1B8LA

Calcium-bound d51a/e101d/f102w triple mutant of beta carp parvalbumin
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
108
structure length
108
Chain Sequence
AFAGVLNDADIAAALEACKAADSFNHKAFFAKVGLTSKSADDVKKAFAIIAQDKSGFIEEDELKLFLQNFKADARALTDGETKTFLKAGDSDGDGKIGVDDWTALVKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (PARVALBUMIN)
publication title Metal-ion affinity and specificity in EF-hand proteins: coordination geometry and domain plasticity in parvalbumin.
pubmed doi rcsb
source organism Cyprinus carpio
molecule tags Calcium binding protein
total genus 38
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1999-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1b8lA00
1S5GY 1G4YR 2M0RA 1WY9A 2KFFA 1OE9B 1F8HA 1SKTA 1MQ1A 1YR5A 1RECA 2M97A 1BR4B 1XVJA 3NXAA 1K93D 1SYMA 4F0ZB 1A75B 1QLKA 1WLZA 1JUOA 1YUUA 1LKJA 4CFQA 1PSBA 5CSNA 2KI6D 5HLVA 3SG5A 1JC2A 3D10A 2I2RE 1CLLA 3LK1A 2KFGA 1PALA 2OS8B 2LM5A 2LMUA 5CSJA 2H2KA 5HYDA 2F3ZA 1BF5A 4YRUA 1SL9A 2JULA 1OZSA 1M63B 1SCMC 3LK0A 2D8NA 4FTGA 1TNWA 1SK6D 3LLEA 3BOWB 1SCMB 3RM1A 1F4OA 1DTLA 5HLOA 2M49B 1XFZO 2Y5IA 3SG7A 4I5JA 1BJFA 2LVVA 1C7WA 3BUOB 2LLUA 3KPXA 1IGVA 1AJ5A 4YGAA 4GUKA 1MXEA 1F70A 3AAJA 4QJ4B 3D0YA 2ZNEA 4PE0A 1ALWA 3DF0A 3SJSA 2GGMA 2R2IA 1WRLA 1IWQA 2VRGA 2JQ6A 4XJKA 3ICBA 3CS1A 4GGFC 1B1GA 5KTYA 2KQYA 2F33A 5B8IB 2BKIB 2K7DA 3EKJA 1CMGA 2F2OA 1DJZA 2BCXA 3CZTX 2EC6C 1SL8A 1RTP1 1IJ6A 2LUCA 2MLEC 2JPTA 5J3XA 1S26D 1J1DA 1JBAA 4PHKA 3EKHA 4AOMA 4MZKA 1PULA 1C7VA 4QJ5B 1GGZA 1TCFA 4I5KA 1JF0A 3SG4A 1NCZA 1ZOTB 4I5LB 4NDDA 4HRHA 2H61C 2OTGB 1KK8C 2LC5A 1BLQA 1S36A 1K9PA 2PRUA 1KWOC 4PALA 1Y1UA 4ORBB 1CFCA 2LP2A 1VRKA 3IF7A 2JRFA 1TNQA 1YX7A 4PCWA 1K9UA 4MZLA 1KQVA 1WRZA 1QATA 1NUBA 2K7CA 2KAYA 1SBJA 1RK9A 3AKAA 4GFTA 4OV2A 1CKKA 5JOLA 3BQ3A 2FJUB 2K2FA 3DF0B 2Q91A 4PHMA 3TZ1A 2WORA 2ZRSA 5ER5A 4CLNA 1JFJA 4JQ0D 3KO0A 4AQIA 1F55A 4DRWA 1MXLC 1EL4A 1KSMA 1YTZC 1LINA 5I8NA 2LAPA 2EHBA 2K0JA 2LE9B 4JPZB 1YUSA 1UHNA 5JJGA 1PSRA 2KYCA 4WRIA 1QV0A 2WNDA 1IJ5A 2FOTA 3MSEB 2MLFC 1F54A 1FPWA 5I2QA 1KFXS 2KDHA 3OX6A 4GPLB 1OMVA 1ZFSA 2K7OA 2GV5A 3KHEA 3SG3A 3CTNA 1UHHA 2NZ0A 1NSHA 1OOJA 3DVKA 2DOQA 2CT9A 2WCFA 1UHIA 2JNFA 1CTRA 4ICBA 1YVHA 1XK4C 1A03A 5K89A 1KK7Z 1HT9A 3CR4X 1KK7Y 1DMOA 4OCIA 1Q80A 3FS7A 1EG3A 5AEQA 1S3PA 2JXLA 2F2PA 3TUYC 2JWWA 4PE7A 1BODA 1L7ZA 1UHJA 2K2AA 2SASA 1H8BA 1A29A 1K9KA 1HQVA 2ZKMX 1S1EA 2COLB 4NDBA 4MLWA 1MF8B 2LNKA 1RWYA 1ZMZA 2JT3A 1PRWA 1KFXL 2PMYA 2Y1MA 4PDZA 1J7OA 1CFFA 1AK8A 1EXRA 2BCBA 2IS9A 1NWDA 5FYXA 3VRQA 3AKBA 1TOPA 3BYAA 2K8MB 5AERA 1BG1A 4ORAB 2A4JA 4ZCUA 1QX7A 2OS8C 4XYNA 1YRUB 1J7PA 2LHIA 2JZIA 3C1VA 1M46A 2M29A 3CGAA 3CWGA 1CDNA 2KQ6A 2KOTA 2P6BB 1F71A 3PN7B 1K2HA 1BR1B 1FI6A 4YBHB 2M7NA 2KGRA 4N1GA 1S6IA 1SW8A 4DS7A 1U5IB 2QACA 3O2PA 5AXIA 2L4HA 3CLNA 2CNPA 4BY5A 1D1OA 1CM4A 5D7FA 3OX5A 1LA0A 5I2LA 1J1EA 1AHRA 3DVEA 1DJXA 2JNXA 4A4CA 2H61A 2Y4QA 4A4BA 4USLA 3E3RA 3FWCA 4MN0A 2LVKA 1GGWA 3IQQA 1QJTA 1ZACA 4IL1A 4N5XA 4YGCB 4DIRA 1KCYA 1TNXA 2LV7A 1TNPA 4GGNA 1CB1A 1SMGA 3PFVA 3O4YA 3JTDC 2KFHA 1NPQA 4NDCA 4OR9B 1FI5A 1SPYA 5TNCA 2MA2A 3JTDB 3I5FC 1K96A 2HETA 3I5FB 2AAOA 3BUMB 1WLMA 2K7BA 2PSRA 2OTGC 1TCOB 1IQ3A 1QX5B 3PSRA 1SCVA 2WCBA 1BOCA 1YUTA 1YX8A 1X02A 2KHNA 4MEWA 5KSZA 2M7LA 5ER4X 3DD4A 3WHTB 3A8RA 1CM1A 3VRNA 3ZNIA 2L50A 3GOFA 1YRTB 2L5XB 4HRGA 3I5GB 1QVIZ 1QVIY 2LANA 3O6BA 4DCKA 3PM8A 2ZNDA 2E30A 1PVBA 4YGEB 1IKUA 2KNEA 4PHJA 3H4SE 4Q04A 4GBAA 1NYAA 2CTNA 2B1UA 2HPSA 3D0YB 4MZJA 5D69A 5DKNA 5DKQA 1QLSA 4GNKB 4XJKB 3SG6A 2HQ8A 1XFYO 2L4IA 1M45A 4DUQA 2ZFDA 1UURA 1NX1A 3QRXA 2JXCA 1S6CA 4PE1A 1AJ4A 1YURA 1QASA 2KBIA 4C0JA 3WNXB 1CLMA 1AUIB 1DF0A 3CR2A 1BU3A 4M2OA 3SG2A 2LLTA 1PVAA 2WOSA 4C0LA 1WDCB 2LP3A 1DJIA 1V1FA 1XFVO 1SNLA 1SR6C 1DJHA 1KFUS 3RLZA 4E68A 1DT7B 1FBVA 1SR6B 2F8PA 3BUNB 5GQQC 1OSAA 2Y1NA 2KAVA 2LMTA 1MR8A 1A75A 2V53A 2LMVA 3OP0A 3AAKA 1DGUA 4MBEA 1Y1XA 4ORCB 2MRDA 1B9AA 4NQGA 1J55A 1MHOA 4YGBB 2LHLA 4AQJA 2WC8A 2LVJA 2BL0B 2M3WA 3BUXB 1EH2A 1CDMA 1BT6A 2JC2A 3EVVA 2AUCA 4D1EA 4ETOA 1IRJA 1DJGA 2MAZA 1AVSA 5G08A 4GAOA 3BOWA 4QJ3B 1W7IB 1DVIA 1NP8A 3NSLA 1A4PA 3NSKA 2KYFA 2LUXA 4CIDA 2KSPA 1JWDA 3OB1B 1TRFA 3BXKA 1XFXO 1XA5A 4OKHA 2SCPA 4MSPA 3SIBA 2EGDA 1B47A 2KBMA 1AP4A 2L98A 2ISDA 1JSAA 1TIZA 2M9GA 2LCPA 4UPGA 1CMFA 1Y6WA 2JT8A 2CCMA 1CDPA 3HX4A 3PN7C 1G8IA 5F6TA 1NIWA 4GGFA 1KQMC 1XFUO 2FCEA 2KAXA 1OQPA 1MWNA 1KQMB 1QV1A 1NCYA 4I5NB 4MRXA 5HKYA 1DJYA 3DVMA 3EK7A 3M0WA 1XFWO 5HKWA 5KU1A 1GJYA 1YVLA 1R6PA 1J7QA 2BECA 3I5IC 1Y1AA 3O78A 1GQMA 3I5IB 3F45A 3EK8A 3PLFB 4OVNF 3K21A 3VROA 2BKHB 3WHUB 2BE4A 4WQ3A 4CPVA 2BE6A 2O60A 1DGVA 5AFPA 3VRRA 4P5OE 2K61A 4MVFA 1M39A 1R2UA 1MUXA 1L2OC 1NCXA 1JFKA 3EVRA 4BY4A 1L2OB 1OZOA 2BBMA 2MJWB 1WRKA 4U8DA 2KI4C 3TDZA 1G33A 1SL7A 2KI4B 3I5HC 1J7RA 2MBXA 2I7AA 3VGOA 1H4BA 3I5HB 1UP5A 4M2QA 3ZWHA 2CXJA 2OPOA 2JT0A 2LLSA 3VRPA 2TN4A 1IQ5A 1CFDA 2BCAA 2QPTA 3HCMA 4PHNA 1UHKA 4YI9A 1UWOA 1N2DA 3I5GC 3KF9A 2M1UA 4FQOA 1FW4A 1LXFC 1K94A 1QX2A 4JWQA 2EC6B 4YGDB 4MRYA 1B8LA 3BUWB 5CSIA 5AANA 2KGBC 1QIWA 1B8RA 5BPJA 2JU0A 4WQ2A 4HSZA 1B4CA 1RFJA 2ZRTA 5CPVA 1A2XA 4P2YB 1BMOA 3NSOA 4TNCA 3FIAA 1CFPA 3A4UB 3PALA 3WXAA 1CNPA 1UUSA 1V1GA 1KK8B 3GK4X 4HREE 1NX2A 1K90D 1QS7A 1KWOB 2RGIA 4CFRA 4L9MA 1SY9A 2ZN8A 1XK4A 2G2BA 1DJWA 1SRAA 1K8UA 3EK4A 2JTTA 1OMRA 2L2EA 2ZN9A 1CDLA 1WDCC 1CLBA 1ZUZA 1FF1A 5HKZA 1NX3A 1LA3A 1PK0D 1XYDA 2AMIA 1QTXA 1NX0A 2JOJA 2HF5A 3DVJA 1N65A 2KI6C 1XO5A 1JF2A 1Y0VH 2PVBA 2Q4UA 1IH0A 2E6WA 3GK2A 2FCDA 2M1KB 1IG5A 3LL8B 2M8UA 3KEVA 3TDUA 1N0YA 1RROA 3SIAA 4R1EA 2JTZA 3EVUA 1EJ3A 2G9BA 3OHMB 2CBLA 1E8AA 5I2OA 1ODBA 5PALA 1K95A 2L51A 1S6JA 2BL0C 2PALA 3PATA 1EG4A 4PE4A 2HQWA 4YI8A 1OMDA 3TDIA 4ZCVA 1C07A 1TTXA 1B7TZ 4M2PA 1B7TY 2WCEA 4N1FA 2NCOA 2PASA 3GK1A 2L0PA 1B8CA 1M31A 3TS5C 5IBWA 1QXPA 1F4QA 5DKRA 1W7JB 2NCPA 3TS5B 1LVCD 2O5GA 1U5IA 2I94A 4C0KA 1QIVA 3LCPC 1RJVA 2I18A 1DF0B 1KFUL 3CR5X 2GGZA 2MHHA 3NSIA 1TN4A 2BBNA 2LVIA 3JVTC 5CSFA 1KSOA 3JVTB 2F3YA 3FWBA 2NXQA 3OB2B 3TUYB 3IQOA 1ALVA 1S5GZ 2NLNA
chains in the Genus database with same CATH superfamily
1S5GY 1G4YR 2PYQA 3UO9A 2M0RA 1WY9A 2KFFA 1OE9B 1F8HA 1SKTA 1MQ1A 1DELA 1RECA 1YR5A 1BR4B 1XVJA 2M97A 1K93D 3NXAA 1SYMA 4F0ZB 2P71A 1A75B 1QLKA 1WLZA 1JUOA 1YUUA 1LKJA 4CFQA 1PSBA 2WCJA 5CSNA 2KI6D 5HLVA 3SG5A 1JC2A 3D10A 2I2RE 2P70A 1OW4A 1CLLA 3LK1A 2KFGA 1PALA 2OS8B 2LM5A 1GM0A 2LMUA 5CSJA 2H2KA 5HYDA 2F3ZA 1BF5A 4YRUA 1SL9A 2JULA 1OZSA 1M63B 1SCMC 3LK0A 2D8NA 4FTGA 3D77A 1TNWA 1SK6D 3LLEA 3BOWB 1SCMB 3RM1A 1F4OA 1DTLA 5HLOA 2M49B 1XFZO 2Y5IA 3SG7A 4I5JA 1BJFA 2LVVA 1C7WA 3BUOB 2LLUA 3KPXA 1IGVA 1AJ5A 4YGAA 4GUKA 1MXEA 1TWOA 1F70A 3L4AA 3AAJA 4QJ4B 3D0YA 3R1VA 2ZNEA 3D73A 4PE0A 1ALWA 3DF0A 3SJSA 2GGMA 2R2IA 1WRLA 1IWQA 2VRGA 2JQ6A 2K60A 3ICBA 3CS1A 4GGFC 4XJKA 1B1GA 5KTYA 2KQYA 2F33A 5B8IB 2BKIB 2K7DA 3EKJA 1CMGA 2F2OA 1DJZA 2BCXA 3CZTX 2EC6C 1SL8A 1IIOA 1RTP1 1IJ6A 2LUCA 2MLEC 2JPTA 5J3XA 1S26D 1J1DA 3PJIA 3S0GA 1JBAA 4PHKA 3EKHA 4AOMA 4MZKA 1PULA 1C7VA 4QJ5B 1GGZA 1TCFA 4I5KA 1JF0A 3SG4A 1NCZA 1ZOTB 4I5LB 4NDDA 4HRHA 2H61C 2OTGB 3CZ0A 1KK8C 2LC5A 1BLQA 1S36A 1K9PA 2PRUA 1KWOC 4PALA 1Y1UA 4ORBB 1CFCA 2LP2A 1VRKA 3IF7A 2JRFA 3OGNA 1TNQA 1YX7A 3SS4A 4PCWA 1K9UA 3S0EA 4MZLA 1KQVA 1WRZA 4INXA 1QATA 1NUBA 2K7CA 2KAYA 1SBJA 3CABA 1RK9A 3AKAA 4GFTA 3QMEA 4OV2A 3D78A 1CKKA 5JOLA 3BQ3A 2FJUB 2K2FA 3DF0B 2Q91A 4PHMA 3CYZA 3TZ1A 2WORA 2ZRSA 5ER5A 4CLNA 1JFJA 4JQ0D 1TUJA 3KO0A 3UNWA 4AQIA 3L4LA 1F55A 2JPOA 4DRWA 1MXLC 1EL4A 1KSMA 1YTZC 1LINA 5I8NA 2LAPA 3FE6A 3SS3A 2EHBA 2K0JA 2LE9B 1Z4HA 1YUSA 4JPZB 1UHNA 5JJGA 1PSRA 2KYCA 3L47A 4WRIA 1QV0A 2WNDA 1IJ5A 2FOTA 3MSEB 2MLFC 1F54A 1FPWA 5I2QA 3CZ2A 1KFXS 2KDHA 3OX6A 3OBVA 4GPLB 1OMVA 5D3OA 1ZFSA 2K7OA 2GV5A 3KHEA 3SG3A 3CTNA 4JKTA 1UHHA 2NZ0A 1NSHA 1OOJA 3DVKA 2DOQA 2CT9A 2WCFA 1UHIA 2JNFA 1CTRA 4ICBA 1YVHA 1XK4C 1A03A 5K89A 1KK7Z 1HT9A 3CR4X 1KK7Y 1DMOA 4OCIA 1Q80A 3FS7A 1EG3A 5AEQA 1S3PA 2JXLA 2F2PA 3TUYC 2JWWA 4PE7A 1BODA 1L7ZA 1UHJA 2K2AA 2SASA 1H8BA 1A29A 1K9KA 1HQVA 2ZKMX 1S1EA 2COLB 4NDBA 4MLWA 1DC1A 1MF8B 2LNKA 1RWYA 1ZMZA 2JT3A 1PRWA 1KFXL 2PMYA 2Y1MA 4PDZA 1J7OA 1CFFA 1AK8A 1EXRA 2BCBA 2IS9A 1NWDA 5FYXA 3VRQA 5FI7A 3AKBA 1TOPA 3BYAA 2K8MB 5AERA 1BG1A 4ORAB 3VB1A 2A4JA 1T14A 2YGUA 4ZCUA 1QX7A 2OS8C 4XYNA 1YRUB 1J7PA 2LHIA 2JZIA 3C1VA 1M46A 3CZ1A 1XFRA 2M29A 3CGAA 3DYEA 1TUZA 3CWGA 1CDNA 2KQ6A 2KOTA 2QEVA 2P6BB 1F71A 3PN7B 1K2HA 1BR1B 4PT1A 4YBHB 1FI6A 2M7NA 2KGRA 4N1GA 1S6IA 1SW8A 4DS7A 1U5IB 2QACA 3O2PA 5AXIA 2L4HA 3CLNA 2CNPA 4BY5A 1D1OA 3S0FA 1CM4A 5D7FA 3OX5A 1LA0A 5I2LA 1J1EA 1AHRA 3DVEA 1DJXA 2JNXA 4KYNA 4A4CA 2H61A 2Y4QA 4A4BA 4USLA 2QEOA 3E3RA 3FWCA 4MN0A 2LVKA 1GGWA 3IQQA 1QJTA 1ZACA 3IVTA 4IL1A 4N5XA 4YGCB 4DIRA 5HL1A 1TNXA 3B88A 1KCYA 2LV7A 1TNPA 3NHIA 4GGNA 1CB1A 1SMGA 3PFVA 1OOFA 3JTDC 2KFHA 1NPQA 3O4YA 4NDCA 4OR9B 1FI5A 1SPYA 5TNCA 2MA2A 3JTDB 3I5FC 1K96A 2HETA 3I5FB 2AAOA 3BUMB 1WLMA 1DEKA 2K7BA 2PSRA 2OTGC 1TCOB 1IQ3A 1QX5B 3PSRA 1SCVA 2WCBA 1BOCA 1YUTA 1YX8A 1X02A 2KHNA 3N7HA 3B7AA 4MEWA 5KSZA 2M7LA 5ER4X 3DD4A 3WHTB 3A8RA 3K1EA 1CM1A 3VRNA 3ZNIA 2L50A 3GOFA 2GTEA 1YRTB 2L5XB 4INWA 4HRGA 3I5GB 1QVIZ 1C3YA 1QVIY 2LANA 3O6BA 2BAPA 4DCKA 3BFBA 3PM8A 2ZNDA 2E30A 1PVBA 4IJ7A 4YGEB 1IKUA 2KNEA 4PHJA 3H4SE 4Q04A 4GBAA 1NYAA 2CTNA 2B1UA 2HPSA 3D0YB 4MZJA 5D69A 5DKNA 5DKQA 1QLSA 4GNKB 4XJKB 2WCHA 3SG6A 3S0DA 2HQ8A 1C3ZA 1XFYO 2KPHA 1M45A 2L4IA 2QEBA 4DUQA 2ZFDA 1UURA 1NX1A 3QRXA 2JXCA 1S6CA 4PE1A 1AJ4A 1YURA 1QASA 2KBIA 4C0JA 3WNXB 1CLMA 1AUIB 1DF0A 3CR2A 1BU3A 4M2OA 3SG2A 1ORGA 2LLTA 1PVAA 2WOSA 4C0LA 1WDCB 2LP3A 1DJIA 1V1FA 1XFVO 1SNLA 1SR6C 1DJHA 1KFUS 3RLZA 4E68A 1DT7B 1FBVA 1SR6B 2F8PA 3BUNB 5GQQC 1OSAA 2Y1NA 2KAVA 2LMTA 1MR8A 1A75A 2V53A 2LMVA 3OP0A 3AAKA 1DGUA 4MBEA 1Y1XA 4ORCB 2MRDA 1B9AA 4NQGA 1J55A 1MHOA 4YGBB 2LHLA 3S0AA 4AQJA 2WC8A 2LVJA 3BJHA 2BL0B 2M3WA 3BUXB 1EH2A 1CDMA 1BT6A 2JC2A 3EVVA 5FI2A 2AUCA 4D1EA 4ETOA 1IRJA 1DJGA 2MAZA 1AVSA 5G08A 4GAOA 3BOWA 4QJ3B 1W7IB 1DVIA 1NP8A 3NSLA 1A4PA 1LS8A 2KYFA 2LUXA 3NSKA 2KSPA 4CIDA 3SS5A 1JWDA 2WCLA 3OB1B 1TRFA 3BXKA 1XFXO 1XA5A 4OKHA 2KLEA 2SCPA 5I94A 3RZSA 4MSPA 3SIBA 2EGDA 1B47A 2KBMA 1AP4A 2L98A 2ISDA 1JSAA 2QEHA 2H8VA 3DY9A 4F7FA 1TIZA 2M9GA 2LCPA 4UPGA 1CMFA 1Y6WA 2JT8A 2CCMA 1CDPA 3HX4A 3PN7C 1G8IA 4OZDA 5F6TA 1NIWA 4GGFA 1KQMC 1XFUO 4JD9A 2FCEA 2KAXA 1OQPA 1MWNA 1KQMB 1QV1A 1NCYA 3R72A 4I5NB 4MRXA 5EL2A 5HKYA 1DJYA 3DVMA 3EK7A 3M0WA 1XFWO 5HKWA 5KU1A 1GJYA 1YVLA 1R6PA 1J7QA 2BECA 3D75A 3I5IC 1Y1AA 3O78A 1GQMA 3I5IB 3F45A 3EK8A 3PLFB 4OVNF 3K21A 3VROA 2BKHB 3WHUB 2BE4A 4WQ3A 4CPVA 2BE6A 2O60A 1DGVA 5AFPA 1SSEB 3B6XA 3VRRA 4P5OE 3R1PA 2K61A 4MVFA 1M39A 1R2UA 1MUXA 1L2OC 1Z2CB 1NCXA 1JFKA 3EVRA 4BY4A 1L2OB 1OZOA 2BBMA 2WCMA 2MJWB 1WRKA 4U8DA 2KI4C 3TDZA 3D74A 1W9ZA 1G33A 1SL7A 2KI4B 3I5HC 1J7RA 2MBXA 2I7AA 3VGOA 1H4BA 3I5HB 1UP5A 4M2QA 3ZWHA 2KLDA 3BFHA 2CXJA 2L5YA 2OPOA 2JT0A 2LLSA 3CDNA 3R1OA 3VRPA 2TN4A 1IQ5A 1CFDA 2BCAA 2QPTA 5DICA 3HCMA 3B86A 4PHNA 1UHKA 2WC5A 4YI9A 1UWOA 1DQEA 1N2DA 5FI6A 3I5GC 3KF9A 2M1UA 2WCKA 4FQOA 1FW4A 1LXFC 1K94A 1QX2A 4JWQA 2EC6B 4YGDB 4MRYA 1B8LA 3BUWB 5CSIA 5AANA 2KGBC 4FQTA 1QIWA 1B8RA 5BPJA 3NHTA 3V2LA 2JU0A 3NGVA 4WQ2A 4HSZA 1B4CA 1RFJA 2ZRTA 5CPVA 1A2XA 4P2YB 1BMOA 1QWVA 3NSOA 4TNCA 3FIAA 1CFPA 3A4UB 3PALA 3D76A 3WXAA 1CNPA 1OOHA 1UUSA 1V1GA 1KK8B 3GK4X 4HREE 1NX2A 1K90D 1QS7A 1KWOB 2RGIA 4CFRA 4L9MA 1SY9A 2ZN8A 1XK4A 2G2BA 1DJWA 3S0BA 1SRAA 1K8UA 3EK4A 2JTTA 1OMRA 2L2EA 2ZN9A 1CDLA 1WDCC 1CLBA 1ZUZA 3FE9A 1FF1A 5HKZA 1NX3A 1LA3A 1PK0D 1XYDA 2AMIA 1QTXA 1NX0A 2JOJA 2HF5A 3DVJA 1N65A 2KI6C 1XO5A 2L2CA 3B87A 1JF2A 1Y0VH 2PVBA 2WC6A 2Q4UA 1IH0A 2E6WA 3GK2A 2FCDA 2M1KB 1IG5A 3LL8B 2M8UA 3KEVA 3TDUA 1N0YA 1RROA 3SIAA 4R1EA 2JTZA 3EVUA 3O4XA 1EJ3A 2G9BA 3OHMB 2CBLA 1E8AA 5I2OA 1ODBA 2QDIA 5PALA 1K95A 2L51A 1S6JA 2BL0C 2PALA 3PATA 1EG4A 3EG5B 4PE4A 2HQWA 2PQLA 4YI8A 1OMDA 3DXLA 3TDIA 4ZCVA 1C07A 1TTXA 1B7TZ 4M2PA 1B7TY 1P28A 2WCEA 4N1FA 2NCOA 2PASA 3GK1A 2L0PA 1B8CA 1M31A 3TS5C 5IBWA 1QXPA 1F4QA 5DKRA 1W7JB 2NCPA 3TS5B 1LVCD 2O5GA 1U5IA 2I94A 4C0KA 1QIVA 1OOGA 3LCPC 1RJVA 2I18A 1DF0B 3DZTA 1KFUL 3CR5X 2GGZA 2ERBA 2MHHA 3NSIA 1TN4A 2BBNA 2LVIA 1OOIX 3FE8A 3JVTC 5CSFA 1KSOA 2BNXA 3JVTB 2F3YA 3Q8IA 3FWBA 2NXQA 3OB2B 3TUYB 2FJYA 3IQOA 3BFAA 3PM2A 1ALVA 1S5GZ 2NLNA
chains in the Genus database with same CATH topology
1S5GY 1G4YR 2M0RA 1WY9A 2KFFA 1OE9B 1F8HA 1SKTA 1MQ1A 1YR5A 1RECA 2M97A 1BR4B 1XVJA 3NXAA 1K93D 1SYMA 4F0ZB 1A75B 1QLKA 1WLZA 1JUOA 1YUUA 1LKJA 4CFQA 1PSBA 5CSNA 2KI6D 5HLVA 3SG5A 1JC2A 3D10A 2I2RE 1CLLA 3LK1A 2KFGA 1PALA 2OS8B 2LM5A 2LMUA 5CSJA 2H2KA 5HYDA 2F3ZA 1BF5A 4YRUA 1SL9A 2JULA 1OZSA 1M63B 1SCMC 3LK0A 2D8NA 4FTGA 1TNWA 1SK6D 3LLEA 3BOWB 1SCMB 3RM1A 1F4OA 1DTLA 5HLOA 2M49B 1XFZO 2Y5IA 3SG7A 4I5JA 1BJFA 2LVVA 1C7WA 3BUOB 2LLUA 3KPXA 1IGVA 1AJ5A 4YGAA 4GUKA 1MXEA 1F70A 3AAJA 4QJ4B 3D0YA 2ZNEA 4PE0A 1ALWA 3DF0A 3SJSA 2GGMA 2R2IA 1WRLA 1IWQA 2VRGA 2JQ6A 4XJKA 3ICBA 3CS1A 4GGFC 1B1GA 5KTYA 2KQYA 2F33A 5B8IB 2BKIB 2K7DA 3EKJA 1CMGA 2F2OA 1DJZA 2BCXA 3CZTX 2EC6C 1SL8A 1RTP1 1IJ6A 2LUCA 2MLEC 2JPTA 5J3XA 1S26D 1J1DA 1JBAA 4PHKA 3EKHA 4AOMA 4MZKA 1PULA 1C7VA 4QJ5B 1GGZA 1TCFA 4I5KA 1JF0A 3SG4A 1NCZA 1ZOTB 4I5LB 4NDDA 4HRHA 2H61C 2OTGB 1KK8C 2LC5A 1BLQA 1S36A 1K9PA 2PRUA 1KWOC 4PALA 1Y1UA 4ORBB 1CFCA 2LP2A 1VRKA 3IF7A 2JRFA 1TNQA 1YX7A 4PCWA 1K9UA 4MZLA 1KQVA 1WRZA 1QATA 1NUBA 2K7CA 2KAYA 1SBJA 1RK9A 3AKAA 4GFTA 4OV2A 1CKKA 5JOLA 3BQ3A 2FJUB 2K2FA 3DF0B 2Q91A 4PHMA 3TZ1A 2WORA 2ZRSA 5ER5A 4CLNA 1JFJA 4JQ0D 3KO0A 4AQIA 1F55A 4DRWA 1MXLC 1EL4A 1KSMA 1YTZC 1LINA 5I8NA 2LAPA 2EHBA 2K0JA 2LE9B 4JPZB 1YUSA 1UHNA 5JJGA 1PSRA 2KYCA 4WRIA 1QV0A 2WNDA 1IJ5A 2FOTA 3MSEB 2MLFC 1F54A 1FPWA 5I2QA 1KFXS 2KDHA 3OX6A 4GPLB 1OMVA 1ZFSA 2K7OA 2GV5A 3KHEA 3SG3A 3CTNA 1UHHA 2NZ0A 1NSHA 1OOJA 3DVKA 2DOQA 2CT9A 2WCFA 1UHIA 2JNFA 1CTRA 4ICBA 1YVHA 1XK4C 1A03A 5K89A 1KK7Z 1HT9A 3CR4X 1KK7Y 1DMOA 4OCIA 1Q80A 3FS7A 1EG3A 5AEQA 1S3PA 2JXLA 2F2PA 3TUYC 2JWWA 4PE7A 1BODA 1L7ZA 1UHJA 2K2AA 2SASA 1H8BA 1A29A 1K9KA 1HQVA 2ZKMX 1S1EA 2COLB 4NDBA 4MLWA 1MF8B 2LNKA 1RWYA 1ZMZA 2JT3A 1PRWA 1KFXL 2PMYA 2Y1MA 4PDZA 1J7OA 1CFFA 1AK8A 1EXRA 2BCBA 2IS9A 1NWDA 5FYXA 3VRQA 3AKBA 1TOPA 3BYAA 2K8MB 5AERA 1BG1A 4ORAB 2A4JA 4ZCUA 1QX7A 2OS8C 4XYNA 1YRUB 1J7PA 2LHIA 2JZIA 3C1VA 1M46A 2M29A 3CGAA 3CWGA 1CDNA 2KQ6A 2KOTA 2P6BB 1F71A 3PN7B 1K2HA 1BR1B 1FI6A 4YBHB 2M7NA 2KGRA 4N1GA 1S6IA 1SW8A 4DS7A 1U5IB 2QACA 3O2PA 5AXIA 2L4HA 3CLNA 2CNPA 4BY5A 1D1OA 1CM4A 5D7FA 3OX5A 1LA0A 5I2LA 1J1EA 1AHRA 3DVEA 1DJXA 2JNXA 4A4CA 2H61A 2Y4QA 4A4BA 4USLA 3E3RA 3FWCA 4MN0A 2LVKA 1GGWA 3IQQA 1QJTA 1ZACA 4IL1A 4N5XA 4YGCB 4DIRA 1KCYA 1TNXA 2LV7A 1TNPA 4GGNA 1CB1A 1SMGA 3PFVA 3O4YA 3JTDC 2KFHA 1NPQA 4NDCA 4OR9B 1FI5A 1SPYA 5TNCA 2MA2A 3JTDB 3I5FC 1K96A 2HETA 3I5FB 2AAOA 3BUMB 1WLMA 2K7BA 2PSRA 2OTGC 1TCOB 1IQ3A 1QX5B 3PSRA 1SCVA 2WCBA 1BOCA 1YUTA 1YX8A 1X02A 2KHNA 4MEWA 5KSZA 2M7LA 5ER4X 3DD4A 3WHTB 3A8RA 1CM1A 3VRNA 3ZNIA 2L50A 3GOFA 1YRTB 2L5XB 4HRGA 3I5GB 1QVIZ 1QVIY 2LANA 3O6BA 4DCKA 3PM8A 2ZNDA 2E30A 1PVBA 4YGEB 1IKUA 2KNEA 4PHJA 3H4SE 4Q04A 4GBAA 1NYAA 2CTNA 2B1UA 2HPSA 3D0YB 4MZJA 5D69A 5DKNA 5DKQA 1QLSA 4GNKB 4XJKB 3SG6A 2HQ8A 1XFYO 2L4IA 1M45A 4DUQA 2ZFDA 1UURA 1NX1A 3QRXA 2JXCA 1S6CA 4PE1A 1AJ4A 1YURA 1QASA 2KBIA 4C0JA 3WNXB 1CLMA 1AUIB 1DF0A 3CR2A 1BU3A 4M2OA 3SG2A 2LLTA 1PVAA 2WOSA 4C0LA 1WDCB 2LP3A 1DJIA 1V1FA 1XFVO 1SNLA 1SR6C 1DJHA 1KFUS 3RLZA 4E68A 1DT7B 1FBVA 1SR6B 2F8PA 3BUNB 5GQQC 1OSAA 2Y1NA 2KAVA 2LMTA 1MR8A 1A75A 2V53A 2LMVA 3OP0A 3AAKA 1DGUA 4MBEA 1Y1XA 4ORCB 2MRDA 1B9AA 4NQGA 1J55A 1MHOA 4YGBB 2LHLA 4AQJA 2WC8A 2LVJA 2BL0B 2M3WA 3BUXB 1EH2A 1CDMA 1BT6A 2JC2A 3EVVA 2AUCA 4D1EA 4ETOA 1IRJA 1DJGA 2MAZA 1AVSA 5G08A 4GAOA 3BOWA 4QJ3B 1W7IB 1DVIA 1NP8A 3NSLA 1A4PA 3NSKA 2KYFA 2LUXA 4CIDA 2KSPA 1JWDA 3OB1B 1TRFA 3BXKA 1XFXO 1XA5A 4OKHA 2SCPA 4MSPA 3SIBA 2EGDA 1B47A 2KBMA 1AP4A 2L98A 2ISDA 1JSAA 1TIZA 2M9GA 2LCPA 4UPGA 1CMFA 1Y6WA 2JT8A 2CCMA 1CDPA 3HX4A 3PN7C 1G8IA 5F6TA 1NIWA 4GGFA 1KQMC 1XFUO 2FCEA 2KAXA 1OQPA 1MWNA 1KQMB 1QV1A 1NCYA 4I5NB 4MRXA 5HKYA 1DJYA 3DVMA 3EK7A 3M0WA 1XFWO 5HKWA 5KU1A 1GJYA 1YVLA 1R6PA 1J7QA 2BECA 3I5IC 1Y1AA 3O78A 1GQMA 3I5IB 3F45A 3EK8A 3PLFB 4OVNF 3K21A 3VROA 2BKHB 3WHUB 2BE4A 4WQ3A 4CPVA 2BE6A 2O60A 1DGVA 5AFPA 3VRRA 4P5OE 2K61A 4MVFA 1M39A 1R2UA 1MUXA 1L2OC 1NCXA 1JFKA 3EVRA 4BY4A 1L2OB 1OZOA 2BBMA 2MJWB 1WRKA 4U8DA 2KI4C 3TDZA 1G33A 1SL7A 2KI4B 3I5HC 1J7RA 2MBXA 2I7AA 3VGOA 1H4BA 3I5HB 1UP5A 4M2QA 3ZWHA 2CXJA 2OPOA 2JT0A 2LLSA 3VRPA 2TN4A 1IQ5A 1CFDA 2BCAA 2QPTA 3HCMA 4PHNA 1UHKA 4YI9A 1UWOA 1N2DA 3I5GC 3KF9A 2M1UA 4FQOA 1FW4A 1LXFC 1K94A 1QX2A 4JWQA 2EC6B 4YGDB 4MRYA 1B8LA 3BUWB 5CSIA 5AANA 2KGBC 1QIWA 1B8RA 5BPJA 2JU0A 4WQ2A 4HSZA 1B4CA 1RFJA 2ZRTA 5CPVA 1A2XA 4P2YB 1BMOA 3NSOA 4TNCA 3FIAA 1CFPA 3A4UB 3PALA 3WXAA 1CNPA 1UUSA 1V1GA 1KK8B 3GK4X 4HREE 1NX2A 1K90D 1QS7A 1KWOB 2RGIA 4CFRA 4L9MA 1SY9A 2ZN8A 1XK4A 2G2BA 1DJWA 1SRAA 1K8UA 3EK4A 2JTTA 1OMRA 2L2EA 2ZN9A 1CDLA 1WDCC 1CLBA 1ZUZA 1FF1A 5HKZA 1NX3A 1LA3A 1PK0D 1XYDA 2AMIA 1QTXA 1NX0A 2JOJA 2HF5A 3DVJA 1N65A 2KI6C 1XO5A 1JF2A 1Y0VH 2PVBA 2Q4UA 1IH0A 2E6WA 3GK2A 2FCDA 2M1KB 1IG5A 3LL8B 2M8UA 3KEVA 3TDUA 1N0YA 1RROA 3SIAA 4R1EA 2JTZA 3EVUA 1EJ3A 2G9BA 3OHMB 2CBLA 1E8AA 5I2OA 1ODBA 5PALA 1K95A 2L51A 1S6JA 2BL0C 2PALA 3PATA 1EG4A 4PE4A 2HQWA 4YI8A 1OMDA 3TDIA 4ZCVA 1C07A 1TTXA 1B7TZ 4M2PA 1B7TY 2WCEA 4N1FA 2NCOA 2PASA 3GK1A 2L0PA 1B8CA 1M31A 3TS5C 5IBWA 1QXPA 1F4QA 5DKRA 1W7JB 2NCPA 3TS5B 1LVCD 2O5GA 1U5IA 2I94A 4C0KA 1QIVA 3LCPC 1RJVA 2I18A 1DF0B 1KFUL 3CR5X 2GGZA 2MHHA 3NSIA 1TN4A 2BBNA 2LVIA 3JVTC 5CSFA 1KSOA 3JVTB 2F3YA 3FWBA 2NXQA 3OB2B 3TUYB 3IQOA 1ALVA 1S5GZ 2NLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5G Y;  1G4Y R;  2M0R A;  1WY9 A;  2KFF A;  1OE9 B;  1F8H A;  1SKT A;  1MQ1 A;  1YR5 A;  1REC A;  2M97 A;  1BR4 B;  1XVJ A;  3NXA A;  1K93 D;  1SYM A;  4F0Z B;  1A75 B;  1QLK A;  1WLZ A;  1JUO A;  1YUU A;  1LKJ A;  4CFQ A;  1PSB A;  5CSN A;  2KI6 D;  5HLV A;  3SG5 A;  1JC2 A;  3D10 A;  2I2R E;  1CLL A;  3LK1 A;  2KFG A;  1PAL A;  2OS8 B;  2LM5 A;  2LMU A;  5CSJ A;  2H2K A;  5HYD A;  2F3Z A;  1BF5 A;  4YRU A;  1SL9 A;  2JUL A;  1OZS A;  1M63 B;  1SCM C;  3LK0 A;  2D8N A;  4FTG A;  1TNW A;  1SK6 D;  3LLE A;  3BOW B;  1SCM B;  3RM1 A;  1F4O A;  1DTL A;  5HLO A;  2M49 B;  1XFZ O;  2Y5I A;  3SG7 A;  4I5J A;  1BJF A;  2LVV A;  1C7W A;  3BUO B;  2LLU A;  3KPX A;  1IGV A;  1AJ5 A;  4YGA A;  4GUK A;  1MXE A;  1F70 A;  3AAJ A;  4QJ4 B;  3D0Y A;  2ZNE A;  4PE0 A;  1ALW A;  3DF0 A;  3SJS A;  2GGM A;  2R2I A;  1WRL A;  1IWQ A;  2VRG A;  2JQ6 A;  4XJK A;  3ICB A;  3CS1 A;  4GGF C;  1B1G A;  5KTY A;  2KQY A;  2F33 A;  5B8I B;  2BKI B;  2K7D A;  3EKJ A;  1CMG A;  2F2O A;  1DJZ A;  2BCX A;  3CZT X;  2EC6 C;  1SL8 A;  1RTP 1;  1IJ6 A;  2LUC A;  2MLE C;  2JPT A;  5J3X A;  1S26 D;  1J1D A;  1JBA A;  4PHK A;  3EKH A;  4AOM A;  4MZK A;  1PUL A;  1C7V A;  4QJ5 B;  1GGZ A;  1TCF A;  4I5K A;  1JF0 A;  3SG4 A;  1NCZ A;  1ZOT B;  4I5L B;  4NDD A;  4HRH A;  2H61 C;  2OTG B;  1KK8 C;  2LC5 A;  1BLQ A;  1S36 A;  1K9P A;  2PRU A;  1KWO C;  4PAL A;  1Y1U A;  4ORB B;  1CFC A;  2LP2 A;  1VRK A;  3IF7 A;  2JRF A;  1TNQ A;  1YX7 A;  4PCW A;  1K9U A;  4MZL A;  1KQV A;  1WRZ A;  1QAT A;  1NUB A;  2K7C A;  2KAY A;  1SBJ A;  1RK9 A;  3AKA A;  4GFT A;  4OV2 A;  1CKK A;  5JOL A;  3BQ3 A;  2FJU B;  2K2F A;  3DF0 B;  2Q91 A;  4PHM A;  3TZ1 A;  2WOR A;  2ZRS A;  5ER5 A;  4CLN A;  1JFJ A;  4JQ0 D;  3KO0 A;  4AQI A;  1F55 A;  4DRW A;  1MXL C;  1EL4 A;  1KSM A;  1YTZ C;  1LIN A;  5I8N A;  2LAP A;  2EHB A;  2K0J A;  2LE9 B;  4JPZ B;  1YUS A;  1UHN A;  5JJG A;  1PSR A;  2KYC A;  4WRI A;  1QV0 A;  2WND A;  1IJ5 A;  2FOT A;  3MSE B;  2MLF C;  1F54 A;  1FPW A;  5I2Q A;  1KFX S;  2KDH A;  3OX6 A;  4GPL B;  1OMV A;  1ZFS A;  2K7O A;  2GV5 A;  3KHE A;  3SG3 A;  3CTN A;  1UHH A;  2NZ0 A;  1NSH A;  1OOJ A;  3DVK A;  2DOQ A;  2CT9 A;  2WCF A;  1UHI A;  2JNF A;  1CTR A;  4ICB A;  1YVH A;  1XK4 C;  1A03 A;  5K89 A;  1KK7 Z;  1HT9 A;  3CR4 X;  1KK7 Y;  1DMO A;  4OCI A;  1Q80 A;  3FS7 A;  1EG3 A;  5AEQ A;  1S3P A;  2JXL A;  2F2P A;  3TUY C;  2JWW A;  4PE7 A;  1BOD A;  1L7Z A;  1UHJ A;  2K2A A;  2SAS A;  1H8B A;  1A29 A;  1K9K A;  1HQV A;  2ZKM X;  1S1E A;  2COL B;  4NDB A;  4MLW A;  1MF8 B;  2LNK A;  1RWY A;  1ZMZ A;  2JT3 A;  1PRW A;  1KFX L;  2PMY A;  2Y1M A;  4PDZ A;  1J7O A;  1CFF A;  1AK8 A;  1EXR A;  2BCB A;  2IS9 A;  1NWD A;  5FYX A;  3VRQ A;  3AKB A;  1TOP A;  3BYA A;  2K8M B;  5AER A;  1BG1 A;  4ORA B;  2A4J A;  4ZCU A;  1QX7 A;  2OS8 C;  4XYN A;  1YRU B;  1J7P A;  2LHI A;  2JZI A;  3C1V A;  1M46 A;  2M29 A;  3CGA A;  3CWG A;  1CDN A;  2KQ6 A;  2KOT A;  2P6B B;  1F71 A;  3PN7 B;  1K2H A;  1BR1 B;  1FI6 A;  4YBH B;  2M7N A;  2KGR A;  4N1G A;  1S6I A;  1SW8 A;  4DS7 A;  1U5I B;  2QAC A;  3O2P A;  5AXI A;  2L4H A;  3CLN A;  2CNP A;  4BY5 A;  1D1O A;  1CM4 A;  5D7F A;  3OX5 A;  1LA0 A;  5I2L A;  1J1E A;  1AHR A;  3DVE A;  1DJX A;  2JNX A;  4A4C A;  2H61 A;  2Y4Q A;  4A4B A;  4USL A;  3E3R A;  3FWC A;  4MN0 A;  2LVK A;  1GGW A;  3IQQ A;  1QJT A;  1ZAC A;  4IL1 A;  4N5X A;  4YGC B;  4DIR A;  1KCY A;  1TNX A;  2LV7 A;  1TNP A;  4GGN A;  1CB1 A;  1SMG A;  3PFV A;  3O4Y A;  3JTD C;  2KFH A;  1NPQ A;  4NDC A;  4OR9 B;  1FI5 A;  1SPY A;  5TNC A;  2MA2 A;  3JTD B;  3I5F C;  1K96 A;  2HET A;  3I5F B;  2AAO A;  3BUM B;  1WLM A;  2K7B A;  2PSR A;  2OTG C;  1TCO B;  1IQ3 A;  1QX5 B;  3PSR A;  1SCV A;  2WCB A;  1BOC A;  1YUT A;  1YX8 A;  1X02 A;  2KHN A;  4MEW A;  5KSZ A;  2M7L A;  5ER4 X;  3DD4 A;  3WHT B;  3A8R A;  1CM1 A;  3VRN A;  3ZNI A;  2L50 A;  3GOF A;  1YRT B;  2L5X B;  4HRG A;  3I5G B;  1QVI Z;  1QVI Y;  2LAN A;  3O6B A;  4DCK A;  3PM8 A;  2ZND A;  2E30 A;  1PVB A;  4YGE B;  1IKU A;  2KNE A;  4PHJ A;  3H4S E;  4Q04 A;  4GBA A;  1NYA A;  2CTN A;  2B1U A;  2HPS A;  3D0Y B;  4MZJ A;  5D69 A;  5DKN A;  5DKQ A;  1QLS A;  4GNK B;  4XJK B;  3SG6 A;  2HQ8 A;  1XFY O;  2L4I A;  1M45 A;  4DUQ A;  2ZFD A;  1UUR A;  1NX1 A;  3QRX A;  2JXC A;  1S6C A;  4PE1 A;  1AJ4 A;  1YUR A;  1QAS A;  2KBI A;  4C0J A;  3WNX B;  1CLM A;  1AUI B;  1DF0 A;  3CR2 A;  1BU3 A;  4M2O A;  3SG2 A;  2LLT A;  1PVA A;  2WOS A;  4C0L A;  1WDC B;  2LP3 A;  1DJI A;  1V1F A;  1XFV O;  1SNL A;  1SR6 C;  1DJH A;  1KFU S;  3RLZ A;  4E68 A;  1DT7 B;  1FBV A;  1SR6 B;  2F8P A;  3BUN B;  5GQQ C;  1OSA A;  2Y1N A;  2KAV A;  2LMT A;  1MR8 A;  1A75 A;  2V53 A;  2LMV A;  3OP0 A;  3AAK A;  1DGU A;  4MBE A;  1Y1X A;  4ORC B;  2MRD A;  1B9A A;  4NQG A;  1J55 A;  1MHO A;  4YGB B;  2LHL A;  4AQJ A;  2WC8 A;  2LVJ A;  2BL0 B;  2M3W A;  3BUX B;  1EH2 A;  1CDM A;  1BT6 A;  2JC2 A;  3EVV A;  2AUC A;  4D1E A;  4ETO A;  1IRJ A;  1DJG A;  2MAZ A;  1AVS A;  5G08 A;  4GAO A;  3BOW A;  4QJ3 B;  1W7I B;  1DVI A;  1NP8 A;  3NSL A;  1A4P A;  3NSK A;  2KYF A;  2LUX A;  4CID A;  2KSP A;  1JWD A;  3OB1 B;  1TRF A;  3BXK A;  1XFX O;  1XA5 A;  4OKH A;  2SCP A;  4MSP A;  3SIB A;  2EGD A;  1B47 A;  2KBM A;  1AP4 A;  2L98 A;  2ISD A;  1JSA A;  1TIZ A;  2M9G A;  2LCP A;  4UPG A;  1CMF A;  1Y6W A;  2JT8 A;  2CCM A;  1CDP A;  3HX4 A;  3PN7 C;  1G8I A;  5F6T A;  1NIW A;  4GGF A;  1KQM C;  1XFU O;  2FCE A;  2KAX A;  1OQP A;  1MWN A;  1KQM B;  1QV1 A;  1NCY A;  4I5N B;  4MRX A;  5HKY A;  1DJY A;  3DVM A;  3EK7 A;  3M0W A;  1XFW O;  5HKW A;  5KU1 A;  1GJY A;  1YVL A;  1R6P A;  1J7Q A;  2BEC A;  3I5I C;  1Y1A A;  3O78 A;  1GQM A;  3I5I B;  3F45 A;  3EK8 A;  3PLF B;  4OVN F;  3K21 A;  3VRO A;  2BKH B;  3WHU B;  2BE4 A;  4WQ3 A;  4CPV A;  2BE6 A;  2O60 A;  1DGV A;  5AFP A;  3VRR A;  4P5O E;  2K61 A;  4MVF A;  1M39 A;  1R2U A;  1MUX A;  1L2O C;  1NCX A;  1JFK A;  3EVR A;  4BY4 A;  1L2O B;  1OZO A;  2BBM A;  2MJW B;  1WRK A;  4U8D A;  2KI4 C;  3TDZ A;  1G33 A;  1SL7 A;  2KI4 B;  3I5H C;  1J7R A;  2MBX A;  2I7A A;  3VGO A;  1H4B A;  3I5H B;  1UP5 A;  4M2Q A;  3ZWH A;  2CXJ A;  2OPO A;  2JT0 A;  2LLS A;  3VRP A;  2TN4 A;  1IQ5 A;  1CFD A;  2BCA A;  2QPT A;  3HCM A;  4PHN A;  1UHK A;  4YI9 A;  1UWO A;  1N2D A;  3I5G C;  3KF9 A;  2M1U A;  4FQO A;  1FW4 A;  1LXF C;  1K94 A;  1QX2 A;  4JWQ A;  2EC6 B;  4YGD B;  4MRY A;  1B8L A;  3BUW B;  5CSI A;  5AAN A;  2KGB C;  1QIW A;  1B8R A;  5BPJ A;  2JU0 A;  4WQ2 A;  4HSZ A;  1B4C A;  1RFJ A;  2ZRT A;  5CPV A;  1A2X A;  4P2Y B;  1BMO A;  3NSO A;  4TNC A;  3FIA A;  1CFP A;  3A4U B;  3PAL A;  3WXA A;  1CNP A;  1UUS A;  1V1G A;  1KK8 B;  3GK4 X;  4HRE E;  1NX2 A;  1K90 D;  1QS7 A;  1KWO B;  2RGI A;  4CFR A;  4L9M A;  1SY9 A;  2ZN8 A;  1XK4 A;  2G2B A;  1DJW A;  1SRA A;  1K8U A;  3EK4 A;  2JTT A;  1OMR A;  2L2E A;  2ZN9 A;  1CDL A;  1WDC C;  1CLB A;  1ZUZ A;  1FF1 A;  5HKZ A;  1NX3 A;  1LA3 A;  1PK0 D;  1XYD A;  2AMI A;  1QTX A;  1NX0 A;  2JOJ A;  2HF5 A;  3DVJ A;  1N65 A;  2KI6 C;  1XO5 A;  1JF2 A;  1Y0V H;  2PVB A;  2Q4U A;  1IH0 A;  2E6W A;  3GK2 A;  2FCD A;  2M1K B;  1IG5 A;  3LL8 B;  2M8U A;  3KEV A;  3TDU A;  1N0Y A;  1RRO A;  3SIA A;  4R1E A;  2JTZ A;  3EVU A;  1EJ3 A;  2G9B A;  3OHM B;  2CBL A;  1E8A A;  5I2O A;  1ODB A;  5PAL A;  1K95 A;  2L51 A;  1S6J A;  2BL0 C;  2PAL A;  3PAT A;  1EG4 A;  4PE4 A;  2HQW A;  4YI8 A;  1OMD A;  3TDI A;  4ZCV A;  1C07 A;  1TTX A;  1B7T Z;  4M2P A;  1B7T Y;  2WCE A;  4N1F A;  2NCO A;  2PAS A;  3GK1 A;  2L0P A;  1B8C A;  1M31 A;  3TS5 C;  5IBW A;  1QXP A;  1F4Q A;  5DKR A;  1W7J B;  2NCP A;  3TS5 B;  1LVC D;  2O5G A;  1U5I A;  2I94 A;  4C0K A;  1QIV A;  3LCP C;  1RJV A;  2I18 A;  1DF0 B;  1KFU L;  3CR5 X;  2GGZ A;  2MHH A;  3NSI A;  1TN4 A;  2BBN A;  2LVI A;  3JVT C;  5CSF A;  1KSO A;  3JVT B;  2F3Y A;  3FWB A;  2NXQ A;  3OB2 B;  3TUY B;  3IQO A;  1ALV A;  1S5G Z;  2NLN A; 
#chains in the Genus database with same CATH topology
 1S5G Y;  1G4Y R;  2PYQ A;  3UO9 A;  2M0R A;  1WY9 A;  2KFF A;  1OE9 B;  1F8H A;  1SKT A;  1MQ1 A;  1DEL A;  1REC A;  1YR5 A;  1BR4 B;  1XVJ A;  2M97 A;  1K93 D;  3NXA A;  1SYM A;  4F0Z B;  2P71 A;  1A75 B;  1QLK A;  1WLZ A;  1JUO A;  1YUU A;  1LKJ A;  4CFQ A;  1PSB A;  2WCJ A;  5CSN A;  2KI6 D;  5HLV A;  3SG5 A;  1JC2 A;  3D10 A;  2I2R E;  2P70 A;  1OW4 A;  1CLL A;  3LK1 A;  2KFG A;  1PAL A;  2OS8 B;  2LM5 A;  1GM0 A;  2LMU A;  5CSJ A;  2H2K A;  5HYD A;  2F3Z A;  1BF5 A;  4YRU A;  1SL9 A;  2JUL A;  1OZS A;  1M63 B;  1SCM C;  3LK0 A;  2D8N A;  4FTG A;  3D77 A;  1TNW A;  1SK6 D;  3LLE A;  3BOW B;  1SCM B;  3RM1 A;  1F4O A;  1DTL A;  5HLO A;  2M49 B;  1XFZ O;  2Y5I A;  3SG7 A;  4I5J A;  1BJF A;  2LVV A;  1C7W A;  3BUO B;  2LLU A;  3KPX A;  1IGV A;  1AJ5 A;  4YGA A;  4GUK A;  1MXE A;  1TWO A;  1F70 A;  3L4A A;  3AAJ A;  4QJ4 B;  3D0Y A;  3R1V A;  2ZNE A;  3D73 A;  4PE0 A;  1ALW A;  3DF0 A;  3SJS A;  2GGM A;  2R2I A;  1WRL A;  1IWQ A;  2VRG A;  2JQ6 A;  2K60 A;  3ICB A;  3CS1 A;  4GGF C;  4XJK A;  1B1G A;  5KTY A;  2KQY A;  2F33 A;  5B8I B;  2BKI B;  2K7D A;  3EKJ A;  1CMG A;  2F2O A;  1DJZ A;  2BCX A;  3CZT X;  2EC6 C;  1SL8 A;  1IIO A;  1RTP 1;  1IJ6 A;  2LUC A;  2MLE C;  2JPT A;  5J3X A;  1S26 D;  1J1D A;  3PJI A;  3S0G A;  1JBA A;  4PHK A;  3EKH A;  4AOM A;  4MZK A;  1PUL A;  1C7V A;  4QJ5 B;  1GGZ A;  1TCF A;  4I5K A;  1JF0 A;  3SG4 A;  1NCZ A;  1ZOT B;  4I5L B;  4NDD A;  4HRH A;  2H61 C;  2OTG B;  3CZ0 A;  1KK8 C;  2LC5 A;  1BLQ A;  1S36 A;  1K9P A;  2PRU A;  1KWO C;  4PAL A;  1Y1U A;  4ORB B;  1CFC A;  2LP2 A;  1VRK A;  3IF7 A;  2JRF A;  3OGN A;  1TNQ A;  1YX7 A;  3SS4 A;  4PCW A;  1K9U A;  3S0E A;  4MZL A;  1KQV A;  1WRZ A;  4INX A;  1QAT A;  1NUB A;  2K7C A;  2KAY A;  1SBJ A;  3CAB A;  1RK9 A;  3AKA A;  4GFT A;  3QME A;  4OV2 A;  3D78 A;  1CKK A;  5JOL A;  3BQ3 A;  2FJU B;  2K2F A;  3DF0 B;  2Q91 A;  4PHM A;  3CYZ A;  3TZ1 A;  2WOR A;  2ZRS A;  5ER5 A;  4CLN A;  1JFJ A;  4JQ0 D;  1TUJ A;  3KO0 A;  3UNW A;  4AQI A;  3L4L A;  1F55 A;  2JPO A;  4DRW A;  1MXL C;  1EL4 A;  1KSM A;  1YTZ C;  1LIN A;  5I8N A;  2LAP A;  3FE6 A;  3SS3 A;  2EHB A;  2K0J A;  2LE9 B;  1Z4H A;  1YUS A;  4JPZ B;  1UHN A;  5JJG A;  1PSR A;  2KYC A;  3L47 A;  4WRI A;  1QV0 A;  2WND A;  1IJ5 A;  2FOT A;  3MSE B;  2MLF C;  1F54 A;  1FPW A;  5I2Q A;  3CZ2 A;  1KFX S;  2KDH A;  3OX6 A;  3OBV A;  4GPL B;  1OMV A;  5D3O A;  1ZFS A;  2K7O A;  2GV5 A;  3KHE A;  3SG3 A;  3CTN A;  4JKT A;  1UHH A;  2NZ0 A;  1NSH A;  1OOJ A;  3DVK A;  2DOQ A;  2CT9 A;  2WCF A;  1UHI A;  2JNF A;  1CTR A;  4ICB A;  1YVH A;  1XK4 C;  1A03 A;  5K89 A;  1KK7 Z;  1HT9 A;  3CR4 X;  1KK7 Y;  1DMO A;  4OCI A;  1Q80 A;  3FS7 A;  1EG3 A;  5AEQ A;  1S3P A;  2JXL A;  2F2P A;  3TUY C;  2JWW A;  4PE7 A;  1BOD A;  1L7Z A;  1UHJ A;  2K2A A;  2SAS A;  1H8B A;  1A29 A;  1K9K A;  1HQV A;  2ZKM X;  1S1E A;  2COL B;  4NDB A;  4MLW A;  1DC1 A;  1MF8 B;  2LNK A;  1RWY A;  1ZMZ A;  2JT3 A;  1PRW A;  1KFX L;  2PMY A;  2Y1M A;  4PDZ A;  1J7O A;  1CFF A;  1AK8 A;  1EXR A;  2BCB A;  2IS9 A;  1NWD A;  5FYX A;  3VRQ A;  5FI7 A;  3AKB A;  1TOP A;  3BYA A;  2K8M B;  5AER A;  1BG1 A;  4ORA B;  3VB1 A;  2A4J A;  1T14 A;  2YGU A;  4ZCU A;  1QX7 A;  2OS8 C;  4XYN A;  1YRU B;  1J7P A;  2LHI A;  2JZI A;  3C1V A;  1M46 A;  3CZ1 A;  1XFR A;  2M29 A;  3CGA A;  3DYE A;  1TUZ A;  3CWG A;  1CDN A;  2KQ6 A;  2KOT A;  2QEV A;  2P6B B;  1F71 A;  3PN7 B;  1K2H A;  1BR1 B;  4PT1 A;  4YBH B;  1FI6 A;  2M7N A;  2KGR A;  4N1G A;  1S6I A;  1SW8 A;  4DS7 A;  1U5I B;  2QAC A;  3O2P A;  5AXI A;  2L4H A;  3CLN A;  2CNP A;  4BY5 A;  1D1O A;  3S0F A;  1CM4 A;  5D7F A;  3OX5 A;  1LA0 A;  5I2L A;  1J1E A;  1AHR A;  3DVE A;  1DJX A;  2JNX A;  4KYN A;  4A4C A;  2H61 A;  2Y4Q A;  4A4B A;  4USL A;  2QEO A;  3E3R A;  3FWC A;  4MN0 A;  2LVK A;  1GGW A;  3IQQ A;  1QJT A;  1ZAC A;  3IVT A;  4IL1 A;  4N5X A;  4YGC B;  4DIR A;  5HL1 A;  1TNX A;  3B88 A;  1KCY A;  2LV7 A;  1TNP A;  3NHI A;  4GGN A;  1CB1 A;  1SMG A;  3PFV A;  1OOF A;  3JTD C;  2KFH A;  1NPQ A;  3O4Y A;  4NDC A;  4OR9 B;  1FI5 A;  1SPY A;  5TNC A;  2MA2 A;  3JTD B;  3I5F C;  1K96 A;  2HET A;  3I5F B;  2AAO A;  3BUM B;  1WLM A;  1DEK A;  2K7B A;  2PSR A;  2OTG C;  1TCO B;  1IQ3 A;  1QX5 B;  3PSR A;  1SCV A;  2WCB A;  1BOC A;  1YUT A;  1YX8 A;  1X02 A;  2KHN A;  3N7H A;  3B7A A;  4MEW A;  5KSZ A;  2M7L A;  5ER4 X;  3DD4 A;  3WHT B;  3A8R A;  3K1E A;  1CM1 A;  3VRN A;  3ZNI A;  2L50 A;  3GOF A;  2GTE A;  1YRT B;  2L5X B;  4INW A;  4HRG A;  3I5G B;  1QVI Z;  1C3Y A;  1QVI Y;  2LAN A;  3O6B A;  2BAP A;  4DCK A;  3BFB A;  3PM8 A;  2ZND A;  2E30 A;  1PVB A;  4IJ7 A;  4YGE B;  1IKU A;  2KNE A;  4PHJ A;  3H4S E;  4Q04 A;  4GBA A;  1NYA A;  2CTN A;  2B1U A;  2HPS A;  3D0Y B;  4MZJ A;  5D69 A;  5DKN A;  5DKQ A;  1QLS A;  4GNK B;  4XJK B;  2WCH A;  3SG6 A;  3S0D A;  2HQ8 A;  1C3Z A;  1XFY O;  2KPH A;  1M45 A;  2L4I A;  2QEB A;  4DUQ A;  2ZFD A;  1UUR A;  1NX1 A;  3QRX A;  2JXC A;  1S6C A;  4PE1 A;  1AJ4 A;  1YUR A;  1QAS A;  2KBI A;  4C0J A;  3WNX B;  1CLM A;  1AUI B;  1DF0 A;  3CR2 A;  1BU3 A;  4M2O A;  3SG2 A;  1ORG A;  2LLT A;  1PVA A;  2WOS A;  4C0L A;  1WDC B;  2LP3 A;  1DJI A;  1V1F A;  1XFV O;  1SNL A;  1SR6 C;  1DJH A;  1KFU S;  3RLZ A;  4E68 A;  1DT7 B;  1FBV A;  1SR6 B;  2F8P A;  3BUN B;  5GQQ C;  1OSA A;  2Y1N A;  2KAV A;  2LMT A;  1MR8 A;  1A75 A;  2V53 A;  2LMV A;  3OP0 A;  3AAK A;  1DGU A;  4MBE A;  1Y1X A;  4ORC B;  2MRD A;  1B9A A;  4NQG A;  1J55 A;  1MHO A;  4YGB B;  2LHL A;  3S0A A;  4AQJ A;  2WC8 A;  2LVJ A;  3BJH A;  2BL0 B;  2M3W A;  3BUX B;  1EH2 A;  1CDM A;  1BT6 A;  2JC2 A;  3EVV A;  5FI2 A;  2AUC A;  4D1E A;  4ETO A;  1IRJ A;  1DJG A;  2MAZ A;  1AVS A;  5G08 A;  4GAO A;  3BOW A;  4QJ3 B;  1W7I B;  1DVI A;  1NP8 A;  3NSL A;  1A4P A;  1LS8 A;  2KYF A;  2LUX A;  3NSK A;  2KSP A;  4CID A;  3SS5 A;  1JWD A;  2WCL A;  3OB1 B;  1TRF A;  3BXK A;  1XFX O;  1XA5 A;  4OKH A;  2KLE A;  2SCP A;  5I94 A;  3RZS A;  4MSP A;  3SIB A;  2EGD A;  1B47 A;  2KBM A;  1AP4 A;  2L98 A;  2ISD A;  1JSA A;  2QEH A;  2H8V A;  3DY9 A;  4F7F A;  1TIZ A;  2M9G A;  2LCP A;  4UPG A;  1CMF A;  1Y6W A;  2JT8 A;  2CCM A;  1CDP A;  3HX4 A;  3PN7 C;  1G8I A;  4OZD A;  5F6T A;  1NIW A;  4GGF A;  1KQM C;  1XFU O;  4JD9 A;  2FCE A;  2KAX A;  1OQP A;  1MWN A;  1KQM B;  1QV1 A;  1NCY A;  3R72 A;  4I5N B;  4MRX A;  5EL2 A;  5HKY A;  1DJY A;  3DVM A;  3EK7 A;  3M0W A;  1XFW O;  5HKW A;  5KU1 A;  1GJY A;  1YVL A;  1R6P A;  1J7Q A;  2BEC A;  3D75 A;  3I5I C;  1Y1A A;  3O78 A;  1GQM A;  3I5I B;  3F45 A;  3EK8 A;  3PLF B;  4OVN F;  3K21 A;  3VRO A;  2BKH B;  3WHU B;  2BE4 A;  4WQ3 A;  4CPV A;  2BE6 A;  2O60 A;  1DGV A;  5AFP A;  1SSE B;  3B6X A;  3VRR A;  4P5O E;  3R1P A;  2K61 A;  4MVF A;  1M39 A;  1R2U A;  1MUX A;  1L2O C;  1Z2C B;  1NCX A;  1JFK A;  3EVR A;  4BY4 A;  1L2O B;  1OZO A;  2BBM A;  2WCM A;  2MJW B;  1WRK A;  4U8D A;  2KI4 C;  3TDZ A;  3D74 A;  1W9Z A;  1G33 A;  1SL7 A;  2KI4 B;  3I5H C;  1J7R A;  2MBX A;  2I7A A;  3VGO A;  1H4B A;  3I5H B;  1UP5 A;  4M2Q A;  3ZWH A;  2KLD A;  3BFH A;  2CXJ A;  2L5Y A;  2OPO A;  2JT0 A;  2LLS A;  3CDN A;  3R1O A;  3VRP A;  2TN4 A;  1IQ5 A;  1CFD A;  2BCA A;  2QPT A;  5DIC A;  3HCM A;  3B86 A;  4PHN A;  1UHK A;  2WC5 A;  4YI9 A;  1UWO A;  1DQE A;  1N2D A;  5FI6 A;  3I5G C;  3KF9 A;  2M1U A;  2WCK A;  4FQO A;  1FW4 A;  1LXF C;  1K94 A;  1QX2 A;  4JWQ A;  2EC6 B;  4YGD B;  4MRY A;  1B8L A;  3BUW B;  5CSI A;  5AAN A;  2KGB C;  4FQT A;  1QIW A;  1B8R A;  5BPJ A;  3NHT A;  3V2L A;  2JU0 A;  3NGV A;  4WQ2 A;  4HSZ A;  1B4C A;  1RFJ A;  2ZRT A;  5CPV A;  1A2X A;  4P2Y B;  1BMO A;  1QWV A;  3NSO A;  4TNC A;  3FIA A;  1CFP A;  3A4U B;  3PAL A;  3D76 A;  3WXA A;  1CNP A;  1OOH A;  1UUS A;  1V1G A;  1KK8 B;  3GK4 X;  4HRE E;  1NX2 A;  1K90 D;  1QS7 A;  1KWO B;  2RGI A;  4CFR A;  4L9M A;  1SY9 A;  2ZN8 A;  1XK4 A;  2G2B A;  1DJW A;  3S0B A;  1SRA A;  1K8U A;  3EK4 A;  2JTT A;  1OMR A;  2L2E A;  2ZN9 A;  1CDL A;  1WDC C;  1CLB A;  1ZUZ A;  3FE9 A;  1FF1 A;  5HKZ A;  1NX3 A;  1LA3 A;  1PK0 D;  1XYD A;  2AMI A;  1QTX A;  1NX0 A;  2JOJ A;  2HF5 A;  3DVJ A;  1N65 A;  2KI6 C;  1XO5 A;  2L2C A;  3B87 A;  1JF2 A;  1Y0V H;  2PVB A;  2WC6 A;  2Q4U A;  1IH0 A;  2E6W A;  3GK2 A;  2FCD A;  2M1K B;  1IG5 A;  3LL8 B;  2M8U A;  3KEV A;  3TDU A;  1N0Y A;  1RRO A;  3SIA A;  4R1E A;  2JTZ A;  3EVU A;  3O4X A;  1EJ3 A;  2G9B A;  3OHM B;  2CBL A;  1E8A A;  5I2O A;  1ODB A;  2QDI A;  5PAL A;  1K95 A;  2L51 A;  1S6J A;  2BL0 C;  2PAL A;  3PAT A;  1EG4 A;  3EG5 B;  4PE4 A;  2HQW A;  2PQL A;  4YI8 A;  1OMD A;  3DXL A;  3TDI A;  4ZCV A;  1C07 A;  1TTX A;  1B7T Z;  4M2P A;  1B7T Y;  1P28 A;  2WCE A;  4N1F A;  2NCO A;  2PAS A;  3GK1 A;  2L0P A;  1B8C A;  1M31 A;  3TS5 C;  5IBW A;  1QXP A;  1F4Q A;  5DKR A;  1W7J B;  2NCP A;  3TS5 B;  1LVC D;  2O5G A;  1U5I A;  2I94 A;  4C0K A;  1QIV A;  1OOG A;  3LCP C;  1RJV A;  2I18 A;  1DF0 B;  3DZT A;  1KFU L;  3CR5 X;  2GGZ A;  2ERB A;  2MHH A;  3NSI A;  1TN4 A;  2BBN A;  2LVI A;  1OOI X;  3FE8 A;  3JVT C;  5CSF A;  1KSO A;  2BNX A;  3JVT B;  2F3Y A;  3Q8I A;  3FWB A;  2NXQ A;  3OB2 B;  3TUY B;  2FJY A;  3IQO A;  3BFA A;  3PM2 A;  1ALV A;  1S5G Z;  2NLN A; 
#chains in the Genus database with same CATH homology
 1S5G Y;  1G4Y R;  2M0R A;  1WY9 A;  2KFF A;  1OE9 B;  1F8H A;  1SKT A;  1MQ1 A;  1YR5 A;  1REC A;  2M97 A;  1BR4 B;  1XVJ A;  3NXA A;  1K93 D;  1SYM A;  4F0Z B;  1A75 B;  1QLK A;  1WLZ A;  1JUO A;  1YUU A;  1LKJ A;  4CFQ A;  1PSB A;  5CSN A;  2KI6 D;  5HLV A;  3SG5 A;  1JC2 A;  3D10 A;  2I2R E;  1CLL A;  3LK1 A;  2KFG A;  1PAL A;  2OS8 B;  2LM5 A;  2LMU A;  5CSJ A;  2H2K A;  5HYD A;  2F3Z A;  1BF5 A;  4YRU A;  1SL9 A;  2JUL A;  1OZS A;  1M63 B;  1SCM C;  3LK0 A;  2D8N A;  4FTG A;  1TNW A;  1SK6 D;  3LLE A;  3BOW B;  1SCM B;  3RM1 A;  1F4O A;  1DTL A;  5HLO A;  2M49 B;  1XFZ O;  2Y5I A;  3SG7 A;  4I5J A;  1BJF A;  2LVV A;  1C7W A;  3BUO B;  2LLU A;  3KPX A;  1IGV A;  1AJ5 A;  4YGA A;  4GUK A;  1MXE A;  1F70 A;  3AAJ A;  4QJ4 B;  3D0Y A;  2ZNE A;  4PE0 A;  1ALW A;  3DF0 A;  3SJS A;  2GGM A;  2R2I A;  1WRL A;  1IWQ A;  2VRG A;  2JQ6 A;  4XJK A;  3ICB A;  3CS1 A;  4GGF C;  1B1G A;  5KTY A;  2KQY A;  2F33 A;  5B8I B;  2BKI B;  2K7D A;  3EKJ A;  1CMG A;  2F2O A;  1DJZ A;  2BCX A;  3CZT X;  2EC6 C;  1SL8 A;  1RTP 1;  1IJ6 A;  2LUC A;  2MLE C;  2JPT A;  5J3X A;  1S26 D;  1J1D A;  1JBA A;  4PHK A;  3EKH A;  4AOM A;  4MZK A;  1PUL A;  1C7V A;  4QJ5 B;  1GGZ A;  1TCF A;  4I5K A;  1JF0 A;  3SG4 A;  1NCZ A;  1ZOT B;  4I5L B;  4NDD A;  4HRH A;  2H61 C;  2OTG B;  1KK8 C;  2LC5 A;  1BLQ A;  1S36 A;  1K9P A;  2PRU A;  1KWO C;  4PAL A;  1Y1U A;  4ORB B;  1CFC A;  2LP2 A;  1VRK A;  3IF7 A;  2JRF A;  1TNQ A;  1YX7 A;  4PCW A;  1K9U A;  4MZL A;  1KQV A;  1WRZ A;  1QAT A;  1NUB A;  2K7C A;  2KAY A;  1SBJ A;  1RK9 A;  3AKA A;  4GFT A;  4OV2 A;  1CKK A;  5JOL A;  3BQ3 A;  2FJU B;  2K2F A;  3DF0 B;  2Q91 A;  4PHM A;  3TZ1 A;  2WOR A;  2ZRS A;  5ER5 A;  4CLN A;  1JFJ A;  4JQ0 D;  3KO0 A;  4AQI A;  1F55 A;  4DRW A;  1MXL C;  1EL4 A;  1KSM A;  1YTZ C;  1LIN A;  5I8N A;  2LAP A;  2EHB A;  2K0J A;  2LE9 B;  4JPZ B;  1YUS A;  1UHN A;  5JJG A;  1PSR A;  2KYC A;  4WRI A;  1QV0 A;  2WND A;  1IJ5 A;  2FOT A;  3MSE B;  2MLF C;  1F54 A;  1FPW A;  5I2Q A;  1KFX S;  2KDH A;  3OX6 A;  4GPL B;  1OMV A;  1ZFS A;  2K7O A;  2GV5 A;  3KHE A;  3SG3 A;  3CTN A;  1UHH A;  2NZ0 A;  1NSH A;  1OOJ A;  3DVK A;  2DOQ A;  2CT9 A;  2WCF A;  1UHI A;  2JNF A;  1CTR A;  4ICB A;  1YVH A;  1XK4 C;  1A03 A;  5K89 A;  1KK7 Z;  1HT9 A;  3CR4 X;  1KK7 Y;  1DMO A;  4OCI A;  1Q80 A;  3FS7 A;  1EG3 A;  5AEQ A;  1S3P A;  2JXL A;  2F2P A;  3TUY C;  2JWW A;  4PE7 A;  1BOD A;  1L7Z A;  1UHJ A;  2K2A A;  2SAS A;  1H8B A;  1A29 A;  1K9K A;  1HQV A;  2ZKM X;  1S1E A;  2COL B;  4NDB A;  4MLW A;  1MF8 B;  2LNK A;  1RWY A;  1ZMZ A;  2JT3 A;  1PRW A;  1KFX L;  2PMY A;  2Y1M A;  4PDZ A;  1J7O A;  1CFF A;  1AK8 A;  1EXR A;  2BCB A;  2IS9 A;  1NWD A;  5FYX A;  3VRQ A;  3AKB A;  1TOP A;  3BYA A;  2K8M B;  5AER A;  1BG1 A;  4ORA B;  2A4J A;  4ZCU A;  1QX7 A;  2OS8 C;  4XYN A;  1YRU B;  1J7P A;  2LHI A;  2JZI A;  3C1V A;  1M46 A;  2M29 A;  3CGA A;  3CWG A;  1CDN A;  2KQ6 A;  2KOT A;  2P6B B;  1F71 A;  3PN7 B;  1K2H A;  1BR1 B;  1FI6 A;  4YBH B;  2M7N A;  2KGR A;  4N1G A;  1S6I A;  1SW8 A;  4DS7 A;  1U5I B;  2QAC A;  3O2P A;  5AXI A;  2L4H A;  3CLN A;  2CNP A;  4BY5 A;  1D1O A;  1CM4 A;  5D7F A;  3OX5 A;  1LA0 A;  5I2L A;  1J1E A;  1AHR A;  3DVE A;  1DJX A;  2JNX A;  4A4C A;  2H61 A;  2Y4Q A;  4A4B A;  4USL A;  3E3R A;  3FWC A;  4MN0 A;  2LVK A;  1GGW A;  3IQQ A;  1QJT A;  1ZAC A;  4IL1 A;  4N5X A;  4YGC B;  4DIR A;  1KCY A;  1TNX A;  2LV7 A;  1TNP A;  4GGN A;  1CB1 A;  1SMG A;  3PFV A;  3O4Y A;  3JTD C;  2KFH A;  1NPQ A;  4NDC A;  4OR9 B;  1FI5 A;  1SPY A;  5TNC A;  2MA2 A;  3JTD B;  3I5F C;  1K96 A;  2HET A;  3I5F B;  2AAO A;  3BUM B;  1WLM A;  2K7B A;  2PSR A;  2OTG C;  1TCO B;  1IQ3 A;  1QX5 B;  3PSR A;  1SCV A;  2WCB A;  1BOC A;  1YUT A;  1YX8 A;  1X02 A;  2KHN A;  4MEW A;  5KSZ A;  2M7L A;  5ER4 X;  3DD4 A;  3WHT B;  3A8R A;  1CM1 A;  3VRN A;  3ZNI A;  2L50 A;  3GOF A;  1YRT B;  2L5X B;  4HRG A;  3I5G B;  1QVI Z;  1QVI Y;  2LAN A;  3O6B A;  4DCK A;  3PM8 A;  2ZND A;  2E30 A;  1PVB A;  4YGE B;  1IKU A;  2KNE A;  4PHJ A;  3H4S E;  4Q04 A;  4GBA A;  1NYA A;  2CTN A;  2B1U A;  2HPS A;  3D0Y B;  4MZJ A;  5D69 A;  5DKN A;  5DKQ A;  1QLS A;  4GNK B;  4XJK B;  3SG6 A;  2HQ8 A;  1XFY O;  2L4I A;  1M45 A;  4DUQ A;  2ZFD A;  1UUR A;  1NX1 A;  3QRX A;  2JXC A;  1S6C A;  4PE1 A;  1AJ4 A;  1YUR A;  1QAS A;  2KBI A;  4C0J A;  3WNX B;  1CLM A;  1AUI B;  1DF0 A;  3CR2 A;  1BU3 A;  4M2O A;  3SG2 A;  2LLT A;  1PVA A;  2WOS A;  4C0L A;  1WDC B;  2LP3 A;  1DJI A;  1V1F A;  1XFV O;  1SNL A;  1SR6 C;  1DJH A;  1KFU S;  3RLZ A;  4E68 A;  1DT7 B;  1FBV A;  1SR6 B;  2F8P A;  3BUN B;  5GQQ C;  1OSA A;  2Y1N A;  2KAV A;  2LMT A;  1MR8 A;  1A75 A;  2V53 A;  2LMV A;  3OP0 A;  3AAK A;  1DGU A;  4MBE A;  1Y1X A;  4ORC B;  2MRD A;  1B9A A;  4NQG A;  1J55 A;  1MHO A;  4YGB B;  2LHL A;  4AQJ A;  2WC8 A;  2LVJ A;  2BL0 B;  2M3W A;  3BUX B;  1EH2 A;  1CDM A;  1BT6 A;  2JC2 A;  3EVV A;  2AUC A;  4D1E A;  4ETO A;  1IRJ A;  1DJG A;  2MAZ A;  1AVS A;  5G08 A;  4GAO A;  3BOW A;  4QJ3 B;  1W7I B;  1DVI A;  1NP8 A;  3NSL A;  1A4P A;  3NSK A;  2KYF A;  2LUX A;  4CID A;  2KSP A;  1JWD A;  3OB1 B;  1TRF A;  3BXK A;  1XFX O;  1XA5 A;  4OKH A;  2SCP A;  4MSP A;  3SIB A;  2EGD A;  1B47 A;  2KBM A;  1AP4 A;  2L98 A;  2ISD A;  1JSA A;  1TIZ A;  2M9G A;  2LCP A;  4UPG A;  1CMF A;  1Y6W A;  2JT8 A;  2CCM A;  1CDP A;  3HX4 A;  3PN7 C;  1G8I A;  5F6T A;  1NIW A;  4GGF A;  1KQM C;  1XFU O;  2FCE A;  2KAX A;  1OQP A;  1MWN A;  1KQM B;  1QV1 A;  1NCY A;  4I5N B;  4MRX A;  5HKY A;  1DJY A;  3DVM A;  3EK7 A;  3M0W A;  1XFW O;  5HKW A;  5KU1 A;  1GJY A;  1YVL A;  1R6P A;  1J7Q A;  2BEC A;  3I5I C;  1Y1A A;  3O78 A;  1GQM A;  3I5I B;  3F45 A;  3EK8 A;  3PLF B;  4OVN F;  3K21 A;  3VRO A;  2BKH B;  3WHU B;  2BE4 A;  4WQ3 A;  4CPV A;  2BE6 A;  2O60 A;  1DGV A;  5AFP A;  3VRR A;  4P5O E;  2K61 A;  4MVF A;  1M39 A;  1R2U A;  1MUX A;  1L2O C;  1NCX A;  1JFK A;  3EVR A;  4BY4 A;  1L2O B;  1OZO A;  2BBM A;  2MJW B;  1WRK A;  4U8D A;  2KI4 C;  3TDZ A;  1G33 A;  1SL7 A;  2KI4 B;  3I5H C;  1J7R A;  2MBX A;  2I7A A;  3VGO A;  1H4B A;  3I5H B;  1UP5 A;  4M2Q A;  3ZWH A;  2CXJ A;  2OPO A;  2JT0 A;  2LLS A;  3VRP A;  2TN4 A;  1IQ5 A;  1CFD A;  2BCA A;  2QPT A;  3HCM A;  4PHN A;  1UHK A;  4YI9 A;  1UWO A;  1N2D A;  3I5G C;  3KF9 A;  2M1U A;  4FQO A;  1FW4 A;  1LXF C;  1K94 A;  1QX2 A;  4JWQ A;  2EC6 B;  4YGD B;  4MRY A;  1B8L A;  3BUW B;  5CSI A;  5AAN A;  2KGB C;  1QIW A;  1B8R A;  5BPJ A;  2JU0 A;  4WQ2 A;  4HSZ A;  1B4C A;  1RFJ A;  2ZRT A;  5CPV A;  1A2X A;  4P2Y B;  1BMO A;  3NSO A;  4TNC A;  3FIA A;  1CFP A;  3A4U B;  3PAL A;  3WXA A;  1CNP A;  1UUS A;  1V1G A;  1KK8 B;  3GK4 X;  4HRE E;  1NX2 A;  1K90 D;  1QS7 A;  1KWO B;  2RGI A;  4CFR A;  4L9M A;  1SY9 A;  2ZN8 A;  1XK4 A;  2G2B A;  1DJW A;  1SRA A;  1K8U A;  3EK4 A;  2JTT A;  1OMR A;  2L2E A;  2ZN9 A;  1CDL A;  1WDC C;  1CLB A;  1ZUZ A;  1FF1 A;  5HKZ A;  1NX3 A;  1LA3 A;  1PK0 D;  1XYD A;  2AMI A;  1QTX A;  1NX0 A;  2JOJ A;  2HF5 A;  3DVJ A;  1N65 A;  2KI6 C;  1XO5 A;  1JF2 A;  1Y0V H;  2PVB A;  2Q4U A;  1IH0 A;  2E6W A;  3GK2 A;  2FCD A;  2M1K B;  1IG5 A;  3LL8 B;  2M8U A;  3KEV A;  3TDU A;  1N0Y A;  1RRO A;  3SIA A;  4R1E A;  2JTZ A;  3EVU A;  1EJ3 A;  2G9B A;  3OHM B;  2CBL A;  1E8A A;  5I2O A;  1ODB A;  5PAL A;  1K95 A;  2L51 A;  1S6J A;  2BL0 C;  2PAL A;  3PAT A;  1EG4 A;  4PE4 A;  2HQW A;  4YI8 A;  1OMD A;  3TDI A;  4ZCV A;  1C07 A;  1TTX A;  1B7T Z;  4M2P A;  1B7T Y;  2WCE A;  4N1F A;  2NCO A;  2PAS A;  3GK1 A;  2L0P A;  1B8C A;  1M31 A;  3TS5 C;  5IBW A;  1QXP A;  1F4Q A;  5DKR A;  1W7J B;  2NCP A;  3TS5 B;  1LVC D;  2O5G A;  1U5I A;  2I94 A;  4C0K A;  1QIV A;  3LCP C;  1RJV A;  2I18 A;  1DF0 B;  1KFU L;  3CR5 X;  2GGZ A;  2MHH A;  3NSI A;  1TN4 A;  2BBN A;  2LVI A;  3JVT C;  5CSF A;  1KSO A;  3JVT B;  2F3Y A;  3FWB A;  2NXQ A;  3OB2 B;  3TUY B;  3IQO A;  1ALV A;  1S5G Z;  2NLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...