4OKHA

Crystal structure of calpain-3 penta-ef-hand domain
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
176
structure length
171
Chain Sequence
QQQFRNIFKQIAGDDMEICADELKKVLNTVVNKTHGFTLESCRSMIALMDTDGSGKLNLQEFHHLWNKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMYALEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Calpain-3
publication title Crystal structure of calpain-3 penta-EF-hand (PEF) domain - a homodimerized PEF family member with calcium bound at the fifth EF-hand.
pubmed doi rcsb
source organism Homo sapiens
total genus 60
structure length 171
sequence length 176
chains with identical sequence B, C
ec nomenclature ec 3.4.22.54: Calpain-3.
pdb deposition date 2014-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4okhA00
3I5GB 1S1EA 5I2QA 1UP5A 1H8BA 4P2YB 1BR1B 1CB1A 2MBXA 1MQ1A 3A4UB 4YGAA 1NX2A 4GBAA 2KHNA 1CTRA 4ETOA 2D8NA 1SYMA 3TS5C 1G33A 4MLWA 5CSFA 4UPGA 1DMOA 2KAVA 1CFPA 1N2DA 2WOSA 5CSNA 1AHRA 3HX4A 3CGAA 3O6BA 1NCYA 1BODA 2QPTA 2ZFDA 4DIRA 1IJ5A 1TIZA 1CDNA 2KI6D 3AAJA 5G08A 1ZOTB 1ALWA 2KGRA 1NIWA 1TTXA 1SK6D 4CPVA 4P5OE 2CNPA 2B1UA 2ZRTA 3SG7A 2CTNA 5TNCA 2L51A 5AXIA 1SKTA 2LAPA 4HRGA 2I7AA 1PK0D 2M49B 4NDBA 2HQWA 1X02A 2LLUA 1UURA 3EK7A 2LCPA 3BYAA 4NDDA 1ALVA 3KHEA 1LXFC 1KFUS 1DJGA 4N1FA 3ICBA 1TN4A 1CM4A 1CFCA 1H4BA 1PSRA 2IS9A 1QIWA 1KFUL 2F3ZA 2HPSA 2Y4QA 1SR6B 3FWCA 4YBHB 1Q80A 2OS8C 3DVMA 2I18A 1OE9B 1F70A 1RROA 3PATA 1ZUZA 5AANA 1S6IA 2K8MB 3PN7C 3LLEA 1JSAA 1KSMA 4JWQA 2LMUA 1S36A 3ZNIA 1JWDA 4ZCVA 4BY5A 1F71A 2F33A 2CBLA 4HSZA 2CXJA 2RGIA 1BF5A 2R2IA 2L5XB 3O4YA 1MXEA 2AUCA 3ZWHA 2JOJA 2MLFC 3CR2A 2I94A 3CWGA 2LM5A 5HYDA 1IGVA 4OR9B 3EVUA 1LINA 3SIAA 1KK7Y 2G2BA 1S5GZ 1YX8A 1EXRA 1QXPA 5B8IB 1YUTA 3JTDC 3GK1A 3KPXA 1MR8A 5HLOA 1F8HA 4MVFA 5CPVA 1SNLA 2PSRA 4YI9A 1DJWA 1IRJA 4GGNA 1DF0A 1SL8A 2K61A 2MHHA 2LMVA 1AJ5A 2HF5A 4YRUA 5KTYA 5CSJA 3GOFA 3NXAA 3DVKA 3D0YA 4GNKB 4M2QA 1L7ZA 5DKQA 1PSBA 1U5IA 1FBVA 1YUUA 2LUXA 2JNFA 5HKYA 3I5FC 3OX6A 1UUSA 4F0ZB 1FI5A 1XFZO 1NWDA 1SCVA 2KFFA 2K7DA 2M8UA 1M46A 1Y1XA 1NCZA 3DD4A 3WHTB 1EL4A 2JU0A 2JTTA 3EVVA 2LVKA 3VGOA 1PVBA 4OKHA 1WRZA 1TNPA 5JOLA 1J55A 1K94A 1GGZA 1QX5B 3A8RA 1NX3A 1C7VA 1K8UA 1SMGA 2COLB 2LV7A 2LMTA 1CLLA 4PHNA 1ZMZA 2GGZA 3SG2A 3TDZA 2JXLA 4DUQA 3I5IC 1FF1A 1K96A 2LHLA 2MLEC 3OHMB 2F2PA 2KNEA 5AEQA 2WNDA 1XFWO 2BECA 1JC2A 4YI8A 4R1EA 3C1VA 1N65A 1B7TY 2JT8A 4WQ3A 1DTLA 2BL0C 1G8IA 1PULA 4M2PA 1E8AA 3OX5A 5HKWA 1LA0A 3IQOA 1NP8A 4PALA 1OMRA 2JWWA 2M0RA 3HCMA 3SJSA 2JZIA 2KBIA 3WXAA 2K2AA 3O78A 1QIVA 1KSOA 2BBMA 4I5LB 2KOTA 2LHIA 3SG5A 5GQQC 4MSPA 4C0JA 1QJTA 1KQMB 1JFKA 1TNXA 1DF0B 4MZKA 1K2HA 1QLSA 3PLFB 3CLNA 1W7JB 1QX2A 2ZNDA 1YR5A 4MZLA 1QVIY 2WCBA 2KFHA 3D0YB 2L4HA 1SL7A 3LCPC 1MXLC 2BBNA 2KAYA 1Y1AA 4ZCUA 4A4CA 3BXKA 1J1DA 1B47A 2M1KB 3EK4A 1NX1A 3DVEA 5DKNA 1F55A 1XFYO 1L2OC 4DS7A 3TS5B 1CMGA 4MEWA 2JQ6A 2AAOA 2L2EA 2A4JA 4AOMA 3OB2B 1TRFA 1J7PA 1WRLA 2PMYA 4MBEA 4YGDB 1F4OA 1KFXS 1SCMC 2NCOA 1YURA 4HRHA 1J7RA 1BG1A 1KK8C 1SY9A 1IWQA 4FQOA 2ZN9A 1RWYA 1VRKA 3KO0A 5HLVA 1KFXL 4PE7A 2KAXA 1TNWA 2H2KA 4PE4A 4MN0A 5K89A 1S3PA 1IQ5A 2NZ0A 3AAKA 2WC8A 3EKHA 5JJGA 1SW8A 5BPJA 1KK7Z 4D1EA 3DF0A 2L50A 2PRUA 4XJKA 1DJXA 2Q4UA 2PALA 2OPOA 1CM1A 1L2OB 1EJ3A 1WDCC 1FI6A 1UHHA 2KI4C 4QJ5B 3SG6A 1K9PA 4DCKA 5ER4X 2QACA 3EKJA 3I5HC 4YGCB 2ISDA 2JT3A 1B8LA 1DJYA 2OTGC 4XYNA 4AQIA 1SCMB 2BCAA 1LVCD 1UHKA 1J1EA 4I5NB 3EK8A 1OOJA 1OSAA 1B1GA 2KFGA 1BOCA 2JTZA 3O2PA 4FTGA 2LC5A 3NSLA 1YRUB 4PHKA 2CT9A 1C7WA 2EGDA 2K7BA 1WLZA 2BKHB 2OS8B 1TCFA 1YTZC 2ZKMX 2JRFA 1DGVA 5F6TA 1BT6A 3PN7B 1GQMA 5IBWA 1AP4A 1YUSA 2M9GA 4IL1A 4N5XA 1A03A 3PSRA 3WHUB 1F54A 2M29A 3FWBA 1BJFA 2JC2A 1S26D 5KSZA 1BLQA 1M39A 1QATA 1WDCB 2WCFA 1K95A 3BUWB 4GPLB 2KI4B 5I8NA 1IJ6A 1K9KA 2HQ8A 1M31A 3F45A 4YGBB 4C0LA 1UHNA 3I5HB 4CFQA 1ZACA 3BOWA 1B9AA 1AK8A 3IF7A 4MRXA 1EG3A 1Y1UA 5I2LA 1W7IB 3IQQA 1QTXA 1QX7A 2K0JA 4MRYA 1SBJA 2EHBA 1V1GA 1OMDA 2O60A 5HKZA 3JTDB 1YRTB 3VROA 2Y1MA 1AUIB 2JNXA 1B7TZ 1TOPA 3AKBA 1DJIA 3H4SE 1SRAA 4C0KA 1GGWA 2JPTA 1DGUA 2JXCA 2M1UA 1KQVA 1JF0A 4ORAB 2EC6C 2FJUB 2BE6A 2ZNEA 3I5GC 2M3WA 2ZRSA 3BUNB 2BCBA 1XYDA 2LVVA 2KDHA 3CR4X 2DOQA 3DF0B 1XVJA 2F8PA 2I2RE 3PM8A 1QS7A 1ZFSA 5J3XA 2F2OA 1RK9A 5KU1A 3I5FB 1AJ4A 5CSIA 1GJYA 2MAZA 4PHMA 2PASA 2NCPA 1CNPA 2PVBA 1B8RA 3TDUA 2TN4A 1CFFA 1MWNA 1N0YA 1QVIZ 1K90D 1JUOA 3BUOB 3M0WA 3WNXB 2KSPA 3TUYC 1NX0A 2L0PA 4L9MA 1B8CA 4YGEB 5FYXA 4N1GA 2P6BB 1ODBA 1QLKA 4U8DA 1MF8B 3BUXB 1NUBA 1V1FA 1XFVO 1RTP1 2SCPA 4NQGA 2FCEA 4JPZB 4OV2A 2EC6B 4QJ3B 2O5GA 4JQ0D 3I5IB 1YVHA 2JT0A 1CMFA 4DRWA 1OZOA 1A4PA 1Y0VH 4CLNA 3FIAA 3CTNA 2BL0B 4A4BA 1U5IB 1WRKA 2M7LA 3BOWB 1NPQA 3BUMB 2NXQA 2WORA 1DVIA 4WRIA 1UHJA 2G9BA 3PALA 1XK4A 1JF2A 1CLBA 2HETA 1OQPA 1WY9A 1XFUO 3DVJA 3OP0A 3TUYB 2KYFA 2SASA 1FPWA 1OZSA 3NSIA 3OB1B 2FOTA 2NLNA 4GUKA 5D69A 4GFTA 1SR6C 1IH0A 1A75A 1JFJA 4USLA 1NCXA 3VRPA 2BKIB 1IKUA 2M7NA 1J7OA 2GV5A 3EVRA 3MSEB 1Y6WA 1TCOB 1S6JA 2K2FA 4GGFA 4PCWA 5ER5A 2E30A 4NDCA 1R2UA 1LKJA 3KEVA 3TZ1A 2CCMA 4I5JA 1LA3A 1YVLA 3CZTX 1YX7A 2L4IA 1J7QA 3GK4X 1WLMA 2MA2A 3NSOA 3VRRA 4Q04A 1HQVA 2LP2A 1RJVA 4GAOA 4CIDA 3RLZA 3CR5X 4CFRA 4M2OA 3JVTC 1CLMA 1HT9A 4MZJA 2VRGA 2JULA 1XK4C 1KK8B 2Y1NA 1FW4A 1DT7B 1MHOA 3FS7A 3QRXA 4PHJA 5D7FA 2E6WA 3LK1A 2LLTA 1UWOA 1M45A 1A29A 3VRQA 4TNCA 4ORBB 1UHIA 2WCEA 1C07A 2L98A 2V53A 1XFXO 1K9UA 2H61A 2MJWB 4ICBA 4HREE 1QV0A 2GGMA 4GGFC 1CKKA 1EH2A 3SG3A 3KF9A 2LVJA 1CDLA 1M63B 2ZN8A 1DJZA 3RM1A 4E68A 1MUXA 3E3RA 2KQ6A 2K7OA 3JVTB 1IQ3A 1PVAA 2OTGB 1A2XA 2KI6C 2M97A 1CFDA 4PE0A 3SIBA 1IG5A 5I2OA 2LE9B 2Q91A 1PRWA 2FCDA 2K7CA 3GK2A 2LLSA 4PE1A 1RECA 1AVSA 4AQJA 5AERA 1A75B 4OVNF 4QJ4B 1K93D 1S6CA 3VRNA 1S5GY 5DKRA 2MRDA 1OMVA 1F4QA 1KWOC 1SL9A 3BQ3A 2KYCA 3AKAA 2LNKA 2LANA 1NYAA 1JBAA 2H61C 2KGBC 1D1OA 4ORCB 4XJKB 1PALA 2BE4A 3SG4A 1CDMA 3CS1A 2Y5IA 1NSHA 1BMOA 4PDZA 3TDIA 2KBMA 1R6PA 2KQYA 1RFJA 1G4YR 4I5KA 4BY4A 3LK0A 1QASA 1BR4B 2AMIA 1B4CA 3LL8B 5PALA 4OCIA 2LVIA 1XA5A 1KCYA 4WQ2A 1KQMC 1EG4A 1BU3A 2F3YA 1SPYA 2BCXA 3PFVA 5AFPA 2LP3A 3D10A 1TNQA 3NSKA 1CDPA 3K21A 1KWOB 2LUCA 1XO5A 1QV1A 1DJHA
chains in the Genus database with same CATH superfamily
3I5GB 1S1EA 5I2QA 1UP5A 1BLQA 1H8BA 4P2YB 1BR1B 1OOFA 2JPOA 1CB1A 2MBXA 1OOGA 1MQ1A 3A4UB 4YGAA 1NX2A 4GBAA 5FI6A 2KHNA 3BFAA 1CTRA 4ETOA 2D8NA 1SYMA 3TS5C 1G33A 4MLWA 2YGUA 3S0DA 5CSFA 4UPGA 1DMOA 3UNWA 3B6XA 2KAVA 1CFPA 1N2DA 2WOSA 5CSNA 1AHRA 3HX4A 3CGAA 3O6BA 1NCYA 3R1PA 1BODA 2QPTA 2ZFDA 4DIRA 1Z4HA 1IJ5A 1TIZA 1CDNA 3B86A 3V2LA 2KI6D 3AAJA 3BFBA 3Q8IA 3OGNA 5G08A 1ZOTB 1ALWA 2KGRA 1NIWA 1TTXA 1SK6D 4CPVA 4P5OE 2CNPA 1SSEB 2B1UA 2ZRTA 1C3YA 3SG7A 2CTNA 5TNCA 2L51A 5AXIA 3RZSA 3VB1A 1SKTA 2LAPA 3R72A 2I7AA 4HRGA 1PK0D 2M49B 3FE6A 2HQWA 4NDBA 1X02A 2LLUA 1UURA 3EK7A 2LCPA 3BYAA 4NDDA 1OOIX 1ALVA 2L2CA 3KHEA 1DQEA 1LXFC 1KFUS 3SS5A 1DJGA 1LS8A 3ICBA 4N1FA 1TN4A 3SS4A 1CM4A 1CFCA 1H4BA 1PSRA 1OOHA 2WCMA 2IS9A 1QIWA 1KFUL 2F3ZA 2HPSA 2Y4QA 1SR6B 3B87A 3FWCA 4YBHB 1Q80A 2OS8C 3DVMA 2I18A 1OE9B 1F70A 1RROA 3PATA 1ZUZA 5AANA 1S6IA 2K8MB 3PN7C 3LLEA 1JSAA 1KSMA 4JWQA 2LMUA 1S36A 3ZNIA 2WCLA 1JWDA 4ZCVA 4BY5A 2L5YA 1F71A 2F33A 2CBLA 4HSZA 2CXJA 2RGIA 1BF5A 2R2IA 2L5XB 3O4YA 1MXEA 3DXLA 2AUCA 3ZWHA 2JOJA 2MLFC 3CR2A 2I94A 3CWGA 2LM5A 5HYDA 1IGVA 4OR9B 2WCJA 3EVUA 1LINA 2P71A 3SIAA 1KK7Y 2G2BA 1S5GZ 1YX8A 1EXRA 1QXPA 5B8IB 1YUTA 2QDIA 2FJYA 3JTDC 3GK1A 3KPXA 1MR8A 5HLOA 1F8HA 4MVFA 5CPVA 1SNLA 2PSRA 4YI9A 1DJWA 1IRJA 4GGNA 1DF0A 1SL8A 2K61A 2MHHA 2LMVA 1AJ5A 2HF5A 4YRUA 5KTYA 3D76A 5CSJA 3GOFA 3IVTA 3DVKA 3NXAA 3D0YA 4GNKB 3OBVA 4M2QA 1L7ZA 5DKQA 1PSBA 1T14A 1U5IA 1FBVA 1YUUA 2LUXA 2JNFA 5HKYA 3I5FC 3OX6A 1UUSA 4F0ZB 1FI5A 1XFZO 1NWDA 4PT1A 1ORGA 1SCVA 2KFFA 2K7DA 2M8UA 1M46A 1Y1XA 4JKTA 1NCZA 3DD4A 3WHTB 1EL4A 2JU0A 2JTTA 3EVVA 2LVKA 3VGOA 1PVBA 4OKHA 1WRZA 1TNPA 4INXA 5JOLA 1J55A 1K94A 1GGZA 1QX5B 3A8RA 3CDNA 1NX3A 1C7VA 1K8UA 1SMGA 2COLB 2LV7A 2LMTA 1CLLA 4PHNA 1ZMZA 2GGZA 3SG2A 3TDZA 2JXLA 4DUQA 3I5IC 1FF1A 1K96A 2KLDA 2LHLA 2MLEC 2F2PA 3OHMB 2KNEA 5AEQA 2WNDA 1XFWO 2BECA 1JC2A 4YI8A 3D77A 1XFRA 4R1EA 3C1VA 1N65A 1B7TY 2JT8A 4WQ3A 1DTLA 1W9ZA 2BL0C 1G8IA 1PULA 4M2PA 1E8AA 3OX5A 5HKWA 1LA0A 3IQOA 1NP8A 4PALA 1OMRA 2JWWA 2M0RA 3HCMA 1DEKA 3SJSA 1OW4A 2JZIA 2KBIA 3WXAA 3CZ0A 2K2AA 3O78A 1QIVA 3R1VA 1KSOA 2BBMA 4I5LB 2KOTA 2LHIA 1P28A 3O4XA 3SG5A 5GQQC 4MSPA 3D74A 4C0JA 1QJTA 1KQMB 1JFKA 1TNXA 1DF0B 4MZKA 1K2HA 1QLSA 3PLFB 3CLNA 1W7JB 1QX2A 2ZNDA 1YR5A 4MZLA 1QVIY 1IIOA 2WCBA 2KFHA 3D0YB 2L4HA 1SL7A 3LCPC 1MXLC 4KYNA 2BBNA 3DZTA 2KAYA 1Y1AA 4ZCUA 4A4CA 3BXKA 1J1DA 1B47A 2M1KB 3EK4A 1NX1A 3DVEA 3DY9A 5DKNA 1F55A 1XFYO 1L2OC 4DS7A 3TS5B 1CMGA 4MEWA 2JQ6A 1DC1A 2AAOA 2L2EA 2A4JA 4AOMA 3OB2B 1TRFA 1J7PA 1WRLA 2PMYA 4MBEA 4YGDB 1F4OA 1KFXS 1SCMC 2NCOA 1YURA 4HRHA 1J7RA 1BG1A 1KK8C 1SY9A 1IWQA 4FQOA 2ZN9A 1RWYA 1VRKA 3KO0A 5HLVA 1KFXL 4PE7A 2KAXA 1TNWA 2H2KA 4PE4A 4MN0A 5K89A 1S3PA 3FE9A 1IQ5A 2NZ0A 3AAKA 2WC8A 3EKHA 3L4AA 5JJGA 1SW8A 1GM0A 5BPJA 1KK7Z 4D1EA 3DF0A 2L50A 2PRUA 4XJKA 1DJXA 2Q4UA 2PALA 2OPOA 1CM1A 1L2OB 1EJ3A 1WDCC 1FI6A 1UHHA 2KI4C 4QJ5B 3SG6A 1K9PA 4DCKA 5ER4X 2QACA 3EKJA 3I5HC 4YGCB 2ISDA 2JT3A 3PM2A 1B8LA 1DJYA 2OTGC 4XYNA 4AQIA 1SCMB 2BCAA 1LVCD 1UHKA 1J1EA 3CYZA 3PJIA 4I5NB 3EK8A 1OOJA 1OSAA 1B1GA 2KFGA 5FI2A 1BOCA 2JTZA 3O2PA 4FTGA 2LC5A 3NSLA 1YRUB 2H8VA 4PHKA 2CT9A 1F54A 1C7WA 2EGDA 2K7BA 1WLZA 2BKHB 2OS8B 1TCFA 1YTZC 2ZKMX 2QEVA 2JRFA 1DGVA 5F6TA 1BT6A 3PN7B 1GQMA 5IBWA 3B7AA 1AP4A 1YUSA 3NHTA 2M9GA 4IL1A 4N5XA 1A03A 3PSRA 3BJHA 3WHUB 2M29A 3FWBA 1BJFA 2JC2A 1S26D 2PQLA 5KSZA 1M39A 1QATA 1WDCB 2WCFA 1K95A 3BUWB 4GPLB 2KI4B 5I8NA 1IJ6A 1K9KA 2HQ8A 1M31A 3F45A 4YGBB 4C0LA 1UHNA 3I5HB 4CFQA 1ZACA 3BOWA 1B9AA 1TUJA 1AK8A 3IF7A 4MRXA 1EG3A 1Y1UA 5I2LA 3S0GA 2QEOA 1W7IB 3IQQA 1QTXA 1QX7A 2K0JA 4MRYA 5FI7A 1SBJA 2EHBA 1V1GA 1OMDA 2O60A 3D78A 5HKZA 3JTDB 1YRTB 3BFHA 3VROA 2Y1MA 1AUIB 2JNXA 3DYEA 1B7TZ 3N7HA 1TOPA 3AKBA 1DJIA 3H4SE 1SRAA 4C0KA 1GGWA 2JPTA 1C3ZA 1DGUA 1TUZA 2JXCA 2M1UA 1KQVA 1JF0A 4ORAB 2EC6C 2FJUB 2BE6A 2ZNEA 3I5GC 2M3WA 2ZRSA 3BUNB 2BCBA 1XYDA 2LVVA 2KDHA 3CR4X 2DOQA 3DF0B 1XVJA 3L4LA 2F8PA 2I2RE 3PM8A 1QS7A 1ZFSA 4FQTA 2F2OA 1RK9A 5J3XA 5KU1A 3I5FB 1AJ4A 5CSIA 1GJYA 4INWA 2MAZA 4PHMA 2PASA 2NCPA 1CNPA 2PVBA 1B8RA 3TDUA 2KLEA 3D75A 2TN4A 1CFFA 1MWNA 1N0YA 1QVIZ 1K90D 3K1EA 1JUOA 3EG5B 3BUOB 3M0WA 3WNXB 2KSPA 3TUYC 1NX0A 2L0PA 4L9MA 1B8CA 4YGEB 2BAPA 5FYXA 4N1GA 2P6BB 1ODBA 1QLKA 4U8DA 1MF8B 3BUXB 1NUBA 5D3OA 1V1FA 1XFVO 1RTP1 4JD9A 2SCPA 4NQGA 3UO9A 2FCEA 4JPZB 2PYQA 2EC6B 2WC6A 4OV2A 2O5GA 4JQ0D 4QJ3B 3I5IB 1YVHA 2JT0A 1CMFA 4DRWA 1OZOA 5EL2A 1A4PA 1Y0VH 4CLNA 3FIAA 3CTNA 2BL0B 4A4BA 3CZ2A 1QWVA 1U5IB 1WRKA 2M7LA 3BOWB 2BNXA 1NPQA 3BUMB 2NXQA 2WORA 1DVIA 4WRIA 1UHJA 3CZ1A 3S0BA 2G9BA 3PALA 1XK4A 2K60A 1JF2A 1CLBA 2HETA 1OQPA 1WY9A 1XFUO 3DVJA 3OP0A 3TUYB 2WC5A 2KYFA 2SASA 1FPWA 1OZSA 3NSIA 3OB1B 2FOTA 2NLNA 4GUKA 5D69A 4GFTA 1SR6C 5DICA 1IH0A 1A75A 1TWOA 1JFJA 4USLA 1NCXA 3VRPA 2BKIB 1IKUA 2M7NA 1Z2CB 1J7OA 2GV5A 5HL1A 3EVRA 3R1OA 3MSEB 1Y6WA 1TCOB 1S6JA 2K2FA 4GGFA 4PCWA 5ER5A 2E30A 4NDCA 1R2UA 1LKJA 3KEVA 3TZ1A 2CCMA 4I5JA 1LA3A 1YVLA 3CZTX 1YX7A 2L4IA 1J7QA 3CABA 3GK4X 1WLMA 2MA2A 3NSOA 3VRRA 4Q04A 1HQVA 2LP2A 1RJVA 4GAOA 4CIDA 3RLZA 3CR5X 4CFRA 4M2OA 2WCKA 3JVTC 2P70A 1CLMA 1HT9A 4MZJA 2VRGA 2JULA 1XK4C 1KK8B 2Y1NA 1FW4A 1DT7B 1MHOA 3FS7A 3QRXA 4PHJA 5D7FA 2E6WA 3LK1A 2LLTA 1UWOA 1M45A 1A29A 3VRQA 4TNCA 4ORBB 1UHIA 2WCEA 1C07A 2L98A 3D73A 2V53A 1XFXO 1K9UA 2H61A 2MJWB 4ICBA 4HREE 1QV0A 2GGMA 4GGFC 1CKKA 1EH2A 3SG3A 3KF9A 3NGVA 4IJ7A 2LVJA 1CDLA 1M63B 2ZN8A 1DJZA 3RM1A 4E68A 1MUXA 3E3RA 2KQ6A 3NHIA 1DELA 2K7OA 2KPHA 4OZDA 3JVTB 1IQ3A 1PVAA 2QEBA 2OTGB 1A2XA 2KI6C 2M97A 1CFDA 4PE0A 3SIBA 1IG5A 5I2OA 2LE9B 2Q91A 1PRWA 2FCDA 3QMEA 2K7CA 2QEHA 2LLSA 3GK2A 1RECA 4PE1A 1AVSA 4AQJA 5AERA 1A75B 4OVNF 3S0AA 4QJ4B 1K93D 3S0EA 1S6CA 3VRNA 1S5GY 5DKRA 2MRDA 1OMVA 5I94A 3B88A 1F4QA 1KWOC 1SL9A 3BQ3A 2KYCA 3AKAA 2LNKA 2LANA 1NYAA 1JBAA 2H61C 2KGBC 1D1OA 2WCHA 4ORCB 4XJKB 1PALA 2BE4A 3SG4A 1CDMA 3CS1A 2Y5IA 1NSHA 1BMOA 4PDZA 3TDIA 2KBMA 2ERBA 1R6PA 2KQYA 1RFJA 3S0FA 1G4YR 4I5KA 3SS3A 4BY4A 3LK0A 1QASA 1BR4B 2AMIA 3L47A 1B4CA 3LL8B 5PALA 4OCIA 2LVIA 1XA5A 1KCYA 4WQ2A 1KQMC 1EG4A 1BU3A 2F3YA 1SPYA 2BCXA 3PFVA 4F7FA 5AFPA 2GTEA 2LP3A 3D10A 3FE8A 1TNQA 3NSKA 1CDPA 3K21A 1KWOB 2LUCA 1XO5A 1QV1A 1DJHA
chains in the Genus database with same CATH topology
3I5GB 1S1EA 5I2QA 1UP5A 1H8BA 4P2YB 1BR1B 1CB1A 2MBXA 1MQ1A 3A4UB 4YGAA 1NX2A 4GBAA 2KHNA 1CTRA 4ETOA 2D8NA 1SYMA 3TS5C 1G33A 4MLWA 5CSFA 4UPGA 1DMOA 2KAVA 1CFPA 1N2DA 2WOSA 5CSNA 1AHRA 3HX4A 3CGAA 3O6BA 1NCYA 1BODA 2QPTA 2ZFDA 4DIRA 1IJ5A 1TIZA 1CDNA 2KI6D 3AAJA 5G08A 1ZOTB 1ALWA 2KGRA 1NIWA 1TTXA 1SK6D 4CPVA 4P5OE 2CNPA 2B1UA 2ZRTA 3SG7A 2CTNA 5TNCA 2L51A 5AXIA 1SKTA 2LAPA 4HRGA 2I7AA 1PK0D 2M49B 4NDBA 2HQWA 1X02A 2LLUA 1UURA 3EK7A 2LCPA 3BYAA 4NDDA 1ALVA 3KHEA 1LXFC 1KFUS 1DJGA 4N1FA 3ICBA 1TN4A 1CM4A 1CFCA 1H4BA 1PSRA 2IS9A 1QIWA 1KFUL 2F3ZA 2HPSA 2Y4QA 1SR6B 3FWCA 4YBHB 1Q80A 2OS8C 3DVMA 2I18A 1OE9B 1F70A 1RROA 3PATA 1ZUZA 5AANA 1S6IA 2K8MB 3PN7C 3LLEA 1JSAA 1KSMA 4JWQA 2LMUA 1S36A 3ZNIA 1JWDA 4ZCVA 4BY5A 1F71A 2F33A 2CBLA 4HSZA 2CXJA 2RGIA 1BF5A 2R2IA 2L5XB 3O4YA 1MXEA 2AUCA 3ZWHA 2JOJA 2MLFC 3CR2A 2I94A 3CWGA 2LM5A 5HYDA 1IGVA 4OR9B 3EVUA 1LINA 3SIAA 1KK7Y 2G2BA 1S5GZ 1YX8A 1EXRA 1QXPA 5B8IB 1YUTA 3JTDC 3GK1A 3KPXA 1MR8A 5HLOA 1F8HA 4MVFA 5CPVA 1SNLA 2PSRA 4YI9A 1DJWA 1IRJA 4GGNA 1DF0A 1SL8A 2K61A 2MHHA 2LMVA 1AJ5A 2HF5A 4YRUA 5KTYA 5CSJA 3GOFA 3NXAA 3DVKA 3D0YA 4GNKB 4M2QA 1L7ZA 5DKQA 1PSBA 1U5IA 1FBVA 1YUUA 2LUXA 2JNFA 5HKYA 3I5FC 3OX6A 1UUSA 4F0ZB 1FI5A 1XFZO 1NWDA 1SCVA 2KFFA 2K7DA 2M8UA 1M46A 1Y1XA 1NCZA 3DD4A 3WHTB 1EL4A 2JU0A 2JTTA 3EVVA 2LVKA 3VGOA 1PVBA 4OKHA 1WRZA 1TNPA 5JOLA 1J55A 1K94A 1GGZA 1QX5B 3A8RA 1NX3A 1C7VA 1K8UA 1SMGA 2COLB 2LV7A 2LMTA 1CLLA 4PHNA 1ZMZA 2GGZA 3SG2A 3TDZA 2JXLA 4DUQA 3I5IC 1FF1A 1K96A 2LHLA 2MLEC 3OHMB 2F2PA 2KNEA 5AEQA 2WNDA 1XFWO 2BECA 1JC2A 4YI8A 4R1EA 3C1VA 1N65A 1B7TY 2JT8A 4WQ3A 1DTLA 2BL0C 1G8IA 1PULA 4M2PA 1E8AA 3OX5A 5HKWA 1LA0A 3IQOA 1NP8A 4PALA 1OMRA 2JWWA 2M0RA 3HCMA 3SJSA 2JZIA 2KBIA 3WXAA 2K2AA 3O78A 1QIVA 1KSOA 2BBMA 4I5LB 2KOTA 2LHIA 3SG5A 5GQQC 4MSPA 4C0JA 1QJTA 1KQMB 1JFKA 1TNXA 1DF0B 4MZKA 1K2HA 1QLSA 3PLFB 3CLNA 1W7JB 1QX2A 2ZNDA 1YR5A 4MZLA 1QVIY 2WCBA 2KFHA 3D0YB 2L4HA 1SL7A 3LCPC 1MXLC 2BBNA 2KAYA 1Y1AA 4ZCUA 4A4CA 3BXKA 1J1DA 1B47A 2M1KB 3EK4A 1NX1A 3DVEA 5DKNA 1F55A 1XFYO 1L2OC 4DS7A 3TS5B 1CMGA 4MEWA 2JQ6A 2AAOA 2L2EA 2A4JA 4AOMA 3OB2B 1TRFA 1J7PA 1WRLA 2PMYA 4MBEA 4YGDB 1F4OA 1KFXS 1SCMC 2NCOA 1YURA 4HRHA 1J7RA 1BG1A 1KK8C 1SY9A 1IWQA 4FQOA 2ZN9A 1RWYA 1VRKA 3KO0A 5HLVA 1KFXL 4PE7A 2KAXA 1TNWA 2H2KA 4PE4A 4MN0A 5K89A 1S3PA 1IQ5A 2NZ0A 3AAKA 2WC8A 3EKHA 5JJGA 1SW8A 5BPJA 1KK7Z 4D1EA 3DF0A 2L50A 2PRUA 4XJKA 1DJXA 2Q4UA 2PALA 2OPOA 1CM1A 1L2OB 1EJ3A 1WDCC 1FI6A 1UHHA 2KI4C 4QJ5B 3SG6A 1K9PA 4DCKA 5ER4X 2QACA 3EKJA 3I5HC 4YGCB 2ISDA 2JT3A 1B8LA 1DJYA 2OTGC 4XYNA 4AQIA 1SCMB 2BCAA 1LVCD 1UHKA 1J1EA 4I5NB 3EK8A 1OOJA 1OSAA 1B1GA 2KFGA 1BOCA 2JTZA 3O2PA 4FTGA 2LC5A 3NSLA 1YRUB 4PHKA 2CT9A 1C7WA 2EGDA 2K7BA 1WLZA 2BKHB 2OS8B 1TCFA 1YTZC 2ZKMX 2JRFA 1DGVA 5F6TA 1BT6A 3PN7B 1GQMA 5IBWA 1AP4A 1YUSA 2M9GA 4IL1A 4N5XA 1A03A 3PSRA 3WHUB 1F54A 2M29A 3FWBA 1BJFA 2JC2A 1S26D 5KSZA 1BLQA 1M39A 1QATA 1WDCB 2WCFA 1K95A 3BUWB 4GPLB 2KI4B 5I8NA 1IJ6A 1K9KA 2HQ8A 1M31A 3F45A 4YGBB 4C0LA 1UHNA 3I5HB 4CFQA 1ZACA 3BOWA 1B9AA 1AK8A 3IF7A 4MRXA 1EG3A 1Y1UA 5I2LA 1W7IB 3IQQA 1QTXA 1QX7A 2K0JA 4MRYA 1SBJA 2EHBA 1V1GA 1OMDA 2O60A 5HKZA 3JTDB 1YRTB 3VROA 2Y1MA 1AUIB 2JNXA 1B7TZ 1TOPA 3AKBA 1DJIA 3H4SE 1SRAA 4C0KA 1GGWA 2JPTA 1DGUA 2JXCA 2M1UA 1KQVA 1JF0A 4ORAB 2EC6C 2FJUB 2BE6A 2ZNEA 3I5GC 2M3WA 2ZRSA 3BUNB 2BCBA 1XYDA 2LVVA 2KDHA 3CR4X 2DOQA 3DF0B 1XVJA 2F8PA 2I2RE 3PM8A 1QS7A 1ZFSA 5J3XA 2F2OA 1RK9A 5KU1A 3I5FB 1AJ4A 5CSIA 1GJYA 2MAZA 4PHMA 2PASA 2NCPA 1CNPA 2PVBA 1B8RA 3TDUA 2TN4A 1CFFA 1MWNA 1N0YA 1QVIZ 1K90D 1JUOA 3BUOB 3M0WA 3WNXB 2KSPA 3TUYC 1NX0A 2L0PA 4L9MA 1B8CA 4YGEB 5FYXA 4N1GA 2P6BB 1ODBA 1QLKA 4U8DA 1MF8B 3BUXB 1NUBA 1V1FA 1XFVO 1RTP1 2SCPA 4NQGA 2FCEA 4JPZB 4OV2A 2EC6B 4QJ3B 2O5GA 4JQ0D 3I5IB 1YVHA 2JT0A 1CMFA 4DRWA 1OZOA 1A4PA 1Y0VH 4CLNA 3FIAA 3CTNA 2BL0B 4A4BA 1U5IB 1WRKA 2M7LA 3BOWB 1NPQA 3BUMB 2NXQA 2WORA 1DVIA 4WRIA 1UHJA 2G9BA 3PALA 1XK4A 1JF2A 1CLBA 2HETA 1OQPA 1WY9A 1XFUO 3DVJA 3OP0A 3TUYB 2KYFA 2SASA 1FPWA 1OZSA 3NSIA 3OB1B 2FOTA 2NLNA 4GUKA 5D69A 4GFTA 1SR6C 1IH0A 1A75A 1JFJA 4USLA 1NCXA 3VRPA 2BKIB 1IKUA 2M7NA 1J7OA 2GV5A 3EVRA 3MSEB 1Y6WA 1TCOB 1S6JA 2K2FA 4GGFA 4PCWA 5ER5A 2E30A 4NDCA 1R2UA 1LKJA 3KEVA 3TZ1A 2CCMA 4I5JA 1LA3A 1YVLA 3CZTX 1YX7A 2L4IA 1J7QA 3GK4X 1WLMA 2MA2A 3NSOA 3VRRA 4Q04A 1HQVA 2LP2A 1RJVA 4GAOA 4CIDA 3RLZA 3CR5X 4CFRA 4M2OA 3JVTC 1CLMA 1HT9A 4MZJA 2VRGA 2JULA 1XK4C 1KK8B 2Y1NA 1FW4A 1DT7B 1MHOA 3FS7A 3QRXA 4PHJA 5D7FA 2E6WA 3LK1A 2LLTA 1UWOA 1M45A 1A29A 3VRQA 4TNCA 4ORBB 1UHIA 2WCEA 1C07A 2L98A 2V53A 1XFXO 1K9UA 2H61A 2MJWB 4ICBA 4HREE 1QV0A 2GGMA 4GGFC 1CKKA 1EH2A 3SG3A 3KF9A 2LVJA 1CDLA 1M63B 2ZN8A 1DJZA 3RM1A 4E68A 1MUXA 3E3RA 2KQ6A 2K7OA 3JVTB 1IQ3A 1PVAA 2OTGB 1A2XA 2KI6C 2M97A 1CFDA 4PE0A 3SIBA 1IG5A 5I2OA 2LE9B 2Q91A 1PRWA 2FCDA 2K7CA 3GK2A 2LLSA 4PE1A 1RECA 1AVSA 4AQJA 5AERA 1A75B 4OVNF 4QJ4B 1K93D 1S6CA 3VRNA 1S5GY 5DKRA 2MRDA 1OMVA 1F4QA 1KWOC 1SL9A 3BQ3A 2KYCA 3AKAA 2LNKA 2LANA 1NYAA 1JBAA 2H61C 2KGBC 1D1OA 4ORCB 4XJKB 1PALA 2BE4A 3SG4A 1CDMA 3CS1A 2Y5IA 1NSHA 1BMOA 4PDZA 3TDIA 2KBMA 1R6PA 2KQYA 1RFJA 1G4YR 4I5KA 4BY4A 3LK0A 1QASA 1BR4B 2AMIA 1B4CA 3LL8B 5PALA 4OCIA 2LVIA 1XA5A 1KCYA 4WQ2A 1KQMC 1EG4A 1BU3A 2F3YA 1SPYA 2BCXA 3PFVA 5AFPA 2LP3A 3D10A 1TNQA 3NSKA 1CDPA 3K21A 1KWOB 2LUCA 1XO5A 1QV1A 1DJHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I5G B;  1S1E A;  5I2Q A;  1UP5 A;  1H8B A;  4P2Y B;  1BR1 B;  1CB1 A;  2MBX A;  1MQ1 A;  3A4U B;  4YGA A;  1NX2 A;  4GBA A;  2KHN A;  1CTR A;  4ETO A;  2D8N A;  1SYM A;  3TS5 C;  1G33 A;  4MLW A;  5CSF A;  4UPG A;  1DMO A;  2KAV A;  1CFP A;  1N2D A;  2WOS A;  5CSN A;  1AHR A;  3HX4 A;  3CGA A;  3O6B A;  1NCY A;  1BOD A;  2QPT A;  2ZFD A;  4DIR A;  1IJ5 A;  1TIZ A;  1CDN A;  2KI6 D;  3AAJ A;  5G08 A;  1ZOT B;  1ALW A;  2KGR A;  1NIW A;  1TTX A;  1SK6 D;  4CPV A;  4P5O E;  2CNP A;  2B1U A;  2ZRT A;  3SG7 A;  2CTN A;  5TNC A;  2L51 A;  5AXI A;  1SKT A;  2LAP A;  4HRG A;  2I7A A;  1PK0 D;  2M49 B;  4NDB A;  2HQW A;  1X02 A;  2LLU A;  1UUR A;  3EK7 A;  2LCP A;  3BYA A;  4NDD A;  1ALV A;  3KHE A;  1LXF C;  1KFU S;  1DJG A;  4N1F A;  3ICB A;  1TN4 A;  1CM4 A;  1CFC A;  1H4B A;  1PSR A;  2IS9 A;  1QIW A;  1KFU L;  2F3Z A;  2HPS A;  2Y4Q A;  1SR6 B;  3FWC A;  4YBH B;  1Q80 A;  2OS8 C;  3DVM A;  2I18 A;  1OE9 B;  1F70 A;  1RRO A;  3PAT A;  1ZUZ A;  5AAN A;  1S6I A;  2K8M B;  3PN7 C;  3LLE A;  1JSA A;  1KSM A;  4JWQ A;  2LMU A;  1S36 A;  3ZNI A;  1JWD A;  4ZCV A;  4BY5 A;  1F71 A;  2F33 A;  2CBL A;  4HSZ A;  2CXJ A;  2RGI A;  1BF5 A;  2R2I A;  2L5X B;  3O4Y A;  1MXE A;  2AUC A;  3ZWH A;  2JOJ A;  2MLF C;  3CR2 A;  2I94 A;  3CWG A;  2LM5 A;  5HYD A;  1IGV A;  4OR9 B;  3EVU A;  1LIN A;  3SIA A;  1KK7 Y;  2G2B A;  1S5G Z;  1YX8 A;  1EXR A;  1QXP A;  5B8I B;  1YUT A;  3JTD C;  3GK1 A;  3KPX A;  1MR8 A;  5HLO A;  1F8H A;  4MVF A;  5CPV A;  1SNL A;  2PSR A;  4YI9 A;  1DJW A;  1IRJ A;  4GGN A;  1DF0 A;  1SL8 A;  2K61 A;  2MHH A;  2LMV A;  1AJ5 A;  2HF5 A;  4YRU A;  5KTY A;  5CSJ A;  3GOF A;  3NXA A;  3DVK A;  3D0Y A;  4GNK B;  4M2Q A;  1L7Z A;  5DKQ A;  1PSB A;  1U5I A;  1FBV A;  1YUU A;  2LUX A;  2JNF A;  5HKY A;  3I5F C;  3OX6 A;  1UUS A;  4F0Z B;  1FI5 A;  1XFZ O;  1NWD A;  1SCV A;  2KFF A;  2K7D A;  2M8U A;  1M46 A;  1Y1X A;  1NCZ A;  3DD4 A;  3WHT B;  1EL4 A;  2JU0 A;  2JTT A;  3EVV A;  2LVK A;  3VGO A;  1PVB A;  4OKH A;  1WRZ A;  1TNP A;  5JOL A;  1J55 A;  1K94 A;  1GGZ A;  1QX5 B;  3A8R A;  1NX3 A;  1C7V A;  1K8U A;  1SMG A;  2COL B;  2LV7 A;  2LMT A;  1CLL A;  4PHN A;  1ZMZ A;  2GGZ A;  3SG2 A;  3TDZ A;  2JXL A;  4DUQ A;  3I5I C;  1FF1 A;  1K96 A;  2LHL A;  2MLE C;  3OHM B;  2F2P A;  2KNE A;  5AEQ A;  2WND A;  1XFW O;  2BEC A;  1JC2 A;  4YI8 A;  4R1E A;  3C1V A;  1N65 A;  1B7T Y;  2JT8 A;  4WQ3 A;  1DTL A;  2BL0 C;  1G8I A;  1PUL A;  4M2P A;  1E8A A;  3OX5 A;  5HKW A;  1LA0 A;  3IQO A;  1NP8 A;  4PAL A;  1OMR A;  2JWW A;  2M0R A;  3HCM A;  3SJS A;  2JZI A;  2KBI A;  3WXA A;  2K2A A;  3O78 A;  1QIV A;  1KSO A;  2BBM A;  4I5L B;  2KOT A;  2LHI A;  3SG5 A;  5GQQ C;  4MSP A;  4C0J A;  1QJT A;  1KQM B;  1JFK A;  1TNX A;  1DF0 B;  4MZK A;  1K2H A;  1QLS A;  3PLF B;  3CLN A;  1W7J B;  1QX2 A;  2ZND A;  1YR5 A;  4MZL A;  1QVI Y;  2WCB A;  2KFH A;  3D0Y B;  2L4H A;  1SL7 A;  3LCP C;  1MXL C;  2BBN A;  2KAY A;  1Y1A A;  4ZCU A;  4A4C A;  3BXK A;  1J1D A;  1B47 A;  2M1K B;  3EK4 A;  1NX1 A;  3DVE A;  5DKN A;  1F55 A;  1XFY O;  1L2O C;  4DS7 A;  3TS5 B;  1CMG A;  4MEW A;  2JQ6 A;  2AAO A;  2L2E A;  2A4J A;  4AOM A;  3OB2 B;  1TRF A;  1J7P A;  1WRL A;  2PMY A;  4MBE A;  4YGD B;  1F4O A;  1KFX S;  1SCM C;  2NCO A;  1YUR A;  4HRH A;  1J7R A;  1BG1 A;  1KK8 C;  1SY9 A;  1IWQ A;  4FQO A;  2ZN9 A;  1RWY A;  1VRK A;  3KO0 A;  5HLV A;  1KFX L;  4PE7 A;  2KAX A;  1TNW A;  2H2K A;  4PE4 A;  4MN0 A;  5K89 A;  1S3P A;  1IQ5 A;  2NZ0 A;  3AAK A;  2WC8 A;  3EKH A;  5JJG A;  1SW8 A;  5BPJ A;  1KK7 Z;  4D1E A;  3DF0 A;  2L50 A;  2PRU A;  4XJK A;  1DJX A;  2Q4U A;  2PAL A;  2OPO A;  1CM1 A;  1L2O B;  1EJ3 A;  1WDC C;  1FI6 A;  1UHH A;  2KI4 C;  4QJ5 B;  3SG6 A;  1K9P A;  4DCK A;  5ER4 X;  2QAC A;  3EKJ A;  3I5H C;  4YGC B;  2ISD A;  2JT3 A;  1B8L A;  1DJY A;  2OTG C;  4XYN A;  4AQI A;  1SCM B;  2BCA A;  1LVC D;  1UHK A;  1J1E A;  4I5N B;  3EK8 A;  1OOJ A;  1OSA A;  1B1G A;  2KFG A;  1BOC A;  2JTZ A;  3O2P A;  4FTG A;  2LC5 A;  3NSL A;  1YRU B;  4PHK A;  2CT9 A;  1C7W A;  2EGD A;  2K7B A;  1WLZ A;  2BKH B;  2OS8 B;  1TCF A;  1YTZ C;  2ZKM X;  2JRF A;  1DGV A;  5F6T A;  1BT6 A;  3PN7 B;  1GQM A;  5IBW A;  1AP4 A;  1YUS A;  2M9G A;  4IL1 A;  4N5X A;  1A03 A;  3PSR A;  3WHU B;  1F54 A;  2M29 A;  3FWB A;  1BJF A;  2JC2 A;  1S26 D;  5KSZ A;  1BLQ A;  1M39 A;  1QAT A;  1WDC B;  2WCF A;  1K95 A;  3BUW B;  4GPL B;  2KI4 B;  5I8N A;  1IJ6 A;  1K9K A;  2HQ8 A;  1M31 A;  3F45 A;  4YGB B;  4C0L A;  1UHN A;  3I5H B;  4CFQ A;  1ZAC A;  3BOW A;  1B9A A;  1AK8 A;  3IF7 A;  4MRX A;  1EG3 A;  1Y1U A;  5I2L A;  1W7I B;  3IQQ A;  1QTX A;  1QX7 A;  2K0J A;  4MRY A;  1SBJ A;  2EHB A;  1V1G A;  1OMD A;  2O60 A;  5HKZ A;  3JTD B;  1YRT B;  3VRO A;  2Y1M A;  1AUI B;  2JNX A;  1B7T Z;  1TOP A;  3AKB A;  1DJI A;  3H4S E;  1SRA A;  4C0K A;  1GGW A;  2JPT A;  1DGU A;  2JXC A;  2M1U A;  1KQV A;  1JF0 A;  4ORA B;  2EC6 C;  2FJU B;  2BE6 A;  2ZNE A;  3I5G C;  2M3W A;  2ZRS A;  3BUN B;  2BCB A;  1XYD A;  2LVV A;  2KDH A;  3CR4 X;  2DOQ A;  3DF0 B;  1XVJ A;  2F8P A;  2I2R E;  3PM8 A;  1QS7 A;  1ZFS A;  5J3X A;  2F2O A;  1RK9 A;  5KU1 A;  3I5F B;  1AJ4 A;  5CSI A;  1GJY A;  2MAZ A;  4PHM A;  2PAS A;  2NCP A;  1CNP A;  2PVB A;  1B8R A;  3TDU A;  2TN4 A;  1CFF A;  1MWN A;  1N0Y A;  1QVI Z;  1K90 D;  1JUO A;  3BUO B;  3M0W A;  3WNX B;  2KSP A;  3TUY C;  1NX0 A;  2L0P A;  4L9M A;  1B8C A;  4YGE B;  5FYX A;  4N1G A;  2P6B B;  1ODB A;  1QLK A;  4U8D A;  1MF8 B;  3BUX B;  1NUB A;  1V1F A;  1XFV O;  1RTP 1;  2SCP A;  4NQG A;  2FCE A;  4JPZ B;  4OV2 A;  2EC6 B;  4QJ3 B;  2O5G A;  4JQ0 D;  3I5I B;  1YVH A;  2JT0 A;  1CMF A;  4DRW A;  1OZO A;  1A4P A;  1Y0V H;  4CLN A;  3FIA A;  3CTN A;  2BL0 B;  4A4B A;  1U5I B;  1WRK A;  2M7L A;  3BOW B;  1NPQ A;  3BUM B;  2NXQ A;  2WOR A;  1DVI A;  4WRI A;  1UHJ A;  2G9B A;  3PAL A;  1XK4 A;  1JF2 A;  1CLB A;  2HET A;  1OQP A;  1WY9 A;  1XFU O;  3DVJ A;  3OP0 A;  3TUY B;  2KYF A;  2SAS A;  1FPW A;  1OZS A;  3NSI A;  3OB1 B;  2FOT A;  2NLN A;  4GUK A;  5D69 A;  4GFT A;  1SR6 C;  1IH0 A;  1A75 A;  1JFJ A;  4USL A;  1NCX A;  3VRP A;  2BKI B;  1IKU A;  2M7N A;  1J7O A;  2GV5 A;  3EVR A;  3MSE B;  1Y6W A;  1TCO B;  1S6J A;  2K2F A;  4GGF A;  4PCW A;  5ER5 A;  2E30 A;  4NDC A;  1R2U A;  1LKJ A;  3KEV A;  3TZ1 A;  2CCM A;  4I5J A;  1LA3 A;  1YVL A;  3CZT X;  1YX7 A;  2L4I A;  1J7Q A;  3GK4 X;  1WLM A;  2MA2 A;  3NSO A;  3VRR A;  4Q04 A;  1HQV A;  2LP2 A;  1RJV A;  4GAO A;  4CID A;  3RLZ A;  3CR5 X;  4CFR A;  4M2O A;  3JVT C;  1CLM A;  1HT9 A;  4MZJ A;  2VRG A;  2JUL A;  1XK4 C;  1KK8 B;  2Y1N A;  1FW4 A;  1DT7 B;  1MHO A;  3FS7 A;  3QRX A;  4PHJ A;  5D7F A;  2E6W A;  3LK1 A;  2LLT A;  1UWO A;  1M45 A;  1A29 A;  3VRQ A;  4TNC A;  4ORB B;  1UHI A;  2WCE A;  1C07 A;  2L98 A;  2V53 A;  1XFX O;  1K9U A;  2H61 A;  2MJW B;  4ICB A;  4HRE E;  1QV0 A;  2GGM A;  4GGF C;  1CKK A;  1EH2 A;  3SG3 A;  3KF9 A;  2LVJ A;  1CDL A;  1M63 B;  2ZN8 A;  1DJZ A;  3RM1 A;  4E68 A;  1MUX A;  3E3R A;  2KQ6 A;  2K7O A;  3JVT B;  1IQ3 A;  1PVA A;  2OTG B;  1A2X A;  2KI6 C;  2M97 A;  1CFD A;  4PE0 A;  3SIB A;  1IG5 A;  5I2O A;  2LE9 B;  2Q91 A;  1PRW A;  2FCD A;  2K7C A;  3GK2 A;  2LLS A;  4PE1 A;  1REC A;  1AVS A;  4AQJ A;  5AER A;  1A75 B;  4OVN F;  4QJ4 B;  1K93 D;  1S6C A;  3VRN A;  1S5G Y;  5DKR A;  2MRD A;  1OMV A;  1F4Q A;  1KWO C;  1SL9 A;  3BQ3 A;  2KYC A;  3AKA A;  2LNK A;  2LAN A;  1NYA A;  1JBA A;  2H61 C;  2KGB C;  1D1O A;  4ORC B;  4XJK B;  1PAL A;  2BE4 A;  3SG4 A;  1CDM A;  3CS1 A;  2Y5I A;  1NSH A;  1BMO A;  4PDZ A;  3TDI A;  2KBM A;  1R6P A;  2KQY A;  1RFJ A;  1G4Y R;  4I5K A;  4BY4 A;  3LK0 A;  1QAS A;  1BR4 B;  2AMI A;  1B4C A;  3LL8 B;  5PAL A;  4OCI A;  2LVI A;  1XA5 A;  1KCY A;  4WQ2 A;  1KQM C;  1EG4 A;  1BU3 A;  2F3Y A;  1SPY A;  2BCX A;  3PFV A;  5AFP A;  2LP3 A;  3D10 A;  1TNQ A;  3NSK A;  1CDP A;  3K21 A;  1KWO B;  2LUC A;  1XO5 A;  1QV1 A;  1DJH A; 
#chains in the Genus database with same CATH topology
 3I5G B;  1S1E A;  5I2Q A;  1UP5 A;  1BLQ A;  1H8B A;  4P2Y B;  1BR1 B;  1OOF A;  2JPO A;  1CB1 A;  2MBX A;  1OOG A;  1MQ1 A;  3A4U B;  4YGA A;  1NX2 A;  4GBA A;  5FI6 A;  2KHN A;  3BFA A;  1CTR A;  4ETO A;  2D8N A;  1SYM A;  3TS5 C;  1G33 A;  4MLW A;  2YGU A;  3S0D A;  5CSF A;  4UPG A;  1DMO A;  3UNW A;  3B6X A;  2KAV A;  1CFP A;  1N2D A;  2WOS A;  5CSN A;  1AHR A;  3HX4 A;  3CGA A;  3O6B A;  1NCY A;  3R1P A;  1BOD A;  2QPT A;  2ZFD A;  4DIR A;  1Z4H A;  1IJ5 A;  1TIZ A;  1CDN A;  3B86 A;  3V2L A;  2KI6 D;  3AAJ A;  3BFB A;  3Q8I A;  3OGN A;  5G08 A;  1ZOT B;  1ALW A;  2KGR A;  1NIW A;  1TTX A;  1SK6 D;  4CPV A;  4P5O E;  2CNP A;  1SSE B;  2B1U A;  2ZRT A;  1C3Y A;  3SG7 A;  2CTN A;  5TNC A;  2L51 A;  5AXI A;  3RZS A;  3VB1 A;  1SKT A;  2LAP A;  3R72 A;  2I7A A;  4HRG A;  1PK0 D;  2M49 B;  3FE6 A;  2HQW A;  4NDB A;  1X02 A;  2LLU A;  1UUR A;  3EK7 A;  2LCP A;  3BYA A;  4NDD A;  1OOI X;  1ALV A;  2L2C A;  3KHE A;  1DQE A;  1LXF C;  1KFU S;  3SS5 A;  1DJG A;  1LS8 A;  3ICB A;  4N1F A;  1TN4 A;  3SS4 A;  1CM4 A;  1CFC A;  1H4B A;  1PSR A;  1OOH A;  2WCM A;  2IS9 A;  1QIW A;  1KFU L;  2F3Z A;  2HPS A;  2Y4Q A;  1SR6 B;  3B87 A;  3FWC A;  4YBH B;  1Q80 A;  2OS8 C;  3DVM A;  2I18 A;  1OE9 B;  1F70 A;  1RRO A;  3PAT A;  1ZUZ A;  5AAN A;  1S6I A;  2K8M B;  3PN7 C;  3LLE A;  1JSA A;  1KSM A;  4JWQ A;  2LMU A;  1S36 A;  3ZNI A;  2WCL A;  1JWD A;  4ZCV A;  4BY5 A;  2L5Y A;  1F71 A;  2F33 A;  2CBL A;  4HSZ A;  2CXJ A;  2RGI A;  1BF5 A;  2R2I A;  2L5X B;  3O4Y A;  1MXE A;  3DXL A;  2AUC A;  3ZWH A;  2JOJ A;  2MLF C;  3CR2 A;  2I94 A;  3CWG A;  2LM5 A;  5HYD A;  1IGV A;  4OR9 B;  2WCJ A;  3EVU A;  1LIN A;  2P71 A;  3SIA A;  1KK7 Y;  2G2B A;  1S5G Z;  1YX8 A;  1EXR A;  1QXP A;  5B8I B;  1YUT A;  2QDI A;  2FJY A;  3JTD C;  3GK1 A;  3KPX A;  1MR8 A;  5HLO A;  1F8H A;  4MVF A;  5CPV A;  1SNL A;  2PSR A;  4YI9 A;  1DJW A;  1IRJ A;  4GGN A;  1DF0 A;  1SL8 A;  2K61 A;  2MHH A;  2LMV A;  1AJ5 A;  2HF5 A;  4YRU A;  5KTY A;  3D76 A;  5CSJ A;  3GOF A;  3IVT A;  3DVK A;  3NXA A;  3D0Y A;  4GNK B;  3OBV A;  4M2Q A;  1L7Z A;  5DKQ A;  1PSB A;  1T14 A;  1U5I A;  1FBV A;  1YUU A;  2LUX A;  2JNF A;  5HKY A;  3I5F C;  3OX6 A;  1UUS A;  4F0Z B;  1FI5 A;  1XFZ O;  1NWD A;  4PT1 A;  1ORG A;  1SCV A;  2KFF A;  2K7D A;  2M8U A;  1M46 A;  1Y1X A;  4JKT A;  1NCZ A;  3DD4 A;  3WHT B;  1EL4 A;  2JU0 A;  2JTT A;  3EVV A;  2LVK A;  3VGO A;  1PVB A;  4OKH A;  1WRZ A;  1TNP A;  4INX A;  5JOL A;  1J55 A;  1K94 A;  1GGZ A;  1QX5 B;  3A8R A;  3CDN A;  1NX3 A;  1C7V A;  1K8U A;  1SMG A;  2COL B;  2LV7 A;  2LMT A;  1CLL A;  4PHN A;  1ZMZ A;  2GGZ A;  3SG2 A;  3TDZ A;  2JXL A;  4DUQ A;  3I5I C;  1FF1 A;  1K96 A;  2KLD A;  2LHL A;  2MLE C;  2F2P A;  3OHM B;  2KNE A;  5AEQ A;  2WND A;  1XFW O;  2BEC A;  1JC2 A;  4YI8 A;  3D77 A;  1XFR A;  4R1E A;  3C1V A;  1N65 A;  1B7T Y;  2JT8 A;  4WQ3 A;  1DTL A;  1W9Z A;  2BL0 C;  1G8I A;  1PUL A;  4M2P A;  1E8A A;  3OX5 A;  5HKW A;  1LA0 A;  3IQO A;  1NP8 A;  4PAL A;  1OMR A;  2JWW A;  2M0R A;  3HCM A;  1DEK A;  3SJS A;  1OW4 A;  2JZI A;  2KBI A;  3WXA A;  3CZ0 A;  2K2A A;  3O78 A;  1QIV A;  3R1V A;  1KSO A;  2BBM A;  4I5L B;  2KOT A;  2LHI A;  1P28 A;  3O4X A;  3SG5 A;  5GQQ C;  4MSP A;  3D74 A;  4C0J A;  1QJT A;  1KQM B;  1JFK A;  1TNX A;  1DF0 B;  4MZK A;  1K2H A;  1QLS A;  3PLF B;  3CLN A;  1W7J B;  1QX2 A;  2ZND A;  1YR5 A;  4MZL A;  1QVI Y;  1IIO A;  2WCB A;  2KFH A;  3D0Y B;  2L4H A;  1SL7 A;  3LCP C;  1MXL C;  4KYN A;  2BBN A;  3DZT A;  2KAY A;  1Y1A A;  4ZCU A;  4A4C A;  3BXK A;  1J1D A;  1B47 A;  2M1K B;  3EK4 A;  1NX1 A;  3DVE A;  3DY9 A;  5DKN A;  1F55 A;  1XFY O;  1L2O C;  4DS7 A;  3TS5 B;  1CMG A;  4MEW A;  2JQ6 A;  1DC1 A;  2AAO A;  2L2E A;  2A4J A;  4AOM A;  3OB2 B;  1TRF A;  1J7P A;  1WRL A;  2PMY A;  4MBE A;  4YGD B;  1F4O A;  1KFX S;  1SCM C;  2NCO A;  1YUR A;  4HRH A;  1J7R A;  1BG1 A;  1KK8 C;  1SY9 A;  1IWQ A;  4FQO A;  2ZN9 A;  1RWY A;  1VRK A;  3KO0 A;  5HLV A;  1KFX L;  4PE7 A;  2KAX A;  1TNW A;  2H2K A;  4PE4 A;  4MN0 A;  5K89 A;  1S3P A;  3FE9 A;  1IQ5 A;  2NZ0 A;  3AAK A;  2WC8 A;  3EKH A;  3L4A A;  5JJG A;  1SW8 A;  1GM0 A;  5BPJ A;  1KK7 Z;  4D1E A;  3DF0 A;  2L50 A;  2PRU A;  4XJK A;  1DJX A;  2Q4U A;  2PAL A;  2OPO A;  1CM1 A;  1L2O B;  1EJ3 A;  1WDC C;  1FI6 A;  1UHH A;  2KI4 C;  4QJ5 B;  3SG6 A;  1K9P A;  4DCK A;  5ER4 X;  2QAC A;  3EKJ A;  3I5H C;  4YGC B;  2ISD A;  2JT3 A;  3PM2 A;  1B8L A;  1DJY A;  2OTG C;  4XYN A;  4AQI A;  1SCM B;  2BCA A;  1LVC D;  1UHK A;  1J1E A;  3CYZ A;  3PJI A;  4I5N B;  3EK8 A;  1OOJ A;  1OSA A;  1B1G A;  2KFG A;  5FI2 A;  1BOC A;  2JTZ A;  3O2P A;  4FTG A;  2LC5 A;  3NSL A;  1YRU B;  2H8V A;  4PHK A;  2CT9 A;  1F54 A;  1C7W A;  2EGD A;  2K7B A;  1WLZ A;  2BKH B;  2OS8 B;  1TCF A;  1YTZ C;  2ZKM X;  2QEV A;  2JRF A;  1DGV A;  5F6T A;  1BT6 A;  3PN7 B;  1GQM A;  5IBW A;  3B7A A;  1AP4 A;  1YUS A;  3NHT A;  2M9G A;  4IL1 A;  4N5X A;  1A03 A;  3PSR A;  3BJH A;  3WHU B;  2M29 A;  3FWB A;  1BJF A;  2JC2 A;  1S26 D;  2PQL A;  5KSZ A;  1M39 A;  1QAT A;  1WDC B;  2WCF A;  1K95 A;  3BUW B;  4GPL B;  2KI4 B;  5I8N A;  1IJ6 A;  1K9K A;  2HQ8 A;  1M31 A;  3F45 A;  4YGB B;  4C0L A;  1UHN A;  3I5H B;  4CFQ A;  1ZAC A;  3BOW A;  1B9A A;  1TUJ A;  1AK8 A;  3IF7 A;  4MRX A;  1EG3 A;  1Y1U A;  5I2L A;  3S0G A;  2QEO A;  1W7I B;  3IQQ A;  1QTX A;  1QX7 A;  2K0J A;  4MRY A;  5FI7 A;  1SBJ A;  2EHB A;  1V1G A;  1OMD A;  2O60 A;  3D78 A;  5HKZ A;  3JTD B;  1YRT B;  3BFH A;  3VRO A;  2Y1M A;  1AUI B;  2JNX A;  3DYE A;  1B7T Z;  3N7H A;  1TOP A;  3AKB A;  1DJI A;  3H4S E;  1SRA A;  4C0K A;  1GGW A;  2JPT A;  1C3Z A;  1DGU A;  1TUZ A;  2JXC A;  2M1U A;  1KQV A;  1JF0 A;  4ORA B;  2EC6 C;  2FJU B;  2BE6 A;  2ZNE A;  3I5G C;  2M3W A;  2ZRS A;  3BUN B;  2BCB A;  1XYD A;  2LVV A;  2KDH A;  3CR4 X;  2DOQ A;  3DF0 B;  1XVJ A;  3L4L A;  2F8P A;  2I2R E;  3PM8 A;  1QS7 A;  1ZFS A;  4FQT A;  2F2O A;  1RK9 A;  5J3X A;  5KU1 A;  3I5F B;  1AJ4 A;  5CSI A;  1GJY A;  4INW A;  2MAZ A;  4PHM A;  2PAS A;  2NCP A;  1CNP A;  2PVB A;  1B8R A;  3TDU A;  2KLE A;  3D75 A;  2TN4 A;  1CFF A;  1MWN A;  1N0Y A;  1QVI Z;  1K90 D;  3K1E A;  1JUO A;  3EG5 B;  3BUO B;  3M0W A;  3WNX B;  2KSP A;  3TUY C;  1NX0 A;  2L0P A;  4L9M A;  1B8C A;  4YGE B;  2BAP A;  5FYX A;  4N1G A;  2P6B B;  1ODB A;  1QLK A;  4U8D A;  1MF8 B;  3BUX B;  1NUB A;  5D3O A;  1V1F A;  1XFV O;  1RTP 1;  4JD9 A;  2SCP A;  4NQG A;  3UO9 A;  2FCE A;  4JPZ B;  2PYQ A;  2EC6 B;  2WC6 A;  4OV2 A;  2O5G A;  4JQ0 D;  4QJ3 B;  3I5I B;  1YVH A;  2JT0 A;  1CMF A;  4DRW A;  1OZO A;  5EL2 A;  1A4P A;  1Y0V H;  4CLN A;  3FIA A;  3CTN A;  2BL0 B;  4A4B A;  3CZ2 A;  1QWV A;  1U5I B;  1WRK A;  2M7L A;  3BOW B;  2BNX A;  1NPQ A;  3BUM B;  2NXQ A;  2WOR A;  1DVI A;  4WRI A;  1UHJ A;  3CZ1 A;  3S0B A;  2G9B A;  3PAL A;  1XK4 A;  2K60 A;  1JF2 A;  1CLB A;  2HET A;  1OQP A;  1WY9 A;  1XFU O;  3DVJ A;  3OP0 A;  3TUY B;  2WC5 A;  2KYF A;  2SAS A;  1FPW A;  1OZS A;  3NSI A;  3OB1 B;  2FOT A;  2NLN A;  4GUK A;  5D69 A;  4GFT A;  1SR6 C;  5DIC A;  1IH0 A;  1A75 A;  1TWO A;  1JFJ A;  4USL A;  1NCX A;  3VRP A;  2BKI B;  1IKU A;  2M7N A;  1Z2C B;  1J7O A;  2GV5 A;  5HL1 A;  3EVR A;  3R1O A;  3MSE B;  1Y6W A;  1TCO B;  1S6J A;  2K2F A;  4GGF A;  4PCW A;  5ER5 A;  2E30 A;  4NDC A;  1R2U A;  1LKJ A;  3KEV A;  3TZ1 A;  2CCM A;  4I5J A;  1LA3 A;  1YVL A;  3CZT X;  1YX7 A;  2L4I A;  1J7Q A;  3CAB A;  3GK4 X;  1WLM A;  2MA2 A;  3NSO A;  3VRR A;  4Q04 A;  1HQV A;  2LP2 A;  1RJV A;  4GAO A;  4CID A;  3RLZ A;  3CR5 X;  4CFR A;  4M2O A;  2WCK A;  3JVT C;  2P70 A;  1CLM A;  1HT9 A;  4MZJ A;  2VRG A;  2JUL A;  1XK4 C;  1KK8 B;  2Y1N A;  1FW4 A;  1DT7 B;  1MHO A;  3FS7 A;  3QRX A;  4PHJ A;  5D7F A;  2E6W A;  3LK1 A;  2LLT A;  1UWO A;  1M45 A;  1A29 A;  3VRQ A;  4TNC A;  4ORB B;  1UHI A;  2WCE A;  1C07 A;  2L98 A;  3D73 A;  2V53 A;  1XFX O;  1K9U A;  2H61 A;  2MJW B;  4ICB A;  4HRE E;  1QV0 A;  2GGM A;  4GGF C;  1CKK A;  1EH2 A;  3SG3 A;  3KF9 A;  3NGV A;  4IJ7 A;  2LVJ A;  1CDL A;  1M63 B;  2ZN8 A;  1DJZ A;  3RM1 A;  4E68 A;  1MUX A;  3E3R A;  2KQ6 A;  3NHI A;  1DEL A;  2K7O A;  2KPH A;  4OZD A;  3JVT B;  1IQ3 A;  1PVA A;  2QEB A;  2OTG B;  1A2X A;  2KI6 C;  2M97 A;  1CFD A;  4PE0 A;  3SIB A;  1IG5 A;  5I2O A;  2LE9 B;  2Q91 A;  1PRW A;  2FCD A;  3QME A;  2K7C A;  2QEH A;  2LLS A;  3GK2 A;  1REC A;  4PE1 A;  1AVS A;  4AQJ A;  5AER A;  1A75 B;  4OVN F;  3S0A A;  4QJ4 B;  1K93 D;  3S0E A;  1S6C A;  3VRN A;  1S5G Y;  5DKR A;  2MRD A;  1OMV A;  5I94 A;  3B88 A;  1F4Q A;  1KWO C;  1SL9 A;  3BQ3 A;  2KYC A;  3AKA A;  2LNK A;  2LAN A;  1NYA A;  1JBA A;  2H61 C;  2KGB C;  1D1O A;  2WCH A;  4ORC B;  4XJK B;  1PAL A;  2BE4 A;  3SG4 A;  1CDM A;  3CS1 A;  2Y5I A;  1NSH A;  1BMO A;  4PDZ A;  3TDI A;  2KBM A;  2ERB A;  1R6P A;  2KQY A;  1RFJ A;  3S0F A;  1G4Y R;  4I5K A;  3SS3 A;  4BY4 A;  3LK0 A;  1QAS A;  1BR4 B;  2AMI A;  3L47 A;  1B4C A;  3LL8 B;  5PAL A;  4OCI A;  2LVI A;  1XA5 A;  1KCY A;  4WQ2 A;  1KQM C;  1EG4 A;  1BU3 A;  2F3Y A;  1SPY A;  2BCX A;  3PFV A;  4F7F A;  5AFP A;  2GTE A;  2LP3 A;  3D10 A;  3FE8 A;  1TNQ A;  3NSK A;  1CDP A;  3K21 A;  1KWO B;  2LUC A;  1XO5 A;  1QV1 A;  1DJH A; 
#chains in the Genus database with same CATH homology
 3I5G B;  1S1E A;  5I2Q A;  1UP5 A;  1H8B A;  4P2Y B;  1BR1 B;  1CB1 A;  2MBX A;  1MQ1 A;  3A4U B;  4YGA A;  1NX2 A;  4GBA A;  2KHN A;  1CTR A;  4ETO A;  2D8N A;  1SYM A;  3TS5 C;  1G33 A;  4MLW A;  5CSF A;  4UPG A;  1DMO A;  2KAV A;  1CFP A;  1N2D A;  2WOS A;  5CSN A;  1AHR A;  3HX4 A;  3CGA A;  3O6B A;  1NCY A;  1BOD A;  2QPT A;  2ZFD A;  4DIR A;  1IJ5 A;  1TIZ A;  1CDN A;  2KI6 D;  3AAJ A;  5G08 A;  1ZOT B;  1ALW A;  2KGR A;  1NIW A;  1TTX A;  1SK6 D;  4CPV A;  4P5O E;  2CNP A;  2B1U A;  2ZRT A;  3SG7 A;  2CTN A;  5TNC A;  2L51 A;  5AXI A;  1SKT A;  2LAP A;  4HRG A;  2I7A A;  1PK0 D;  2M49 B;  4NDB A;  2HQW A;  1X02 A;  2LLU A;  1UUR A;  3EK7 A;  2LCP A;  3BYA A;  4NDD A;  1ALV A;  3KHE A;  1LXF C;  1KFU S;  1DJG A;  4N1F A;  3ICB A;  1TN4 A;  1CM4 A;  1CFC A;  1H4B A;  1PSR A;  2IS9 A;  1QIW A;  1KFU L;  2F3Z A;  2HPS A;  2Y4Q A;  1SR6 B;  3FWC A;  4YBH B;  1Q80 A;  2OS8 C;  3DVM A;  2I18 A;  1OE9 B;  1F70 A;  1RRO A;  3PAT A;  1ZUZ A;  5AAN A;  1S6I A;  2K8M B;  3PN7 C;  3LLE A;  1JSA A;  1KSM A;  4JWQ A;  2LMU A;  1S36 A;  3ZNI A;  1JWD A;  4ZCV A;  4BY5 A;  1F71 A;  2F33 A;  2CBL A;  4HSZ A;  2CXJ A;  2RGI A;  1BF5 A;  2R2I A;  2L5X B;  3O4Y A;  1MXE A;  2AUC A;  3ZWH A;  2JOJ A;  2MLF C;  3CR2 A;  2I94 A;  3CWG A;  2LM5 A;  5HYD A;  1IGV A;  4OR9 B;  3EVU A;  1LIN A;  3SIA A;  1KK7 Y;  2G2B A;  1S5G Z;  1YX8 A;  1EXR A;  1QXP A;  5B8I B;  1YUT A;  3JTD C;  3GK1 A;  3KPX A;  1MR8 A;  5HLO A;  1F8H A;  4MVF A;  5CPV A;  1SNL A;  2PSR A;  4YI9 A;  1DJW A;  1IRJ A;  4GGN A;  1DF0 A;  1SL8 A;  2K61 A;  2MHH A;  2LMV A;  1AJ5 A;  2HF5 A;  4YRU A;  5KTY A;  5CSJ A;  3GOF A;  3NXA A;  3DVK A;  3D0Y A;  4GNK B;  4M2Q A;  1L7Z A;  5DKQ A;  1PSB A;  1U5I A;  1FBV A;  1YUU A;  2LUX A;  2JNF A;  5HKY A;  3I5F C;  3OX6 A;  1UUS A;  4F0Z B;  1FI5 A;  1XFZ O;  1NWD A;  1SCV A;  2KFF A;  2K7D A;  2M8U A;  1M46 A;  1Y1X A;  1NCZ A;  3DD4 A;  3WHT B;  1EL4 A;  2JU0 A;  2JTT A;  3EVV A;  2LVK A;  3VGO A;  1PVB A;  4OKH A;  1WRZ A;  1TNP A;  5JOL A;  1J55 A;  1K94 A;  1GGZ A;  1QX5 B;  3A8R A;  1NX3 A;  1C7V A;  1K8U A;  1SMG A;  2COL B;  2LV7 A;  2LMT A;  1CLL A;  4PHN A;  1ZMZ A;  2GGZ A;  3SG2 A;  3TDZ A;  2JXL A;  4DUQ A;  3I5I C;  1FF1 A;  1K96 A;  2LHL A;  2MLE C;  3OHM B;  2F2P A;  2KNE A;  5AEQ A;  2WND A;  1XFW O;  2BEC A;  1JC2 A;  4YI8 A;  4R1E A;  3C1V A;  1N65 A;  1B7T Y;  2JT8 A;  4WQ3 A;  1DTL A;  2BL0 C;  1G8I A;  1PUL A;  4M2P A;  1E8A A;  3OX5 A;  5HKW A;  1LA0 A;  3IQO A;  1NP8 A;  4PAL A;  1OMR A;  2JWW A;  2M0R A;  3HCM A;  3SJS A;  2JZI A;  2KBI A;  3WXA A;  2K2A A;  3O78 A;  1QIV A;  1KSO A;  2BBM A;  4I5L B;  2KOT A;  2LHI A;  3SG5 A;  5GQQ C;  4MSP A;  4C0J A;  1QJT A;  1KQM B;  1JFK A;  1TNX A;  1DF0 B;  4MZK A;  1K2H A;  1QLS A;  3PLF B;  3CLN A;  1W7J B;  1QX2 A;  2ZND A;  1YR5 A;  4MZL A;  1QVI Y;  2WCB A;  2KFH A;  3D0Y B;  2L4H A;  1SL7 A;  3LCP C;  1MXL C;  2BBN A;  2KAY A;  1Y1A A;  4ZCU A;  4A4C A;  3BXK A;  1J1D A;  1B47 A;  2M1K B;  3EK4 A;  1NX1 A;  3DVE A;  5DKN A;  1F55 A;  1XFY O;  1L2O C;  4DS7 A;  3TS5 B;  1CMG A;  4MEW A;  2JQ6 A;  2AAO A;  2L2E A;  2A4J A;  4AOM A;  3OB2 B;  1TRF A;  1J7P A;  1WRL A;  2PMY A;  4MBE A;  4YGD B;  1F4O A;  1KFX S;  1SCM C;  2NCO A;  1YUR A;  4HRH A;  1J7R A;  1BG1 A;  1KK8 C;  1SY9 A;  1IWQ A;  4FQO A;  2ZN9 A;  1RWY A;  1VRK A;  3KO0 A;  5HLV A;  1KFX L;  4PE7 A;  2KAX A;  1TNW A;  2H2K A;  4PE4 A;  4MN0 A;  5K89 A;  1S3P A;  1IQ5 A;  2NZ0 A;  3AAK A;  2WC8 A;  3EKH A;  5JJG A;  1SW8 A;  5BPJ A;  1KK7 Z;  4D1E A;  3DF0 A;  2L50 A;  2PRU A;  4XJK A;  1DJX A;  2Q4U A;  2PAL A;  2OPO A;  1CM1 A;  1L2O B;  1EJ3 A;  1WDC C;  1FI6 A;  1UHH A;  2KI4 C;  4QJ5 B;  3SG6 A;  1K9P A;  4DCK A;  5ER4 X;  2QAC A;  3EKJ A;  3I5H C;  4YGC B;  2ISD A;  2JT3 A;  1B8L A;  1DJY A;  2OTG C;  4XYN A;  4AQI A;  1SCM B;  2BCA A;  1LVC D;  1UHK A;  1J1E A;  4I5N B;  3EK8 A;  1OOJ A;  1OSA A;  1B1G A;  2KFG A;  1BOC A;  2JTZ A;  3O2P A;  4FTG A;  2LC5 A;  3NSL A;  1YRU B;  4PHK A;  2CT9 A;  1C7W A;  2EGD A;  2K7B A;  1WLZ A;  2BKH B;  2OS8 B;  1TCF A;  1YTZ C;  2ZKM X;  2JRF A;  1DGV A;  5F6T A;  1BT6 A;  3PN7 B;  1GQM A;  5IBW A;  1AP4 A;  1YUS A;  2M9G A;  4IL1 A;  4N5X A;  1A03 A;  3PSR A;  3WHU B;  1F54 A;  2M29 A;  3FWB A;  1BJF A;  2JC2 A;  1S26 D;  5KSZ A;  1BLQ A;  1M39 A;  1QAT A;  1WDC B;  2WCF A;  1K95 A;  3BUW B;  4GPL B;  2KI4 B;  5I8N A;  1IJ6 A;  1K9K A;  2HQ8 A;  1M31 A;  3F45 A;  4YGB B;  4C0L A;  1UHN A;  3I5H B;  4CFQ A;  1ZAC A;  3BOW A;  1B9A A;  1AK8 A;  3IF7 A;  4MRX A;  1EG3 A;  1Y1U A;  5I2L A;  1W7I B;  3IQQ A;  1QTX A;  1QX7 A;  2K0J A;  4MRY A;  1SBJ A;  2EHB A;  1V1G A;  1OMD A;  2O60 A;  5HKZ A;  3JTD B;  1YRT B;  3VRO A;  2Y1M A;  1AUI B;  2JNX A;  1B7T Z;  1TOP A;  3AKB A;  1DJI A;  3H4S E;  1SRA A;  4C0K A;  1GGW A;  2JPT A;  1DGU A;  2JXC A;  2M1U A;  1KQV A;  1JF0 A;  4ORA B;  2EC6 C;  2FJU B;  2BE6 A;  2ZNE A;  3I5G C;  2M3W A;  2ZRS A;  3BUN B;  2BCB A;  1XYD A;  2LVV A;  2KDH A;  3CR4 X;  2DOQ A;  3DF0 B;  1XVJ A;  2F8P A;  2I2R E;  3PM8 A;  1QS7 A;  1ZFS A;  5J3X A;  2F2O A;  1RK9 A;  5KU1 A;  3I5F B;  1AJ4 A;  5CSI A;  1GJY A;  2MAZ A;  4PHM A;  2PAS A;  2NCP A;  1CNP A;  2PVB A;  1B8R A;  3TDU A;  2TN4 A;  1CFF A;  1MWN A;  1N0Y A;  1QVI Z;  1K90 D;  1JUO A;  3BUO B;  3M0W A;  3WNX B;  2KSP A;  3TUY C;  1NX0 A;  2L0P A;  4L9M A;  1B8C A;  4YGE B;  5FYX A;  4N1G A;  2P6B B;  1ODB A;  1QLK A;  4U8D A;  1MF8 B;  3BUX B;  1NUB A;  1V1F A;  1XFV O;  1RTP 1;  2SCP A;  4NQG A;  2FCE A;  4JPZ B;  4OV2 A;  2EC6 B;  4QJ3 B;  2O5G A;  4JQ0 D;  3I5I B;  1YVH A;  2JT0 A;  1CMF A;  4DRW A;  1OZO A;  1A4P A;  1Y0V H;  4CLN A;  3FIA A;  3CTN A;  2BL0 B;  4A4B A;  1U5I B;  1WRK A;  2M7L A;  3BOW B;  1NPQ A;  3BUM B;  2NXQ A;  2WOR A;  1DVI A;  4WRI A;  1UHJ A;  2G9B A;  3PAL A;  1XK4 A;  1JF2 A;  1CLB A;  2HET A;  1OQP A;  1WY9 A;  1XFU O;  3DVJ A;  3OP0 A;  3TUY B;  2KYF A;  2SAS A;  1FPW A;  1OZS A;  3NSI A;  3OB1 B;  2FOT A;  2NLN A;  4GUK A;  5D69 A;  4GFT A;  1SR6 C;  1IH0 A;  1A75 A;  1JFJ A;  4USL A;  1NCX A;  3VRP A;  2BKI B;  1IKU A;  2M7N A;  1J7O A;  2GV5 A;  3EVR A;  3MSE B;  1Y6W A;  1TCO B;  1S6J A;  2K2F A;  4GGF A;  4PCW A;  5ER5 A;  2E30 A;  4NDC A;  1R2U A;  1LKJ A;  3KEV A;  3TZ1 A;  2CCM A;  4I5J A;  1LA3 A;  1YVL A;  3CZT X;  1YX7 A;  2L4I A;  1J7Q A;  3GK4 X;  1WLM A;  2MA2 A;  3NSO A;  3VRR A;  4Q04 A;  1HQV A;  2LP2 A;  1RJV A;  4GAO A;  4CID A;  3RLZ A;  3CR5 X;  4CFR A;  4M2O A;  3JVT C;  1CLM A;  1HT9 A;  4MZJ A;  2VRG A;  2JUL A;  1XK4 C;  1KK8 B;  2Y1N A;  1FW4 A;  1DT7 B;  1MHO A;  3FS7 A;  3QRX A;  4PHJ A;  5D7F A;  2E6W A;  3LK1 A;  2LLT A;  1UWO A;  1M45 A;  1A29 A;  3VRQ A;  4TNC A;  4ORB B;  1UHI A;  2WCE A;  1C07 A;  2L98 A;  2V53 A;  1XFX O;  1K9U A;  2H61 A;  2MJW B;  4ICB A;  4HRE E;  1QV0 A;  2GGM A;  4GGF C;  1CKK A;  1EH2 A;  3SG3 A;  3KF9 A;  2LVJ A;  1CDL A;  1M63 B;  2ZN8 A;  1DJZ A;  3RM1 A;  4E68 A;  1MUX A;  3E3R A;  2KQ6 A;  2K7O A;  3JVT B;  1IQ3 A;  1PVA A;  2OTG B;  1A2X A;  2KI6 C;  2M97 A;  1CFD A;  4PE0 A;  3SIB A;  1IG5 A;  5I2O A;  2LE9 B;  2Q91 A;  1PRW A;  2FCD A;  2K7C A;  3GK2 A;  2LLS A;  4PE1 A;  1REC A;  1AVS A;  4AQJ A;  5AER A;  1A75 B;  4OVN F;  4QJ4 B;  1K93 D;  1S6C A;  3VRN A;  1S5G Y;  5DKR A;  2MRD A;  1OMV A;  1F4Q A;  1KWO C;  1SL9 A;  3BQ3 A;  2KYC A;  3AKA A;  2LNK A;  2LAN A;  1NYA A;  1JBA A;  2H61 C;  2KGB C;  1D1O A;  4ORC B;  4XJK B;  1PAL A;  2BE4 A;  3SG4 A;  1CDM A;  3CS1 A;  2Y5I A;  1NSH A;  1BMO A;  4PDZ A;  3TDI A;  2KBM A;  1R6P A;  2KQY A;  1RFJ A;  1G4Y R;  4I5K A;  4BY4 A;  3LK0 A;  1QAS A;  1BR4 B;  2AMI A;  1B4C A;  3LL8 B;  5PAL A;  4OCI A;  2LVI A;  1XA5 A;  1KCY A;  4WQ2 A;  1KQM C;  1EG4 A;  1BU3 A;  2F3Y A;  1SPY A;  2BCX A;  3PFV A;  5AFP A;  2LP3 A;  3D10 A;  1TNQ A;  3NSK A;  1CDP A;  3K21 A;  1KWO B;  2LUC A;  1XO5 A;  1QV1 A;  1DJH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...