4OKHA

Crystal structure of calpain-3 penta-ef-hand domain
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
176
structure length
171
Chain Sequence
b'QQQFRNIFKQIAGDDMEICADELKKVLNTVVNKTHGFTLESCRSMIALMDTDGSGKLNLQEFHHLWNKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMYALEHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Calpain-3
publication title Crystal structure of calpain-3 penta-EF-hand (PEF) domain - a homodimerized PEF family member with calcium bound at the fifth EF-hand.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 60
structure length 171
sequence length 176
chains with identical sequence B, C
ec nomenclature ec 3.4.22.54: Calpain-3.
pdb deposition date 2014-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4okhA00
2LVVA 1TNQA 1OSAA 2GGZA 5TNCA 4CPVA 3FS7A 3H4SE 2JT3A 2Y5IA 4PE0A 3CR4X 4YGDB 3JVTC 4MZKA 1UHKA 4PALA 4YI9A 1K90D 2ISDA 5HYDA 1F71A 1S5GZ 1YUSA 4YBHB 4USLA 1B7TZ 1A2XA 2M0RA 4P5OE 5BPJA 1JSAA 1YUTA 2M29A 1OMVA 2WORA 2L98A 3CZTX 2JRFA 1RK9A 1EG3A 1OOJA 1CDLA 2EHBA 3GK1A 2KBIA 2JWWA 1IRJA 2CBLA 3I5HC 2JPTA 1CLLA 1EXRA 2M1UA 1TIZA 1CFPA 2AUCA 2K2FA 2PRUA 1KK7Y 4YGEB 1K8UA 2F3YA 2KQYA 4YI8A 1K95A 1NX3A 5I2OA 3TDIA 1TNXA 2NCPA 4MN0A 1SR6B 1PULA 2M7LA 2KGRA 1SCVA 1UHJA 3CLNA 1XVJA 4D1EA 1NX1A 1CDNA 1JC2A 3KHEA 1A03A 1Q80A 1S6JA 2JXLA 5B8IB 2BCAA 4QJ5B 1CFDA 1S36A 2MJWB 4MLWA 3A4UB 2HETA 2Y1MA 2MRDA 2KHNA 2LAPA 3O2PA 2ZKMX 4GAOA 1ALVA 2BKHB 1J55A 2BL0B 4C0KA 1GJYA 3OHMB 1QX5B 2L4IA 1Y6WA 2JQ6A 2KBMA 2LANA 5D7FA 3BYAA 4WQ3A 2G9BA 3WHUB 3ICBA 2AMIA 1DGVA 1MXLC 2QPTA 2F2OA 3PATA 1WRLA 4MZJA 2OTGB 1BMOA 2KDHA 4F0ZB 3TUYC 1XO5A 4GBAA 1PSBA 1K93D 4M2QA 2LP2A 3D0YB 4CFQA 4C0LA 2FCEA 2FOTA 1J7QA 3VGOA 1SRAA 1DMOA 2RGIA 1K9PA 4N1GA 1LKJA 5JOLA 2WNDA 5CPVA 3I5GB 4A4BA 5IBWA 4GUKA 3SG4A 2K7BA 1TOPA 2KFGA 2LCPA 2P6BB 2TN4A 4L9MA 1DJIA 2JTTA 1MHOA 3GK2A 5CSIA 2D8NA 2KYCA 4CIDA 1JF2A 1SBJA 2BL0C 2SASA 1NYAA 2MBXA 1FI5A 2CNPA 2LLTA 1MWNA 2FJUB 3EVUA 1JWDA 1UP5A 1ALWA 3LCPC 1RJVA 1XFYO 4NQGA 1B8CA 1B8LA 2BBNA 4XJKA 3E3RA 3WHTB 4HSZA 1G4YR 1F70A 1DJXA 1JUOA 2HQ8A 2ZN8A 3OP0A 3A8RA 1RWYA 1OZOA 1WDCB 1D1OA 1FBVA 5GQQC 1FPWA 3PALA 4NDBA 2WCFA 2EC6B 4FQOA 3PM8A 1YR5A 5I2LA 2M8UA 1KFXS 2H61C 4MSPA 4ICBA 3I5GC 5DKRA 1SCMC 1BODA 2JC2A 5FYXA 4AQJA 2PMYA 2JZIA 2KI4B 2WCEA 1AVSA 2WOSA 5HKZA 1NPQA 2PVBA 3VRPA 1JF0A 1MXEA 3PFVA 1SYMA 2LUCA 1L2OB 1DJZA 2COLB 1TN4A 1NCZA 4GGFC 1NIWA 1BJFA 1QIWA 2ZN9A 3SG3A 1EG4A 1PALA 1J7PA 3FWBA 2LV7A 3CTNA 2I94A 1EJ3A 3GK4X 4ETOA 1WDCC 3SG2A 2OS8B 2EC6C 1A75B 3SG7A 2CT9A 1XK4C 5HKWA 4P2YB 2K61A 4PHNA 1RFJA 1J7RA 2A4JA 1QIVA 1ZUZA 2LMVA 3KF9A 2LP3A 2I2RE 3KPXA 1SKTA 1CLMA 1BT6A 1KQMB 2MAZA 1R6PA 2Y4QA 1IJ6A 3OX6A 1M63B 1BOCA 1A75A 1IJ5A 1PSRA 1WRKA 1QS7A 1YRTB 2K2AA 3WXAA 1TRFA 1AJ5A 1A29A 1L2OC 1OMDA 1IG5A 5PALA 2V53A 1DJYA 1M46A 1NCXA 2KI6D 3C1VA 3BOWA 3RM1A 1KFXL 2BCBA 4AOMA 1K94A 1XFVO 2F2PA 3WNXB 1SPYA 5HLVA 2KSPA 2B1UA 2Q4UA 1XFUO 1RECA 4PCWA 3LK1A 4OKHA 2LVIA 3TS5B 4GFTA 3AKBA 4PE4A 1YX7A 2SCPA 1V1GA 1R2UA 3NSLA 1H8BA 1K2HA 2HPSA 2R2IA 3VRQA 1K96A 4N1FA 2NZ0A 5AXIA 1XFZO 2LMUA 1UHNA 1UHHA 2JNXA 5KTYA 1BLQA 1NP8A 1H4BA 4IL1A 4R1EA 5F6TA 1KQMC 3AAJA 1YX8A 2LLSA 1AJ4A 4OR9B 4YRUA 5CSJA 5AANA 3CWGA 2KI6C 2ZRSA 1UURA 4DRWA 1N2DA 4GGNA 3TZ1A 1NUBA 3CS1A 1J7OA 4JWQA 1B9AA 1C07A 5JJGA 2CXJA 3DVEA 1YURA 1CMFA 5DKQA 1J1EA 1EH2A 1F4OA 2BE6A 1SR6C 2PSRA 3VRRA 4U8DA 2BKIB 1F4QA 1NX2A 1ZMZA 3EK4A 1QX2A 1JFKA 3ZNIA 3NSIA 5D69A 1OQPA 1J1DA 4BY5A 1CFCA 3K21A 1DT7B 1XFWO 2EGDA 1BR4B 2L50A 2DOQA 4Q04A 1IWQA 1DVIA 2JU0A 1IGVA 4A4CA 1QJTA 3OX5A 4M2PA 3SIAA 1AK8A 2NCOA 1ZACA 4TNCA 4C0JA 5KU1A 1AHRA 2BBMA 4M2OA 2JT0A 3AAKA 4XJKB 1G33A 4MEWA 4HREE 1S3PA 4PE1A 2F3ZA 4DCKA 1SL8A 2KOTA 2ZNEA 2HF5A 2L5XB 1TCFA 2L0PA 4PHMA 2MA2A 1HT9A 1CDMA 5K89A 3HX4A 2K0JA 1DF0A 4YGAA 1NSHA 3BXKA 1XYDA 1KSOA 2OTGC 2BE4A 2BECA 1ZFSA 1MF8B 5G08A 1B47A 1Y1AA 1MR8A 3GOFA 3DF0A 2LNKA 3ZWHA 4I5NB 1HQVA 1YVLA 2MLFC 3O6BA 2Q91A 2KFFA 4QJ4B 4HRGA 4GNKB 3I5FB 2H2KA 3EVRA 1YUUA 2L2EA 5AEQA 1IQ3A 2KAYA 1X02A 1CDPA 2I18A 2LLUA 1OMRA 3KEVA 2KNEA 1CNPA 1M45A 3EK8A 1VRKA 1KK8B 1LINA 2LUXA 1S26D 1DJGA 3D10A 1BF5A 3FIAA 5CSFA 1WLZA 3CR2A 1CLBA 1KFUS 2M49B 1W7IB 1BR1B 2L51A 3TDUA 2KAVA 3BUWB 4PHJA 1N65A 4QJ3B 3FWCA 1WRZA 3BUXB 5CSNA 2G2BA 3EK7A 1CMGA 1K9KA 2E30A 1V1FA 3PSRA 1DGUA 2BCXA 3I5FC 4JPZB 5J3XA 1QXPA 2O5GA 1S1EA 4DUQA 3IQOA 1M39A 1W7JB 3PN7B 2LE9B 5AERA 3I5HB 1PRWA 1SNLA 3NSKA 3BOWB 4MRXA 2KI4C 1SK6D 1QVIY 1KK8C 2CTNA 2GV5A 4YGCB 1NX0A 4CLNA 2I7AA 1IQ5A 2E6WA 4NDDA 3SG5A 4DIRA 1RROA 3KO0A 1GGZA 1Y1UA 1CFFA 5ER4X 4XYNA 1C7WA 2F33A 3NXAA 3OB1B 3IF7A 1PVAA 2F8PA 2M1KB 3DD4A 3DVKA 3LL8B 5HKYA 2NXQA 1MUXA 2OPOA 1UUSA 2MHHA 1SL7A 3I5IB 4BY4A 3AKAA 1KSMA 2M9GA 3SIBA 3O78A 1DTLA 1K9UA 1U5IB 3OB2B 4OVNF 4ZCUA 2OS8C 2K7DA 2NLNA 1YVHA 3EKJA 1QV0A 4GPLB 1OE9B 1KFUL 3PN7C 1UWOA 3LK0A 1FW4A 3SG6A 1IKUA 5DKNA 1XA5A 1UHIA 2K7OA 3DVMA 1QX7A 1U5IA 4ORBB 4NDCA 4ZCVA 5I2QA 4WRIA 2ZRTA 1SW8A 3HCMA 3TUYB 2KFHA 1GQMA 4ORCB 1EL4A 2L4HA 1F55A 2ZNDA 1CM4A 1CM1A 2MLEC 1PK0D 1B1GA 1GGWA 1TTXA 1AUIB 1KWOB 1RTP1 3I5IC 1QVIZ 2LMTA 2M7NA 3BUNB 4MBEA 5AFPA 1YTZC 1LVCD 3TS5C 4I5JA 2JNFA 2Y1NA 2KAXA 2LVKA 2PASA 3PLFB 4PE7A 1A4PA 2WCBA 3IQQA 1G8IA 2JTZA 3MSEB 2O60A 1E8AA 1QLSA 1SY9A 4WQ2A 1S6CA 2KYFA 3BUMB 4MVFA 2LHIA 3BUOB 2M97A 1DF0B 4AQIA 1OZSA 3EKHA 1S6IA 3VRNA 2KGBC 1SMGA 1KQVA 3EVVA 1CTRA 1NWDA 1QLKA 2WC8A 1WLMA 3DF0B 3CR5X 2CCMA 2LHLA 1LA3A 4ORAB 2LVJA 1FI6A 3TDZA 3JTDB 1Y0VH 1TCOB 1IH0A 5HLOA 1B8RA 1KK7Z 1NCYA 1F8HA 2LC5A 1KWOC 4CFRA 2KQ6A 1MQ1A 1CB1A 4DS7A 3NSOA 1KCYA 3D0YA 1SCMB 4YGBB 1QASA 4N5XA 2JULA 3RLZA 1L7ZA 5I8NA 1LXFC 3SJSA 1SL9A 4E68A 4I5LB 1Y1XA 4PHKA 1N0YA 5ER5A 2H61A 1S5GY 1QTXA 1BG1A 1B7TY 1TNPA 1XFXO 2HQWA 3BQ3A 1DJWA 4PDZA 4MRYA 1JFJA 1QATA 2FCDA 1YRUB 1PVBA 4UPGA 1DJHA 3F45A 2GGMA 5KSZA 1LA0A 2AAOA 3LLEA 3JVTB 3JTDC 1TNWA 2K7CA 2ZFDA 4GGFA 1C7VA 1FF1A 2K8MB 1M31A 4HRHA 3CGAA 3DVJA 2QACA 2VRGA 3M0WA 2M3WA 2PALA 1JBAA 2IS9A 3O4YA 3VROA 4OCIA 2JT8A 1BU3A 1ODBA 1ZOTB 2LM5A 1WY9A 4I5KA 4FTGA 1AP4A 1F54A 1XK4A 4OV2A 1B4CA 2JOJA 4MZLA 3QRXA 4JQ0D 2JXCA 1QV1A 1CKKA
chains in the Genus database with same CATH superfamily
2LVVA 1TNQA 3OBVA 4KYNA 1OSAA 2GGZA 5TNCA 4CPVA 3FS7A 3H4SE 2JT3A 2Y5IA 4PE0A 3CR4X 4YGDB 3JVTC 1T14A 3NGVA 4MZKA 1UHKA 4PALA 4YI9A 1K90D 2ISDA 5HYDA 1F71A 1S5GZ 1YUSA 4YBHB 1TUZA 3B86A 4USLA 1B7TZ 3S0AA 1A2XA 2M0RA 4P5OE 5BPJA 1JSAA 1YUTA 2M29A 3DXLA 1OMVA 2WORA 2L98A 1OOGA 2WCHA 3CZTX 2JRFA 1RK9A 3VB1A 1DEKA 1EG3A 2WCKA 1OOJA 1CDLA 2EHBA 3CZ1A 2KBIA 3GK1A 3UNWA 2JWWA 1IRJA 2CBLA 3I5HC 2JPTA 1CLLA 1EXRA 2M1UA 1TIZA 1CFPA 2AUCA 2K2FA 2PRUA 1KK7Y 4YGEB 1K8UA 2F3YA 2KQYA 4YI8A 1K95A 1NX3A 5I2OA 3TDIA 1TNXA 2NCPA 4MN0A 1SR6B 1PULA 2M7LA 2KGRA 1SCVA 1UHJA 3CLNA 1XVJA 3EG5B 4PT1A 4D1EA 1NX1A 3R1OA 1CDNA 3KHEA 1JC2A 1A03A 1Q80A 1S6JA 2JXLA 5B8IB 2BCAA 3NHTA 4QJ5B 1CFDA 1S36A 2MJWB 4MLWA 3A4UB 2HETA 2Y1MA 2MRDA 2KHNA 2LAPA 1DQEA 3O2PA 2ZKMX 4GAOA 2BAPA 1ALVA 2BKHB 1J55A 2BL0B 4C0KA 3D74A 1GJYA 3OHMB 1QX5B 2L4IA 2JPOA 1Y6WA 2JQ6A 2KBMA 2KPHA 2LANA 3R1VA 5D7FA 3BYAA 4WQ3A 2G9BA 3WHUB 2QDIA 3ICBA 2AMIA 3NHIA 1DGVA 1MXLC 2QPTA 2WCJA 2F2OA 3PATA 1WRLA 4MZJA 2OTGB 1BMOA 2KDHA 4F0ZB 3TUYC 1DELA 1XO5A 4GBAA 1PSBA 1K93D 4M2QA 2LP2A 3D0YB 3S0GA 4CFQA 4C0LA 2FCEA 2FOTA 1J7QA 3BFHA 1SRAA 3VGOA 1DMOA 2RGIA 1K9PA 4N1GA 1LKJA 3FE8A 5JOLA 2WNDA 5CPVA 2QEOA 3I5GB 4A4BA 5IBWA 4GUKA 3SG4A 2K7BA 1TOPA 2KFGA 2LCPA 2P6BB 2TN4A 4L9MA 1DJIA 2JTTA 1MHOA 3GK2A 5CSIA 2D8NA 2KYCA 4CIDA 1JF2A 1SBJA 2BL0C 2FJYA 1NYAA 2SASA 3B88A 5I94A 2MBXA 1FI5A 2CNPA 2LLTA 1MWNA 2FJUB 3V2LA 3EVUA 1JWDA 1UP5A 1ALWA 3LCPC 1RJVA 1XFYO 5EL2A 3OGNA 1B8CA 1B8LA 2BBNA 4NQGA 4XJKA 3E3RA 3WHTB 4HSZA 1G4YR 1F70A 1DJXA 1JUOA 3CYZA 2HQ8A 2ZN8A 3OP0A 3PM2A 3A8RA 1RWYA 1OZOA 1WDCB 1D1OA 1FBVA 5GQQC 1FPWA 3PALA 4NDBA 2WCFA 2EC6B 4FQOA 3PM8A 1YR5A 5I2LA 2M8UA 1KFXS 2H61C 4MSPA 4ICBA 3I5GC 5DKRA 2ERBA 1SCMC 1BODA 2JC2A 5FYXA 4AQJA 2PMYA 2JZIA 2KI4B 2WCEA 1AVSA 2WOSA 5HKZA 1NPQA 2PVBA 3VRPA 1JF0A 1MXEA 3PFVA 1SYMA 2WC6A 5DICA 2LUCA 1L2OB 2WCLA 1DJZA 3PJIA 2COLB 1TN4A 1NCZA 4GGFC 1NIWA 1BJFA 1QIWA 2ZN9A 3SG3A 1EG4A 1PALA 1J7PA 3FWBA 2LV7A 3CTNA 2I94A 1EJ3A 3GK4X 3DY9A 4ETOA 1WDCC 3SG2A 2WC5A 2OS8B 2EC6C 1A75B 3SG7A 2CT9A 1XK4C 5HKWA 4P2YB 1OOHA 2K61A 1RFJA 4PHNA 1J7RA 2A4JA 1QIVA 1ZUZA 2LMVA 3KF9A 2LP3A 2I2RE 1C3ZA 1SKTA 1CLMA 3KPXA 1BT6A 1KQMB 2MAZA 1R6PA 2Y4QA 1IJ6A 3OX6A 1M63B 1BOCA 1A75A 2L2CA 1IJ5A 1PSRA 1WRKA 1QS7A 1YRTB 2K2AA 2QEHA 1TRFA 1AJ5A 3WXAA 1Z2CB 1A29A 1L2OC 1OMDA 1IG5A 5PALA 2V53A 1DJYA 1M46A 1NCXA 2KI6D 3K1EA 3C1VA 3BOWA 3RM1A 1KFXL 2BCBA 5FI6A 4AOMA 1K94A 1XFVO 2F2PA 3WNXB 1SPYA 5HLVA 2KSPA 2B1UA 2Q4UA 1XFUO 1RECA 4PCWA 3LK1A 4OKHA 2LVIA 3TS5B 5FI7A 2QEVA 3AKBA 4GFTA 1GM0A 4PE4A 1YX7A 2SCPA 1V1GA 1R2UA 3NSLA 1H8BA 3FE6A 2HPSA 2R2IA 1K2HA 3VRQA 1K96A 5HL1A 4N1FA 2NZ0A 5AXIA 1XFZO 2LMUA 1UHNA 1UHHA 2JNXA 5KTYA 1BLQA 1NP8A 1H4BA 4IL1A 4R1EA 5F6TA 1KQMC 3AAJA 1YX8A 2K60A 2LLSA 1AJ4A 4OR9B 4YRUA 1Z4HA 5CSJA 4INWA 5AANA 3CWGA 2KI6C 2ZRSA 1UURA 4DRWA 1N2DA 2KLEA 4GGNA 3TZ1A 1NUBA 3CS1A 1J7OA 4JWQA 1B9AA 1OOIX 5JJGA 1C07A 2CXJA 3DVEA 1YURA 1CMFA 5DKQA 1J1EA 1EH2A 1F4OA 2BE6A 1SR6C 2PSRA 3SS5A 3VRRA 4U8DA 3UO9A 2BKIB 1F4QA 1NX2A 1ZMZA 3EK4A 3SS3A 1QX2A 3FE9A 3R1PA 3O4XA 1JFKA 3ZNIA 3NSIA 3D76A 1OQPA 1J1DA 5D69A 4BY5A 1CFCA 3K21A 3L47A 1DT7B 1XFWO 2EGDA 4F7FA 1BR4B 2L50A 2DOQA 4Q04A 3DZTA 1IWQA 1DVIA 2JU0A 1IGVA 4A4CA 1QJTA 3OX5A 4M2PA 3SIAA 1AK8A 2NCOA 3IVTA 1ZACA 2KLDA 4TNCA 4C0JA 2P71A 5KU1A 1AHRA 2BBMA 4M2OA 2JT0A 3AAKA 3D73A 4XJKB 1G33A 3CZ0A 4HREE 4MEWA 3S0FA 1S3PA 4PE1A 2F3ZA 4DCKA 1SL8A 2KOTA 3D78A 2ZNEA 2HF5A 2L5XB 4INXA 1TCFA 2L0PA 4PHMA 2MA2A 1HT9A 1CDMA 3QMEA 5K89A 3HX4A 2K0JA 1DF0A 4YGAA 1NSHA 3BXKA 1XYDA 1KSOA 2OTGC 2BE4A 2BECA 1ZFSA 1MF8B 5G08A 1B47A 1Y1AA 1MR8A 2H8VA 3GOFA 3DF0A 2LNKA 3ZWHA 4I5NB 1HQVA 1YVLA 2MLFC 1OW4A 3O6BA 2Q91A 2KFFA 4QJ4B 4HRGA 4GNKB 3I5FB 2H2KA 3EVRA 1YUUA 1LS8A 2L2EA 5AEQA 1IQ3A 2KAYA 1X02A 1CDPA 2I18A 2LLUA 1OMRA 3BFAA 3KEVA 2BNXA 2KNEA 1CNPA 1M45A 3BFBA 3EK8A 1VRKA 1KK8B 1LINA 2LUXA 1S26D 1DJGA 3D10A 3RZSA 1BF5A 2PYQA 3FIAA 5CSFA 1WLZA 3CR2A 1CLBA 1KFUS 2M49B 1SSEB 1W7IB 1BR1B 2L51A 3TDUA 2KAVA 3BUWB 4PHJA 1N65A 4QJ3B 1ORGA 3FWCA 1WRZA 3BUXB 1TUJA 5CSNA 2G2BA 3DYEA 3EK7A 1CMGA 1K9KA 2E30A 1V1FA 3PSRA 3Q8IA 3S0DA 1DGUA 2BCXA 3I5FC 4JPZB 5J3XA 1QXPA 2O5GA 1S1EA 4DUQA 3IQOA 1M39A 1W7JB 3PN7B 2LE9B 3N7HA 5FI2A 5AERA 3I5HB 1PRWA 1SNLA 3B6XA 1IIOA 3NSKA 3BOWB 4FQTA 4MRXA 2KI4C 1SK6D 1QVIY 1KK8C 2CTNA 3SS4A 3S0BA 2GV5A 4JKTA 2WCMA 4YGCB 1NX0A 4CLNA 2I7AA 2L5YA 1IQ5A 2E6WA 4NDDA 3SG5A 4DIRA 1RROA 2YGUA 3KO0A 1GGZA 1Y1UA 4OZDA 1CFFA 5ER4X 4XYNA 1C7WA 3R72A 2F33A 3NXAA 3OB1B 3IF7A 1PVAA 2F8PA 2M1KB 3DD4A 3DVKA 3LL8B 5HKYA 2NXQA 1MUXA 2OPOA 1UUSA 1P28A 2MHHA 1SL7A 3I5IB 4BY4A 3AKAA 1KSMA 2M9GA 3SIBA 3O78A 1DTLA 1K9UA 1U5IB 3OB2B 4OVNF 4ZCUA 2PQLA 2OS8C 1C3YA 2K7DA 2NLNA 1YVHA 3EKJA 1QV0A 4GPLB 1OE9B 2GTEA 1KFUL 3PN7C 1UWOA 3LK0A 1FW4A 3SG6A 1IKUA 5DKNA 1XA5A 1UHIA 2K7OA 3DVMA 1QX7A 1U5IA 4ORBB 4NDCA 3L4LA 4ZCVA 5I2QA 4WRIA 3CABA 1TWOA 2ZRTA 1SW8A 3HCMA 3TUYB 2KFHA 1GQMA 4ORCB 1EL4A 2L4HA 2P70A 2QEBA 1F55A 2ZNDA 1CM4A 1CM1A 2MLEC 1PK0D 1XFRA 1B1GA 1GGWA 1TTXA 1AUIB 1KWOB 1RTP1 3I5IC 1QVIZ 2LMTA 2M7NA 3BUNB 4MBEA 5AFPA 1YTZC 1LVCD 3TS5C 4I5JA 2JNFA 2Y1NA 2KAXA 3CZ2A 2LVKA 3D77A 2PASA 3D75A 3PLFB 1A4PA 4PE7A 2WCBA 3IQQA 1G8IA 2JTZA 3MSEB 2O60A 3B7AA 1E8AA 1QLSA 1SY9A 4WQ2A 1S6CA 2KYFA 3BUMB 4MVFA 2LHIA 3BUOB 2M97A 1DF0B 4AQIA 1OZSA 3EKHA 1S6IA 3VRNA 2KGBC 1DC1A 1SMGA 1KQVA 3EVVA 1CTRA 1NWDA 1QLKA 2WC8A 1WLMA 3DF0B 3CR5X 2CCMA 2LHLA 1LA3A 4ORAB 2LVJA 1FI6A 3TDZA 3JTDB 1Y0VH 1TCOB 3S0EA 1IH0A 5HLOA 1B8RA 1KK7Z 1NCYA 1F8HA 2LC5A 1KWOC 4CFRA 2KQ6A 1MQ1A 1CB1A 4DS7A 3NSOA 1KCYA 3D0YA 1SCMB 4YGBB 1QASA 4N5XA 2JULA 5D3OA 3RLZA 3BJHA 1L7ZA 5I8NA 1LXFC 3SJSA 1SL9A 3B87A 4I5LB 4E68A 1Y1XA 4PHKA 1N0YA 5ER5A 2H61A 1S5GY 1QTXA 1BG1A 1B7TY 1TNPA 1XFXO 2HQWA 3BQ3A 1DJWA 4PDZA 4MRYA 3L4AA 1JFJA 1QATA 2FCDA 1YRUB 1PVBA 4UPGA 1DJHA 3F45A 2GGMA 5KSZA 1LA0A 2AAOA 3LLEA 3JVTB 3JTDC 1TNWA 2K7CA 2ZFDA 4GGFA 3CDNA 1C7VA 1FF1A 4JD9A 2K8MB 1M31A 4HRHA 3CGAA 3DVJA 2QACA 2VRGA 3M0WA 1OOFA 2M3WA 1W9ZA 2PALA 1JBAA 2IS9A 3O4YA 3VROA 4OCIA 2JT8A 1BU3A 4IJ7A 1ODBA 1ZOTB 1QWVA 1WY9A 2LM5A 4I5KA 4FTGA 1AP4A 1F54A 1XK4A 4OV2A 1B4CA 2JOJA 4MZLA 3QRXA 4JQ0D 2JXCA 1QV1A 1CKKA
chains in the Genus database with same CATH topology
2LVVA 1TNQA 1OSAA 2GGZA 5TNCA 4CPVA 3FS7A 3H4SE 2JT3A 2Y5IA 4PE0A 3CR4X 4YGDB 3JVTC 4MZKA 1UHKA 4PALA 4YI9A 1K90D 2ISDA 5HYDA 1F71A 1S5GZ 1YUSA 4YBHB 4USLA 1B7TZ 1A2XA 2M0RA 4P5OE 5BPJA 1JSAA 1YUTA 2M29A 1OMVA 2WORA 2L98A 3CZTX 2JRFA 1RK9A 1EG3A 1OOJA 1CDLA 2EHBA 3GK1A 2KBIA 2JWWA 1IRJA 2CBLA 3I5HC 2JPTA 1CLLA 1EXRA 2M1UA 1TIZA 1CFPA 2AUCA 2K2FA 2PRUA 1KK7Y 4YGEB 1K8UA 2F3YA 2KQYA 4YI8A 1K95A 1NX3A 5I2OA 3TDIA 1TNXA 2NCPA 4MN0A 1SR6B 1PULA 2M7LA 2KGRA 1SCVA 1UHJA 3CLNA 1XVJA 4D1EA 1NX1A 1CDNA 1JC2A 3KHEA 1A03A 1Q80A 1S6JA 2JXLA 5B8IB 2BCAA 4QJ5B 1CFDA 1S36A 2MJWB 4MLWA 3A4UB 2HETA 2Y1MA 2MRDA 2KHNA 2LAPA 3O2PA 2ZKMX 4GAOA 1ALVA 2BKHB 1J55A 2BL0B 4C0KA 1GJYA 3OHMB 1QX5B 2L4IA 1Y6WA 2JQ6A 2KBMA 2LANA 5D7FA 3BYAA 4WQ3A 2G9BA 3WHUB 3ICBA 2AMIA 1DGVA 1MXLC 2QPTA 2F2OA 3PATA 1WRLA 4MZJA 2OTGB 1BMOA 2KDHA 4F0ZB 3TUYC 1XO5A 4GBAA 1PSBA 1K93D 4M2QA 2LP2A 3D0YB 4CFQA 4C0LA 2FCEA 2FOTA 1J7QA 3VGOA 1SRAA 1DMOA 2RGIA 1K9PA 4N1GA 1LKJA 5JOLA 2WNDA 5CPVA 3I5GB 4A4BA 5IBWA 4GUKA 3SG4A 2K7BA 1TOPA 2KFGA 2LCPA 2P6BB 2TN4A 4L9MA 1DJIA 2JTTA 1MHOA 3GK2A 5CSIA 2D8NA 2KYCA 4CIDA 1JF2A 1SBJA 2BL0C 2SASA 1NYAA 2MBXA 1FI5A 2CNPA 2LLTA 1MWNA 2FJUB 3EVUA 1JWDA 1UP5A 1ALWA 3LCPC 1RJVA 1XFYO 4NQGA 1B8CA 1B8LA 2BBNA 4XJKA 3E3RA 3WHTB 4HSZA 1G4YR 1F70A 1DJXA 1JUOA 2HQ8A 2ZN8A 3OP0A 3A8RA 1RWYA 1OZOA 1WDCB 1D1OA 1FBVA 5GQQC 1FPWA 3PALA 4NDBA 2WCFA 2EC6B 4FQOA 3PM8A 1YR5A 5I2LA 2M8UA 1KFXS 2H61C 4MSPA 4ICBA 3I5GC 5DKRA 1SCMC 1BODA 2JC2A 5FYXA 4AQJA 2PMYA 2JZIA 2KI4B 2WCEA 1AVSA 2WOSA 5HKZA 1NPQA 2PVBA 3VRPA 1JF0A 1MXEA 3PFVA 1SYMA 2LUCA 1L2OB 1DJZA 2COLB 1TN4A 1NCZA 4GGFC 1NIWA 1BJFA 1QIWA 2ZN9A 3SG3A 1EG4A 1PALA 1J7PA 3FWBA 2LV7A 3CTNA 2I94A 1EJ3A 3GK4X 4ETOA 1WDCC 3SG2A 2OS8B 2EC6C 1A75B 3SG7A 2CT9A 1XK4C 5HKWA 4P2YB 2K61A 4PHNA 1RFJA 1J7RA 2A4JA 1QIVA 1ZUZA 2LMVA 3KF9A 2LP3A 2I2RE 3KPXA 1SKTA 1CLMA 1BT6A 1KQMB 2MAZA 1R6PA 2Y4QA 1IJ6A 3OX6A 1M63B 1BOCA 1A75A 1IJ5A 1PSRA 1WRKA 1QS7A 1YRTB 2K2AA 3WXAA 1TRFA 1AJ5A 1A29A 1L2OC 1OMDA 1IG5A 5PALA 2V53A 1DJYA 1M46A 1NCXA 2KI6D 3C1VA 3BOWA 3RM1A 1KFXL 2BCBA 4AOMA 1K94A 1XFVO 2F2PA 3WNXB 1SPYA 5HLVA 2KSPA 2B1UA 2Q4UA 1XFUO 1RECA 4PCWA 3LK1A 4OKHA 2LVIA 3TS5B 4GFTA 3AKBA 4PE4A 1YX7A 2SCPA 1V1GA 1R2UA 3NSLA 1H8BA 1K2HA 2HPSA 2R2IA 3VRQA 1K96A 4N1FA 2NZ0A 5AXIA 1XFZO 2LMUA 1UHNA 1UHHA 2JNXA 5KTYA 1BLQA 1NP8A 1H4BA 4IL1A 4R1EA 5F6TA 1KQMC 3AAJA 1YX8A 2LLSA 1AJ4A 4OR9B 4YRUA 5CSJA 5AANA 3CWGA 2KI6C 2ZRSA 1UURA 4DRWA 1N2DA 4GGNA 3TZ1A 1NUBA 3CS1A 1J7OA 4JWQA 1B9AA 1C07A 5JJGA 2CXJA 3DVEA 1YURA 1CMFA 5DKQA 1J1EA 1EH2A 1F4OA 2BE6A 1SR6C 2PSRA 3VRRA 4U8DA 2BKIB 1F4QA 1NX2A 1ZMZA 3EK4A 1QX2A 1JFKA 3ZNIA 3NSIA 5D69A 1OQPA 1J1DA 4BY5A 1CFCA 3K21A 1DT7B 1XFWO 2EGDA 1BR4B 2L50A 2DOQA 4Q04A 1IWQA 1DVIA 2JU0A 1IGVA 4A4CA 1QJTA 3OX5A 4M2PA 3SIAA 1AK8A 2NCOA 1ZACA 4TNCA 4C0JA 5KU1A 1AHRA 2BBMA 4M2OA 2JT0A 3AAKA 4XJKB 1G33A 4MEWA 4HREE 1S3PA 4PE1A 2F3ZA 4DCKA 1SL8A 2KOTA 2ZNEA 2HF5A 2L5XB 1TCFA 2L0PA 4PHMA 2MA2A 1HT9A 1CDMA 5K89A 3HX4A 2K0JA 1DF0A 4YGAA 1NSHA 3BXKA 1XYDA 1KSOA 2OTGC 2BE4A 2BECA 1ZFSA 1MF8B 5G08A 1B47A 1Y1AA 1MR8A 3GOFA 3DF0A 2LNKA 3ZWHA 4I5NB 1HQVA 1YVLA 2MLFC 3O6BA 2Q91A 2KFFA 4QJ4B 4HRGA 4GNKB 3I5FB 2H2KA 3EVRA 1YUUA 2L2EA 5AEQA 1IQ3A 2KAYA 1X02A 1CDPA 2I18A 2LLUA 1OMRA 3KEVA 2KNEA 1CNPA 1M45A 3EK8A 1VRKA 1KK8B 1LINA 2LUXA 1S26D 1DJGA 3D10A 1BF5A 3FIAA 5CSFA 1WLZA 3CR2A 1CLBA 1KFUS 2M49B 1W7IB 1BR1B 2L51A 3TDUA 2KAVA 3BUWB 4PHJA 1N65A 4QJ3B 3FWCA 1WRZA 3BUXB 5CSNA 2G2BA 3EK7A 1CMGA 1K9KA 2E30A 1V1FA 3PSRA 1DGUA 2BCXA 3I5FC 4JPZB 5J3XA 1QXPA 2O5GA 1S1EA 4DUQA 3IQOA 1M39A 1W7JB 3PN7B 2LE9B 5AERA 3I5HB 1PRWA 1SNLA 3NSKA 3BOWB 4MRXA 2KI4C 1SK6D 1QVIY 1KK8C 2CTNA 2GV5A 4YGCB 1NX0A 4CLNA 2I7AA 1IQ5A 2E6WA 4NDDA 3SG5A 4DIRA 1RROA 3KO0A 1GGZA 1Y1UA 1CFFA 5ER4X 4XYNA 1C7WA 2F33A 3NXAA 3OB1B 3IF7A 1PVAA 2F8PA 2M1KB 3DD4A 3DVKA 3LL8B 5HKYA 2NXQA 1MUXA 2OPOA 1UUSA 2MHHA 1SL7A 3I5IB 4BY4A 3AKAA 1KSMA 2M9GA 3SIBA 3O78A 1DTLA 1K9UA 1U5IB 3OB2B 4OVNF 4ZCUA 2OS8C 2K7DA 2NLNA 1YVHA 3EKJA 1QV0A 4GPLB 1OE9B 1KFUL 3PN7C 1UWOA 3LK0A 1FW4A 3SG6A 1IKUA 5DKNA 1XA5A 1UHIA 2K7OA 3DVMA 1QX7A 1U5IA 4ORBB 4NDCA 4ZCVA 5I2QA 4WRIA 2ZRTA 1SW8A 3HCMA 3TUYB 2KFHA 1GQMA 4ORCB 1EL4A 2L4HA 1F55A 2ZNDA 1CM4A 1CM1A 2MLEC 1PK0D 1B1GA 1GGWA 1TTXA 1AUIB 1KWOB 1RTP1 3I5IC 1QVIZ 2LMTA 2M7NA 3BUNB 4MBEA 5AFPA 1YTZC 1LVCD 3TS5C 4I5JA 2JNFA 2Y1NA 2KAXA 2LVKA 2PASA 3PLFB 4PE7A 1A4PA 2WCBA 3IQQA 1G8IA 2JTZA 3MSEB 2O60A 1E8AA 1QLSA 1SY9A 4WQ2A 1S6CA 2KYFA 3BUMB 4MVFA 2LHIA 3BUOB 2M97A 1DF0B 4AQIA 1OZSA 3EKHA 1S6IA 3VRNA 2KGBC 1SMGA 1KQVA 3EVVA 1CTRA 1NWDA 1QLKA 2WC8A 1WLMA 3DF0B 3CR5X 2CCMA 2LHLA 1LA3A 4ORAB 2LVJA 1FI6A 3TDZA 3JTDB 1Y0VH 1TCOB 1IH0A 5HLOA 1B8RA 1KK7Z 1NCYA 1F8HA 2LC5A 1KWOC 4CFRA 2KQ6A 1MQ1A 1CB1A 4DS7A 3NSOA 1KCYA 3D0YA 1SCMB 4YGBB 1QASA 4N5XA 2JULA 3RLZA 1L7ZA 5I8NA 1LXFC 3SJSA 1SL9A 4E68A 4I5LB 1Y1XA 4PHKA 1N0YA 5ER5A 2H61A 1S5GY 1QTXA 1BG1A 1B7TY 1TNPA 1XFXO 2HQWA 3BQ3A 1DJWA 4PDZA 4MRYA 1JFJA 1QATA 2FCDA 1YRUB 1PVBA 4UPGA 1DJHA 3F45A 2GGMA 5KSZA 1LA0A 2AAOA 3LLEA 3JVTB 3JTDC 1TNWA 2K7CA 2ZFDA 4GGFA 1C7VA 1FF1A 2K8MB 1M31A 4HRHA 3CGAA 3DVJA 2QACA 2VRGA 3M0WA 2M3WA 2PALA 1JBAA 2IS9A 3O4YA 3VROA 4OCIA 2JT8A 1BU3A 1ODBA 1ZOTB 2LM5A 1WY9A 4I5KA 4FTGA 1AP4A 1F54A 1XK4A 4OV2A 1B4CA 2JOJA 4MZLA 3QRXA 4JQ0D 2JXCA 1QV1A 1CKKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LVV A;  1TNQ A;  1OSA A;  2GGZ A;  5TNC A;  4CPV A;  3FS7 A;  3H4S E;  2JT3 A;  2Y5I A;  4PE0 A;  3CR4 X;  4YGD B;  3JVT C;  4MZK A;  1UHK A;  4PAL A;  4YI9 A;  1K90 D;  2ISD A;  5HYD A;  1F71 A;  1S5G Z;  1YUS A;  4YBH B;  4USL A;  1B7T Z;  1A2X A;  2M0R A;  4P5O E;  5BPJ A;  1JSA A;  1YUT A;  2M29 A;  1OMV A;  2WOR A;  2L98 A;  3CZT X;  2JRF A;  1RK9 A;  1EG3 A;  1OOJ A;  1CDL A;  2EHB A;  3GK1 A;  2KBI A;  2JWW A;  1IRJ A;  2CBL A;  3I5H C;  2JPT A;  1CLL A;  1EXR A;  2M1U A;  1TIZ A;  1CFP A;  2AUC A;  2K2F A;  2PRU A;  1KK7 Y;  4YGE B;  1K8U A;  2F3Y A;  2KQY A;  4YI8 A;  1K95 A;  1NX3 A;  5I2O A;  3TDI A;  1TNX A;  2NCP A;  4MN0 A;  1SR6 B;  1PUL A;  2M7L A;  2KGR A;  1SCV A;  1UHJ A;  3CLN A;  1XVJ A;  4D1E A;  1NX1 A;  1CDN A;  1JC2 A;  3KHE A;  1A03 A;  1Q80 A;  1S6J A;  2JXL A;  5B8I B;  2BCA A;  4QJ5 B;  1CFD A;  1S36 A;  2MJW B;  4MLW A;  3A4U B;  2HET A;  2Y1M A;  2MRD A;  2KHN A;  2LAP A;  3O2P A;  2ZKM X;  4GAO A;  1ALV A;  2BKH B;  1J55 A;  2BL0 B;  4C0K A;  1GJY A;  3OHM B;  1QX5 B;  2L4I A;  1Y6W A;  2JQ6 A;  2KBM A;  2LAN A;  5D7F A;  3BYA A;  4WQ3 A;  2G9B A;  3WHU B;  3ICB A;  2AMI A;  1DGV A;  1MXL C;  2QPT A;  2F2O A;  3PAT A;  1WRL A;  4MZJ A;  2OTG B;  1BMO A;  2KDH A;  4F0Z B;  3TUY C;  1XO5 A;  4GBA A;  1PSB A;  1K93 D;  4M2Q A;  2LP2 A;  3D0Y B;  4CFQ A;  4C0L A;  2FCE A;  2FOT A;  1J7Q A;  3VGO A;  1SRA A;  1DMO A;  2RGI A;  1K9P A;  4N1G A;  1LKJ A;  5JOL A;  2WND A;  5CPV A;  3I5G B;  4A4B A;  5IBW A;  4GUK A;  3SG4 A;  2K7B A;  1TOP A;  2KFG A;  2LCP A;  2P6B B;  2TN4 A;  4L9M A;  1DJI A;  2JTT A;  1MHO A;  3GK2 A;  5CSI A;  2D8N A;  2KYC A;  4CID A;  1JF2 A;  1SBJ A;  2BL0 C;  2SAS A;  1NYA A;  2MBX A;  1FI5 A;  2CNP A;  2LLT A;  1MWN A;  2FJU B;  3EVU A;  1JWD A;  1UP5 A;  1ALW A;  3LCP C;  1RJV A;  1XFY O;  4NQG A;  1B8C A;  1B8L A;  2BBN A;  4XJK A;  3E3R A;  3WHT B;  4HSZ A;  1G4Y R;  1F70 A;  1DJX A;  1JUO A;  2HQ8 A;  2ZN8 A;  3OP0 A;  3A8R A;  1RWY A;  1OZO A;  1WDC B;  1D1O A;  1FBV A;  5GQQ C;  1FPW A;  3PAL A;  4NDB A;  2WCF A;  2EC6 B;  4FQO A;  3PM8 A;  1YR5 A;  5I2L A;  2M8U A;  1KFX S;  2H61 C;  4MSP A;  4ICB A;  3I5G C;  5DKR A;  1SCM C;  1BOD A;  2JC2 A;  5FYX A;  4AQJ A;  2PMY A;  2JZI A;  2KI4 B;  2WCE A;  1AVS A;  2WOS A;  5HKZ A;  1NPQ A;  2PVB A;  3VRP A;  1JF0 A;  1MXE A;  3PFV A;  1SYM A;  2LUC A;  1L2O B;  1DJZ A;  2COL B;  1TN4 A;  1NCZ A;  4GGF C;  1NIW A;  1BJF A;  1QIW A;  2ZN9 A;  3SG3 A;  1EG4 A;  1PAL A;  1J7P A;  3FWB A;  2LV7 A;  3CTN A;  2I94 A;  1EJ3 A;  3GK4 X;  4ETO A;  1WDC C;  3SG2 A;  2OS8 B;  2EC6 C;  1A75 B;  3SG7 A;  2CT9 A;  1XK4 C;  5HKW A;  4P2Y B;  2K61 A;  4PHN A;  1RFJ A;  1J7R A;  2A4J A;  1QIV A;  1ZUZ A;  2LMV A;  3KF9 A;  2LP3 A;  2I2R E;  3KPX A;  1SKT A;  1CLM A;  1BT6 A;  1KQM B;  2MAZ A;  1R6P A;  2Y4Q A;  1IJ6 A;  3OX6 A;  1M63 B;  1BOC A;  1A75 A;  1IJ5 A;  1PSR A;  1WRK A;  1QS7 A;  1YRT B;  2K2A A;  3WXA A;  1TRF A;  1AJ5 A;  1A29 A;  1L2O C;  1OMD A;  1IG5 A;  5PAL A;  2V53 A;  1DJY A;  1M46 A;  1NCX A;  2KI6 D;  3C1V A;  3BOW A;  3RM1 A;  1KFX L;  2BCB A;  4AOM A;  1K94 A;  1XFV O;  2F2P A;  3WNX B;  1SPY A;  5HLV A;  2KSP A;  2B1U A;  2Q4U A;  1XFU O;  1REC A;  4PCW A;  3LK1 A;  4OKH A;  2LVI A;  3TS5 B;  4GFT A;  3AKB A;  4PE4 A;  1YX7 A;  2SCP A;  1V1G A;  1R2U A;  3NSL A;  1H8B A;  1K2H A;  2HPS A;  2R2I A;  3VRQ A;  1K96 A;  4N1F A;  2NZ0 A;  5AXI A;  1XFZ O;  2LMU A;  1UHN A;  1UHH A;  2JNX A;  5KTY A;  1BLQ A;  1NP8 A;  1H4B A;  4IL1 A;  4R1E A;  5F6T A;  1KQM C;  3AAJ A;  1YX8 A;  2LLS A;  1AJ4 A;  4OR9 B;  4YRU A;  5CSJ A;  5AAN A;  3CWG A;  2KI6 C;  2ZRS A;  1UUR A;  4DRW A;  1N2D A;  4GGN A;  3TZ1 A;  1NUB A;  3CS1 A;  1J7O A;  4JWQ A;  1B9A A;  1C07 A;  5JJG A;  2CXJ A;  3DVE A;  1YUR A;  1CMF A;  5DKQ A;  1J1E A;  1EH2 A;  1F4O A;  2BE6 A;  1SR6 C;  2PSR A;  3VRR A;  4U8D A;  2BKI B;  1F4Q A;  1NX2 A;  1ZMZ A;  3EK4 A;  1QX2 A;  1JFK A;  3ZNI A;  3NSI A;  5D69 A;  1OQP A;  1J1D A;  4BY5 A;  1CFC A;  3K21 A;  1DT7 B;  1XFW O;  2EGD A;  1BR4 B;  2L50 A;  2DOQ A;  4Q04 A;  1IWQ A;  1DVI A;  2JU0 A;  1IGV A;  4A4C A;  1QJT A;  3OX5 A;  4M2P A;  3SIA A;  1AK8 A;  2NCO A;  1ZAC A;  4TNC A;  4C0J A;  5KU1 A;  1AHR A;  2BBM A;  4M2O A;  2JT0 A;  3AAK A;  4XJK B;  1G33 A;  4MEW A;  4HRE E;  1S3P A;  4PE1 A;  2F3Z A;  4DCK A;  1SL8 A;  2KOT A;  2ZNE A;  2HF5 A;  2L5X B;  1TCF A;  2L0P A;  4PHM A;  2MA2 A;  1HT9 A;  1CDM A;  5K89 A;  3HX4 A;  2K0J A;  1DF0 A;  4YGA A;  1NSH A;  3BXK A;  1XYD A;  1KSO A;  2OTG C;  2BE4 A;  2BEC A;  1ZFS A;  1MF8 B;  5G08 A;  1B47 A;  1Y1A A;  1MR8 A;  3GOF A;  3DF0 A;  2LNK A;  3ZWH A;  4I5N B;  1HQV A;  1YVL A;  2MLF C;  3O6B A;  2Q91 A;  2KFF A;  4QJ4 B;  4HRG A;  4GNK B;  3I5F B;  2H2K A;  3EVR A;  1YUU A;  2L2E A;  5AEQ A;  1IQ3 A;  2KAY A;  1X02 A;  1CDP A;  2I18 A;  2LLU A;  1OMR A;  3KEV A;  2KNE A;  1CNP A;  1M45 A;  3EK8 A;  1VRK A;  1KK8 B;  1LIN A;  2LUX A;  1S26 D;  1DJG A;  3D10 A;  1BF5 A;  3FIA A;  5CSF A;  1WLZ A;  3CR2 A;  1CLB A;  1KFU S;  2M49 B;  1W7I B;  1BR1 B;  2L51 A;  3TDU A;  2KAV A;  3BUW B;  4PHJ A;  1N65 A;  4QJ3 B;  3FWC A;  1WRZ A;  3BUX B;  5CSN A;  2G2B A;  3EK7 A;  1CMG A;  1K9K A;  2E30 A;  1V1F A;  3PSR A;  1DGU A;  2BCX A;  3I5F C;  4JPZ B;  5J3X A;  1QXP A;  2O5G A;  1S1E A;  4DUQ A;  3IQO A;  1M39 A;  1W7J B;  3PN7 B;  2LE9 B;  5AER A;  3I5H B;  1PRW A;  1SNL A;  3NSK A;  3BOW B;  4MRX A;  2KI4 C;  1SK6 D;  1QVI Y;  1KK8 C;  2CTN A;  2GV5 A;  4YGC B;  1NX0 A;  4CLN A;  2I7A A;  1IQ5 A;  2E6W A;  4NDD A;  3SG5 A;  4DIR A;  1RRO A;  3KO0 A;  1GGZ A;  1Y1U A;  1CFF A;  5ER4 X;  4XYN A;  1C7W A;  2F33 A;  3NXA A;  3OB1 B;  3IF7 A;  1PVA A;  2F8P A;  2M1K B;  3DD4 A;  3DVK A;  3LL8 B;  5HKY A;  2NXQ A;  1MUX A;  2OPO A;  1UUS A;  2MHH A;  1SL7 A;  3I5I B;  4BY4 A;  3AKA A;  1KSM A;  2M9G A;  3SIB A;  3O78 A;  1DTL A;  1K9U A;  1U5I B;  3OB2 B;  4OVN F;  4ZCU A;  2OS8 C;  2K7D A;  2NLN A;  1YVH A;  3EKJ A;  1QV0 A;  4GPL B;  1OE9 B;  1KFU L;  3PN7 C;  1UWO A;  3LK0 A;  1FW4 A;  3SG6 A;  1IKU A;  5DKN A;  1XA5 A;  1UHI A;  2K7O A;  3DVM A;  1QX7 A;  1U5I A;  4ORB B;  4NDC A;  4ZCV A;  5I2Q A;  4WRI A;  2ZRT A;  1SW8 A;  3HCM A;  3TUY B;  2KFH A;  1GQM A;  4ORC B;  1EL4 A;  2L4H A;  1F55 A;  2ZND A;  1CM4 A;  1CM1 A;  2MLE C;  1PK0 D;  1B1G A;  1GGW A;  1TTX A;  1AUI B;  1KWO B;  1RTP 1;  3I5I C;  1QVI Z;  2LMT A;  2M7N A;  3BUN B;  4MBE A;  5AFP A;  1YTZ C;  1LVC D;  3TS5 C;  4I5J A;  2JNF A;  2Y1N A;  2KAX A;  2LVK A;  2PAS A;  3PLF B;  4PE7 A;  1A4P A;  2WCB A;  3IQQ A;  1G8I A;  2JTZ A;  3MSE B;  2O60 A;  1E8A A;  1QLS A;  1SY9 A;  4WQ2 A;  1S6C A;  2KYF A;  3BUM B;  4MVF A;  2LHI A;  3BUO B;  2M97 A;  1DF0 B;  4AQI A;  1OZS A;  3EKH A;  1S6I A;  3VRN A;  2KGB C;  1SMG A;  1KQV A;  3EVV A;  1CTR A;  1NWD A;  1QLK A;  2WC8 A;  1WLM A;  3DF0 B;  3CR5 X;  2CCM A;  2LHL A;  1LA3 A;  4ORA B;  2LVJ A;  1FI6 A;  3TDZ A;  3JTD B;  1Y0V H;  1TCO B;  1IH0 A;  5HLO A;  1B8R A;  1KK7 Z;  1NCY A;  1F8H A;  2LC5 A;  1KWO C;  4CFR A;  2KQ6 A;  1MQ1 A;  1CB1 A;  4DS7 A;  3NSO A;  1KCY A;  3D0Y A;  1SCM B;  4YGB B;  1QAS A;  4N5X A;  2JUL A;  3RLZ A;  1L7Z A;  5I8N A;  1LXF C;  3SJS A;  1SL9 A;  4E68 A;  4I5L B;  1Y1X A;  4PHK A;  1N0Y A;  5ER5 A;  2H61 A;  1S5G Y;  1QTX A;  1BG1 A;  1B7T Y;  1TNP A;  1XFX O;  2HQW A;  3BQ3 A;  1DJW A;  4PDZ A;  4MRY A;  1JFJ A;  1QAT A;  2FCD A;  1YRU B;  1PVB A;  4UPG A;  1DJH A;  3F45 A;  2GGM A;  5KSZ A;  1LA0 A;  2AAO A;  3LLE A;  3JVT B;  3JTD C;  1TNW A;  2K7C A;  2ZFD A;  4GGF A;  1C7V A;  1FF1 A;  2K8M B;  1M31 A;  4HRH A;  3CGA A;  3DVJ A;  2QAC A;  2VRG A;  3M0W A;  2M3W A;  2PAL A;  1JBA A;  2IS9 A;  3O4Y A;  3VRO A;  4OCI A;  2JT8 A;  1BU3 A;  1ODB A;  1ZOT B;  2LM5 A;  1WY9 A;  4I5K A;  4FTG A;  1AP4 A;  1F54 A;  1XK4 A;  4OV2 A;  1B4C A;  2JOJ A;  4MZL A;  3QRX A;  4JQ0 D;  2JXC A;  1QV1 A;  1CKK A; 
#chains in the Genus database with same CATH topology
 2LVV A;  1TNQ A;  3OBV A;  4KYN A;  1OSA A;  2GGZ A;  5TNC A;  4CPV A;  3FS7 A;  3H4S E;  2JT3 A;  2Y5I A;  4PE0 A;  3CR4 X;  4YGD B;  3JVT C;  1T14 A;  3NGV A;  4MZK A;  1UHK A;  4PAL A;  4YI9 A;  1K90 D;  2ISD A;  5HYD A;  1F71 A;  1S5G Z;  1YUS A;  4YBH B;  1TUZ A;  3B86 A;  4USL A;  1B7T Z;  3S0A A;  1A2X A;  2M0R A;  4P5O E;  5BPJ A;  1JSA A;  1YUT A;  2M29 A;  3DXL A;  1OMV A;  2WOR A;  2L98 A;  1OOG A;  2WCH A;  3CZT X;  2JRF A;  1RK9 A;  3VB1 A;  1DEK A;  1EG3 A;  2WCK A;  1OOJ A;  1CDL A;  2EHB A;  3CZ1 A;  2KBI A;  3GK1 A;  3UNW A;  2JWW A;  1IRJ A;  2CBL A;  3I5H C;  2JPT A;  1CLL A;  1EXR A;  2M1U A;  1TIZ A;  1CFP A;  2AUC A;  2K2F A;  2PRU A;  1KK7 Y;  4YGE B;  1K8U A;  2F3Y A;  2KQY A;  4YI8 A;  1K95 A;  1NX3 A;  5I2O A;  3TDI A;  1TNX A;  2NCP A;  4MN0 A;  1SR6 B;  1PUL A;  2M7L A;  2KGR A;  1SCV A;  1UHJ A;  3CLN A;  1XVJ A;  3EG5 B;  4PT1 A;  4D1E A;  1NX1 A;  3R1O A;  1CDN A;  3KHE A;  1JC2 A;  1A03 A;  1Q80 A;  1S6J A;  2JXL A;  5B8I B;  2BCA A;  3NHT A;  4QJ5 B;  1CFD A;  1S36 A;  2MJW B;  4MLW A;  3A4U B;  2HET A;  2Y1M A;  2MRD A;  2KHN A;  2LAP A;  1DQE A;  3O2P A;  2ZKM X;  4GAO A;  2BAP A;  1ALV A;  2BKH B;  1J55 A;  2BL0 B;  4C0K A;  3D74 A;  1GJY A;  3OHM B;  1QX5 B;  2L4I A;  2JPO A;  1Y6W A;  2JQ6 A;  2KBM A;  2KPH A;  2LAN A;  3R1V A;  5D7F A;  3BYA A;  4WQ3 A;  2G9B A;  3WHU B;  2QDI A;  3ICB A;  2AMI A;  3NHI A;  1DGV A;  1MXL C;  2QPT A;  2WCJ A;  2F2O A;  3PAT A;  1WRL A;  4MZJ A;  2OTG B;  1BMO A;  2KDH A;  4F0Z B;  3TUY C;  1DEL A;  1XO5 A;  4GBA A;  1PSB A;  1K93 D;  4M2Q A;  2LP2 A;  3D0Y B;  3S0G A;  4CFQ A;  4C0L A;  2FCE A;  2FOT A;  1J7Q A;  3BFH A;  1SRA A;  3VGO A;  1DMO A;  2RGI A;  1K9P A;  4N1G A;  1LKJ A;  3FE8 A;  5JOL A;  2WND A;  5CPV A;  2QEO A;  3I5G B;  4A4B A;  5IBW A;  4GUK A;  3SG4 A;  2K7B A;  1TOP A;  2KFG A;  2LCP A;  2P6B B;  2TN4 A;  4L9M A;  1DJI A;  2JTT A;  1MHO A;  3GK2 A;  5CSI A;  2D8N A;  2KYC A;  4CID A;  1JF2 A;  1SBJ A;  2BL0 C;  2FJY A;  1NYA A;  2SAS A;  3B88 A;  5I94 A;  2MBX A;  1FI5 A;  2CNP A;  2LLT A;  1MWN A;  2FJU B;  3V2L A;  3EVU A;  1JWD A;  1UP5 A;  1ALW A;  3LCP C;  1RJV A;  1XFY O;  5EL2 A;  3OGN A;  1B8C A;  1B8L A;  2BBN A;  4NQG A;  4XJK A;  3E3R A;  3WHT B;  4HSZ A;  1G4Y R;  1F70 A;  1DJX A;  1JUO A;  3CYZ A;  2HQ8 A;  2ZN8 A;  3OP0 A;  3PM2 A;  3A8R A;  1RWY A;  1OZO A;  1WDC B;  1D1O A;  1FBV A;  5GQQ C;  1FPW A;  3PAL A;  4NDB A;  2WCF A;  2EC6 B;  4FQO A;  3PM8 A;  1YR5 A;  5I2L A;  2M8U A;  1KFX S;  2H61 C;  4MSP A;  4ICB A;  3I5G C;  5DKR A;  2ERB A;  1SCM C;  1BOD A;  2JC2 A;  5FYX A;  4AQJ A;  2PMY A;  2JZI A;  2KI4 B;  2WCE A;  1AVS A;  2WOS A;  5HKZ A;  1NPQ A;  2PVB A;  3VRP A;  1JF0 A;  1MXE A;  3PFV A;  1SYM A;  2WC6 A;  5DIC A;  2LUC A;  1L2O B;  2WCL A;  1DJZ A;  3PJI A;  2COL B;  1TN4 A;  1NCZ A;  4GGF C;  1NIW A;  1BJF A;  1QIW A;  2ZN9 A;  3SG3 A;  1EG4 A;  1PAL A;  1J7P A;  3FWB A;  2LV7 A;  3CTN A;  2I94 A;  1EJ3 A;  3GK4 X;  3DY9 A;  4ETO A;  1WDC C;  3SG2 A;  2WC5 A;  2OS8 B;  2EC6 C;  1A75 B;  3SG7 A;  2CT9 A;  1XK4 C;  5HKW A;  4P2Y B;  1OOH A;  2K61 A;  1RFJ A;  4PHN A;  1J7R A;  2A4J A;  1QIV A;  1ZUZ A;  2LMV A;  3KF9 A;  2LP3 A;  2I2R E;  1C3Z A;  1SKT A;  1CLM A;  3KPX A;  1BT6 A;  1KQM B;  2MAZ A;  1R6P A;  2Y4Q A;  1IJ6 A;  3OX6 A;  1M63 B;  1BOC A;  1A75 A;  2L2C A;  1IJ5 A;  1PSR A;  1WRK A;  1QS7 A;  1YRT B;  2K2A A;  2QEH A;  1TRF A;  1AJ5 A;  3WXA A;  1Z2C B;  1A29 A;  1L2O C;  1OMD A;  1IG5 A;  5PAL A;  2V53 A;  1DJY A;  1M46 A;  1NCX A;  2KI6 D;  3K1E A;  3C1V A;  3BOW A;  3RM1 A;  1KFX L;  2BCB A;  5FI6 A;  4AOM A;  1K94 A;  1XFV O;  2F2P A;  3WNX B;  1SPY A;  5HLV A;  2KSP A;  2B1U A;  2Q4U A;  1XFU O;  1REC A;  4PCW A;  3LK1 A;  4OKH A;  2LVI A;  3TS5 B;  5FI7 A;  2QEV A;  3AKB A;  4GFT A;  1GM0 A;  4PE4 A;  1YX7 A;  2SCP A;  1V1G A;  1R2U A;  3NSL A;  1H8B A;  3FE6 A;  2HPS A;  2R2I A;  1K2H A;  3VRQ A;  1K96 A;  5HL1 A;  4N1F A;  2NZ0 A;  5AXI A;  1XFZ O;  2LMU A;  1UHN A;  1UHH A;  2JNX A;  5KTY A;  1BLQ A;  1NP8 A;  1H4B A;  4IL1 A;  4R1E A;  5F6T A;  1KQM C;  3AAJ A;  1YX8 A;  2K60 A;  2LLS A;  1AJ4 A;  4OR9 B;  4YRU A;  1Z4H A;  5CSJ A;  4INW A;  5AAN A;  3CWG A;  2KI6 C;  2ZRS A;  1UUR A;  4DRW A;  1N2D A;  2KLE A;  4GGN A;  3TZ1 A;  1NUB A;  3CS1 A;  1J7O A;  4JWQ A;  1B9A A;  1OOI X;  5JJG A;  1C07 A;  2CXJ A;  3DVE A;  1YUR A;  1CMF A;  5DKQ A;  1J1E A;  1EH2 A;  1F4O A;  2BE6 A;  1SR6 C;  2PSR A;  3SS5 A;  3VRR A;  4U8D A;  3UO9 A;  2BKI B;  1F4Q A;  1NX2 A;  1ZMZ A;  3EK4 A;  3SS3 A;  1QX2 A;  3FE9 A;  3R1P A;  3O4X A;  1JFK A;  3ZNI A;  3NSI A;  3D76 A;  1OQP A;  1J1D A;  5D69 A;  4BY5 A;  1CFC A;  3K21 A;  3L47 A;  1DT7 B;  1XFW O;  2EGD A;  4F7F A;  1BR4 B;  2L50 A;  2DOQ A;  4Q04 A;  3DZT A;  1IWQ A;  1DVI A;  2JU0 A;  1IGV A;  4A4C A;  1QJT A;  3OX5 A;  4M2P A;  3SIA A;  1AK8 A;  2NCO A;  3IVT A;  1ZAC A;  2KLD A;  4TNC A;  4C0J A;  2P71 A;  5KU1 A;  1AHR A;  2BBM A;  4M2O A;  2JT0 A;  3AAK A;  3D73 A;  4XJK B;  1G33 A;  3CZ0 A;  4HRE E;  4MEW A;  3S0F A;  1S3P A;  4PE1 A;  2F3Z A;  4DCK A;  1SL8 A;  2KOT A;  3D78 A;  2ZNE A;  2HF5 A;  2L5X B;  4INX A;  1TCF A;  2L0P A;  4PHM A;  2MA2 A;  1HT9 A;  1CDM A;  3QME A;  5K89 A;  3HX4 A;  2K0J A;  1DF0 A;  4YGA A;  1NSH A;  3BXK A;  1XYD A;  1KSO A;  2OTG C;  2BE4 A;  2BEC A;  1ZFS A;  1MF8 B;  5G08 A;  1B47 A;  1Y1A A;  1MR8 A;  2H8V A;  3GOF A;  3DF0 A;  2LNK A;  3ZWH A;  4I5N B;  1HQV A;  1YVL A;  2MLF C;  1OW4 A;  3O6B A;  2Q91 A;  2KFF A;  4QJ4 B;  4HRG A;  4GNK B;  3I5F B;  2H2K A;  3EVR A;  1YUU A;  1LS8 A;  2L2E A;  5AEQ A;  1IQ3 A;  2KAY A;  1X02 A;  1CDP A;  2I18 A;  2LLU A;  1OMR A;  3BFA A;  3KEV A;  2BNX A;  2KNE A;  1CNP A;  1M45 A;  3BFB A;  3EK8 A;  1VRK A;  1KK8 B;  1LIN A;  2LUX A;  1S26 D;  1DJG A;  3D10 A;  3RZS A;  1BF5 A;  2PYQ A;  3FIA A;  5CSF A;  1WLZ A;  3CR2 A;  1CLB A;  1KFU S;  2M49 B;  1SSE B;  1W7I B;  1BR1 B;  2L51 A;  3TDU A;  2KAV A;  3BUW B;  4PHJ A;  1N65 A;  4QJ3 B;  1ORG A;  3FWC A;  1WRZ A;  3BUX B;  1TUJ A;  5CSN A;  2G2B A;  3DYE A;  3EK7 A;  1CMG A;  1K9K A;  2E30 A;  1V1F A;  3PSR A;  3Q8I A;  3S0D A;  1DGU A;  2BCX A;  3I5F C;  4JPZ B;  5J3X A;  1QXP A;  2O5G A;  1S1E A;  4DUQ A;  3IQO A;  1M39 A;  1W7J B;  3PN7 B;  2LE9 B;  3N7H A;  5FI2 A;  5AER A;  3I5H B;  1PRW A;  1SNL A;  3B6X A;  1IIO A;  3NSK A;  3BOW B;  4FQT A;  4MRX A;  2KI4 C;  1SK6 D;  1QVI Y;  1KK8 C;  2CTN A;  3SS4 A;  3S0B A;  2GV5 A;  4JKT A;  2WCM A;  4YGC B;  1NX0 A;  4CLN A;  2I7A A;  2L5Y A;  1IQ5 A;  2E6W A;  4NDD A;  3SG5 A;  4DIR A;  1RRO A;  2YGU A;  3KO0 A;  1GGZ A;  1Y1U A;  4OZD A;  1CFF A;  5ER4 X;  4XYN A;  1C7W A;  3R72 A;  2F33 A;  3NXA A;  3OB1 B;  3IF7 A;  1PVA A;  2F8P A;  2M1K B;  3DD4 A;  3DVK A;  3LL8 B;  5HKY A;  2NXQ A;  1MUX A;  2OPO A;  1UUS A;  1P28 A;  2MHH A;  1SL7 A;  3I5I B;  4BY4 A;  3AKA A;  1KSM A;  2M9G A;  3SIB A;  3O78 A;  1DTL A;  1K9U A;  1U5I B;  3OB2 B;  4OVN F;  4ZCU A;  2PQL A;  2OS8 C;  1C3Y A;  2K7D A;  2NLN A;  1YVH A;  3EKJ A;  1QV0 A;  4GPL B;  1OE9 B;  2GTE A;  1KFU L;  3PN7 C;  1UWO A;  3LK0 A;  1FW4 A;  3SG6 A;  1IKU A;  5DKN A;  1XA5 A;  1UHI A;  2K7O A;  3DVM A;  1QX7 A;  1U5I A;  4ORB B;  4NDC A;  3L4L A;  4ZCV A;  5I2Q A;  4WRI A;  3CAB A;  1TWO A;  2ZRT A;  1SW8 A;  3HCM A;  3TUY B;  2KFH A;  1GQM A;  4ORC B;  1EL4 A;  2L4H A;  2P70 A;  2QEB A;  1F55 A;  2ZND A;  1CM4 A;  1CM1 A;  2MLE C;  1PK0 D;  1XFR A;  1B1G A;  1GGW A;  1TTX A;  1AUI B;  1KWO B;  1RTP 1;  3I5I C;  1QVI Z;  2LMT A;  2M7N A;  3BUN B;  4MBE A;  5AFP A;  1YTZ C;  1LVC D;  3TS5 C;  4I5J A;  2JNF A;  2Y1N A;  2KAX A;  3CZ2 A;  2LVK A;  3D77 A;  2PAS A;  3D75 A;  3PLF B;  1A4P A;  4PE7 A;  2WCB A;  3IQQ A;  1G8I A;  2JTZ A;  3MSE B;  2O60 A;  3B7A A;  1E8A A;  1QLS A;  1SY9 A;  4WQ2 A;  1S6C A;  2KYF A;  3BUM B;  4MVF A;  2LHI A;  3BUO B;  2M97 A;  1DF0 B;  4AQI A;  1OZS A;  3EKH A;  1S6I A;  3VRN A;  2KGB C;  1DC1 A;  1SMG A;  1KQV A;  3EVV A;  1CTR A;  1NWD A;  1QLK A;  2WC8 A;  1WLM A;  3DF0 B;  3CR5 X;  2CCM A;  2LHL A;  1LA3 A;  4ORA B;  2LVJ A;  1FI6 A;  3TDZ A;  3JTD B;  1Y0V H;  1TCO B;  3S0E A;  1IH0 A;  5HLO A;  1B8R A;  1KK7 Z;  1NCY A;  1F8H A;  2LC5 A;  1KWO C;  4CFR A;  2KQ6 A;  1MQ1 A;  1CB1 A;  4DS7 A;  3NSO A;  1KCY A;  3D0Y A;  1SCM B;  4YGB B;  1QAS A;  4N5X A;  2JUL A;  5D3O A;  3RLZ A;  3BJH A;  1L7Z A;  5I8N A;  1LXF C;  3SJS A;  1SL9 A;  3B87 A;  4I5L B;  4E68 A;  1Y1X A;  4PHK A;  1N0Y A;  5ER5 A;  2H61 A;  1S5G Y;  1QTX A;  1BG1 A;  1B7T Y;  1TNP A;  1XFX O;  2HQW A;  3BQ3 A;  1DJW A;  4PDZ A;  4MRY A;  3L4A A;  1JFJ A;  1QAT A;  2FCD A;  1YRU B;  1PVB A;  4UPG A;  1DJH A;  3F45 A;  2GGM A;  5KSZ A;  1LA0 A;  2AAO A;  3LLE A;  3JVT B;  3JTD C;  1TNW A;  2K7C A;  2ZFD A;  4GGF A;  3CDN A;  1C7V A;  1FF1 A;  4JD9 A;  2K8M B;  1M31 A;  4HRH A;  3CGA A;  3DVJ A;  2QAC A;  2VRG A;  3M0W A;  1OOF A;  2M3W A;  1W9Z A;  2PAL A;  1JBA A;  2IS9 A;  3O4Y A;  3VRO A;  4OCI A;  2JT8 A;  1BU3 A;  4IJ7 A;  1ODB A;  1ZOT B;  1QWV A;  1WY9 A;  2LM5 A;  4I5K A;  4FTG A;  1AP4 A;  1F54 A;  1XK4 A;  4OV2 A;  1B4C A;  2JOJ A;  4MZL A;  3QRX A;  4JQ0 D;  2JXC A;  1QV1 A;  1CKK A; 
#chains in the Genus database with same CATH homology
 2LVV A;  1TNQ A;  1OSA A;  2GGZ A;  5TNC A;  4CPV A;  3FS7 A;  3H4S E;  2JT3 A;  2Y5I A;  4PE0 A;  3CR4 X;  4YGD B;  3JVT C;  4MZK A;  1UHK A;  4PAL A;  4YI9 A;  1K90 D;  2ISD A;  5HYD A;  1F71 A;  1S5G Z;  1YUS A;  4YBH B;  4USL A;  1B7T Z;  1A2X A;  2M0R A;  4P5O E;  5BPJ A;  1JSA A;  1YUT A;  2M29 A;  1OMV A;  2WOR A;  2L98 A;  3CZT X;  2JRF A;  1RK9 A;  1EG3 A;  1OOJ A;  1CDL A;  2EHB A;  3GK1 A;  2KBI A;  2JWW A;  1IRJ A;  2CBL A;  3I5H C;  2JPT A;  1CLL A;  1EXR A;  2M1U A;  1TIZ A;  1CFP A;  2AUC A;  2K2F A;  2PRU A;  1KK7 Y;  4YGE B;  1K8U A;  2F3Y A;  2KQY A;  4YI8 A;  1K95 A;  1NX3 A;  5I2O A;  3TDI A;  1TNX A;  2NCP A;  4MN0 A;  1SR6 B;  1PUL A;  2M7L A;  2KGR A;  1SCV A;  1UHJ A;  3CLN A;  1XVJ A;  4D1E A;  1NX1 A;  1CDN A;  1JC2 A;  3KHE A;  1A03 A;  1Q80 A;  1S6J A;  2JXL A;  5B8I B;  2BCA A;  4QJ5 B;  1CFD A;  1S36 A;  2MJW B;  4MLW A;  3A4U B;  2HET A;  2Y1M A;  2MRD A;  2KHN A;  2LAP A;  3O2P A;  2ZKM X;  4GAO A;  1ALV A;  2BKH B;  1J55 A;  2BL0 B;  4C0K A;  1GJY A;  3OHM B;  1QX5 B;  2L4I A;  1Y6W A;  2JQ6 A;  2KBM A;  2LAN A;  5D7F A;  3BYA A;  4WQ3 A;  2G9B A;  3WHU B;  3ICB A;  2AMI A;  1DGV A;  1MXL C;  2QPT A;  2F2O A;  3PAT A;  1WRL A;  4MZJ A;  2OTG B;  1BMO A;  2KDH A;  4F0Z B;  3TUY C;  1XO5 A;  4GBA A;  1PSB A;  1K93 D;  4M2Q A;  2LP2 A;  3D0Y B;  4CFQ A;  4C0L A;  2FCE A;  2FOT A;  1J7Q A;  3VGO A;  1SRA A;  1DMO A;  2RGI A;  1K9P A;  4N1G A;  1LKJ A;  5JOL A;  2WND A;  5CPV A;  3I5G B;  4A4B A;  5IBW A;  4GUK A;  3SG4 A;  2K7B A;  1TOP A;  2KFG A;  2LCP A;  2P6B B;  2TN4 A;  4L9M A;  1DJI A;  2JTT A;  1MHO A;  3GK2 A;  5CSI A;  2D8N A;  2KYC A;  4CID A;  1JF2 A;  1SBJ A;  2BL0 C;  2SAS A;  1NYA A;  2MBX A;  1FI5 A;  2CNP A;  2LLT A;  1MWN A;  2FJU B;  3EVU A;  1JWD A;  1UP5 A;  1ALW A;  3LCP C;  1RJV A;  1XFY O;  4NQG A;  1B8C A;  1B8L A;  2BBN A;  4XJK A;  3E3R A;  3WHT B;  4HSZ A;  1G4Y R;  1F70 A;  1DJX A;  1JUO A;  2HQ8 A;  2ZN8 A;  3OP0 A;  3A8R A;  1RWY A;  1OZO A;  1WDC B;  1D1O A;  1FBV A;  5GQQ C;  1FPW A;  3PAL A;  4NDB A;  2WCF A;  2EC6 B;  4FQO A;  3PM8 A;  1YR5 A;  5I2L A;  2M8U A;  1KFX S;  2H61 C;  4MSP A;  4ICB A;  3I5G C;  5DKR A;  1SCM C;  1BOD A;  2JC2 A;  5FYX A;  4AQJ A;  2PMY A;  2JZI A;  2KI4 B;  2WCE A;  1AVS A;  2WOS A;  5HKZ A;  1NPQ A;  2PVB A;  3VRP A;  1JF0 A;  1MXE A;  3PFV A;  1SYM A;  2LUC A;  1L2O B;  1DJZ A;  2COL B;  1TN4 A;  1NCZ A;  4GGF C;  1NIW A;  1BJF A;  1QIW A;  2ZN9 A;  3SG3 A;  1EG4 A;  1PAL A;  1J7P A;  3FWB A;  2LV7 A;  3CTN A;  2I94 A;  1EJ3 A;  3GK4 X;  4ETO A;  1WDC C;  3SG2 A;  2OS8 B;  2EC6 C;  1A75 B;  3SG7 A;  2CT9 A;  1XK4 C;  5HKW A;  4P2Y B;  2K61 A;  4PHN A;  1RFJ A;  1J7R A;  2A4J A;  1QIV A;  1ZUZ A;  2LMV A;  3KF9 A;  2LP3 A;  2I2R E;  3KPX A;  1SKT A;  1CLM A;  1BT6 A;  1KQM B;  2MAZ A;  1R6P A;  2Y4Q A;  1IJ6 A;  3OX6 A;  1M63 B;  1BOC A;  1A75 A;  1IJ5 A;  1PSR A;  1WRK A;  1QS7 A;  1YRT B;  2K2A A;  3WXA A;  1TRF A;  1AJ5 A;  1A29 A;  1L2O C;  1OMD A;  1IG5 A;  5PAL A;  2V53 A;  1DJY A;  1M46 A;  1NCX A;  2KI6 D;  3C1V A;  3BOW A;  3RM1 A;  1KFX L;  2BCB A;  4AOM A;  1K94 A;  1XFV O;  2F2P A;  3WNX B;  1SPY A;  5HLV A;  2KSP A;  2B1U A;  2Q4U A;  1XFU O;  1REC A;  4PCW A;  3LK1 A;  4OKH A;  2LVI A;  3TS5 B;  4GFT A;  3AKB A;  4PE4 A;  1YX7 A;  2SCP A;  1V1G A;  1R2U A;  3NSL A;  1H8B A;  1K2H A;  2HPS A;  2R2I A;  3VRQ A;  1K96 A;  4N1F A;  2NZ0 A;  5AXI A;  1XFZ O;  2LMU A;  1UHN A;  1UHH A;  2JNX A;  5KTY A;  1BLQ A;  1NP8 A;  1H4B A;  4IL1 A;  4R1E A;  5F6T A;  1KQM C;  3AAJ A;  1YX8 A;  2LLS A;  1AJ4 A;  4OR9 B;  4YRU A;  5CSJ A;  5AAN A;  3CWG A;  2KI6 C;  2ZRS A;  1UUR A;  4DRW A;  1N2D A;  4GGN A;  3TZ1 A;  1NUB A;  3CS1 A;  1J7O A;  4JWQ A;  1B9A A;  1C07 A;  5JJG A;  2CXJ A;  3DVE A;  1YUR A;  1CMF A;  5DKQ A;  1J1E A;  1EH2 A;  1F4O A;  2BE6 A;  1SR6 C;  2PSR A;  3VRR A;  4U8D A;  2BKI B;  1F4Q A;  1NX2 A;  1ZMZ A;  3EK4 A;  1QX2 A;  1JFK A;  3ZNI A;  3NSI A;  5D69 A;  1OQP A;  1J1D A;  4BY5 A;  1CFC A;  3K21 A;  1DT7 B;  1XFW O;  2EGD A;  1BR4 B;  2L50 A;  2DOQ A;  4Q04 A;  1IWQ A;  1DVI A;  2JU0 A;  1IGV A;  4A4C A;  1QJT A;  3OX5 A;  4M2P A;  3SIA A;  1AK8 A;  2NCO A;  1ZAC A;  4TNC A;  4C0J A;  5KU1 A;  1AHR A;  2BBM A;  4M2O A;  2JT0 A;  3AAK A;  4XJK B;  1G33 A;  4MEW A;  4HRE E;  1S3P A;  4PE1 A;  2F3Z A;  4DCK A;  1SL8 A;  2KOT A;  2ZNE A;  2HF5 A;  2L5X B;  1TCF A;  2L0P A;  4PHM A;  2MA2 A;  1HT9 A;  1CDM A;  5K89 A;  3HX4 A;  2K0J A;  1DF0 A;  4YGA A;  1NSH A;  3BXK A;  1XYD A;  1KSO A;  2OTG C;  2BE4 A;  2BEC A;  1ZFS A;  1MF8 B;  5G08 A;  1B47 A;  1Y1A A;  1MR8 A;  3GOF A;  3DF0 A;  2LNK A;  3ZWH A;  4I5N B;  1HQV A;  1YVL A;  2MLF C;  3O6B A;  2Q91 A;  2KFF A;  4QJ4 B;  4HRG A;  4GNK B;  3I5F B;  2H2K A;  3EVR A;  1YUU A;  2L2E A;  5AEQ A;  1IQ3 A;  2KAY A;  1X02 A;  1CDP A;  2I18 A;  2LLU A;  1OMR A;  3KEV A;  2KNE A;  1CNP A;  1M45 A;  3EK8 A;  1VRK A;  1KK8 B;  1LIN A;  2LUX A;  1S26 D;  1DJG A;  3D10 A;  1BF5 A;  3FIA A;  5CSF A;  1WLZ A;  3CR2 A;  1CLB A;  1KFU S;  2M49 B;  1W7I B;  1BR1 B;  2L51 A;  3TDU A;  2KAV A;  3BUW B;  4PHJ A;  1N65 A;  4QJ3 B;  3FWC A;  1WRZ A;  3BUX B;  5CSN A;  2G2B A;  3EK7 A;  1CMG A;  1K9K A;  2E30 A;  1V1F A;  3PSR A;  1DGU A;  2BCX A;  3I5F C;  4JPZ B;  5J3X A;  1QXP A;  2O5G A;  1S1E A;  4DUQ A;  3IQO A;  1M39 A;  1W7J B;  3PN7 B;  2LE9 B;  5AER A;  3I5H B;  1PRW A;  1SNL A;  3NSK A;  3BOW B;  4MRX A;  2KI4 C;  1SK6 D;  1QVI Y;  1KK8 C;  2CTN A;  2GV5 A;  4YGC B;  1NX0 A;  4CLN A;  2I7A A;  1IQ5 A;  2E6W A;  4NDD A;  3SG5 A;  4DIR A;  1RRO A;  3KO0 A;  1GGZ A;  1Y1U A;  1CFF A;  5ER4 X;  4XYN A;  1C7W A;  2F33 A;  3NXA A;  3OB1 B;  3IF7 A;  1PVA A;  2F8P A;  2M1K B;  3DD4 A;  3DVK A;  3LL8 B;  5HKY A;  2NXQ A;  1MUX A;  2OPO A;  1UUS A;  2MHH A;  1SL7 A;  3I5I B;  4BY4 A;  3AKA A;  1KSM A;  2M9G A;  3SIB A;  3O78 A;  1DTL A;  1K9U A;  1U5I B;  3OB2 B;  4OVN F;  4ZCU A;  2OS8 C;  2K7D A;  2NLN A;  1YVH A;  3EKJ A;  1QV0 A;  4GPL B;  1OE9 B;  1KFU L;  3PN7 C;  1UWO A;  3LK0 A;  1FW4 A;  3SG6 A;  1IKU A;  5DKN A;  1XA5 A;  1UHI A;  2K7O A;  3DVM A;  1QX7 A;  1U5I A;  4ORB B;  4NDC A;  4ZCV A;  5I2Q A;  4WRI A;  2ZRT A;  1SW8 A;  3HCM A;  3TUY B;  2KFH A;  1GQM A;  4ORC B;  1EL4 A;  2L4H A;  1F55 A;  2ZND A;  1CM4 A;  1CM1 A;  2MLE C;  1PK0 D;  1B1G A;  1GGW A;  1TTX A;  1AUI B;  1KWO B;  1RTP 1;  3I5I C;  1QVI Z;  2LMT A;  2M7N A;  3BUN B;  4MBE A;  5AFP A;  1YTZ C;  1LVC D;  3TS5 C;  4I5J A;  2JNF A;  2Y1N A;  2KAX A;  2LVK A;  2PAS A;  3PLF B;  4PE7 A;  1A4P A;  2WCB A;  3IQQ A;  1G8I A;  2JTZ A;  3MSE B;  2O60 A;  1E8A A;  1QLS A;  1SY9 A;  4WQ2 A;  1S6C A;  2KYF A;  3BUM B;  4MVF A;  2LHI A;  3BUO B;  2M97 A;  1DF0 B;  4AQI A;  1OZS A;  3EKH A;  1S6I A;  3VRN A;  2KGB C;  1SMG A;  1KQV A;  3EVV A;  1CTR A;  1NWD A;  1QLK A;  2WC8 A;  1WLM A;  3DF0 B;  3CR5 X;  2CCM A;  2LHL A;  1LA3 A;  4ORA B;  2LVJ A;  1FI6 A;  3TDZ A;  3JTD B;  1Y0V H;  1TCO B;  1IH0 A;  5HLO A;  1B8R A;  1KK7 Z;  1NCY A;  1F8H A;  2LC5 A;  1KWO C;  4CFR A;  2KQ6 A;  1MQ1 A;  1CB1 A;  4DS7 A;  3NSO A;  1KCY A;  3D0Y A;  1SCM B;  4YGB B;  1QAS A;  4N5X A;  2JUL A;  3RLZ A;  1L7Z A;  5I8N A;  1LXF C;  3SJS A;  1SL9 A;  4E68 A;  4I5L B;  1Y1X A;  4PHK A;  1N0Y A;  5ER5 A;  2H61 A;  1S5G Y;  1QTX A;  1BG1 A;  1B7T Y;  1TNP A;  1XFX O;  2HQW A;  3BQ3 A;  1DJW A;  4PDZ A;  4MRY A;  1JFJ A;  1QAT A;  2FCD A;  1YRU B;  1PVB A;  4UPG A;  1DJH A;  3F45 A;  2GGM A;  5KSZ A;  1LA0 A;  2AAO A;  3LLE A;  3JVT B;  3JTD C;  1TNW A;  2K7C A;  2ZFD A;  4GGF A;  1C7V A;  1FF1 A;  2K8M B;  1M31 A;  4HRH A;  3CGA A;  3DVJ A;  2QAC A;  2VRG A;  3M0W A;  2M3W A;  2PAL A;  1JBA A;  2IS9 A;  3O4Y A;  3VRO A;  4OCI A;  2JT8 A;  1BU3 A;  1ODB A;  1ZOT B;  2LM5 A;  1WY9 A;  4I5K A;  4FTG A;  1AP4 A;  1F54 A;  1XK4 A;  4OV2 A;  1B4C A;  2JOJ A;  4MZL A;  3QRX A;  4JQ0 D;  2JXC A;  1QV1 A;  1CKK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...