1B8LA

Calcium-bound d51a/e101d/f102w triple mutant of beta carp parvalbumin
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
108
structure length
108
Chain Sequence
AFAGVLNDADIAAALEACKAADSFNHKAFFAKVGLTSKSADDVKKAFAIIAQDKSGFIEEDELKLFLQNFKADARALTDGETKTFLKAGDSDGDGKIGVDDWTALVKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium binding protein
molecule keywords PROTEIN (PARVALBUMIN)
publication title Metal-ion affinity and specificity in EF-hand proteins: coordination geometry and domain plasticity in parvalbumin.
pubmed doi rcsb
source organism Cyprinus carpio
total genus 38
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1999-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1b8lA00
1XK4C 1BU3A 3IF7A 1L2OB 1B7TY 1ZUZA 2H2KA 1CDLA 3M0WA 1UWOA 1LXFC 1A4PA 1F70A 2CCMA 2KSPA 4GGNA 4ZCUA 2JT3A 3TUYB 2ZNDA 4GGFA 1K9UA 1QV1A 2JPTA 3NSKA 1DJIA 4MEWA 2KBIA 3GK1A 1IRJA 3TZ1A 4PALA 1CFDA 1K93D 1TOPA 3CS1A 1KK7Z 2CTNA 3PFVA 1QVIY 3BUOB 1CLMA 2G9BA 1NYAA 1SL7A 2KYFA 2RGIA 3H4SE 1IQ5A 2EC6B 2KI4B 1MF8B 2K2FA 4JPZB 4HRGA 1GQMA 5TNCA 1Y0VH 2LLSA 1R6PA 5J3XA 3SG5A 2BBMA 1DTLA 4M2PA 4GGFC 1EXRA 2K61A 1SCVA 2AMIA 2OTGC 1A75B 1XFWO 3KO0A 1H4BA 1QIVA 4XJKA 1CMGA 2DOQA 1NCYA 1Y1XA 2KOTA 3NXAA 1DJGA 1F4QA 2BBNA 3PSRA 4XYNA 1SMGA 3BOWA 3JTDC 1AUIB 4GAOA 1J1EA 1CNPA 1F8HA 1U5IB 5CSJA 1YUUA 3LCPC 5AERA 1B4CA 1YX8A 1JC2A 2WC8A 4OCIA 1TNQA 4NDDA 4YI8A 5HLVA 2M7LA 4TNCA 1S5GZ 3LK1A 3C1VA 5K89A 2WCFA 3FS7A 1MR8A 2OTGB 1J7RA 1QS7A 1J7OA 1F55A 1ZFSA 4I5JA 2JNXA 3VRRA 1KK7Y 2L2EA 1WY9A 1NPQA 2A4JA 4HSZA 2M8UA 3DVMA 1BR4B 1IWQA 2WOSA 2QACA 2WCEA 2KYCA 1C7VA 2FJUB 2LANA 1JWDA 2M49B 4P2YB 1NX2A 1WRLA 1G33A 2K7OA 4GNKB 2SCPA 4PE7A 4CLNA 5B8IB 2JZIA 1BMOA 4WQ3A 4NDCA 3BYAA 2L4HA 3CGAA 1PVBA 3CR2A 2BE6A 3BUXB 3OP0A 2ZN8A 2Q4UA 3AAKA 1SW8A 2LMVA 5HKWA 1F54A 2KAVA 1B1GA 2F2OA 3I5IB 1MQ1A 2KFGA 2LVKA 1KCYA 1KQMC 5JOLA 5PALA 1RFJA 4BY5A 2KGBC 1K9PA 1K9KA 1PULA 1MXEA 1UHKA 1S5GY 2IS9A 4I5NB 5KTYA 1YR5A 2Q91A 1PVAA 2PASA 1EG4A 2H61A 1XO5A 3VGOA 4CFQA 5FYXA 2AUCA 1YRUB 1AP4A 5CSNA 3WXAA 4QJ4B 1SCMB 1C7WA 2JULA 5I2OA 2Y1MA 2HQ8A 2JU0A 1WLMA 1L2OC 2K0JA 1CDMA 1ODBA 2JT8A 1UP5A 1M39A 2JXLA 3TUYC 1SYMA 3LLEA 1KQMB 1NX0A 1B47A 1A75A 3DVKA 2K8MB 1SBJA 3CZTX 2LUCA 2H61C 4L9MA 1QX5B 2LM5A 3O4YA 1EJ3A 1FW4A 2B1UA 1TCFA 3CR5X 3PN7B 2EC6C 1IJ6A 1QX7A 4A4CA 1Y6WA 2CBLA 2F3ZA 3EK8A 3O2PA 1U5IA 3O78A 3D10A 2JTTA 2FCEA 4NDBA 1UHNA 4MRYA 1S6JA 1NX3A 2E30A 4JQ0D 1LVCD 4E68A 4YGCB 4YI9A 2ZRTA 1B8CA 4JWQA 2L5XB 1QXPA 3RLZA 2JQ6A 2LHLA 2QPTA 4N1GA 5CSFA 5JJGA 2KGRA 1MXLC 2MHHA 4N5XA 1DF0A 3FWBA 4MRXA 4Q04A 5AEQA 1C07A 1PRWA 1CLBA 2GGZA 4I5LB 1D1OA 1S1EA 1ZOTB 2KNEA 2Y5IA 2JRFA 2L50A 1CFFA 2I94A 2LLTA 1K2HA 5F6TA 2LVVA 3TDUA 5I2QA 1R2UA 1BODA 2NXQA 5I2LA 1IGVA 4YGAA 2BCXA 1B8RA 1TNXA 4MN0A 1OOJA 4OR9B 1M63B 1CDPA 4GUKA 1K95A 1NSHA 3SIBA 3TDIA 1J1DA 1NUBA 5DKRA 1KQVA 2MAZA 2PMYA 1BJFA 4A4BA 2HQWA 3EK7A 2I2RE 2F3YA 3K21A 5ER4X 1EL4A 1DJWA 1AK8A 2MLFC 1YTZC 2L0PA 3PATA 4PHJA 2OPOA 4YRUA 2G2BA 4AQIA 4PHMA 4PHKA 1KWOC 2CXJA 1S3PA 1K94A 4QJ3B 1FI5A 1YVHA 3AKAA 2LMTA 3F45A 1GJYA 2K2AA 2KHNA 5HYDA 3GOFA 3O6BA 4DIRA 1DT7B 1CM4A 2FCDA 2GV5A 1DF0B 1QLKA 1XFXO 5D7FA 4UPGA 2OS8C 2Y4QA 3DD4A 2LV7A 5AFPA 1K90D 3SIAA 1F71A 2HF5A 2PVBA 2COLB 2JC2A 3I5IC 1G8IA 2CNPA 2JNFA 2M0RA 1UHJA 4YGDB 1QLSA 3D0YB 3CWGA 4MZJA 1KWOB 3KF9A 1V1GA 4ORAB 1QX2A 4I5KA 2NCPA 1GGZA 1OZSA 4ZCVA 4MBEA 1CDNA 3QRXA 1G4YR 3SG3A 1SCMC 4USLA 2BE4A 2OS8B 1AHRA 1GGWA 1QASA 1KFXS 1NCXA 1LA3A 1N0YA 1RJVA 1SL9A 1QATA 2M29A 2ZKMX 2M9GA 3JVTB 4MSPA 1YX7A 4HRHA 2PSRA 2KQ6A 1PSRA 3OB1B 1K8UA 1W7JB 2E6WA 2O5GA 2F33A 3TS5B 1KFXL 3OHMB 1V1FA 4PDZA 4PCWA 1EG3A 1WRZA 1CB1A 4DS7A 1RWYA 1NP8A 1WRKA 3PN7C 1W7IB 1KFUS 2KI6C 4GFTA 1DJYA 1E8AA 3SG4A 4D1EA 1UUSA 1PK0D 1Y1UA 4M2QA 2BL0C 1XVJA 1LKJA 3BQ3A 3ICBA 2LP3A 3DVJA 2NLNA 3VRQA 1ALVA 4MZLA 1KFUL 2D8NA 1MHOA 4ORBB 3WHTB 1LA0A 4PE0A 3AKBA 2LLUA 2TN4A 2Y1NA 5BPJA 2LC5A 2MRDA 3AAJA 1RECA 1PSBA 1BOCA 1YUSA 4PHNA 1M31A 1JBAA 3PLFB 1FPWA 3TDZA 4CIDA 1XFYO 1M46A 2SASA 1M45A 2KI6D 2F8PA 2LCPA 4MVFA 3SG6A 1RK9A 2BL0B 2KQYA 1A03A 3KHEA 2K7CA 3GK4X 2PRUA 5HLOA 1TNWA 4C0KA 1UHHA 3CLNA 4WQ2A 3SG7A 2L51A 1KSMA 2CT9A 3HX4A 1CLLA 2LMUA 4FTGA 5I8NA 1WDCB 1XFZO 2MJWB 1TTXA 1XFVO 1SY9A 2M3WA 1SKTA 4ORCB 2LP2A 1OE9B 2ZNEA 2R2IA 1TIZA 5AANA 5CSIA 1SPYA 1A2XA 2JT0A 1TRFA 3OX6A 1RTP1 2FOTA 5DKQA 3SJSA 3ZNIA 1QTXA 1CMFA 2KFHA 1Q80A 3CR4X 1WLZA 2BCAA 1XA5A 3D0YA 4YBHB 1BR1B 2ZRSA 3WNXB 1AJ4A 1YVLA 1JFJA 5G08A 1NWDA 3I5HC 3OX5A 4R1EA 4DRWA 1ZACA 4C0LA 4AQJA 5ER5A 3DVEA 1DJHA 2F2PA 3WHUB 1S6CA 1CFPA 2LE9B 3FIAA 1IG5A 3I5GC 1X02A 1CFCA 4M2OA 1N65A 1B9AA 4N1FA 1FBVA 3EKJA 2GGMA 2WNDA 1DGUA 1KK8B 1S6IA 2EHBA 3KEVA 2K7DA 4MZKA 5CPVA 1LINA 3DF0A 3EVUA 4YGBB 1N2DA 1A29A 1DJZA 1VRKA 1OSAA 3EKHA 3A8RA 3EVVA 2ISDA 4AOMA 1S26D 1KSOA 1OQPA 3I5HB 1MWNA 2HETA 3OB2B 4NQGA 5KU1A 2BCBA 3I5FC 1EH2A 1J55A 5HKYA 2I18A 4C0JA 1YUTA 1BF5A 3I5GB 1DJXA 2V53A 4GBAA 4PE1A 1AVSA 1JFKA 3JVTC 4YGEB 1S36A 1L7ZA 2MA2A 2KDHA 2BKHB 2NZ0A 1MUXA 1OMVA 3NSIA 5IBWA 3TS5C 1DVIA 2MLEC 5HKZA 1RROA 5AXIA 2O60A 1K96A 4CPVA 2LNKA 3CTNA 1NCZA 3I5FB 2JOJA 1SR6C 3BXKA 4IL1A 2K7BA 2L98A 2WORA 3JTDB 2LUXA 1XFUO 4DCKA 2ZFDA 1SRAA 1SK6D 3IQOA 3MSEB 2MBXA 1FF1A 1DMOA 3SG2A 2KAXA 1JUOA 3GK2A 1NIWA 1JF2A 3HCMA 3DF0B 4QJ5B 4BY4A 1QJTA 4PE4A 1IJ5A 1J7PA 3VRPA 1TNPA 1F4OA 2JTZA 3BUWB 5DKNA 2VRGA 4FQOA 1OMDA 1ALWA 1IQ3A 4XJKB 3NSLA 2JWWA 3BUNB 1TN4A 2KBMA 3LK0A 1JSAA 1UHIA 1B8LA 3LL8B 3ZWHA 3KPXA 1BT6A 4OV2A 2JXCA 1JF0A 1IH0A 1OZOA 2I7AA 2EGDA 1SR6B 3A4UB 3BOWB 1DGVA 4ICBA 2WCBA 5D69A 1B7TZ 1ZMZA 1BG1A 1XYDA 2M1UA 2M97A 1QIWA 2BECA 2M7NA 3PM8A 1SNLA 1UURA 1WDCC 4WRIA 1SL8A 1TCOB 4GPLB 1FI6A 1CTRA 1YURA 4F0ZB 5GQQC 1QVIZ 4P5OE 3RM1A 3VRNA 2P6BB 3BUMB 1OMRA 1PALA 2KFFA 4ETOA 1Y1AA 1XK4A 3EVRA 2LAPA 1H8BA 2BKIB 4DUQA 2L4IA 4OKHA 1HT9A 2AAOA 1NX1A 3E3RA 4OVNF 1J7QA 3EK4A 1QV0A 2M1KB 4HREE 1HQVA 2LVIA 3IQQA 3PALA 5KSZA 1CKKA 4CFRA 2LVJA 2ZN9A 1AJ5A 1CM1A 1IKUA 3VROA 2PALA 1YRTB 3NSOA 2KI4C 1BLQA 2NCOA 4U8DA 2LHIA 3FWCA 2HPSA 2KAYA 4MLWA 1KK8C
chains in the Genus database with same CATH superfamily
1XK4C 2QEOA 1BU3A 3IF7A 1L2OB 1B7TY 1ZUZA 3DYEA 2H2KA 1CDLA 3M0WA 1UWOA 1LXFC 1A4PA 1F70A 2CCMA 2KSPA 4GGNA 4ZCUA 2JT3A 3DXLA 3TUYB 3VB1A 2ZNDA 4GGFA 1K9UA 1QV1A 2JPTA 2YGUA 3NSKA 1DJIA 4MEWA 2KBIA 3B87A 3GK1A 1IRJA 3TZ1A 4PALA 1CFDA 1K93D 1TOPA 1Z4HA 1KK7Z 2CTNA 3CS1A 1QVIY 3BUOB 1CLMA 2G9BA 1NYAA 1SL7A 2KYFA 2QEBA 2RGIA 3FE8A 3H4SE 1IQ5A 2EC6B 2KI4B 3R72A 3OBVA 1MF8B 2K2FA 4JPZB 4HRGA 1GQMA 5DICA 5TNCA 1Y0VH 2LLSA 2WCKA 1R6PA 5J3XA 3SG5A 2BBMA 3D76A 1DTLA 4M2PA 4JD9A 4GGFC 1EXRA 2K61A 1SCVA 2AMIA 2OTGC 1A75B 1XFWO 3KO0A 1H4BA 1QIVA 4XJKA 1CMGA 2DOQA 1NCYA 1DELA 3NGVA 1Y1XA 2KOTA 3NXAA 1DJGA 1F4QA 2BBNA 3PSRA 4XYNA 1SMGA 3BOWA 3JTDC 1AUIB 4GAOA 1J1EA 3V2LA 1CNPA 1U5IB 5CSJA 1YUUA 3LCPC 1F8HA 4IJ7A 5AERA 1B4CA 1YX8A 1JC2A 2WC8A 4OCIA 1TNQA 4NDDA 2P70A 4YI8A 5HLVA 2M7LA 4TNCA 1S5GZ 3LK1A 3C1VA 5K89A 1DEKA 2WCFA 3FS7A 1MR8A 2OTGB 1J7RA 1QS7A 1J7OA 1F55A 1ZFSA 1P28A 4I5JA 3S0AA 2JNXA 3VRRA 1KK7Y 5FI7A 2L2EA 1TUZA 1WY9A 1NPQA 2A4JA 4HSZA 2M8UA 3DVMA 1BR4B 1IWQA 2WOSA 2QACA 2K60A 2WCEA 2KYCA 1C7VA 2FJUB 2LANA 3SS5A 1JWDA 2M49B 4P2YB 1NX2A 1WRLA 1G33A 2K7OA 4GNKB 2SCPA 4PE7A 4CLNA 5B8IB 2JZIA 1BMOA 2JPOA 4WQ3A 4NDCA 3BYAA 2L4HA 3CGAA 3UNWA 1OOHA 1PVBA 3CR2A 2BE6A 3BUXB 3OP0A 2ZN8A 2Q4UA 3AAKA 3UO9A 1SW8A 2LMVA 5HKWA 1F54A 2KAVA 1B1GA 2F2OA 3I5IB 1MQ1A 2KFGA 2LVKA 1KCYA 1KQMC 5JOLA 5PALA 1RFJA 4BY5A 2KGBC 1K9PA 1K9KA 1OOIX 1PULA 1MXEA 1UHKA 1S5GY 2IS9A 3L4AA 4I5NB 1YR5A 5KTYA 2Q91A 3D78A 1PVAA 2PASA 1EG4A 2H61A 1XO5A 3VGOA 4CFQA 5FYXA 2AUCA 3DY9A 1YRUB 1AP4A 5CSNA 3CZ1A 3L4LA 3WXAA 4QJ4B 1SCMB 1C7WA 2JULA 5I2OA 2Y1MA 2HQ8A 2JU0A 1WLMA 4OZDA 1SSEB 1L2OC 2K0JA 1CDMA 1XFRA 1ODBA 2JT8A 3BFAA 1UP5A 1M39A 2JXLA 2WCLA 3TUYC 1SYMA 3LLEA 1KQMB 1NX0A 1B47A 1A75A 3DVKA 2K8MB 1SBJA 4PT1A 3CZTX 2LUCA 2H61C 4F7FA 4L9MA 1QX5B 2LM5A 3O4YA 1EJ3A 1FW4A 2B1UA 1TCFA 3CR5X 3PN7B 2EC6C 1IJ6A 1QX7A 4A4CA 1Y6WA 2CBLA 2F3ZA 3EK8A 3O2PA 1U5IA 3O78A 3D10A 2JTTA 2FCEA 4NDBA 1UHNA 1W9ZA 4MRYA 1S6JA 1NX3A 2E30A 2BAPA 1OOFA 4JQ0D 1LVCD 3Q8IA 4E68A 4YGCB 4YI9A 2ZRTA 1B8CA 3S0EA 4JWQA 1C3YA 2L5XB 3PM2A 1QXPA 3RLZA 2JQ6A 2LHLA 2PYQA 2QPTA 4N1GA 2KPHA 5CSFA 5JJGA 2KGRA 1MXLC 2MHHA 3PFVA 1DF0A 3R1PA 4N5XA 3FWBA 4MRXA 4Q04A 5AEQA 3BFBA 1PRWA 1C07A 1CLBA 5FI2A 3PJIA 1GM0A 2GGZA 4I5LB 3CABA 1S1EA 1ZOTB 2KNEA 2Y5IA 1D1OA 2JRFA 2L50A 1CFFA 2I94A 2LLTA 1K2HA 5F6TA 2LVVA 3TDUA 5I2QA 1R2UA 1BODA 2NXQA 5I2LA 1IGVA 4YGAA 2KLEA 2BCXA 1B8RA 1TNXA 4MN0A 1OOJA 4OR9B 1M63B 1CDPA 4GUKA 1K95A 1NSHA 3SIBA 3TDIA 1J1DA 1NUBA 5DKRA 1KQVA 2MAZA 2PMYA 1BJFA 4A4BA 2HQWA 2QDIA 3EK7A 2QEVA 2I2RE 2F3YA 3K21A 2P71A 5ER4X 1EL4A 1DJWA 1AK8A 2MLFC 1YTZC 2L0PA 3CZ0A 3PATA 4PHJA 2OPOA 4YRUA 2G2BA 4AQIA 4PHMA 4PHKA 1KWOC 2CXJA 1S3PA 1K94A 3DZTA 4QJ3B 1FI5A 1YVHA 3AKAA 2LMTA 3F45A 1GJYA 2K2AA 2KHNA 5HYDA 3GOFA 3O6BA 4DIRA 1DT7B 1CM4A 2FCDA 2GV5A 5HL1A 1DF0B 1QLKA 1XFXO 5D7FA 4UPGA 2OS8C 2Y4QA 3DD4A 2LV7A 5AFPA 1K90D 3SIAA 1F71A 2HF5A 2PVBA 2COLB 2JC2A 3FE9A 3I5IC 1G8IA 2CNPA 2JNFA 2M0RA 1UHJA 4YGDB 1QLSA 3D0YB 1Z2CB 3CWGA 1KWOB 4MZJA 1DC1A 3KF9A 1V1GA 4ORAB 1QX2A 4I5KA 2NCPA 1GGZA 1OZSA 4ZCVA 4MBEA 1CDNA 3QRXA 1G4YR 3SG3A 1SCMC 2H8VA 2GTEA 3NHTA 4USLA 2BE4A 2OS8B 1AHRA 1GGWA 1QASA 1KFXS 1NCXA 1LA3A 1N0YA 1RJVA 1SL9A 1QATA 2M29A 3D75A 2ZKMX 3IVTA 2M9GA 3JVTB 4MSPA 1YX7A 4HRHA 2PSRA 2KQ6A 1PSRA 2WC5A 3OB1B 1K8UA 1W7JB 2E6WA 2O5GA 2F33A 3TS5B 1KFXL 3OHMB 1V1FA 4PDZA 4PCWA 1EG3A 3RZSA 4JKTA 3BJHA 1WRZA 1CB1A 4DS7A 1RWYA 1NP8A 1WRKA 3PN7C 1W7IB 3B6XA 1KFUS 2KI6C 3O4XA 1DJYA 1E8AA 4GFTA 3SG4A 4D1EA 1UUSA 1PK0D 1Y1UA 3CYZA 2BL0C 4INWA 4M2QA 1XVJA 1LKJA 3BQ3A 3CZ2A 3ICBA 2LP3A 3DVJA 2NLNA 3VRQA 3B88A 1ALVA 1C3ZA 4MZLA 1KFUL 2D8NA 1MHOA 4ORBB 2WCHA 3WHTB 1LA0A 4PE0A 3D77A 3AKBA 1DQEA 2LLUA 2TN4A 2Y1NA 5BPJA 2LC5A 2MRDA 3AAJA 1RECA 1PSBA 1BOCA 3SS4A 1YUSA 3B7AA 1M31A 2WCJA 3PLFB 4PHNA 1JBAA 3TDZA 4CIDA 1FPWA 1XFYO 1QWVA 1TUJA 1M46A 2SASA 1M45A 2KI6D 2F8PA 2LCPA 4MVFA 3SG6A 5D3OA 1RK9A 2BL0B 2KQYA 3OGNA 1A03A 3D73A 3KHEA 2K7CA 3GK4X 2PRUA 5HLOA 1TNWA 4C0KA 1UHHA 3CLNA 4WQ2A 3S0DA 3SG7A 2L51A 1KSMA 2CT9A 3HX4A 1CLLA 2LMUA 4FTGA 5I8NA 1WDCB 1XFZO 4FQTA 2MJWB 1TTXA 1XFVO 1SY9A 2BNXA 2M3WA 3SS3A 1SKTA 4ORCB 3B86A 2LP2A 1OE9B 2ZNEA 2R2IA 1TIZA 5AANA 5CSIA 3D74A 1SPYA 1A2XA 2JT0A 1TRFA 3OX6A 1RTP1 1T14A 2FOTA 5DKQA 3SJSA 1QTXA 1OW4A 5FI6A 2KFHA 3ZNIA 1Q80A 3CR4X 1WLZA 2BCAA 3R1OA 1XA5A 1IIOA 3D0YA 4YBHB 1BR1B 2ZRSA 3WNXB 1AJ4A 3NHIA 1YVLA 5EL2A 3BFHA 1JFJA 5G08A 1NWDA 3I5HC 3OX5A 4R1EA 4DRWA 1ZACA 4C0LA 4AQJA 5ER5A 3DVEA 1DJHA 2F2PA 3WHUB 1S6CA 1CFPA 2LE9B 3FIAA 3S0FA 1IG5A 3I5GC 1X02A 1CFCA 4M2OA 1N65A 1B9AA 4N1FA 1FBVA 3EKJA 2GGMA 2WNDA 1DGUA 1KK8B 1S6IA 2EHBA 3KEVA 2K7DA 4MZKA 5CPVA 1LINA 3DF0A 3EVUA 4YGBB 1N2DA 1A29A 1DJZA 1VRKA 1OSAA 3R1VA 2L2CA 3FE6A 3EKHA 3A8RA 3EVVA 2ISDA 4AOMA 1S26D 1KSOA 1OQPA 3I5HB 1MWNA 2HETA 3OB2B 4NQGA 5KU1A 2BCBA 3I5FC 1EH2A 1J55A 5HKYA 2I18A 4C0JA 3S0BA 1YUTA 3S0GA 3N7HA 3I5GB 1BF5A 1DJXA 2V53A 2ERBA 2QEHA 3EG5B 4GBAA 4PE1A 1AVSA 1JFKA 3JVTC 4YGEB 1S36A 1L7ZA 2MA2A 2WCMA 2KDHA 2BKHB 2NZ0A 1MUXA 1OMVA 3NSIA 5IBWA 3TS5C 1DVIA 2MLEC 5HKZA 1RROA 5AXIA 2O60A 2PQLA 1K96A 4CPVA 2LNKA 3CTNA 1TWOA 1NCZA 3I5FB 2JOJA 1SR6C 3BXKA 4IL1A 2K7BA 2L98A 2WORA 3JTDB 2LUXA 1XFUO 4DCKA 2ZFDA 1SRAA 1SK6D 3IQOA 3MSEB 2L5YA 2MBXA 1FF1A 1DMOA 3SG2A 2KAXA 1JUOA 3GK2A 1NIWA 1JF2A 3HCMA 3DF0B 4QJ5B 4BY4A 1QJTA 4PE4A 1IJ5A 1J7PA 3VRPA 1TNPA 1F4OA 2JTZA 3BUWB 5DKNA 2VRGA 4FQOA 1OMDA 1ALWA 1IQ3A 3CDNA 4XJKB 3NSLA 2JWWA 5I94A 3BUNB 3L47A 1TN4A 2KBMA 3LK0A 1JSAA 1UHIA 1B8LA 3LL8B 2KLDA 3KPXA 3ZWHA 1BT6A 4OV2A 2JXCA 1JF0A 1IH0A 1OZOA 2I7AA 2EGDA 1SR6B 3A4UB 3BOWB 1DGVA 4ICBA 2WCBA 5D69A 1B7TZ 1ZMZA 1BG1A 1XYDA 2M1UA 2M97A 1QIWA 2BECA 2M7NA 3PM8A 1ORGA 1SNLA 1UURA 1WDCC 2WC6A 4WRIA 1SL8A 1TCOB 4GPLB 1FI6A 1CTRA 1YURA 4F0ZB 5GQQC 1LS8A 1QVIZ 4P5OE 3RM1A 3VRNA 2P6BB 3BUMB 1OMRA 1PALA 2KFFA 4ETOA 2FJYA 1Y1AA 1XK4A 3EVRA 2LAPA 1H8BA 2BKIB 4DUQA 2L4IA 4OKHA 1HT9A 2AAOA 1NX1A 3E3RA 4OVNF 1J7QA 3EK4A 1QV0A 3K1EA 2M1KB 4HREE 1HQVA 2LVIA 1OOGA 3IQQA 3PALA 5KSZA 1CKKA 1CMFA 4CFRA 2LVJA 2ZN9A 1AJ5A 1CM1A 1IKUA 3VROA 2PALA 1YRTB 4INXA 3QMEA 3NSOA 2KI4C 4KYNA 1BLQA 2NCOA 4U8DA 2LHIA 3FWCA 2HPSA 2KAYA 4MLWA 1KK8C
chains in the Genus database with same CATH topology
1XK4C 1BU3A 3IF7A 1L2OB 1B7TY 1ZUZA 2H2KA 1CDLA 3M0WA 1UWOA 1LXFC 1A4PA 1F70A 2CCMA 2KSPA 4GGNA 4ZCUA 2JT3A 3TUYB 2ZNDA 4GGFA 1K9UA 1QV1A 2JPTA 3NSKA 1DJIA 4MEWA 2KBIA 3GK1A 1IRJA 3TZ1A 4PALA 1CFDA 1K93D 1TOPA 3CS1A 1KK7Z 2CTNA 3PFVA 1QVIY 3BUOB 1CLMA 2G9BA 1NYAA 1SL7A 2KYFA 2RGIA 3H4SE 1IQ5A 2EC6B 2KI4B 1MF8B 2K2FA 4JPZB 4HRGA 1GQMA 5TNCA 1Y0VH 2LLSA 1R6PA 5J3XA 3SG5A 2BBMA 1DTLA 4M2PA 4GGFC 1EXRA 2K61A 1SCVA 2AMIA 2OTGC 1A75B 1XFWO 3KO0A 1H4BA 1QIVA 4XJKA 1CMGA 2DOQA 1NCYA 1Y1XA 2KOTA 3NXAA 1DJGA 1F4QA 2BBNA 3PSRA 4XYNA 1SMGA 3BOWA 3JTDC 1AUIB 4GAOA 1J1EA 1CNPA 1F8HA 1U5IB 5CSJA 1YUUA 3LCPC 5AERA 1B4CA 1YX8A 1JC2A 2WC8A 4OCIA 1TNQA 4NDDA 4YI8A 5HLVA 2M7LA 4TNCA 1S5GZ 3LK1A 3C1VA 5K89A 2WCFA 3FS7A 1MR8A 2OTGB 1J7RA 1QS7A 1J7OA 1F55A 1ZFSA 4I5JA 2JNXA 3VRRA 1KK7Y 2L2EA 1WY9A 1NPQA 2A4JA 4HSZA 2M8UA 3DVMA 1BR4B 1IWQA 2WOSA 2QACA 2WCEA 2KYCA 1C7VA 2FJUB 2LANA 1JWDA 2M49B 4P2YB 1NX2A 1WRLA 1G33A 2K7OA 4GNKB 2SCPA 4PE7A 4CLNA 5B8IB 2JZIA 1BMOA 4WQ3A 4NDCA 3BYAA 2L4HA 3CGAA 1PVBA 3CR2A 2BE6A 3BUXB 3OP0A 2ZN8A 2Q4UA 3AAKA 1SW8A 2LMVA 5HKWA 1F54A 2KAVA 1B1GA 2F2OA 3I5IB 1MQ1A 2KFGA 2LVKA 1KCYA 1KQMC 5JOLA 5PALA 1RFJA 4BY5A 2KGBC 1K9PA 1K9KA 1PULA 1MXEA 1UHKA 1S5GY 2IS9A 4I5NB 5KTYA 1YR5A 2Q91A 1PVAA 2PASA 1EG4A 2H61A 1XO5A 3VGOA 4CFQA 5FYXA 2AUCA 1YRUB 1AP4A 5CSNA 3WXAA 4QJ4B 1SCMB 1C7WA 2JULA 5I2OA 2Y1MA 2HQ8A 2JU0A 1WLMA 1L2OC 2K0JA 1CDMA 1ODBA 2JT8A 1UP5A 1M39A 2JXLA 3TUYC 1SYMA 3LLEA 1KQMB 1NX0A 1B47A 1A75A 3DVKA 2K8MB 1SBJA 3CZTX 2LUCA 2H61C 4L9MA 1QX5B 2LM5A 3O4YA 1EJ3A 1FW4A 2B1UA 1TCFA 3CR5X 3PN7B 2EC6C 1IJ6A 1QX7A 4A4CA 1Y6WA 2CBLA 2F3ZA 3EK8A 3O2PA 1U5IA 3O78A 3D10A 2JTTA 2FCEA 4NDBA 1UHNA 4MRYA 1S6JA 1NX3A 2E30A 4JQ0D 1LVCD 4E68A 4YGCB 4YI9A 2ZRTA 1B8CA 4JWQA 2L5XB 1QXPA 3RLZA 2JQ6A 2LHLA 2QPTA 4N1GA 5CSFA 5JJGA 2KGRA 1MXLC 2MHHA 4N5XA 1DF0A 3FWBA 4MRXA 4Q04A 5AEQA 1C07A 1PRWA 1CLBA 2GGZA 4I5LB 1D1OA 1S1EA 1ZOTB 2KNEA 2Y5IA 2JRFA 2L50A 1CFFA 2I94A 2LLTA 1K2HA 5F6TA 2LVVA 3TDUA 5I2QA 1R2UA 1BODA 2NXQA 5I2LA 1IGVA 4YGAA 2BCXA 1B8RA 1TNXA 4MN0A 1OOJA 4OR9B 1M63B 1CDPA 4GUKA 1K95A 1NSHA 3SIBA 3TDIA 1J1DA 1NUBA 5DKRA 1KQVA 2MAZA 2PMYA 1BJFA 4A4BA 2HQWA 3EK7A 2I2RE 2F3YA 3K21A 5ER4X 1EL4A 1DJWA 1AK8A 2MLFC 1YTZC 2L0PA 3PATA 4PHJA 2OPOA 4YRUA 2G2BA 4AQIA 4PHMA 4PHKA 1KWOC 2CXJA 1S3PA 1K94A 4QJ3B 1FI5A 1YVHA 3AKAA 2LMTA 3F45A 1GJYA 2K2AA 2KHNA 5HYDA 3GOFA 3O6BA 4DIRA 1DT7B 1CM4A 2FCDA 2GV5A 1DF0B 1QLKA 1XFXO 5D7FA 4UPGA 2OS8C 2Y4QA 3DD4A 2LV7A 5AFPA 1K90D 3SIAA 1F71A 2HF5A 2PVBA 2COLB 2JC2A 3I5IC 1G8IA 2CNPA 2JNFA 2M0RA 1UHJA 4YGDB 1QLSA 3D0YB 3CWGA 4MZJA 1KWOB 3KF9A 1V1GA 4ORAB 1QX2A 4I5KA 2NCPA 1GGZA 1OZSA 4ZCVA 4MBEA 1CDNA 3QRXA 1G4YR 3SG3A 1SCMC 4USLA 2BE4A 2OS8B 1AHRA 1GGWA 1QASA 1KFXS 1NCXA 1LA3A 1N0YA 1RJVA 1SL9A 1QATA 2M29A 2ZKMX 2M9GA 3JVTB 4MSPA 1YX7A 4HRHA 2PSRA 2KQ6A 1PSRA 3OB1B 1K8UA 1W7JB 2E6WA 2O5GA 2F33A 3TS5B 1KFXL 3OHMB 1V1FA 4PDZA 4PCWA 1EG3A 1WRZA 1CB1A 4DS7A 1RWYA 1NP8A 1WRKA 3PN7C 1W7IB 1KFUS 2KI6C 4GFTA 1DJYA 1E8AA 3SG4A 4D1EA 1UUSA 1PK0D 1Y1UA 4M2QA 2BL0C 1XVJA 1LKJA 3BQ3A 3ICBA 2LP3A 3DVJA 2NLNA 3VRQA 1ALVA 4MZLA 1KFUL 2D8NA 1MHOA 4ORBB 3WHTB 1LA0A 4PE0A 3AKBA 2LLUA 2TN4A 2Y1NA 5BPJA 2LC5A 2MRDA 3AAJA 1RECA 1PSBA 1BOCA 1YUSA 4PHNA 1M31A 1JBAA 3PLFB 1FPWA 3TDZA 4CIDA 1XFYO 1M46A 2SASA 1M45A 2KI6D 2F8PA 2LCPA 4MVFA 3SG6A 1RK9A 2BL0B 2KQYA 1A03A 3KHEA 2K7CA 3GK4X 2PRUA 5HLOA 1TNWA 4C0KA 1UHHA 3CLNA 4WQ2A 3SG7A 2L51A 1KSMA 2CT9A 3HX4A 1CLLA 2LMUA 4FTGA 5I8NA 1WDCB 1XFZO 2MJWB 1TTXA 1XFVO 1SY9A 2M3WA 1SKTA 4ORCB 2LP2A 1OE9B 2ZNEA 2R2IA 1TIZA 5AANA 5CSIA 1SPYA 1A2XA 2JT0A 1TRFA 3OX6A 1RTP1 2FOTA 5DKQA 3SJSA 3ZNIA 1QTXA 1CMFA 2KFHA 1Q80A 3CR4X 1WLZA 2BCAA 1XA5A 3D0YA 4YBHB 1BR1B 2ZRSA 3WNXB 1AJ4A 1YVLA 1JFJA 5G08A 1NWDA 3I5HC 3OX5A 4R1EA 4DRWA 1ZACA 4C0LA 4AQJA 5ER5A 3DVEA 1DJHA 2F2PA 3WHUB 1S6CA 1CFPA 2LE9B 3FIAA 1IG5A 3I5GC 1X02A 1CFCA 4M2OA 1N65A 1B9AA 4N1FA 1FBVA 3EKJA 2GGMA 2WNDA 1DGUA 1KK8B 1S6IA 2EHBA 3KEVA 2K7DA 4MZKA 5CPVA 1LINA 3DF0A 3EVUA 4YGBB 1N2DA 1A29A 1DJZA 1VRKA 1OSAA 3EKHA 3A8RA 3EVVA 2ISDA 4AOMA 1S26D 1KSOA 1OQPA 3I5HB 1MWNA 2HETA 3OB2B 4NQGA 5KU1A 2BCBA 3I5FC 1EH2A 1J55A 5HKYA 2I18A 4C0JA 1YUTA 1BF5A 3I5GB 1DJXA 2V53A 4GBAA 4PE1A 1AVSA 1JFKA 3JVTC 4YGEB 1S36A 1L7ZA 2MA2A 2KDHA 2BKHB 2NZ0A 1MUXA 1OMVA 3NSIA 5IBWA 3TS5C 1DVIA 2MLEC 5HKZA 1RROA 5AXIA 2O60A 1K96A 4CPVA 2LNKA 3CTNA 1NCZA 3I5FB 2JOJA 1SR6C 3BXKA 4IL1A 2K7BA 2L98A 2WORA 3JTDB 2LUXA 1XFUO 4DCKA 2ZFDA 1SRAA 1SK6D 3IQOA 3MSEB 2MBXA 1FF1A 1DMOA 3SG2A 2KAXA 1JUOA 3GK2A 1NIWA 1JF2A 3HCMA 3DF0B 4QJ5B 4BY4A 1QJTA 4PE4A 1IJ5A 1J7PA 3VRPA 1TNPA 1F4OA 2JTZA 3BUWB 5DKNA 2VRGA 4FQOA 1OMDA 1ALWA 1IQ3A 4XJKB 3NSLA 2JWWA 3BUNB 1TN4A 2KBMA 3LK0A 1JSAA 1UHIA 1B8LA 3LL8B 3ZWHA 3KPXA 1BT6A 4OV2A 2JXCA 1JF0A 1IH0A 1OZOA 2I7AA 2EGDA 1SR6B 3A4UB 3BOWB 1DGVA 4ICBA 2WCBA 5D69A 1B7TZ 1ZMZA 1BG1A 1XYDA 2M1UA 2M97A 1QIWA 2BECA 2M7NA 3PM8A 1SNLA 1UURA 1WDCC 4WRIA 1SL8A 1TCOB 4GPLB 1FI6A 1CTRA 1YURA 4F0ZB 5GQQC 1QVIZ 4P5OE 3RM1A 3VRNA 2P6BB 3BUMB 1OMRA 1PALA 2KFFA 4ETOA 1Y1AA 1XK4A 3EVRA 2LAPA 1H8BA 2BKIB 4DUQA 2L4IA 4OKHA 1HT9A 2AAOA 1NX1A 3E3RA 4OVNF 1J7QA 3EK4A 1QV0A 2M1KB 4HREE 1HQVA 2LVIA 3IQQA 3PALA 5KSZA 1CKKA 4CFRA 2LVJA 2ZN9A 1AJ5A 1CM1A 1IKUA 3VROA 2PALA 1YRTB 3NSOA 2KI4C 1BLQA 2NCOA 4U8DA 2LHIA 3FWCA 2HPSA 2KAYA 4MLWA 1KK8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XK4 C;  1BU3 A;  3IF7 A;  1L2O B;  1B7T Y;  1ZUZ A;  2H2K A;  1CDL A;  3M0W A;  1UWO A;  1LXF C;  1A4P A;  1F70 A;  2CCM A;  2KSP A;  4GGN A;  4ZCU A;  2JT3 A;  3TUY B;  2ZND A;  4GGF A;  1K9U A;  1QV1 A;  2JPT A;  3NSK A;  1DJI A;  4MEW A;  2KBI A;  3GK1 A;  1IRJ A;  3TZ1 A;  4PAL A;  1CFD A;  1K93 D;  1TOP A;  3CS1 A;  1KK7 Z;  2CTN A;  3PFV A;  1QVI Y;  3BUO B;  1CLM A;  2G9B A;  1NYA A;  1SL7 A;  2KYF A;  2RGI A;  3H4S E;  1IQ5 A;  2EC6 B;  2KI4 B;  1MF8 B;  2K2F A;  4JPZ B;  4HRG A;  1GQM A;  5TNC A;  1Y0V H;  2LLS A;  1R6P A;  5J3X A;  3SG5 A;  2BBM A;  1DTL A;  4M2P A;  4GGF C;  1EXR A;  2K61 A;  1SCV A;  2AMI A;  2OTG C;  1A75 B;  1XFW O;  3KO0 A;  1H4B A;  1QIV A;  4XJK A;  1CMG A;  2DOQ A;  1NCY A;  1Y1X A;  2KOT A;  3NXA A;  1DJG A;  1F4Q A;  2BBN A;  3PSR A;  4XYN A;  1SMG A;  3BOW A;  3JTD C;  1AUI B;  4GAO A;  1J1E A;  1CNP A;  1F8H A;  1U5I B;  5CSJ A;  1YUU A;  3LCP C;  5AER A;  1B4C A;  1YX8 A;  1JC2 A;  2WC8 A;  4OCI A;  1TNQ A;  4NDD A;  4YI8 A;  5HLV A;  2M7L A;  4TNC A;  1S5G Z;  3LK1 A;  3C1V A;  5K89 A;  2WCF A;  3FS7 A;  1MR8 A;  2OTG B;  1J7R A;  1QS7 A;  1J7O A;  1F55 A;  1ZFS A;  4I5J A;  2JNX A;  3VRR A;  1KK7 Y;  2L2E A;  1WY9 A;  1NPQ A;  2A4J A;  4HSZ A;  2M8U A;  3DVM A;  1BR4 B;  1IWQ A;  2WOS A;  2QAC A;  2WCE A;  2KYC A;  1C7V A;  2FJU B;  2LAN A;  1JWD A;  2M49 B;  4P2Y B;  1NX2 A;  1WRL A;  1G33 A;  2K7O A;  4GNK B;  2SCP A;  4PE7 A;  4CLN A;  5B8I B;  2JZI A;  1BMO A;  4WQ3 A;  4NDC A;  3BYA A;  2L4H A;  3CGA A;  1PVB A;  3CR2 A;  2BE6 A;  3BUX B;  3OP0 A;  2ZN8 A;  2Q4U A;  3AAK A;  1SW8 A;  2LMV A;  5HKW A;  1F54 A;  2KAV A;  1B1G A;  2F2O A;  3I5I B;  1MQ1 A;  2KFG A;  2LVK A;  1KCY A;  1KQM C;  5JOL A;  5PAL A;  1RFJ A;  4BY5 A;  2KGB C;  1K9P A;  1K9K A;  1PUL A;  1MXE A;  1UHK A;  1S5G Y;  2IS9 A;  4I5N B;  5KTY A;  1YR5 A;  2Q91 A;  1PVA A;  2PAS A;  1EG4 A;  2H61 A;  1XO5 A;  3VGO A;  4CFQ A;  5FYX A;  2AUC A;  1YRU B;  1AP4 A;  5CSN A;  3WXA A;  4QJ4 B;  1SCM B;  1C7W A;  2JUL A;  5I2O A;  2Y1M A;  2HQ8 A;  2JU0 A;  1WLM A;  1L2O C;  2K0J A;  1CDM A;  1ODB A;  2JT8 A;  1UP5 A;  1M39 A;  2JXL A;  3TUY C;  1SYM A;  3LLE A;  1KQM B;  1NX0 A;  1B47 A;  1A75 A;  3DVK A;  2K8M B;  1SBJ A;  3CZT X;  2LUC A;  2H61 C;  4L9M A;  1QX5 B;  2LM5 A;  3O4Y A;  1EJ3 A;  1FW4 A;  2B1U A;  1TCF A;  3CR5 X;  3PN7 B;  2EC6 C;  1IJ6 A;  1QX7 A;  4A4C A;  1Y6W A;  2CBL A;  2F3Z A;  3EK8 A;  3O2P A;  1U5I A;  3O78 A;  3D10 A;  2JTT A;  2FCE A;  4NDB A;  1UHN A;  4MRY A;  1S6J A;  1NX3 A;  2E30 A;  4JQ0 D;  1LVC D;  4E68 A;  4YGC B;  4YI9 A;  2ZRT A;  1B8C A;  4JWQ A;  2L5X B;  1QXP A;  3RLZ A;  2JQ6 A;  2LHL A;  2QPT A;  4N1G A;  5CSF A;  5JJG A;  2KGR A;  1MXL C;  2MHH A;  4N5X A;  1DF0 A;  3FWB A;  4MRX A;  4Q04 A;  5AEQ A;  1C07 A;  1PRW A;  1CLB A;  2GGZ A;  4I5L B;  1D1O A;  1S1E A;  1ZOT B;  2KNE A;  2Y5I A;  2JRF A;  2L50 A;  1CFF A;  2I94 A;  2LLT A;  1K2H A;  5F6T A;  2LVV A;  3TDU A;  5I2Q A;  1R2U A;  1BOD A;  2NXQ A;  5I2L A;  1IGV A;  4YGA A;  2BCX A;  1B8R A;  1TNX A;  4MN0 A;  1OOJ A;  4OR9 B;  1M63 B;  1CDP A;  4GUK A;  1K95 A;  1NSH A;  3SIB A;  3TDI A;  1J1D A;  1NUB A;  5DKR A;  1KQV A;  2MAZ A;  2PMY A;  1BJF A;  4A4B A;  2HQW A;  3EK7 A;  2I2R E;  2F3Y A;  3K21 A;  5ER4 X;  1EL4 A;  1DJW A;  1AK8 A;  2MLF C;  1YTZ C;  2L0P A;  3PAT A;  4PHJ A;  2OPO A;  4YRU A;  2G2B A;  4AQI A;  4PHM A;  4PHK A;  1KWO C;  2CXJ A;  1S3P A;  1K94 A;  4QJ3 B;  1FI5 A;  1YVH A;  3AKA A;  2LMT A;  3F45 A;  1GJY A;  2K2A A;  2KHN A;  5HYD A;  3GOF A;  3O6B A;  4DIR A;  1DT7 B;  1CM4 A;  2FCD A;  2GV5 A;  1DF0 B;  1QLK A;  1XFX O;  5D7F A;  4UPG A;  2OS8 C;  2Y4Q A;  3DD4 A;  2LV7 A;  5AFP A;  1K90 D;  3SIA A;  1F71 A;  2HF5 A;  2PVB A;  2COL B;  2JC2 A;  3I5I C;  1G8I A;  2CNP A;  2JNF A;  2M0R A;  1UHJ A;  4YGD B;  1QLS A;  3D0Y B;  3CWG A;  4MZJ A;  1KWO B;  3KF9 A;  1V1G A;  4ORA B;  1QX2 A;  4I5K A;  2NCP A;  1GGZ A;  1OZS A;  4ZCV A;  4MBE A;  1CDN A;  3QRX A;  1G4Y R;  3SG3 A;  1SCM C;  4USL A;  2BE4 A;  2OS8 B;  1AHR A;  1GGW A;  1QAS A;  1KFX S;  1NCX A;  1LA3 A;  1N0Y A;  1RJV A;  1SL9 A;  1QAT A;  2M29 A;  2ZKM X;  2M9G A;  3JVT B;  4MSP A;  1YX7 A;  4HRH A;  2PSR A;  2KQ6 A;  1PSR A;  3OB1 B;  1K8U A;  1W7J B;  2E6W A;  2O5G A;  2F33 A;  3TS5 B;  1KFX L;  3OHM B;  1V1F A;  4PDZ A;  4PCW A;  1EG3 A;  1WRZ A;  1CB1 A;  4DS7 A;  1RWY A;  1NP8 A;  1WRK A;  3PN7 C;  1W7I B;  1KFU S;  2KI6 C;  4GFT A;  1DJY A;  1E8A A;  3SG4 A;  4D1E A;  1UUS A;  1PK0 D;  1Y1U A;  4M2Q A;  2BL0 C;  1XVJ A;  1LKJ A;  3BQ3 A;  3ICB A;  2LP3 A;  3DVJ A;  2NLN A;  3VRQ A;  1ALV A;  4MZL A;  1KFU L;  2D8N A;  1MHO A;  4ORB B;  3WHT B;  1LA0 A;  4PE0 A;  3AKB A;  2LLU A;  2TN4 A;  2Y1N A;  5BPJ A;  2LC5 A;  2MRD A;  3AAJ A;  1REC A;  1PSB A;  1BOC A;  1YUS A;  4PHN A;  1M31 A;  1JBA A;  3PLF B;  1FPW A;  3TDZ A;  4CID A;  1XFY O;  1M46 A;  2SAS A;  1M45 A;  2KI6 D;  2F8P A;  2LCP A;  4MVF A;  3SG6 A;  1RK9 A;  2BL0 B;  2KQY A;  1A03 A;  3KHE A;  2K7C A;  3GK4 X;  2PRU A;  5HLO A;  1TNW A;  4C0K A;  1UHH A;  3CLN A;  4WQ2 A;  3SG7 A;  2L51 A;  1KSM A;  2CT9 A;  3HX4 A;  1CLL A;  2LMU A;  4FTG A;  5I8N A;  1WDC B;  1XFZ O;  2MJW B;  1TTX A;  1XFV O;  1SY9 A;  2M3W A;  1SKT A;  4ORC B;  2LP2 A;  1OE9 B;  2ZNE A;  2R2I A;  1TIZ A;  5AAN A;  5CSI A;  1SPY A;  1A2X A;  2JT0 A;  1TRF A;  3OX6 A;  1RTP 1;  2FOT A;  5DKQ A;  3SJS A;  3ZNI A;  1QTX A;  1CMF A;  2KFH A;  1Q80 A;  3CR4 X;  1WLZ A;  2BCA A;  1XA5 A;  3D0Y A;  4YBH B;  1BR1 B;  2ZRS A;  3WNX B;  1AJ4 A;  1YVL A;  1JFJ A;  5G08 A;  1NWD A;  3I5H C;  3OX5 A;  4R1E A;  4DRW A;  1ZAC A;  4C0L A;  4AQJ A;  5ER5 A;  3DVE A;  1DJH A;  2F2P A;  3WHU B;  1S6C A;  1CFP A;  2LE9 B;  3FIA A;  1IG5 A;  3I5G C;  1X02 A;  1CFC A;  4M2O A;  1N65 A;  1B9A A;  4N1F A;  1FBV A;  3EKJ A;  2GGM A;  2WND A;  1DGU A;  1KK8 B;  1S6I A;  2EHB A;  3KEV A;  2K7D A;  4MZK A;  5CPV A;  1LIN A;  3DF0 A;  3EVU A;  4YGB B;  1N2D A;  1A29 A;  1DJZ A;  1VRK A;  1OSA A;  3EKH A;  3A8R A;  3EVV A;  2ISD A;  4AOM A;  1S26 D;  1KSO A;  1OQP A;  3I5H B;  1MWN A;  2HET A;  3OB2 B;  4NQG A;  5KU1 A;  2BCB A;  3I5F C;  1EH2 A;  1J55 A;  5HKY A;  2I18 A;  4C0J A;  1YUT A;  1BF5 A;  3I5G B;  1DJX A;  2V53 A;  4GBA A;  4PE1 A;  1AVS A;  1JFK A;  3JVT C;  4YGE B;  1S36 A;  1L7Z A;  2MA2 A;  2KDH A;  2BKH B;  2NZ0 A;  1MUX A;  1OMV A;  3NSI A;  5IBW A;  3TS5 C;  1DVI A;  2MLE C;  5HKZ A;  1RRO A;  5AXI A;  2O60 A;  1K96 A;  4CPV A;  2LNK A;  3CTN A;  1NCZ A;  3I5F B;  2JOJ A;  1SR6 C;  3BXK A;  4IL1 A;  2K7B A;  2L98 A;  2WOR A;  3JTD B;  2LUX A;  1XFU O;  4DCK A;  2ZFD A;  1SRA A;  1SK6 D;  3IQO A;  3MSE B;  2MBX A;  1FF1 A;  1DMO A;  3SG2 A;  2KAX A;  1JUO A;  3GK2 A;  1NIW A;  1JF2 A;  3HCM A;  3DF0 B;  4QJ5 B;  4BY4 A;  1QJT A;  4PE4 A;  1IJ5 A;  1J7P A;  3VRP A;  1TNP A;  1F4O A;  2JTZ A;  3BUW B;  5DKN A;  2VRG A;  4FQO A;  1OMD A;  1ALW A;  1IQ3 A;  4XJK B;  3NSL A;  2JWW A;  3BUN B;  1TN4 A;  2KBM A;  3LK0 A;  1JSA A;  1UHI A;  1B8L A;  3LL8 B;  3ZWH A;  3KPX A;  1BT6 A;  4OV2 A;  2JXC A;  1JF0 A;  1IH0 A;  1OZO A;  2I7A A;  2EGD A;  1SR6 B;  3A4U B;  3BOW B;  1DGV A;  4ICB A;  2WCB A;  5D69 A;  1B7T Z;  1ZMZ A;  1BG1 A;  1XYD A;  2M1U A;  2M97 A;  1QIW A;  2BEC A;  2M7N A;  3PM8 A;  1SNL A;  1UUR A;  1WDC C;  4WRI A;  1SL8 A;  1TCO B;  4GPL B;  1FI6 A;  1CTR A;  1YUR A;  4F0Z B;  5GQQ C;  1QVI Z;  4P5O E;  3RM1 A;  3VRN A;  2P6B B;  3BUM B;  1OMR A;  1PAL A;  2KFF A;  4ETO A;  1Y1A A;  1XK4 A;  3EVR A;  2LAP A;  1H8B A;  2BKI B;  4DUQ A;  2L4I A;  4OKH A;  1HT9 A;  2AAO A;  1NX1 A;  3E3R A;  4OVN F;  1J7Q A;  3EK4 A;  1QV0 A;  2M1K B;  4HRE E;  1HQV A;  2LVI A;  3IQQ A;  3PAL A;  5KSZ A;  1CKK A;  4CFR A;  2LVJ A;  2ZN9 A;  1AJ5 A;  1CM1 A;  1IKU A;  3VRO A;  2PAL A;  1YRT B;  3NSO A;  2KI4 C;  1BLQ A;  2NCO A;  4U8D A;  2LHI A;  3FWC A;  2HPS A;  2KAY A;  4MLW A;  1KK8 C; 
#chains in the Genus database with same CATH topology
 1XK4 C;  2QEO A;  1BU3 A;  3IF7 A;  1L2O B;  1B7T Y;  1ZUZ A;  3DYE A;  2H2K A;  1CDL A;  3M0W A;  1UWO A;  1LXF C;  1A4P A;  1F70 A;  2CCM A;  2KSP A;  4GGN A;  4ZCU A;  2JT3 A;  3DXL A;  3TUY B;  3VB1 A;  2ZND A;  4GGF A;  1K9U A;  1QV1 A;  2JPT A;  2YGU A;  3NSK A;  1DJI A;  4MEW A;  2KBI A;  3B87 A;  3GK1 A;  1IRJ A;  3TZ1 A;  4PAL A;  1CFD A;  1K93 D;  1TOP A;  1Z4H A;  1KK7 Z;  2CTN A;  3CS1 A;  1QVI Y;  3BUO B;  1CLM A;  2G9B A;  1NYA A;  1SL7 A;  2KYF A;  2QEB A;  2RGI A;  3FE8 A;  3H4S E;  1IQ5 A;  2EC6 B;  2KI4 B;  3R72 A;  3OBV A;  1MF8 B;  2K2F A;  4JPZ B;  4HRG A;  1GQM A;  5DIC A;  5TNC A;  1Y0V H;  2LLS A;  2WCK A;  1R6P A;  5J3X A;  3SG5 A;  2BBM A;  3D76 A;  1DTL A;  4M2P A;  4JD9 A;  4GGF C;  1EXR A;  2K61 A;  1SCV A;  2AMI A;  2OTG C;  1A75 B;  1XFW O;  3KO0 A;  1H4B A;  1QIV A;  4XJK A;  1CMG A;  2DOQ A;  1NCY A;  1DEL A;  3NGV A;  1Y1X A;  2KOT A;  3NXA A;  1DJG A;  1F4Q A;  2BBN A;  3PSR A;  4XYN A;  1SMG A;  3BOW A;  3JTD C;  1AUI B;  4GAO A;  1J1E A;  3V2L A;  1CNP A;  1U5I B;  5CSJ A;  1YUU A;  3LCP C;  1F8H A;  4IJ7 A;  5AER A;  1B4C A;  1YX8 A;  1JC2 A;  2WC8 A;  4OCI A;  1TNQ A;  4NDD A;  2P70 A;  4YI8 A;  5HLV A;  2M7L A;  4TNC A;  1S5G Z;  3LK1 A;  3C1V A;  5K89 A;  1DEK A;  2WCF A;  3FS7 A;  1MR8 A;  2OTG B;  1J7R A;  1QS7 A;  1J7O A;  1F55 A;  1ZFS A;  1P28 A;  4I5J A;  3S0A A;  2JNX A;  3VRR A;  1KK7 Y;  5FI7 A;  2L2E A;  1TUZ A;  1WY9 A;  1NPQ A;  2A4J A;  4HSZ A;  2M8U A;  3DVM A;  1BR4 B;  1IWQ A;  2WOS A;  2QAC A;  2K60 A;  2WCE A;  2KYC A;  1C7V A;  2FJU B;  2LAN A;  3SS5 A;  1JWD A;  2M49 B;  4P2Y B;  1NX2 A;  1WRL A;  1G33 A;  2K7O A;  4GNK B;  2SCP A;  4PE7 A;  4CLN A;  5B8I B;  2JZI A;  1BMO A;  2JPO A;  4WQ3 A;  4NDC A;  3BYA A;  2L4H A;  3CGA A;  3UNW A;  1OOH A;  1PVB A;  3CR2 A;  2BE6 A;  3BUX B;  3OP0 A;  2ZN8 A;  2Q4U A;  3AAK A;  3UO9 A;  1SW8 A;  2LMV A;  5HKW A;  1F54 A;  2KAV A;  1B1G A;  2F2O A;  3I5I B;  1MQ1 A;  2KFG A;  2LVK A;  1KCY A;  1KQM C;  5JOL A;  5PAL A;  1RFJ A;  4BY5 A;  2KGB C;  1K9P A;  1K9K A;  1OOI X;  1PUL A;  1MXE A;  1UHK A;  1S5G Y;  2IS9 A;  3L4A A;  4I5N B;  1YR5 A;  5KTY A;  2Q91 A;  3D78 A;  1PVA A;  2PAS A;  1EG4 A;  2H61 A;  1XO5 A;  3VGO A;  4CFQ A;  5FYX A;  2AUC A;  3DY9 A;  1YRU B;  1AP4 A;  5CSN A;  3CZ1 A;  3L4L A;  3WXA A;  4QJ4 B;  1SCM B;  1C7W A;  2JUL A;  5I2O A;  2Y1M A;  2HQ8 A;  2JU0 A;  1WLM A;  4OZD A;  1SSE B;  1L2O C;  2K0J A;  1CDM A;  1XFR A;  1ODB A;  2JT8 A;  3BFA A;  1UP5 A;  1M39 A;  2JXL A;  2WCL A;  3TUY C;  1SYM A;  3LLE A;  1KQM B;  1NX0 A;  1B47 A;  1A75 A;  3DVK A;  2K8M B;  1SBJ A;  4PT1 A;  3CZT X;  2LUC A;  2H61 C;  4F7F A;  4L9M A;  1QX5 B;  2LM5 A;  3O4Y A;  1EJ3 A;  1FW4 A;  2B1U A;  1TCF A;  3CR5 X;  3PN7 B;  2EC6 C;  1IJ6 A;  1QX7 A;  4A4C A;  1Y6W A;  2CBL A;  2F3Z A;  3EK8 A;  3O2P A;  1U5I A;  3O78 A;  3D10 A;  2JTT A;  2FCE A;  4NDB A;  1UHN A;  1W9Z A;  4MRY A;  1S6J A;  1NX3 A;  2E30 A;  2BAP A;  1OOF A;  4JQ0 D;  1LVC D;  3Q8I A;  4E68 A;  4YGC B;  4YI9 A;  2ZRT A;  1B8C A;  3S0E A;  4JWQ A;  1C3Y A;  2L5X B;  3PM2 A;  1QXP A;  3RLZ A;  2JQ6 A;  2LHL A;  2PYQ A;  2QPT A;  4N1G A;  2KPH A;  5CSF A;  5JJG A;  2KGR A;  1MXL C;  2MHH A;  3PFV A;  1DF0 A;  3R1P A;  4N5X A;  3FWB A;  4MRX A;  4Q04 A;  5AEQ A;  3BFB A;  1PRW A;  1C07 A;  1CLB A;  5FI2 A;  3PJI A;  1GM0 A;  2GGZ A;  4I5L B;  3CAB A;  1S1E A;  1ZOT B;  2KNE A;  2Y5I A;  1D1O A;  2JRF A;  2L50 A;  1CFF A;  2I94 A;  2LLT A;  1K2H A;  5F6T A;  2LVV A;  3TDU A;  5I2Q A;  1R2U A;  1BOD A;  2NXQ A;  5I2L A;  1IGV A;  4YGA A;  2KLE A;  2BCX A;  1B8R A;  1TNX A;  4MN0 A;  1OOJ A;  4OR9 B;  1M63 B;  1CDP A;  4GUK A;  1K95 A;  1NSH A;  3SIB A;  3TDI A;  1J1D A;  1NUB A;  5DKR A;  1KQV A;  2MAZ A;  2PMY A;  1BJF A;  4A4B A;  2HQW A;  2QDI A;  3EK7 A;  2QEV A;  2I2R E;  2F3Y A;  3K21 A;  2P71 A;  5ER4 X;  1EL4 A;  1DJW A;  1AK8 A;  2MLF C;  1YTZ C;  2L0P A;  3CZ0 A;  3PAT A;  4PHJ A;  2OPO A;  4YRU A;  2G2B A;  4AQI A;  4PHM A;  4PHK A;  1KWO C;  2CXJ A;  1S3P A;  1K94 A;  3DZT A;  4QJ3 B;  1FI5 A;  1YVH A;  3AKA A;  2LMT A;  3F45 A;  1GJY A;  2K2A A;  2KHN A;  5HYD A;  3GOF A;  3O6B A;  4DIR A;  1DT7 B;  1CM4 A;  2FCD A;  2GV5 A;  5HL1 A;  1DF0 B;  1QLK A;  1XFX O;  5D7F A;  4UPG A;  2OS8 C;  2Y4Q A;  3DD4 A;  2LV7 A;  5AFP A;  1K90 D;  3SIA A;  1F71 A;  2HF5 A;  2PVB A;  2COL B;  2JC2 A;  3FE9 A;  3I5I C;  1G8I A;  2CNP A;  2JNF A;  2M0R A;  1UHJ A;  4YGD B;  1QLS A;  3D0Y B;  1Z2C B;  3CWG A;  1KWO B;  4MZJ A;  1DC1 A;  3KF9 A;  1V1G A;  4ORA B;  1QX2 A;  4I5K A;  2NCP A;  1GGZ A;  1OZS A;  4ZCV A;  4MBE A;  1CDN A;  3QRX A;  1G4Y R;  3SG3 A;  1SCM C;  2H8V A;  2GTE A;  3NHT A;  4USL A;  2BE4 A;  2OS8 B;  1AHR A;  1GGW A;  1QAS A;  1KFX S;  1NCX A;  1LA3 A;  1N0Y A;  1RJV A;  1SL9 A;  1QAT A;  2M29 A;  3D75 A;  2ZKM X;  3IVT A;  2M9G A;  3JVT B;  4MSP A;  1YX7 A;  4HRH A;  2PSR A;  2KQ6 A;  1PSR A;  2WC5 A;  3OB1 B;  1K8U A;  1W7J B;  2E6W A;  2O5G A;  2F33 A;  3TS5 B;  1KFX L;  3OHM B;  1V1F A;  4PDZ A;  4PCW A;  1EG3 A;  3RZS A;  4JKT A;  3BJH A;  1WRZ A;  1CB1 A;  4DS7 A;  1RWY A;  1NP8 A;  1WRK A;  3PN7 C;  1W7I B;  3B6X A;  1KFU S;  2KI6 C;  3O4X A;  1DJY A;  1E8A A;  4GFT A;  3SG4 A;  4D1E A;  1UUS A;  1PK0 D;  1Y1U A;  3CYZ A;  2BL0 C;  4INW A;  4M2Q A;  1XVJ A;  1LKJ A;  3BQ3 A;  3CZ2 A;  3ICB A;  2LP3 A;  3DVJ A;  2NLN A;  3VRQ A;  3B88 A;  1ALV A;  1C3Z A;  4MZL A;  1KFU L;  2D8N A;  1MHO A;  4ORB B;  2WCH A;  3WHT B;  1LA0 A;  4PE0 A;  3D77 A;  3AKB A;  1DQE A;  2LLU A;  2TN4 A;  2Y1N A;  5BPJ A;  2LC5 A;  2MRD A;  3AAJ A;  1REC A;  1PSB A;  1BOC A;  3SS4 A;  1YUS A;  3B7A A;  1M31 A;  2WCJ A;  3PLF B;  4PHN A;  1JBA A;  3TDZ A;  4CID A;  1FPW A;  1XFY O;  1QWV A;  1TUJ A;  1M46 A;  2SAS A;  1M45 A;  2KI6 D;  2F8P A;  2LCP A;  4MVF A;  3SG6 A;  5D3O A;  1RK9 A;  2BL0 B;  2KQY A;  3OGN A;  1A03 A;  3D73 A;  3KHE A;  2K7C A;  3GK4 X;  2PRU A;  5HLO A;  1TNW A;  4C0K A;  1UHH A;  3CLN A;  4WQ2 A;  3S0D A;  3SG7 A;  2L51 A;  1KSM A;  2CT9 A;  3HX4 A;  1CLL A;  2LMU A;  4FTG A;  5I8N A;  1WDC B;  1XFZ O;  4FQT A;  2MJW B;  1TTX A;  1XFV O;  1SY9 A;  2BNX A;  2M3W A;  3SS3 A;  1SKT A;  4ORC B;  3B86 A;  2LP2 A;  1OE9 B;  2ZNE A;  2R2I A;  1TIZ A;  5AAN A;  5CSI A;  3D74 A;  1SPY A;  1A2X A;  2JT0 A;  1TRF A;  3OX6 A;  1RTP 1;  1T14 A;  2FOT A;  5DKQ A;  3SJS A;  1QTX A;  1OW4 A;  5FI6 A;  2KFH A;  3ZNI A;  1Q80 A;  3CR4 X;  1WLZ A;  2BCA A;  3R1O A;  1XA5 A;  1IIO A;  3D0Y A;  4YBH B;  1BR1 B;  2ZRS A;  3WNX B;  1AJ4 A;  3NHI A;  1YVL A;  5EL2 A;  3BFH A;  1JFJ A;  5G08 A;  1NWD A;  3I5H C;  3OX5 A;  4R1E A;  4DRW A;  1ZAC A;  4C0L A;  4AQJ A;  5ER5 A;  3DVE A;  1DJH A;  2F2P A;  3WHU B;  1S6C A;  1CFP A;  2LE9 B;  3FIA A;  3S0F A;  1IG5 A;  3I5G C;  1X02 A;  1CFC A;  4M2O A;  1N65 A;  1B9A A;  4N1F A;  1FBV A;  3EKJ A;  2GGM A;  2WND A;  1DGU A;  1KK8 B;  1S6I A;  2EHB A;  3KEV A;  2K7D A;  4MZK A;  5CPV A;  1LIN A;  3DF0 A;  3EVU A;  4YGB B;  1N2D A;  1A29 A;  1DJZ A;  1VRK A;  1OSA A;  3R1V A;  2L2C A;  3FE6 A;  3EKH A;  3A8R A;  3EVV A;  2ISD A;  4AOM A;  1S26 D;  1KSO A;  1OQP A;  3I5H B;  1MWN A;  2HET A;  3OB2 B;  4NQG A;  5KU1 A;  2BCB A;  3I5F C;  1EH2 A;  1J55 A;  5HKY A;  2I18 A;  4C0J A;  3S0B A;  1YUT A;  3S0G A;  3N7H A;  3I5G B;  1BF5 A;  1DJX A;  2V53 A;  2ERB A;  2QEH A;  3EG5 B;  4GBA A;  4PE1 A;  1AVS A;  1JFK A;  3JVT C;  4YGE B;  1S36 A;  1L7Z A;  2MA2 A;  2WCM A;  2KDH A;  2BKH B;  2NZ0 A;  1MUX A;  1OMV A;  3NSI A;  5IBW A;  3TS5 C;  1DVI A;  2MLE C;  5HKZ A;  1RRO A;  5AXI A;  2O60 A;  2PQL A;  1K96 A;  4CPV A;  2LNK A;  3CTN A;  1TWO A;  1NCZ A;  3I5F B;  2JOJ A;  1SR6 C;  3BXK A;  4IL1 A;  2K7B A;  2L98 A;  2WOR A;  3JTD B;  2LUX A;  1XFU O;  4DCK A;  2ZFD A;  1SRA A;  1SK6 D;  3IQO A;  3MSE B;  2L5Y A;  2MBX A;  1FF1 A;  1DMO A;  3SG2 A;  2KAX A;  1JUO A;  3GK2 A;  1NIW A;  1JF2 A;  3HCM A;  3DF0 B;  4QJ5 B;  4BY4 A;  1QJT A;  4PE4 A;  1IJ5 A;  1J7P A;  3VRP A;  1TNP A;  1F4O A;  2JTZ A;  3BUW B;  5DKN A;  2VRG A;  4FQO A;  1OMD A;  1ALW A;  1IQ3 A;  3CDN A;  4XJK B;  3NSL A;  2JWW A;  5I94 A;  3BUN B;  3L47 A;  1TN4 A;  2KBM A;  3LK0 A;  1JSA A;  1UHI A;  1B8L A;  3LL8 B;  2KLD A;  3KPX A;  3ZWH A;  1BT6 A;  4OV2 A;  2JXC A;  1JF0 A;  1IH0 A;  1OZO A;  2I7A A;  2EGD A;  1SR6 B;  3A4U B;  3BOW B;  1DGV A;  4ICB A;  2WCB A;  5D69 A;  1B7T Z;  1ZMZ A;  1BG1 A;  1XYD A;  2M1U A;  2M97 A;  1QIW A;  2BEC A;  2M7N A;  3PM8 A;  1ORG A;  1SNL A;  1UUR A;  1WDC C;  2WC6 A;  4WRI A;  1SL8 A;  1TCO B;  4GPL B;  1FI6 A;  1CTR A;  1YUR A;  4F0Z B;  5GQQ C;  1LS8 A;  1QVI Z;  4P5O E;  3RM1 A;  3VRN A;  2P6B B;  3BUM B;  1OMR A;  1PAL A;  2KFF A;  4ETO A;  2FJY A;  1Y1A A;  1XK4 A;  3EVR A;  2LAP A;  1H8B A;  2BKI B;  4DUQ A;  2L4I A;  4OKH A;  1HT9 A;  2AAO A;  1NX1 A;  3E3R A;  4OVN F;  1J7Q A;  3EK4 A;  1QV0 A;  3K1E A;  2M1K B;  4HRE E;  1HQV A;  2LVI A;  1OOG A;  3IQQ A;  3PAL A;  5KSZ A;  1CKK A;  1CMF A;  4CFR A;  2LVJ A;  2ZN9 A;  1AJ5 A;  1CM1 A;  1IKU A;  3VRO A;  2PAL A;  1YRT B;  4INX A;  3QME A;  3NSO A;  2KI4 C;  4KYN A;  1BLQ A;  2NCO A;  4U8D A;  2LHI A;  3FWC A;  2HPS A;  2KAY A;  4MLW A;  1KK8 C; 
#chains in the Genus database with same CATH homology
 1XK4 C;  1BU3 A;  3IF7 A;  1L2O B;  1B7T Y;  1ZUZ A;  2H2K A;  1CDL A;  3M0W A;  1UWO A;  1LXF C;  1A4P A;  1F70 A;  2CCM A;  2KSP A;  4GGN A;  4ZCU A;  2JT3 A;  3TUY B;  2ZND A;  4GGF A;  1K9U A;  1QV1 A;  2JPT A;  3NSK A;  1DJI A;  4MEW A;  2KBI A;  3GK1 A;  1IRJ A;  3TZ1 A;  4PAL A;  1CFD A;  1K93 D;  1TOP A;  3CS1 A;  1KK7 Z;  2CTN A;  3PFV A;  1QVI Y;  3BUO B;  1CLM A;  2G9B A;  1NYA A;  1SL7 A;  2KYF A;  2RGI A;  3H4S E;  1IQ5 A;  2EC6 B;  2KI4 B;  1MF8 B;  2K2F A;  4JPZ B;  4HRG A;  1GQM A;  5TNC A;  1Y0V H;  2LLS A;  1R6P A;  5J3X A;  3SG5 A;  2BBM A;  1DTL A;  4M2P A;  4GGF C;  1EXR A;  2K61 A;  1SCV A;  2AMI A;  2OTG C;  1A75 B;  1XFW O;  3KO0 A;  1H4B A;  1QIV A;  4XJK A;  1CMG A;  2DOQ A;  1NCY A;  1Y1X A;  2KOT A;  3NXA A;  1DJG A;  1F4Q A;  2BBN A;  3PSR A;  4XYN A;  1SMG A;  3BOW A;  3JTD C;  1AUI B;  4GAO A;  1J1E A;  1CNP A;  1F8H A;  1U5I B;  5CSJ A;  1YUU A;  3LCP C;  5AER A;  1B4C A;  1YX8 A;  1JC2 A;  2WC8 A;  4OCI A;  1TNQ A;  4NDD A;  4YI8 A;  5HLV A;  2M7L A;  4TNC A;  1S5G Z;  3LK1 A;  3C1V A;  5K89 A;  2WCF A;  3FS7 A;  1MR8 A;  2OTG B;  1J7R A;  1QS7 A;  1J7O A;  1F55 A;  1ZFS A;  4I5J A;  2JNX A;  3VRR A;  1KK7 Y;  2L2E A;  1WY9 A;  1NPQ A;  2A4J A;  4HSZ A;  2M8U A;  3DVM A;  1BR4 B;  1IWQ A;  2WOS A;  2QAC A;  2WCE A;  2KYC A;  1C7V A;  2FJU B;  2LAN A;  1JWD A;  2M49 B;  4P2Y B;  1NX2 A;  1WRL A;  1G33 A;  2K7O A;  4GNK B;  2SCP A;  4PE7 A;  4CLN A;  5B8I B;  2JZI A;  1BMO A;  4WQ3 A;  4NDC A;  3BYA A;  2L4H A;  3CGA A;  1PVB A;  3CR2 A;  2BE6 A;  3BUX B;  3OP0 A;  2ZN8 A;  2Q4U A;  3AAK A;  1SW8 A;  2LMV A;  5HKW A;  1F54 A;  2KAV A;  1B1G A;  2F2O A;  3I5I B;  1MQ1 A;  2KFG A;  2LVK A;  1KCY A;  1KQM C;  5JOL A;  5PAL A;  1RFJ A;  4BY5 A;  2KGB C;  1K9P A;  1K9K A;  1PUL A;  1MXE A;  1UHK A;  1S5G Y;  2IS9 A;  4I5N B;  5KTY A;  1YR5 A;  2Q91 A;  1PVA A;  2PAS A;  1EG4 A;  2H61 A;  1XO5 A;  3VGO A;  4CFQ A;  5FYX A;  2AUC A;  1YRU B;  1AP4 A;  5CSN A;  3WXA A;  4QJ4 B;  1SCM B;  1C7W A;  2JUL A;  5I2O A;  2Y1M A;  2HQ8 A;  2JU0 A;  1WLM A;  1L2O C;  2K0J A;  1CDM A;  1ODB A;  2JT8 A;  1UP5 A;  1M39 A;  2JXL A;  3TUY C;  1SYM A;  3LLE A;  1KQM B;  1NX0 A;  1B47 A;  1A75 A;  3DVK A;  2K8M B;  1SBJ A;  3CZT X;  2LUC A;  2H61 C;  4L9M A;  1QX5 B;  2LM5 A;  3O4Y A;  1EJ3 A;  1FW4 A;  2B1U A;  1TCF A;  3CR5 X;  3PN7 B;  2EC6 C;  1IJ6 A;  1QX7 A;  4A4C A;  1Y6W A;  2CBL A;  2F3Z A;  3EK8 A;  3O2P A;  1U5I A;  3O78 A;  3D10 A;  2JTT A;  2FCE A;  4NDB A;  1UHN A;  4MRY A;  1S6J A;  1NX3 A;  2E30 A;  4JQ0 D;  1LVC D;  4E68 A;  4YGC B;  4YI9 A;  2ZRT A;  1B8C A;  4JWQ A;  2L5X B;  1QXP A;  3RLZ A;  2JQ6 A;  2LHL A;  2QPT A;  4N1G A;  5CSF A;  5JJG A;  2KGR A;  1MXL C;  2MHH A;  4N5X A;  1DF0 A;  3FWB A;  4MRX A;  4Q04 A;  5AEQ A;  1C07 A;  1PRW A;  1CLB A;  2GGZ A;  4I5L B;  1D1O A;  1S1E A;  1ZOT B;  2KNE A;  2Y5I A;  2JRF A;  2L50 A;  1CFF A;  2I94 A;  2LLT A;  1K2H A;  5F6T A;  2LVV A;  3TDU A;  5I2Q A;  1R2U A;  1BOD A;  2NXQ A;  5I2L A;  1IGV A;  4YGA A;  2BCX A;  1B8R A;  1TNX A;  4MN0 A;  1OOJ A;  4OR9 B;  1M63 B;  1CDP A;  4GUK A;  1K95 A;  1NSH A;  3SIB A;  3TDI A;  1J1D A;  1NUB A;  5DKR A;  1KQV A;  2MAZ A;  2PMY A;  1BJF A;  4A4B A;  2HQW A;  3EK7 A;  2I2R E;  2F3Y A;  3K21 A;  5ER4 X;  1EL4 A;  1DJW A;  1AK8 A;  2MLF C;  1YTZ C;  2L0P A;  3PAT A;  4PHJ A;  2OPO A;  4YRU A;  2G2B A;  4AQI A;  4PHM A;  4PHK A;  1KWO C;  2CXJ A;  1S3P A;  1K94 A;  4QJ3 B;  1FI5 A;  1YVH A;  3AKA A;  2LMT A;  3F45 A;  1GJY A;  2K2A A;  2KHN A;  5HYD A;  3GOF A;  3O6B A;  4DIR A;  1DT7 B;  1CM4 A;  2FCD A;  2GV5 A;  1DF0 B;  1QLK A;  1XFX O;  5D7F A;  4UPG A;  2OS8 C;  2Y4Q A;  3DD4 A;  2LV7 A;  5AFP A;  1K90 D;  3SIA A;  1F71 A;  2HF5 A;  2PVB A;  2COL B;  2JC2 A;  3I5I C;  1G8I A;  2CNP A;  2JNF A;  2M0R A;  1UHJ A;  4YGD B;  1QLS A;  3D0Y B;  3CWG A;  4MZJ A;  1KWO B;  3KF9 A;  1V1G A;  4ORA B;  1QX2 A;  4I5K A;  2NCP A;  1GGZ A;  1OZS A;  4ZCV A;  4MBE A;  1CDN A;  3QRX A;  1G4Y R;  3SG3 A;  1SCM C;  4USL A;  2BE4 A;  2OS8 B;  1AHR A;  1GGW A;  1QAS A;  1KFX S;  1NCX A;  1LA3 A;  1N0Y A;  1RJV A;  1SL9 A;  1QAT A;  2M29 A;  2ZKM X;  2M9G A;  3JVT B;  4MSP A;  1YX7 A;  4HRH A;  2PSR A;  2KQ6 A;  1PSR A;  3OB1 B;  1K8U A;  1W7J B;  2E6W A;  2O5G A;  2F33 A;  3TS5 B;  1KFX L;  3OHM B;  1V1F A;  4PDZ A;  4PCW A;  1EG3 A;  1WRZ A;  1CB1 A;  4DS7 A;  1RWY A;  1NP8 A;  1WRK A;  3PN7 C;  1W7I B;  1KFU S;  2KI6 C;  4GFT A;  1DJY A;  1E8A A;  3SG4 A;  4D1E A;  1UUS A;  1PK0 D;  1Y1U A;  4M2Q A;  2BL0 C;  1XVJ A;  1LKJ A;  3BQ3 A;  3ICB A;  2LP3 A;  3DVJ A;  2NLN A;  3VRQ A;  1ALV A;  4MZL A;  1KFU L;  2D8N A;  1MHO A;  4ORB B;  3WHT B;  1LA0 A;  4PE0 A;  3AKB A;  2LLU A;  2TN4 A;  2Y1N A;  5BPJ A;  2LC5 A;  2MRD A;  3AAJ A;  1REC A;  1PSB A;  1BOC A;  1YUS A;  4PHN A;  1M31 A;  1JBA A;  3PLF B;  1FPW A;  3TDZ A;  4CID A;  1XFY O;  1M46 A;  2SAS A;  1M45 A;  2KI6 D;  2F8P A;  2LCP A;  4MVF A;  3SG6 A;  1RK9 A;  2BL0 B;  2KQY A;  1A03 A;  3KHE A;  2K7C A;  3GK4 X;  2PRU A;  5HLO A;  1TNW A;  4C0K A;  1UHH A;  3CLN A;  4WQ2 A;  3SG7 A;  2L51 A;  1KSM A;  2CT9 A;  3HX4 A;  1CLL A;  2LMU A;  4FTG A;  5I8N A;  1WDC B;  1XFZ O;  2MJW B;  1TTX A;  1XFV O;  1SY9 A;  2M3W A;  1SKT A;  4ORC B;  2LP2 A;  1OE9 B;  2ZNE A;  2R2I A;  1TIZ A;  5AAN A;  5CSI A;  1SPY A;  1A2X A;  2JT0 A;  1TRF A;  3OX6 A;  1RTP 1;  2FOT A;  5DKQ A;  3SJS A;  3ZNI A;  1QTX A;  1CMF A;  2KFH A;  1Q80 A;  3CR4 X;  1WLZ A;  2BCA A;  1XA5 A;  3D0Y A;  4YBH B;  1BR1 B;  2ZRS A;  3WNX B;  1AJ4 A;  1YVL A;  1JFJ A;  5G08 A;  1NWD A;  3I5H C;  3OX5 A;  4R1E A;  4DRW A;  1ZAC A;  4C0L A;  4AQJ A;  5ER5 A;  3DVE A;  1DJH A;  2F2P A;  3WHU B;  1S6C A;  1CFP A;  2LE9 B;  3FIA A;  1IG5 A;  3I5G C;  1X02 A;  1CFC A;  4M2O A;  1N65 A;  1B9A A;  4N1F A;  1FBV A;  3EKJ A;  2GGM A;  2WND A;  1DGU A;  1KK8 B;  1S6I A;  2EHB A;  3KEV A;  2K7D A;  4MZK A;  5CPV A;  1LIN A;  3DF0 A;  3EVU A;  4YGB B;  1N2D A;  1A29 A;  1DJZ A;  1VRK A;  1OSA A;  3EKH A;  3A8R A;  3EVV A;  2ISD A;  4AOM A;  1S26 D;  1KSO A;  1OQP A;  3I5H B;  1MWN A;  2HET A;  3OB2 B;  4NQG A;  5KU1 A;  2BCB A;  3I5F C;  1EH2 A;  1J55 A;  5HKY A;  2I18 A;  4C0J A;  1YUT A;  1BF5 A;  3I5G B;  1DJX A;  2V53 A;  4GBA A;  4PE1 A;  1AVS A;  1JFK A;  3JVT C;  4YGE B;  1S36 A;  1L7Z A;  2MA2 A;  2KDH A;  2BKH B;  2NZ0 A;  1MUX A;  1OMV A;  3NSI A;  5IBW A;  3TS5 C;  1DVI A;  2MLE C;  5HKZ A;  1RRO A;  5AXI A;  2O60 A;  1K96 A;  4CPV A;  2LNK A;  3CTN A;  1NCZ A;  3I5F B;  2JOJ A;  1SR6 C;  3BXK A;  4IL1 A;  2K7B A;  2L98 A;  2WOR A;  3JTD B;  2LUX A;  1XFU O;  4DCK A;  2ZFD A;  1SRA A;  1SK6 D;  3IQO A;  3MSE B;  2MBX A;  1FF1 A;  1DMO A;  3SG2 A;  2KAX A;  1JUO A;  3GK2 A;  1NIW A;  1JF2 A;  3HCM A;  3DF0 B;  4QJ5 B;  4BY4 A;  1QJT A;  4PE4 A;  1IJ5 A;  1J7P A;  3VRP A;  1TNP A;  1F4O A;  2JTZ A;  3BUW B;  5DKN A;  2VRG A;  4FQO A;  1OMD A;  1ALW A;  1IQ3 A;  4XJK B;  3NSL A;  2JWW A;  3BUN B;  1TN4 A;  2KBM A;  3LK0 A;  1JSA A;  1UHI A;  1B8L A;  3LL8 B;  3ZWH A;  3KPX A;  1BT6 A;  4OV2 A;  2JXC A;  1JF0 A;  1IH0 A;  1OZO A;  2I7A A;  2EGD A;  1SR6 B;  3A4U B;  3BOW B;  1DGV A;  4ICB A;  2WCB A;  5D69 A;  1B7T Z;  1ZMZ A;  1BG1 A;  1XYD A;  2M1U A;  2M97 A;  1QIW A;  2BEC A;  2M7N A;  3PM8 A;  1SNL A;  1UUR A;  1WDC C;  4WRI A;  1SL8 A;  1TCO B;  4GPL B;  1FI6 A;  1CTR A;  1YUR A;  4F0Z B;  5GQQ C;  1QVI Z;  4P5O E;  3RM1 A;  3VRN A;  2P6B B;  3BUM B;  1OMR A;  1PAL A;  2KFF A;  4ETO A;  1Y1A A;  1XK4 A;  3EVR A;  2LAP A;  1H8B A;  2BKI B;  4DUQ A;  2L4I A;  4OKH A;  1HT9 A;  2AAO A;  1NX1 A;  3E3R A;  4OVN F;  1J7Q A;  3EK4 A;  1QV0 A;  2M1K B;  4HRE E;  1HQV A;  2LVI A;  3IQQ A;  3PAL A;  5KSZ A;  1CKK A;  4CFR A;  2LVJ A;  2ZN9 A;  1AJ5 A;  1CM1 A;  1IKU A;  3VRO A;  2PAL A;  1YRT B;  3NSO A;  2KI4 C;  1BLQ A;  2NCO A;  4U8D A;  2LHI A;  3FWC A;  2HPS A;  2KAY A;  4MLW A;  1KK8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...