L2CA 3D78A 3S0GA 3D75A 3DYEA 2WCJA 3CABA 1OOHA 3N7HA
chains in the Genus database with same CATH superfamily
1TTXA 2PALA 4JKTA 2F8PA 3CR2A 1M39A 4U8DA 1MXEA 2YGUA 2G2BA 2H61C 5JOLA 2PMYA 3TS5C 1QX7A 1SYMA 2LANA 3FIAA 4M2PA 1DGVA 2LLSA 1GGZA 4MBEA 1K90D 2WC8A 4YGAA 2LLUA 4MRYA 5D3OA 1GGWA 1L7ZA 3FWBA 1OOGA 1Y0VH 2DOQA 1DJGA 1QIWA 3BUMB 4GGNA 2H8VA 4R1EA 3PATA 2NCOA 5F6TA 1K9UA 3O2PA 3O4YA 3SJSA 3GK1A 5HYDA 1NX0A 1QVIZ 4Q04A 1WY9A 2FOTA 3O6BA 2KI6C 4WRIA 2K7CA 1UHHA 1J1EA 4N5XA 3NHTA 1P28A 2L0PA 1N2DA 1Q80A 4MZLA 3TUYB 2KNEA 2KYFA 4MEWA 1Y1UA 3B87A 1DJYA 1NYAA 1PRWA 3BQ3A 5D7FA 3L4AA 3A8RA 5AERA 1CFPA 1OSAA 2KI6D 3SS3A 3BFHA 1J7RA 2M0RA 1B8RA 1J55A 1UHIA 3CS1A 1TWOA 2WC6A 3KHEA 4WQ2A 5DKRA 4BY5A 1BJFA 1QLSA 2WCFA 5AANA 2KAXA 1S5GY 1YURA 5AXIA 2K7DA 4N1FA 1J7QA 4CFRA 1OMRA 1LA3A 3PN7B 1C07A 2M1KB 1KK8B 1QV1A 1QWVA 2GGZA 3UNWA 1DF0A 1EJ3A 3D0YA 1XK4A 2QEOA 1EH2A 3Q8IA 2BNXA 1QVIY 1S6CA 2F33A 2JT8A 3AAJA 1JBAA 1C7VA 1CFCA 1SBJA 3CWGA 4PE4A 2KFHA 2JNXA 2KQ6A 4ZCUA 2WCKA 2LNKA 1DT7B 1BF5A 3RM1A 2HQ8A 1W7IB 3RLZA 1J7OA 4AQIA 2WCMA 1UWOA 1AUIB 3L4LA 3EVRA 1K96A 1AP4A 2LMUA 3C1VA 4CLNA 4F0ZB 1ORGA 4MN0A 2KFFA 2ZKMX 3OX5A 1H8BA 4ICBA 3KPXA 1KK7Y 2OPOA 2QDIA 1SNLA 3OX6A 2EHBA 1BOCA 2WCHA 1W9ZA 1EXRA 2I2RE 3ICBA 2M1UA 4AOMA 3S0AA 2JULA 2LM5A 1QS7A 2BKIB 2M97A 3BFBA 3CZ0A 1KSOA 4PE7A 3TUYC 3S0DA 3R1OA 1PULA 1CKKA 1KSMA 2L4IA 1TNWA 3LCPC 2M29A 2L98A 4YI8A 3HCMA 4YGDB 2K60A 1U5IA 2KAVA 5DICA 5FI2A 1Y1XA 1KQVA 1XYDA 2QACA 4HSZA 3DZTA 4L9MA 4YRUA 2LVJA 2MBXA 3SG5A 1IJ5A 1T14A 3S0BA 2ZFDA 4A4CA 4M2OA 2KLEA 1UURA 2LVIA 2ERBA 4KYNA 4PHMA 3D76A 1OZSA 2BKHB 3SS5A 1IQ3A 1TCFA 1DELA 1M63B 3EKHA 1KK8C 5DKQA 2LAPA 1M31A 1DJWA 2BL0B 3DYEA 1SR6C 2BE6A 3KO0A 2WCJA 1PALA 1B7TZ 1DJHA 2HETA 2V53A 3N7HA 3IF7A 1H4BA 2KGBC 3CZ2A 1MHOA 4GFTA 5HKWA 3LK1A 4QJ5B 1F71A 2K8MB 2LHLA 3GK2A 3IQOA 3SS4A 2BECA 2L50A 4P5OE 1NP8A 2LLTA 3KEVA 3BFAA 2ZNDA 5GQQC 1F54A 5CSNA 1MUXA 1ZFSA 3DF0A 3TDUA 5HKZA 1NCZA 2BAPA 2R2IA 2CXJA 2M8UA 2M3WA 3BUWB 3BOWA 4ZCVA 4C0KA 1JC2A 2FCDA 2WNDA 3QRXA 2Q91A 1NX2A 3OP0A 1OE9B 4I5NB 2M9GA 5D69A 5IBWA 2OTGB 1QXPA 2KLDA 1DJXA 2JC2A 1AHRA 2FJYA 1TUZA 4ORCB 1CDLA 2G9BA 1OOIX 2O5GA 2B1UA 1AK8A 1S36A 2QPTA 3D74A 2F2PA 2LVKA 4UPGA 1W7JB 1S1EA 2JXLA 2JXCA 1DVIA 1S26D 3CZ1A 1AJ4A 3QMEA 3A4UB 4GGFC 1SW8A 4M2QA 4XJKB 2JPOA 1TN4A 3SIAA 4MZJA 2GTEA 1EL4A 2BL0C 1SL7A 1IRJA 1DGUA 1BG1A 4OCIA 2JWWA 1G33A 1IG5A 4INWA 2JOJA 2MLFC 4I5LB 2L2EA 4CFQA 2JQ6A 1PVAA 3FS7A 2JTZA 1IQ5A 2JZIA 4D1EA 2KOTA 2LE9B 1A4PA 1B8LA 3DD4A 4GAOA 3K21A 3VRQA 3H4SE 3BYAA 3V2LA 1F70A 1UHNA 1MQ1A 1A29A 1LXFC 1NX3A 1AJ5A 1N0YA 2H61A 1R2UA 4NDBA 1B9AA 1KQMB 5KSZA 3I5HB 4IJ7A 3KF9A 3OGNA 2HF5A 3OBVA 2PASA 3NHIA 3B86A 1OZOA 1NCYA 2OTGC 4MZKA 5PALA 3CDNA 1CLMA 3CZTX 1ZMZA 4PCWA 1UHJA 3DF0B 1EG3A 2LVVA 3DVEA 2RGIA 1QX2A 2WCBA 2L51A 2WOSA 1DJZA 2LUCA 1A75B 5KU1A 5J3XA 1IJ6A 3D73A 5I2QA 4C0JA 1L2OB 1YVHA 1G8IA 1HQVA 2NZ0A 2IS9A 4DUQA 1WRKA 4MVFA 1UUSA 3AKAA 2LCPA 1BODA 2CBLA 2K0JA 1IKUA 3WNXB 1B47A 4ETOA 3S0GA 2LMTA 3D75A 1JFJA 4I5JA 2CCMA 1YUSA 2PRUA 1IIOA 1SK6D 5DKNA 2L5YA 4MRXA 5AFPA 3SG2A 2VRGA 1OQPA 4JD9A 1PSBA 3HX4A 5CPVA 5JJGA 1C7WA 1AVSA 3FE6A 3VRPA 1CB1A 1BU3A 1CMFA 3L47A 1PK0D 3B6XA 3VROA 1K9KA 2JPTA 2L4HA 1BR4B 1KWOB 1TNPA 1CDNA 1SY9A 1CM1A 4NQGA 4QJ4B 2K7BA 2M49B 1B1GA 1RK9A 1YUTA 1KQMC 5EL2A 3PN7C 1WDCB 2JRFA 1KFXS 1SMGA 5ER5A 1CLBA 3I5HC 2KI4B 1OOFA 1WRZA 1HT9A 1J1DA 2OS8B 3EVUA 3PJIA 2Y1MA 4YGBB 3SG7A 2KYCA 1NIWA 2O60A 5B8IB 1JFKA 1A2XA 1YUUA 1K93D 2ISDA 2JTTA 2QEBA 1QV0A 4CPVA 4PE0A 2A4JA 3BUNB 1YRUB 4F7FA 1C3YA 2L5XB 3IQQA 5FI6A 3VRRA 1CFFA 1F4QA 1L2OC 1DF0B 1OMVA 3D0YB 3VRNA 3I5IB 1B4CA 2MLEC 3BXKA 3PALA 2F2OA 4INXA 1QLKA 2JNFA 1SKTA 2K2FA 3CR4X 3ZNIA 2QEHA 2LUXA 1S6IA 2KBMA 3E3RA 2AMIA 1X02A 3D10A 1QASA 4A4BA 1KFUS 1LS8A 1BLQA 2KPHA 3TDIA 1LKJA 2WCLA 3PM8A 2KFGA 1SCVA 5HLVA 1ZUZA 2K2AA 1RJVA 3F45A 1IWQA 1QX5B 3PLFB 1YX8A 1GM0A 5I2OA 2ZNEA 1CFDA 3EVVA 1QATA 2COLB 1XFZO 1XFWO 1Y6WA 1B7TY 2WCEA 1RFJA 1M45A 2F3ZA 3I5FB 3CR5X 4OZDA 4DRWA 1B8CA 5HL1A 3CYZA 3DXLA 2KAYA 4CIDA 1SL8A 2BCAA 2D8NA 1LA0A 1OOJA 1RWYA 4MSPA 1KWOC 1QJTA 1DTLA 3IVTA 3UO9A 3JTDB 1SCMB 2JU0A 1EG4A 2Q4UA 4GUKA 4HRHA 1CMGA 1YRTB 2FCEA 2KGRA 1LVCD 2HPSA 3GOFA 4IL1A 2NCPA 4OKHA 4OV2A 3DVMA 2Y4QA 2KI4C 1N65A 1ALWA 1UHKA 2MHHA 3O4XA 1U5IB 2CNPA 1NPQA 2PVBA 2JT0A 1VRKA 1Z2CB 3MSEB 4PHJA 5HLOA 4MLWA 3CTNA 3NSOA 3TDZA 3OHMB 2WORA 3WHUB 3AAKA 4YGCB 1XFRA 1F55A 4GBAA 1LINA 2Y5IA 4YGEB 1FPWA 1S5GZ 2EC6B 4JWQA 5I8NA 2EGDA 2BE4A 1JWDA 1V1FA 3I5IC 1XK4C 4HRGA 1NCXA 3O78A 1K94A 1MWNA 1YVLA 2BBMA 2ZRTA 3EK8A 1CNPA 1SRAA 1JUOA 2I18A 2LC5A 4FTGA 1CM4A 1XFVO 4AQJA 4JPZB 3EG5B 2L2CA 3RZSA 1F4OA 2BCBA 2GV5A 1QTXA 4PALA 5TNCA 4C0LA 1ALVA 1NX1A 1SL9A 1TRFA 3CABA 2F3YA 2Y1NA 2K7OA 3NSIA 4USLA 4YBHB 1YX7A 3LK0A 3BUXB 4GGFA 1FI5A 5K89A 1JF0A 2PYQA 2WC5A 3JVTB 3R1PA 4QJ3B 1XFXO 3DVKA 3M0WA 4BY4A 3EK4A 1TOPA 3D77A 3GK4X 1JSAA 3B88A 3AKBA 5I94A 1TUJA 3BOWB 1DJIA 1SSEB 2I7AA 1PSRA 3BUOB 3I5FC 3SG3A 1F8HA 1G4YR 1IGVA 1DEKA 4ORAB 5ER4X 3EK7A 1FI6A 2H2KA 1KK7Z 3CGAA 1UP5A 2ZN9A 3JTDC 4PE1A 1SCMC 2MRDA 2HQWA 1NSHA 2E30A 2M7NA 3S0EA 1M46A 3SIBA 1CTRA 3R72A 1MR8A 4WQ3A 2P71A 1SR6B 4GNKB 4PHNA 2M7LA 3SG4A 3NGVA 4PT1A 3WHTB 1XFUO 2SASA 5KTYA 3VGOA 1NUBA 4E68A 3FE9A 1RECA 2CT9A 2NLNA 1XO5A 1Z4HA 2AUCA 3PSRA 4I5KA 3CLNA 4OR9B 2BCXA 3VB1A 1QIVA 1DC1A 1YTZC 2EC6C 3OB1B 3LLEA 1WLZA 1CLLA 2KBIA 5FI7A 2P6BB 3ZWHA 1DQEA 1S3PA 1GQMA 1KFXL 3NSLA 4NDDA 3NSKA 1FW4A 2TN4A 1OMDA 2ZRSA 5CSIA 2PQLA 2KDHA 1FF1A 3TZ1A 3K1EA 5AEQA 1PVBA 1MF8B 1RTP1 4N1GA 2QEVA 1TNQA 3I5GB 1K9PA 1XFYO 1J7PA 1XVJA 1MXLC 5I2LA 1NWDA 2K61A 1TIZA 1K95A 5G08A 1OW4A 1Y1AA 4XJKA 1WRLA 4DIRA 3JVTC 3FWCA 3S0FA 2SCPA 1JF2A 1BT6A 2MA2A 3BJHA 3TS5B 3DY9A 2FJUB 3FE8A 4PHKA 4FQOA 1IH0A 2PSRA 2P70A 4TNCA 2KQYA 5CSFA 2LMVA 1E8AA 1SPYA 1DMOA 1KFUL 1CDPA 2LV7A 2MJWB 1K2HA 1CDMA 3LL8B 2KHNA 2MAZA 1S6JA 2E6WA 5HKYA 4P2YB 5BPJA 4HREE 1R6PA 4GPLB 1WLMA 2CTNA 4NDCA 5CSJA 2NXQA 3NXAA 1TCOB 1ZOTB 4XYNA 1ZACA 2LP2A 1FBVA 1KCYA 3OB2B 4FQTA 1GJYA 1ODBA 5FYXA 3B7AA 1YR5A 4JQ0D 4DCKA 3DVJA 2LHIA 1V1GA 2I94A 3PFVA 2LP3A 4YI9A 4PDZA 1RROA 1A03A 2GGMA 1C3ZA 1D1OA 1TNXA 3PM2A 4DS7A 3R1VA 1XA5A 1A75A 1BR1B 2ZN8A 2AAOA 3D78A 1WDCC 2JT3A 3SG6A 3WXAA 2BBNA 2OS8C 3I5GC 1BMOA 4OVNF 4ORBB 1OOHA 3EKJA 2KSPA 1K8UA
chains in the Genus database with same CATH topology
2WC5A 3CZ2A 3R1PA 4JD9A 3D77A 3B88A 3FE6A 1TUJA 3L47A 3B6XA 3BFAA 1OOGA 2H8VA 3S0EA 3R72A 5EL2A 2P71A 1OOFA 3NGVA 4PT1A 3PJIA 3FE9A 3NHTA 1P28A 2QEBA 2FJYA 3VB1A 3B87A 1OOIX 4F7FA 3L4AA 1C3YA 3BFHA 1TWOA 2WC6A 3D74A 4INXA 1DQEA 3CZ1A 3QMEA 2QEHA 2JPOA 2PQLA 1QWVA 1LS8A 2GTEA 2KPHA 3K1EA 2WCLA 2QEOA 2QEVA 3Q8IA 4INWA 1GM0A 1OW4A 3S0FA 3BJHA 2WCKA 3DY9A 3FE8A 4OZDA 3CYZA 3DXLA 2P70A 2WCMA 3L4LA 3V2LA 1ORGA 2QDIA 3OGNA 2WCHA 3S0AA 3NHIA 3B86A 3CDNA 3BFBA 1XFRA 3CZ0A 4FQTA 3S0DA 3R1OA 3B7AA 5DICA 3D73A 3DZTA 1C3ZA 1T14A 3S0BA 2ERBA 3D76A 3R1VA 3RZSA 2L2CA 3D78A 3S0GA 3D75A 3DYEA 2WCJA 3CABA 1OOHA 3N7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WC5 A;  3CZ2 A;  3R1P A;  4JD9 A;  3D77 A;  3B88 A;  3FE6 A;  1TUJ A;  3L47 A;  3B6X A;  3BFA A;  1OOG A;  2H8V A;  3S0E A;  3R72 A;  5EL2 A;  2P71 A;  1OOF A;  3NGV A;  4PT1 A;  3PJI A;  3FE9 A;  3NHT A;  1P28 A;  2QEB A;  2FJY A;  3VB1 A;  3B87 A;  1OOI X;  4F7F A;  3L4A A;  1C3Y A;  3BFH A;  1TWO A;  2WC6 A;  3D74 A;  4INX A;  1DQE A;  3CZ1 A;  3QME A;  2QEH A;  2JPO A;  2PQL A;  1QWV A;  1LS8 A;  2GTE A;  2KPH A;  3K1E A;  2WCL A;  2QEO A;  2QEV A;  3Q8I A;  4INW A;  1GM0 A;  1OW4 A;  3S0F A;  3BJH A;  2WCK A;  3DY9 A;  3FE8 A;  4OZD A;  3CYZ A;  3DXL A;  2P70 A;  2WCM A;  3L4L A;  3V2L A;  1ORG A;  2QDI A;  3OGN A;  2WCH A;  3S0A A;  3NHI A;  3B86 A;  3CDN A;  3BFB A;  1XFR A;  3CZ0 A;  4FQT A;  3S0D A;  3R1O A;  3B7A A;  5DIC A;  3D73 A;  3DZT A;  1C3Z A;  1T14 A;  3S0B A;  2ERB A;  3D76 A;  3R1V A;  3RZS A;  2L2C A;  3D78 A;  3S0G A;  3D75 A;  3DYE A;  2WCJ A;  3CAB A;  1OOH A;  3N7H A; 
#chains in the Genus database with same CATH topology
 1TTX A;  2PAL A;  4JKT A;  2F8P A;  3CR2 A;  1M39 A;  4U8D A;  1MXE A;  2YGU A;  2G2B A;  2H61 C;  5JOL A;  2PMY A;  3TS5 C;  1QX7 A;  1SYM A;  2LAN A;  3FIA A;  4M2P A;  1DGV A;  2LLS A;  1GGZ A;  4MBE A;  1K90 D;  2WC8 A;  4YGA A;  2LLU A;  4MRY A;  5D3O A;  1GGW A;  1L7Z A;  3FWB A;  1OOG A;  1Y0V H;  2DOQ A;  1DJG A;  1QIW A;  3BUM B;  4GGN A;  2H8V A;  4R1E A;  3PAT A;  2NCO A;  5F6T A;  1K9U A;  3O2P A;  3O4Y A;  3SJS A;  3GK1 A;  5HYD A;  1NX0 A;  1QVI Z;  4Q04 A;  1WY9 A;  2FOT A;  3O6B A;  2KI6 C;  4WRI A;  2K7C A;  1UHH A;  1J1E A;  4N5X A;  3NHT A;  1P28 A;  2L0P A;  1N2D A;  1Q80 A;  4MZL A;  3TUY B;  2KNE A;  2KYF A;  4MEW A;  1Y1U A;  3B87 A;  1DJY A;  1NYA A;  1PRW A;  3BQ3 A;  5D7F A;  3L4A A;  3A8R A;  5AER A;  1CFP A;  1OSA A;  2KI6 D;  3SS3 A;  3BFH A;  1J7R A;  2M0R A;  1B8R A;  1J55 A;  1UHI A;  3CS1 A;  1TWO A;  2WC6 A;  3KHE A;  4WQ2 A;  5DKR A;  4BY5 A;  1BJF A;  1QLS A;  2WCF A;  5AAN A;  2KAX A;  1S5G Y;  1YUR A;  5AXI A;  2K7D A;  4N1F A;  1J7Q A;  4CFR A;  1OMR A;  1LA3 A;  3PN7 B;  1C07 A;  2M1K B;  1KK8 B;  1QV1 A;  1QWV A;  2GGZ A;  3UNW A;  1DF0 A;  1EJ3 A;  3D0Y A;  1XK4 A;  2QEO A;  1EH2 A;  3Q8I A;  2BNX A;  1QVI Y;  1S6C A;  2F33 A;  2JT8 A;  3AAJ A;  1JBA A;  1C7V A;  1CFC A;  1SBJ A;  3CWG A;  4PE4 A;  2KFH A;  2JNX A;  2KQ6 A;  4ZCU A;  2WCK A;  2LNK A;  1DT7 B;  1BF5 A;  3RM1 A;  2HQ8 A;  1W7I B;  3RLZ A;  1J7O A;  4AQI A;  2WCM A;  1UWO A;  1AUI B;  3L4L A;  3EVR A;  1K96 A;  1AP4 A;  2LMU A;  3C1V A;  4CLN A;  4F0Z B;  1ORG A;  4MN0 A;  2KFF A;  2ZKM X;  3OX5 A;  1H8B A;  4ICB A;  3KPX A;  1KK7 Y;  2OPO A;  2QDI A;  1SNL A;  3OX6 A;  2EHB A;  1BOC A;  2WCH A;  1W9Z A;  1EXR A;  2I2R E;  3ICB A;  2M1U A;  4AOM A;  3S0A A;  2JUL A;  2LM5 A;  1QS7 A;  2BKI B;  2M97 A;  3BFB A;  3CZ0 A;  1KSO A;  4PE7 A;  3TUY C;  3S0D A;  3R1O A;  1PUL A;  1CKK A;  1KSM A;  2L4I A;  1TNW A;  3LCP C;  2M29 A;  2L98 A;  4YI8 A;  3HCM A;  4YGD B;  2K60 A;  1U5I A;  2KAV A;  5DIC A;  5FI2 A;  1Y1X A;  1KQV A;  1XYD A;  2QAC A;  4HSZ A;  3DZT A;  4L9M A;  4YRU A;  2LVJ A;  2MBX A;  3SG5 A;  1IJ5 A;  1T14 A;  3S0B A;  2ZFD A;  4A4C A;  4M2O A;  2KLE A;  1UUR A;  2LVI A;  2ERB A;  4KYN A;  4PHM A;  3D76 A;  1OZS A;  2BKH B;  3SS5 A;  1IQ3 A;  1TCF A;  1DEL A;  1M63 B;  3EKH A;  1KK8 C;  5DKQ A;  2LAP A;  1M31 A;  1DJW A;  2BL0 B;  3DYE A;  1SR6 C;  2BE6 A;  3KO0 A;  2WCJ A;  1PAL A;  1B7T Z;  1DJH A;  2HET A;  2V53 A;  3N7H A;  3IF7 A;  1H4B A;  2KGB C;  3CZ2 A;  1MHO A;  4GFT A;  5HKW A;  3LK1 A;  4QJ5 B;  1F71 A;  2K8M B;  2LHL A;  3GK2 A;  3IQO A;  3SS4 A;  2BEC A;  2L50 A;  4P5O E;  1NP8 A;  2LLT A;  3KEV A;  3BFA A;  2ZND A;  5GQQ C;  1F54 A;  5CSN A;  1MUX A;  1ZFS A;  3DF0 A;  3TDU A;  5HKZ A;  1NCZ A;  2BAP A;  2R2I A;  2CXJ A;  2M8U A;  2M3W A;  3BUW B;  3BOW A;  4ZCV A;  4C0K A;  1JC2 A;  2FCD A;  2WND A;  3QRX A;  2Q91 A;  1NX2 A;  3OP0 A;  1OE9 B;  4I5N B;  2M9G A;  5D69 A;  5IBW A;  2OTG B;  1QXP A;  2KLD A;  1DJX A;  2JC2 A;  1AHR A;  2FJY A;  1TUZ A;  4ORC B;  1CDL A;  2G9B A;  1OOI X;  2O5G A;  2B1U A;  1AK8 A;  1S36 A;  2QPT A;  3D74 A;  2F2P A;  2LVK A;  4UPG A;  1W7J B;  1S1E A;  2JXL A;  2JXC A;  1DVI A;  1S26 D;  3CZ1 A;  1AJ4 A;  3QME A;  3A4U B;  4GGF C;  1SW8 A;  4M2Q A;  4XJK B;  2JPO A;  1TN4 A;  3SIA A;  4MZJ A;  2GTE A;  1EL4 A;  2BL0 C;  1SL7 A;  1IRJ A;  1DGU A;  1BG1 A;  4OCI A;  2JWW A;  1G33 A;  1IG5 A;  4INW A;  2JOJ A;  2MLF C;  4I5L B;  2L2E A;  4CFQ A;  2JQ6 A;  1PVA A;  3FS7 A;  2JTZ A;  1IQ5 A;  2JZI A;  4D1E A;  2KOT A;  2LE9 B;  1A4P A;  1B8L A;  3DD4 A;  4GAO A;  3K21 A;  3VRQ A;  3H4S E;  3BYA A;  3V2L A;  1F70 A;  1UHN A;  1MQ1 A;  1A29 A;  1LXF C;  1NX3 A;  1AJ5 A;  1N0Y A;  2H61 A;  1R2U A;  4NDB A;  1B9A A;  1KQM B;  5KSZ A;  3I5H B;  4IJ7 A;  3KF9 A;  3OGN A;  2HF5 A;  3OBV A;  2PAS A;  3NHI A;  3B86 A;  1OZO A;  1NCY A;  2OTG C;  4MZK A;  5PAL A;  3CDN A;  1CLM A;  3CZT X;  1ZMZ A;  4PCW A;  1UHJ A;  3DF0 B;  1EG3 A;  2LVV A;  3DVE A;  2RGI A;  1QX2 A;  2WCB A;  2L51 A;  2WOS A;  1DJZ A;  2LUC A;  1A75 B;  5KU1 A;  5J3X A;  1IJ6 A;  3D73 A;  5I2Q A;  4C0J A;  1L2O B;  1YVH A;  1G8I A;  1HQV A;  2NZ0 A;  2IS9 A;  4DUQ A;  1WRK A;  4MVF A;  1UUS A;  3AKA A;  2LCP A;  1BOD A;  2CBL A;  2K0J A;  1IKU A;  3WNX B;  1B47 A;  4ETO A;  3S0G A;  2LMT A;  3D75 A;  1JFJ A;  4I5J A;  2CCM A;  1YUS A;  2PRU A;  1IIO A;  1SK6 D;  5DKN A;  2L5Y A;  4MRX A;  5AFP A;  3SG2 A;  2VRG A;  1OQP A;  4JD9 A;  1PSB A;  3HX4 A;  5CPV A;  5JJG A;  1C7W A;  1AVS A;  3FE6 A;  3VRP A;  1CB1 A;  1BU3 A;  1CMF A;  3L47 A;  1PK0 D;  3B6X A;  3VRO A;  1K9K A;  2JPT A;  2L4H A;  1BR4 B;  1KWO B;  1TNP A;  1CDN A;  1SY9 A;  1CM1 A;  4NQG A;  4QJ4 B;  2K7B A;  2M49 B;  1B1G A;  1RK9 A;  1YUT A;  1KQM C;  5EL2 A;  3PN7 C;  1WDC B;  2JRF A;  1KFX S;  1SMG A;  5ER5 A;  1CLB A;  3I5H C;  2KI4 B;  1OOF A;  1WRZ A;  1HT9 A;  1J1D A;  2OS8 B;  3EVU A;  3PJI A;  2Y1M A;  4YGB B;  3SG7 A;  2KYC A;  1NIW A;  2O60 A;  5B8I B;  1JFK A;  1A2X A;  1YUU A;  1K93 D;  2ISD A;  2JTT A;  2QEB A;  1QV0 A;  4CPV A;  4PE0 A;  2A4J A;  3BUN B;  1YRU B;  4F7F A;  1C3Y A;  2L5X B;  3IQQ A;  5FI6 A;  3VRR A;  1CFF A;  1F4Q A;  1L2O C;  1DF0 B;  1OMV A;  3D0Y B;  3VRN A;  3I5I B;  1B4C A;  2MLE C;  3BXK A;  3PAL A;  2F2O A;  4INX A;  1QLK A;  2JNF A;  1SKT A;  2K2F A;  3CR4 X;  3ZNI A;  2QEH A;  2LUX A;  1S6I A;  2KBM A;  3E3R A;  2AMI A;  1X02 A;  3D10 A;  1QAS A;  4A4B A;  1KFU S;  1LS8 A;  1BLQ A;  2KPH A;  3TDI A;  1LKJ A;  2WCL A;  3PM8 A;  2KFG A;  1SCV A;  5HLV A;  1ZUZ A;  2K2A A;  1RJV A;  3F45 A;  1IWQ A;  1QX5 B;  3PLF B;  1YX8 A;  1GM0 A;  5I2O A;  2ZNE A;  1CFD A;  3EVV A;  1QAT A;  2COL B;  1XFZ O;  1XFW O;  1Y6W A;  1B7T Y;  2WCE A;  1RFJ A;  1M45 A;  2F3Z A;  3I5F B;  3CR5 X;  4OZD A;  4DRW A;  1B8C A;  5HL1 A;  3CYZ A;  3DXL A;  2KAY A;  4CID A;  1SL8 A;  2BCA A;  2D8N A;  1LA0 A;  1OOJ A;  1RWY A;  4MSP A;  1KWO C;  1QJT A;  1DTL A;  3IVT A;  3UO9 A;  3JTD B;  1SCM B;  2JU0 A;  1EG4 A;  2Q4U A;  4GUK A;  4HRH A;  1CMG A;  1YRT B;  2FCE A;  2KGR A;  1LVC D;  2HPS A;  3GOF A;  4IL1 A;  2NCP A;  4OKH A;  4OV2 A;  3DVM A;  2Y4Q A;  2KI4 C;  1N65 A;  1ALW A;  1UHK A;  2MHH A;  3O4X A;  1U5I B;  2CNP A;  1NPQ A;  2PVB A;  2JT0 A;  1VRK A;  1Z2C B;  3MSE B;  4PHJ A;  5HLO A;  4MLW A;  3CTN A;  3NSO A;  3TDZ A;  3OHM B;  2WOR A;  3WHU B;  3AAK A;  4YGC B;  1XFR A;  1F55 A;  4GBA A;  1LIN A;  2Y5I A;  4YGE B;  1FPW A;  1S5G Z;  2EC6 B;  4JWQ A;  5I8N A;  2EGD A;  2BE4 A;  1JWD A;  1V1F A;  3I5I C;  1XK4 C;  4HRG A;  1NCX A;  3O78 A;  1K94 A;  1MWN A;  1YVL A;  2BBM A;  2ZRT A;  3EK8 A;  1CNP A;  1SRA A;  1JUO A;  2I18 A;  2LC5 A;  4FTG A;  1CM4 A;  1XFV O;  4AQJ A;  4JPZ B;  3EG5 B;  2L2C A;  3RZS A;  1F4O A;  2BCB A;  2GV5 A;  1QTX A;  4PAL A;  5TNC A;  4C0L A;  1ALV A;  1NX1 A;  1SL9 A;  1TRF A;  3CAB A;  2F3Y A;  2Y1N A;  2K7O A;  3NSI A;  4USL A;  4YBH B;  1YX7 A;  3LK0 A;  3BUX B;  4GGF A;  1FI5 A;  5K89 A;  1JF0 A;  2PYQ A;  2WC5 A;  3JVT B;  3R1P A;  4QJ3 B;  1XFX O;  3DVK A;  3M0W A;  4BY4 A;  3EK4 A;  1TOP A;  3D77 A;  3GK4 X;  1JSA A;  3B88 A;  3AKB A;  5I94 A;  1TUJ A;  3BOW B;  1DJI A;  1SSE B;  2I7A A;  1PSR A;  3BUO B;  3I5F C;  3SG3 A;  1F8H A;  1G4Y R;  1IGV A;  1DEK A;  4ORA B;  5ER4 X;  3EK7 A;  1FI6 A;  2H2K A;  1KK7 Z;  3CGA A;  1UP5 A;  2ZN9 A;  3JTD C;  4PE1 A;  1SCM C;  2MRD A;  2HQW A;  1NSH A;  2E30 A;  2M7N A;  3S0E A;  1M46 A;  3SIB A;  1CTR A;  3R72 A;  1MR8 A;  4WQ3 A;  2P71 A;  1SR6 B;  4GNK B;  4PHN A;  2M7L A;  3SG4 A;  3NGV A;  4PT1 A;  3WHT B;  1XFU O;  2SAS A;  5KTY A;  3VGO A;  1NUB A;  4E68 A;  3FE9 A;  1REC A;  2CT9 A;  2NLN A;  1XO5 A;  1Z4H A;  2AUC A;  3PSR A;  4I5K A;  3CLN A;  4OR9 B;  2BCX A;  3VB1 A;  1QIV A;  1DC1 A;  1YTZ C;  2EC6 C;  3OB1 B;  3LLE A;  1WLZ A;  1CLL A;  2KBI A;  5FI7 A;  2P6B B;  3ZWH A;  1DQE A;  1S3P A;  1GQM A;  1KFX L;  3NSL A;  4NDD A;  3NSK A;  1FW4 A;  2TN4 A;  1OMD A;  2ZRS A;  5CSI A;  2PQL A;  2KDH A;  1FF1 A;  3TZ1 A;  3K1E A;  5AEQ A;  1PVB A;  1MF8 B;  1RTP 1;  4N1G A;  2QEV A;  1TNQ A;  3I5G B;  1K9P A;  1XFY O;  1J7P A;  1XVJ A;  1MXL C;  5I2L A;  1NWD A;  2K61 A;  1TIZ A;  1K95 A;  5G08 A;  1OW4 A;  1Y1A A;  4XJK A;  1WRL A;  4DIR A;  3JVT C;  3FWC A;  3S0F A;  2SCP A;  1JF2 A;  1BT6 A;  2MA2 A;  3BJH A;  3TS5 B;  3DY9 A;  2FJU B;  3FE8 A;  4PHK A;  4FQO A;  1IH0 A;  2PSR A;  2P70 A;  4TNC A;  2KQY A;  5CSF A;  2LMV A;  1E8A A;  1SPY A;  1DMO A;  1KFU L;  1CDP A;  2LV7 A;  2MJW B;  1K2H A;  1CDM A;  3LL8 B;  2KHN A;  2MAZ A;  1S6J A;  2E6W A;  5HKY A;  4P2Y B;  5BPJ A;  4HRE E;  1R6P A;  4GPL B;  1WLM A;  2CTN A;  4NDC A;  5CSJ A;  2NXQ A;  3NXA A;  1TCO B;  1ZOT B;  4XYN A;  1ZAC A;  2LP2 A;  1FBV A;  1KCY A;  3OB2 B;  4FQT A;  1GJY A;  1ODB A;  5FYX A;  3B7A A;  1YR5 A;  4JQ0 D;  4DCK A;  3DVJ A;  2LHI A;  1V1G A;  2I94 A;  3PFV A;  2LP3 A;  4YI9 A;  4PDZ A;  1RRO A;  1A03 A;  2GGM A;  1C3Z A;  1D1O A;  1TNX A;  3PM2 A;  4DS7 A;  3R1V A;  1XA5 A;  1A75 A;  1BR1 B;  2ZN8 A;  2AAO A;  3D78 A;  1WDC C;  2JT3 A;  3SG6 A;  3WXA A;  2BBN A;  2OS8 C;  3I5G C;  1BMO A;  4OVN F;  4ORB B;  1OOH A;  3EKJ A;  2KSP A;  1K8U A; 
#chains in the Genus database with same CATH homology
 2WC5 A;  3CZ2 A;  3R1P A;  4JD9 A;  3D77 A;  3B88 A;  3FE6 A;  1TUJ A;  3L47 A;  3B6X A;  3BFA A;  1OOG A;  2H8V A;  3S0E A;  3R72 A;  5EL2 A;  2P71 A;  1OOF A;  3NGV A;  4PT1 A;  3PJI A;  3FE9 A;  3NHT A;  1P28 A;  2QEB A;  2FJY A;  3VB1 A;  3B87 A;  1OOI X;  4F7F A;  3L4A A;  1C3Y A;  3BFH A;  1TWO A;  2WC6 A;  3D74 A;  4INX A;  1DQE A;  3CZ1 A;  3QME A;  2QEH A;  2JPO A;  2PQL A;  1QWV A;  1LS8 A;  2GTE A;  2KPH A;  3K1E A;  2WCL A;  2QEO A;  2QEV A;  3Q8I A;  4INW A;  1GM0 A;  1OW4 A;  3S0F A;  3BJH A;  2WCK A;  3DY9 A;  3FE8 A;  4OZD A;  3CYZ A;  3DXL A;  2P70 A;  2WCM A;  3L4L A;  3V2L A;  1ORG A;  2QDI A;  3OGN A;  2WCH A;  3S0A A;  3NHI A;  3B86 A;  3CDN A;  3BFB A;  1XFR A;  3CZ0 A;  4FQT A;  3S0D A;  3R1O A;  3B7A A;  5DIC A;  3D73 A;  3DZT A;  1C3Z A;  1T14 A;  3S0B A;  2ERB A;  3D76 A;  3R1V A;  3RZS A;  2L2C A;  3D78 A;  3S0G A;  3D75 A;  3DYE A;  2WCJ A;  3CAB A;  1OOH A;  3N7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...