2LAPA

Nmr structure of ca2+-bound cabp1 c-domain with rdc
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
70
structure length
70
Chain Sequence
MIGVKELRDAFREFDTNGDGEISTSELREAMRKLLGHQVGHRDIEEIIRDVDLNGDGRVDFEEFVRMMSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Calcium-binding protein 1
publication title 1H, 15N, and 13C chemical shift assignments for CaBP1 with 3 Ca2+ bound
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 14
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2011-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lapA00
2M9GA 3D0YB 2MJWB 4ICBA 1LXFC 1XFWO 1C7VA 1F70A 1DJIA 1XFXO 2HF5A 1KSMA 1KSOA 2WORA 4ORCB 2ZKMX 4OVNF 3BUNB 1X02A 1WRLA 4R1EA 2JZIA 1AJ5A 3DF0A 2K7OA 2OPOA 3OX5A 1DJHA 4C0LA 1A75B 3ICBA 1SRAA 3FIAA 1CFCA 2KDHA 1QLKA 2LC5A 2LNKA 4CLNA 2ZRSA 5KU1A 1QJTA 4WQ3A 2DOQA 3EVUA 3VGOA 1JF2A 1JBAA 1AK8A 3I5HC 1UWOA 1L2OC 4QJ5B 3M0WA 1MXEA 1TIZA 5HYDA 3BXKA 1EG3A 4AQIA 3SG3A 2MRDA 1R2UA 3SG7A 1K8UA 1XO5A 2MBXA 1KK7Y 1G8IA 5J3XA 4CFQA 1QASA 1YUUA 3OHMB 2M8UA 3VROA 4DRWA 2F3YA 1HT9A 2K0JA 5AANA 1WY9A 4USLA 1UHHA 2M97A 3BQ3A 1NIWA 2F8PA 3SG4A 3WHTB 1BODA 1FI5A 3PFVA 1CFFA 2KHNA 5JJGA 1PSRA 1AP4A 3KF9A 5KSZA 3AAJA 4PE7A 2LP3A 3RM1A 4JQ0D 1EH2A 1L2OB 1ZACA 3HX4A 1NX3A 4FTGA 2M3WA 1DMOA 1QV0A 4WRIA 1NWDA 2Q91A 3K21A 1TN4A 1YX8A 3CGAA 3GK2A 2WCEA 1S36A 1XA5A 2JPTA 1PULA 3O2PA 1CFPA 3O78A 2KSPA 2SCPA 3F45A 1LA0A 1QX5B 1ZFSA 1B8RA 2BKIB 2ZN8A 3BUMB 2ISDA 2PALA 2RGIA 2CBLA 2LVIA 3BUXB 2QACA 3NXAA 3SJSA 3PLFB 2PSRA 3LK1A 2BCAA 2K61A 4Q04A 2BBMA 3VRRA 2GGMA 4F0ZB 3JTDC 2GV5A 3JVTC 1AUIB 4C0KA 3D10A 1BLQA 4OV2A 2H61A 4L9MA 1OMDA 1F4QA 1PRWA 1UURA 3BYAA 4DCKA 1S3PA 2KGBC 5PALA 2JNFA 1DJWA 4M2OA 2MHHA 5FYXA 2AMIA 1JFKA 2LHLA 1U5IB 1S6CA 1SL7A 2G9BA 2JT0A 1FPWA 2EC6C 3I5GC 1CKKA 5HKZA 2WCFA 1B8LA 1SPYA 3JVTB 1A29A 4MBEA 1DJGA 3KO0A 1H4BA 1S6JA 1ODBA 3BOWB 4YI9A 2I7AA 3VRNA 2WOSA 1RTP1 3EKHA 1NPQA 3E3RA 1DJZA 1E8AA 2LVVA 1S5GY 2JTZA 4I5NB 1OZSA 4DS7A 1BR1B 2BCXA 3I5IC 3VRQA 1K9PA 2ZRTA 1BMOA 5TNCA 5HLOA 1YVHA 1OSAA 1DT7B 1RWYA 1PVAA 1UUSA 2JNXA 4MRXA 3NSOA 1HQVA 3LL8B 3I5GB 3EKJA 1SW8A 2LVJA 1K9KA 1QIVA 1S1EA 2ZN9A 4YGCB 3A8RA 1WLZA 1CMGA 3OX6A 1YTZC 2KQ6A 1K94A 3CWGA 3EVRA 3H4SE 3ZWHA 1KFXL 3I5IB 2L98A 1SCMC 5F6TA 2M1KB 2Y1NA 1YRUB 1QIWA 1UP5A 1IKUA 1BU3A 4C0JA 1TNQA 1ALVA 2PMYA 2BCBA 1QTXA 4ETOA 1FF1A 1B4CA 1XVJA 2V53A 1J1DA 4OCIA 1YRTB 4P5OE 2I2RE 2L51A 4GAOA 4PHKA 1CFDA 1AJ4A 1F71A 3GK4X 3BUWB 1QVIZ 1SYMA 4GPLB 2HETA 1CDNA 3TZ1A 1SK6D 3TS5C 1YR5A 2LV7A 1DF0A 2MLEC 4DUQA 4UPGA 1SCMB 4ORBB 4PHMA 4PE0A 3I5FC 1ZUZA 4XJKA 5CSIA 1QXPA 1EXRA 4JPZB 1KFUL 1RJVA 1CMFA 2BKHB 1MUXA 2JC2A 2LLTA 3SG2A 2JT8A 4PE4A 1WRZA 1DGUA 1IG5A 4GUKA 1SNLA 1BG1A 3CR2A 1GGWA 1OOJA 1NX1A 1TRFA 4D1EA 2LUXA 2KI4B 3C1VA 5I2OA 2NXQA 1W7JB 4MLWA 2HQ8A 1SY9A 4E68A 3TS5B 2OS8C 1LKJA 2KOTA 2L2EA 1CB1A 2FCEA 1B9AA 1NP8A 3LK0A 3AKBA 3NSKA 4QJ3B 1MHOA 3I5FB 3VRPA 4PDZA 1DJXA 1IH0A 2K2FA 1QS7A 1A75A 1OMRA 4HRGA 2ZNDA 2M49B 1B47A 1XFUO 1TTXA 2H2KA 1J1EA 4MRYA 1C7WA 2O60A 2NCPA 4YGEB 1B7TZ 5ER5A 1RECA 4PHJA 1J55A 3KHEA 2OS8B 1FW4A 1SCVA 1M39A 1NCZA 1KFXS 2FJUB 5HKYA 1LINA 2ZNEA 2IS9A 1WDCC 1A4PA 2WCBA 1RK9A 2JXCA 3IQOA 3O6BA 4BY4A 3RLZA 1F8HA 4YGDB 3A4UB 3TUYC 4P2YB 1Y1XA 2L4IA 1QX7A 1WRKA 2LAPA 1IRJA 1NX0A 2HQWA 1KQMC 2R2IA 3PATA 1AVSA 1Q80A 1VRKA 2BL0C 1ZMZA 1EJ3A 1PK0D 3SIAA 5AEQA 3SG5A 2M1UA 1L7ZA 1SKTA 4A4CA 4HRHA 1WDCB 2JRFA 2Y1MA 1CNPA 1KFUS 1CM1A 3CLNA 1B7TY 4AOMA 3NSIA 1M46A 2L5XB 2KQYA 1UHNA 2WNDA 2KBIA 2JULA 4ZCVA 3TUYB 3SG6A 3QRXA 3LLEA 1J7OA 4YGAA 4MZLA 1KQMB 1NX2A 4JWQA 2KFGA 4PCWA 2M7NA 1NUBA 2BL0B 1ZOTB 1J7PA 1CLBA 1QX2A 2F2PA 1JF0A 5I8NA 2JXLA 2KAXA 4N5XA 5CSNA 2K7CA 1TNXA 4GFTA 5ER4X 3GOFA 3PSRA 2M29A 3PM8A 1PALA 3SIBA 1TCOB 3FS7A 1NCXA 1U5IA 2EHBA 2AAOA 1NYAA 2M0RA 4CFRA 3DF0B 1OQPA 1IQ3A 1CDPA 1LA3A 2K7DA 1XFZO 3DVEA 3DVJA 2WC8A 2KAVA 5HKWA 1H8BA 1B8CA 1CDMA 2VRGA 4IL1A 1IGVA 4N1GA 2LVKA 1AHRA 3ZNIA 5AERA 3KPXA 1IJ6A 2EGDA 2ZFDA 2E30A 2PASA 4XJKB 1J7QA 1M45A 1Y1AA 2BBNA 2JQ6A 1G33A 1MXLC 2KI4C 3WHUB 1KK7Z 4CIDA 1C07A 3IQQA 3WNXB 1JWDA 4N1FA 1WLMA 1K90D 2KNEA 1TNWA 1F4OA 2I18A 2CCMA 1S6IA 1JC2A 1K9UA 2HPSA 4QJ4B 2F33A 4WQ2A 1BF5A 1Y0VH 5D7FA 1MR8A 1OE9B 2KFHA 1M31A 2L50A 2JTTA 2E6WA 2Q4UA 4PALA 3WXAA 1Y1UA 2FCDA 2B1UA 2NLNA 4NQGA 2CNPA 5G08A 2LMTA 1JSAA 2K7BA 1XFYO 2KYCA 1F54A 1MF8B 4OR9B 1QV1A 1OZOA 3HCMA 4PHNA 2H61C 1CLMA 3EVVA 1NCYA 1SL9A 4ZCUA 1RFJA 1JFJA 3D0YA 2JOJA 3CZTX 4NDDA 2SASA 1YUSA 1FBVA 4HSZA 4YI8A 1GGZA 1KK8C 4XYNA 4MZJA 1KWOB 2BE4A 2LCPA 1D1OA 2K8MB 5AFPA 1TCFA 1XYDA 3TDZA 4GGNA 2Y4QA 2M7LA 3PN7C 1MQ1A 2CT9A 1DGVA 1QVIY 3KEVA 5DKNA 1SR6C 4MVFA 4U8DA 5GQQC 1XK4A 2F3ZA 2JT3A 3AKAA 2LLSA 5D69A 3CR5X 1RROA 3OB1B 4AQJA 1PVBA 3CR4X 4GGFA 4I5JA 5I2LA 1YX7A 1EG4A 2LUCA 1K95A 5JOLA 5CSFA 2KI6C 1W7IB 1MWNA 2CXJA 2NZ0A 3I5HB 4DIRA 2MLFC 1KK8B 1V1GA 2A4JA 3DVKA 3IF7A 1PSBA 1UHJA 4GNKB 2L0PA 4I5KA 3TDUA 2JWWA 2KBMA 4MEWA 2PVBA 1UHIA 1QLSA 3PN7B 5IBWA 3OP0A 4M2PA 1SR6B 2KAYA 4MN0A 1M63B 2GGZA 1LVCD 4MZKA 1YUTA 4NDBA 3O4YA 4TNCA 3AAKA 1S5GZ 1YVLA 1V1FA 2JU0A 4PE1A 2G2BA 2L4HA 5DKQA 2AUCA 1J7RA 1SL8A 5AXIA 1UHKA 1YURA 3PALA 3FWCA 1GJYA 2QPTA 1K96A 2KI6D 5DKRA 1A2XA 4MSPA 2TN4A 4I5LB 1G4YR 2F2OA 1BT6A 1CDLA 2LMUA 4OKHA 1SBJA 1A03A 1IQ5A 2K2AA 2KFFA 3CTNA 2COLB 1EL4A 1ALWA 1CM4A 1BOCA 1N2DA 5K89A 3OB2B 1K2HA 2P6BB 5CSJA 3NSLA 1F55A 2KYFA 1XFVO 4NDCA 1IJ5A 2LMVA 4YGBB 1NSHA 3GK1A 3JTDB 2BE6A 2CTNA 2NCOA 2Y5IA 2OTGC 1N65A 1QATA 5I2QA 1N0YA 4YRUA 4A4BA 2FOTA 1JUOA 3MSEB 1K93D 1CTRA 1TNPA 2I94A 2LM5A 1B1GA 3LCPC 2BECA 2LHIA 4M2QA 3TDIA 1KQVA 1BJFA 4HREE 3CS1A 1GQMA 2LP2A 3FWBA 3EK8A 1SMGA 1R6PA 4YBHB 5HLVA 1Y6WA 1TOPA 1BR4B 2D8NA 4FQOA 2KGRA 5CPVA 3DD4A 3BOWA 1DJYA 1DTLA 2EC6B 2O5GA 5BPJA 3EK7A 3EK4A 1DF0B 2OTGB 1DVIA 2LE9B 4GBAA 2MAZA 1KCYA 3BUOB 1CLLA 4CPVA 4ORAB 2MA2A 2LANA 5KTYA 1XK4C 2LLUA 1FI6A 1OMVA 1IWQA 2PRUA 4BY5A 1S26D 5B8IB 1KWOC 4GGFC 3DVMA
chains in the Genus database with same CATH superfamily
2M9GA 3D0YB 2MJWB 4ICBA 1LXFC 1XFWO 1C7VA 1TUZA 1DJIA 1F70A 1XFXO 2HF5A 1KSMA 1KSOA 2WORA 4ORCB 2ZKMX 4OVNF 3BUNB 1X02A 1WRLA 3O4XA 2PQLA 4R1EA 2JZIA 1AJ5A 3DF0A 2K7OA 2OPOA 3OX5A 1DJHA 4C0LA 1A75B 3ICBA 1SRAA 3FIAA 1CFCA 2KDHA 1QLKA 2LC5A 2LNKA 4IJ7A 2ZRSA 4CLNA 5I94A 1QJTA 5KU1A 4WQ3A 2DOQA 3EVUA 3VGOA 1JF2A 1JBAA 1AK8A 3I5HC 3D78A 1UWOA 1L2OC 4QJ5B 3M0WA 1MXEA 1TIZA 5HYDA 3BXKA 1EG3A 4AQIA 3SG3A 2MRDA 1R2UA 3SG7A 1K8UA 1XO5A 2MBXA 1KK7Y 1G8IA 5J3XA 4CFQA 1QASA 1YUUA 3OHMB 2M8UA 1OOGA 3VROA 4DRWA 2F3YA 1HT9A 2K0JA 3BFBA 5AANA 1WY9A 4USLA 1UHHA 2M97A 3BQ3A 1NIWA 2F8PA 3SG4A 3WHTB 1BODA 1FI5A 3PFVA 3NHIA 2KHNA 5JJGA 1PSRA 1AP4A 1CFFA 3NGVA 3KF9A 5KSZA 3AAJA 4PE7A 2LP3A 3RM1A 4JQ0D 1EH2A 1L2OB 1ZACA 3HX4A 4INWA 3PJIA 1NX3A 4FTGA 2M3WA 1DMOA 1QV0A 3RZSA 4WRIA 1NWDA 2Q91A 1QWVA 3K21A 1TN4A 1YX8A 3CGAA 3GK2A 2WCEA 1S36A 1XA5A 2GTEA 2JPTA 1PULA 3O2PA 1CFPA 3O78A 2KSPA 2QEBA 2SCPA 3F45A 1LA0A 1QX5B 1ZFSA 1B8RA 2BKIB 2ZN8A 3BUMB 3S0FA 2ISDA 2PALA 2RGIA 2CBLA 2LVIA 3BUXB 2QACA 3NXAA 3SJSA 3PLFB 2PSRA 3LK1A 2BCAA 2K61A 4Q04A 2BBMA 3VRRA 2GGMA 4F0ZB 3JTDC 2GV5A 3VB1A 3JVTC 4OZDA 1LS8A 1AUIB 2QEVA 4C0KA 3D10A 1BLQA 2BAPA 4OV2A 4F7FA 2H61A 4L9MA 1OMDA 1F4QA 1PRWA 1UURA 3BYAA 4DCKA 1S3PA 2KGBC 5PALA 1SSEB 2JNFA 1DJWA 4M2OA 2MHHA 5FYXA 2AMIA 1JFKA 2K60A 2LHLA 1U5IB 1S6CA 1SL7A 2G9BA 2JT0A 1FPWA 2EC6C 3I5GC 1CKKA 5HKZA 2WCFA 1B8LA 1SPYA 3JVTB 4KYNA 1A29A 3BFHA 4MBEA 1DJGA 3KO0A 1H4BA 1S6JA 1ODBA 3BOWB 4YI9A 2I7AA 3VRNA 2WOSA 1RTP1 3EKHA 1NPQA 2QEHA 3E3RA 1DJZA 1E8AA 2LVVA 1S5GY 2JTZA 3L4AA 1OZSA 4I5NB 4DS7A 1BR1B 1Z2CB 2BCXA 3I5IC 3VRQA 1K9PA 1TWOA 2ZRTA 1BMOA 5TNCA 2WCKA 5HLOA 1YVHA 1OSAA 3CDNA 1RWYA 1DT7B 1PVAA 3SS5A 1UUSA 2JNXA 3Q8IA 3NSOA 4MRXA 1HQVA 3LL8B 3I5GB 3EKJA 1SW8A 2LVJA 1K9KA 1QIVA 1S1EA 2ZN9A 3UNWA 4YGCB 3A8RA 1WLZA 1Z4HA 1CMGA 3OX6A 3R1OA 1YTZC 2KQ6A 1K94A 3CZ0A 3CWGA 3EVRA 3H4SE 3ZWHA 1KFXL 3I5IB 2L98A 1SCMC 5F6TA 2M1KB 2Y1NA 1YRUB 1QIWA 1UP5A 1IKUA 1BU3A 4C0JA 1TNQA 1ALVA 2PMYA 2BCBA 1QTXA 2WC5A 4ETOA 1FF1A 1B4CA 1XVJA 2V53A 1J1DA 4OCIA 1YRTB 4P5OE 2I2RE 2L51A 4GAOA 4PHKA 1CFDA 1AJ4A 1F71A 3GK4X 2KLDA 3BUWB 1QVIZ 1SYMA 4GPLB 2HETA 1CDNA 3TZ1A 1SK6D 3TS5C 2QDIA 1YR5A 2LV7A 1DF0A 2MLEC 4DUQA 4UPGA 1SCMB 4ORBB 4PHMA 4JKTA 3I5FC 1ZUZA 4PE0A 3NHTA 4XJKA 5CSIA 1QXPA 1EXRA 4JPZB 1KFUL 3R1PA 1RJVA 2H8VA 5DICA 1CMFA 2BKHB 1MUXA 2JC2A 2LLTA 3SG2A 2JT8A 4PE4A 1WRZA 3CABA 1DGUA 1IG5A 4GUKA 1SNLA 1BG1A 3CR2A 1GGWA 1OOJA 1NX1A 1TRFA 3S0GA 4D1EA 2LUXA 2KI4B 3C1VA 5I2OA 2NXQA 1W7JB 4MLWA 2HQ8A 1SY9A 4E68A 3D76A 3TS5B 2OS8C 1LKJA 2KOTA 2L2EA 1CB1A 2FCEA 1B9AA 1NP8A 2WCLA 3LK0A 1OW4A 3AKBA 3NSKA 4QJ3B 1MHOA 3I5FB 3VRPA 4PDZA 1DJXA 1IH0A 2K2FA 1QS7A 1A75A 3R1VA 1OMRA 4HRGA 2ZNDA 2M49B 1B47A 1T14A 1XFUO 1TTXA 2H2KA 1J1EA 4MRYA 1C7WA 2QEOA 3OGNA 2O60A 2NCPA 4YGEB 1B7TZ 2WCHA 5ER5A 1RECA 4PHJA 1J55A 3KHEA 2OS8B 1FW4A 1SCVA 1M39A 3UO9A 1NCZA 1DEKA 1KFXS 2FJUB 5HKYA 1LINA 2BNXA 3D74A 2ZNEA 2IS9A 1WDCC 1A4PA 2WCBA 1RK9A 3B87A 2JXCA 3IQOA 3O6BA 4BY4A 3RLZA 1F8HA 4YGDB 3A4UB 3TUYC 4P2YB 1Y1XA 2L4IA 1QX7A 1WRKA 2LAPA 3DZTA 3BJHA 1IRJA 1NX0A 2HQWA 1KQMC 2R2IA 3PATA 1AVSA 1Q80A 1VRKA 2BL0C 1ZMZA 1EJ3A 1PK0D 3SIAA 3R72A 5AEQA 1ORGA 3SG5A 3IVTA 2M1UA 1L7ZA 1SKTA 4A4CA 4HRHA 1WDCB 3QMEA 2JRFA 2Y1MA 1CNPA 1KFUS 1CM1A 3CLNA 1B7TY 4AOMA 3L4LA 1M46A 2L5XB 2KQYA 1UHNA 2WNDA 2KBIA 2JULA 3NSIA 4ZCVA 3TUYB 3B7AA 3SG6A 3QRXA 3LLEA 1J7OA 4YGAA 4MZLA 1KQMB 1NX2A 4JWQA 2KFGA 4PCWA 2M7NA 1NUBA 2BL0B 1ZOTB 1J7PA 1CLBA 1QX2A 2F2PA 1JF0A 5I8NA 2JXLA 2KAXA 4N5XA 1IIOA 5CSNA 2K7CA 1TNXA 4GFTA 4JD9A 5ER4X 4INXA 2L5YA 3GOFA 3PSRA 2M29A 3PM8A 1PALA 3SIBA 4FQTA 1TCOB 3FS7A 1NCXA 4PT1A 1TUJA 1U5IA 2WC6A 1GM0A 2EHBA 2AAOA 1NYAA 2M0RA 4CFRA 5EL2A 3DXLA 3DF0B 3S0DA 1OQPA 3BFAA 1IQ3A 1CDPA 1LA3A 2K7DA 1XFZO 3DVEA 3DVJA 2WC8A 2KAVA 5HKWA 1H8BA 1B8CA 1CDMA 2VRGA 4IL1A 1IGVA 4N1GA 2LVKA 1AHRA 5FI6A 3D77A 3ZNIA 5AERA 3KPXA 1IJ6A 2EGDA 2WCJA 2E30A 2PASA 2ZFDA 4XJKB 1J7QA 1M45A 1Y1AA 2BBNA 2JQ6A 1G33A 1MXLC 2KI4C 3WHUB 1KK7Z 4CIDA 2P71A 1C07A 3IQQA 3WNXB 1JWDA 4N1FA 1WLMA 1XFRA 1K90D 2KNEA 1TNWA 1F4OA 2I18A 2CCMA 1S6IA 1JC2A 1K9UA 2ERBA 2HPSA 2F33A 4WQ2A 4QJ4B 1Y0VH 5D7FA 1MR8A 1OE9B 2KFHA 1M31A 2L50A 1BF5A 2JTTA 2E6WA 2Q4UA 4PALA 3WXAA 1Y1UA 2FCDA 2B1UA 2NLNA 4NQGA 2CNPA 5D3OA 2JPOA 1OOFA 2LMTA 5G08A 1JSAA 2K7BA 1XFYO 2KYCA 3DY9A 1F54A 1W9ZA 3S0AA 1MF8B 4OR9B 3S0BA 1QV1A 1OZOA 3HCMA 4PHNA 1P28A 2H61C 1CLMA 3EVVA 1NCYA 1SL9A 4ZCUA 1RFJA 1JFJA 3D0YA 2JOJA 3CZTX 4NDDA 2SASA 1YUSA 1FBVA 4HSZA 4YI8A 1GGZA 1KK8C 4XYNA 4MZJA 1KWOB 2BE4A 2LCPA 1D1OA 2K8MB 3FE8A 1TCFA 1XYDA 3TDZA 5AFPA 4GGNA 2Y4QA 3SS3A 2M7LA 2PYQA 3PN7C 1MQ1A 2CT9A 1DGVA 1QVIY 3KEVA 5DKNA 1SR6C 4MVFA 4U8DA 1DELA 5GQQC 1XK4A 2F3ZA 2JT3A 3AKAA 2LLSA 5D69A 5FI2A 3FE9A 3V2LA 3CR5X 1RROA 3OB1B 4AQJA 1PVBA 3CR4X 3CYZA 4GGFA 4I5JA 5I2LA 1YX7A 1EG4A 2LUCA 1K95A 5JOLA 3FE6A 5CSFA 2KI6C 3B86A 1W7IB 1MWNA 2CXJA 2NZ0A 3I5HB 4DIRA 2MLFC 2WCMA 1KK8B 1V1GA 2A4JA 3DVKA 3IF7A 1PSBA 1UHJA 4GNKB 2L0PA 4I5KA 3TDUA 2JWWA 3DYEA 2KBMA 4MEWA 2PVBA 1UHIA 1QLSA 3PN7B 2L2CA 5FI7A 3EG5B 5IBWA 3B6XA 3OP0A 4M2PA 2KLEA 1C3ZA 1SR6B 2KAYA 1C3YA 4MN0A 1OOIX 1M63B 2GGZA 1LVCD 4MZKA 1YUTA 4NDBA 3O4YA 4TNCA 3AAKA 1S5GZ 1YVLA 1V1FA 2JU0A 4PE1A 2G2BA 2L4HA 5DKQA 2AUCA 1J7RA 1SL8A 5AXIA 1UHKA 1YURA 3PALA 3FWCA 1GJYA 2QPTA 1K96A 2KI6D 5DKRA 1A2XA 3D73A 2TN4A 4MSPA 5HL1A 4I5LB 1G4YR 2F2OA 1BT6A 1CDLA 2LMUA 4OKHA 1SBJA 1A03A 1DC1A 1IQ5A 2K2AA 2KFFA 3CTNA 2COLB 1EL4A 1ALWA 3N7HA 1CM4A 1BOCA 1N2DA 3K1EA 5K89A 3OB2B 1K2HA 2P6BB 5CSJA 3NSLA 1F55A 2KYFA 1OOHA 1XFVO 4NDCA 1IJ5A 2LMVA 4YGBB 1NSHA 3GK1A 3JTDB 3PM2A 2BE6A 2CTNA 2NCOA 2Y5IA 2OTGC 1N65A 1QATA 2YGUA 5I2QA 1N0YA 4YRUA 4A4BA 2FOTA 1JUOA 3MSEB 3CZ1A 1K93D 1CTRA 1TNPA 2I94A 2LM5A 1B1GA 3LCPC 2BECA 2LHIA 4M2QA 3TDIA 1KQVA 1BJFA 4HREE 3CS1A 1GQMA 2LP2A 3FWBA 3EK8A 1SMGA 1R6PA 2KPHA 4YBHB 5HLVA 1Y6WA 1TOPA 1BR4B 2D8NA 4FQOA 2P70A 2KGRA 5CPVA 3DD4A 3BOWA 1DJYA 1DTLA 2EC6B 2O5GA 3S0EA 5BPJA 3EK7A 3EK4A 1DF0B 3OBVA 2OTGB 3SS4A 1DVIA 2LE9B 4GBAA 3D75A 3CZ2A 2MAZA 1KCYA 3B88A 3BUOB 1CLLA 4CPVA 4ORAB 2MA2A 2LANA 5KTYA 1XK4C 3L47A 2LLUA 1FI6A 1DQEA 1IWQA 1OMVA 2PRUA 2FJYA 4BY5A 1S26D 5B8IB 1KWOC 4GGFC 3DVMA
chains in the Genus database with same CATH topology
2M9GA 3D0YB 2MJWB 4ICBA 1LXFC 1XFWO 1C7VA 1F70A 1DJIA 1XFXO 2HF5A 1KSMA 1KSOA 2WORA 4ORCB 2ZKMX 4OVNF 3BUNB 1X02A 1WRLA 4R1EA 2JZIA 1AJ5A 3DF0A 2K7OA 2OPOA 3OX5A 1DJHA 4C0LA 1A75B 3ICBA 1SRAA 3FIAA 1CFCA 2KDHA 1QLKA 2LC5A 2LNKA 4CLNA 2ZRSA 5KU1A 1QJTA 4WQ3A 2DOQA 3EVUA 3VGOA 1JF2A 1JBAA 1AK8A 3I5HC 1UWOA 1L2OC 4QJ5B 3M0WA 1MXEA 1TIZA 5HYDA 3BXKA 1EG3A 4AQIA 3SG3A 2MRDA 1R2UA 3SG7A 1K8UA 1XO5A 2MBXA 1KK7Y 1G8IA 5J3XA 4CFQA 1QASA 1YUUA 3OHMB 2M8UA 3VROA 4DRWA 2F3YA 1HT9A 2K0JA 5AANA 1WY9A 4USLA 1UHHA 2M97A 3BQ3A 1NIWA 2F8PA 3SG4A 3WHTB 1BODA 1FI5A 3PFVA 1CFFA 2KHNA 5JJGA 1PSRA 1AP4A 3KF9A 5KSZA 3AAJA 4PE7A 2LP3A 3RM1A 4JQ0D 1EH2A 1L2OB 1ZACA 3HX4A 1NX3A 4FTGA 2M3WA 1DMOA 1QV0A 4WRIA 1NWDA 2Q91A 3K21A 1TN4A 1YX8A 3CGAA 3GK2A 2WCEA 1S36A 1XA5A 2JPTA 1PULA 3O2PA 1CFPA 3O78A 2KSPA 2SCPA 3F45A 1LA0A 1QX5B 1ZFSA 1B8RA 2BKIB 2ZN8A 3BUMB 2ISDA 2PALA 2RGIA 2CBLA 2LVIA 3BUXB 2QACA 3NXAA 3SJSA 3PLFB 2PSRA 3LK1A 2BCAA 2K61A 4Q04A 2BBMA 3VRRA 2GGMA 4F0ZB 3JTDC 2GV5A 3JVTC 1AUIB 4C0KA 3D10A 1BLQA 4OV2A 2H61A 4L9MA 1OMDA 1F4QA 1PRWA 1UURA 3BYAA 4DCKA 1S3PA 2KGBC 5PALA 2JNFA 1DJWA 4M2OA 2MHHA 5FYXA 2AMIA 1JFKA 2LHLA 1U5IB 1S6CA 1SL7A 2G9BA 2JT0A 1FPWA 2EC6C 3I5GC 1CKKA 5HKZA 2WCFA 1B8LA 1SPYA 3JVTB 1A29A 4MBEA 1DJGA 3KO0A 1H4BA 1S6JA 1ODBA 3BOWB 4YI9A 2I7AA 3VRNA 2WOSA 1RTP1 3EKHA 1NPQA 3E3RA 1DJZA 1E8AA 2LVVA 1S5GY 2JTZA 4I5NB 1OZSA 4DS7A 1BR1B 2BCXA 3I5IC 3VRQA 1K9PA 2ZRTA 1BMOA 5TNCA 5HLOA 1YVHA 1OSAA 1DT7B 1RWYA 1PVAA 1UUSA 2JNXA 4MRXA 3NSOA 1HQVA 3LL8B 3I5GB 3EKJA 1SW8A 2LVJA 1K9KA 1QIVA 1S1EA 2ZN9A 4YGCB 3A8RA 1WLZA 1CMGA 3OX6A 1YTZC 2KQ6A 1K94A 3CWGA 3EVRA 3H4SE 3ZWHA 1KFXL 3I5IB 2L98A 1SCMC 5F6TA 2M1KB 2Y1NA 1YRUB 1QIWA 1UP5A 1IKUA 1BU3A 4C0JA 1TNQA 1ALVA 2PMYA 2BCBA 1QTXA 4ETOA 1FF1A 1B4CA 1XVJA 2V53A 1J1DA 4OCIA 1YRTB 4P5OE 2I2RE 2L51A 4GAOA 4PHKA 1CFDA 1AJ4A 1F71A 3GK4X 3BUWB 1QVIZ 1SYMA 4GPLB 2HETA 1CDNA 3TZ1A 1SK6D 3TS5C 1YR5A 2LV7A 1DF0A 2MLEC 4DUQA 4UPGA 1SCMB 4ORBB 4PHMA 4PE0A 3I5FC 1ZUZA 4XJKA 5CSIA 1QXPA 1EXRA 4JPZB 1KFUL 1RJVA 1CMFA 2BKHB 1MUXA 2JC2A 2LLTA 3SG2A 2JT8A 4PE4A 1WRZA 1DGUA 1IG5A 4GUKA 1SNLA 1BG1A 3CR2A 1GGWA 1OOJA 1NX1A 1TRFA 4D1EA 2LUXA 2KI4B 3C1VA 5I2OA 2NXQA 1W7JB 4MLWA 2HQ8A 1SY9A 4E68A 3TS5B 2OS8C 1LKJA 2KOTA 2L2EA 1CB1A 2FCEA 1B9AA 1NP8A 3LK0A 3AKBA 3NSKA 4QJ3B 1MHOA 3I5FB 3VRPA 4PDZA 1DJXA 1IH0A 2K2FA 1QS7A 1A75A 1OMRA 4HRGA 2ZNDA 2M49B 1B47A 1XFUO 1TTXA 2H2KA 1J1EA 4MRYA 1C7WA 2O60A 2NCPA 4YGEB 1B7TZ 5ER5A 1RECA 4PHJA 1J55A 3KHEA 2OS8B 1FW4A 1SCVA 1M39A 1NCZA 1KFXS 2FJUB 5HKYA 1LINA 2ZNEA 2IS9A 1WDCC 1A4PA 2WCBA 1RK9A 2JXCA 3IQOA 3O6BA 4BY4A 3RLZA 1F8HA 4YGDB 3A4UB 3TUYC 4P2YB 1Y1XA 2L4IA 1QX7A 1WRKA 2LAPA 1IRJA 1NX0A 2HQWA 1KQMC 2R2IA 3PATA 1AVSA 1Q80A 1VRKA 2BL0C 1ZMZA 1EJ3A 1PK0D 3SIAA 5AEQA 3SG5A 2M1UA 1L7ZA 1SKTA 4A4CA 4HRHA 1WDCB 2JRFA 2Y1MA 1CNPA 1KFUS 1CM1A 3CLNA 1B7TY 4AOMA 3NSIA 1M46A 2L5XB 2KQYA 1UHNA 2WNDA 2KBIA 2JULA 4ZCVA 3TUYB 3SG6A 3QRXA 3LLEA 1J7OA 4YGAA 4MZLA 1KQMB 1NX2A 4JWQA 2KFGA 4PCWA 2M7NA 1NUBA 2BL0B 1ZOTB 1J7PA 1CLBA 1QX2A 2F2PA 1JF0A 5I8NA 2JXLA 2KAXA 4N5XA 5CSNA 2K7CA 1TNXA 4GFTA 5ER4X 3GOFA 3PSRA 2M29A 3PM8A 1PALA 3SIBA 1TCOB 3FS7A 1NCXA 1U5IA 2EHBA 2AAOA 1NYAA 2M0RA 4CFRA 3DF0B 1OQPA 1IQ3A 1CDPA 1LA3A 2K7DA 1XFZO 3DVEA 3DVJA 2WC8A 2KAVA 5HKWA 1H8BA 1B8CA 1CDMA 2VRGA 4IL1A 1IGVA 4N1GA 2LVKA 1AHRA 3ZNIA 5AERA 3KPXA 1IJ6A 2EGDA 2ZFDA 2E30A 2PASA 4XJKB 1J7QA 1M45A 1Y1AA 2BBNA 2JQ6A 1G33A 1MXLC 2KI4C 3WHUB 1KK7Z 4CIDA 1C07A 3IQQA 3WNXB 1JWDA 4N1FA 1WLMA 1K90D 2KNEA 1TNWA 1F4OA 2I18A 2CCMA 1S6IA 1JC2A 1K9UA 2HPSA 4QJ4B 2F33A 4WQ2A 1BF5A 1Y0VH 5D7FA 1MR8A 1OE9B 2KFHA 1M31A 2L50A 2JTTA 2E6WA 2Q4UA 4PALA 3WXAA 1Y1UA 2FCDA 2B1UA 2NLNA 4NQGA 2CNPA 5G08A 2LMTA 1JSAA 2K7BA 1XFYO 2KYCA 1F54A 1MF8B 4OR9B 1QV1A 1OZOA 3HCMA 4PHNA 2H61C 1CLMA 3EVVA 1NCYA 1SL9A 4ZCUA 1RFJA 1JFJA 3D0YA 2JOJA 3CZTX 4NDDA 2SASA 1YUSA 1FBVA 4HSZA 4YI8A 1GGZA 1KK8C 4XYNA 4MZJA 1KWOB 2BE4A 2LCPA 1D1OA 2K8MB 5AFPA 1TCFA 1XYDA 3TDZA 4GGNA 2Y4QA 2M7LA 3PN7C 1MQ1A 2CT9A 1DGVA 1QVIY 3KEVA 5DKNA 1SR6C 4MVFA 4U8DA 5GQQC 1XK4A 2F3ZA 2JT3A 3AKAA 2LLSA 5D69A 3CR5X 1RROA 3OB1B 4AQJA 1PVBA 3CR4X 4GGFA 4I5JA 5I2LA 1YX7A 1EG4A 2LUCA 1K95A 5JOLA 5CSFA 2KI6C 1W7IB 1MWNA 2CXJA 2NZ0A 3I5HB 4DIRA 2MLFC 1KK8B 1V1GA 2A4JA 3DVKA 3IF7A 1PSBA 1UHJA 4GNKB 2L0PA 4I5KA 3TDUA 2JWWA 2KBMA 4MEWA 2PVBA 1UHIA 1QLSA 3PN7B 5IBWA 3OP0A 4M2PA 1SR6B 2KAYA 4MN0A 1M63B 2GGZA 1LVCD 4MZKA 1YUTA 4NDBA 3O4YA 4TNCA 3AAKA 1S5GZ 1YVLA 1V1FA 2JU0A 4PE1A 2G2BA 2L4HA 5DKQA 2AUCA 1J7RA 1SL8A 5AXIA 1UHKA 1YURA 3PALA 3FWCA 1GJYA 2QPTA 1K96A 2KI6D 5DKRA 1A2XA 4MSPA 2TN4A 4I5LB 1G4YR 2F2OA 1BT6A 1CDLA 2LMUA 4OKHA 1SBJA 1A03A 1IQ5A 2K2AA 2KFFA 3CTNA 2COLB 1EL4A 1ALWA 1CM4A 1BOCA 1N2DA 5K89A 3OB2B 1K2HA 2P6BB 5CSJA 3NSLA 1F55A 2KYFA 1XFVO 4NDCA 1IJ5A 2LMVA 4YGBB 1NSHA 3GK1A 3JTDB 2BE6A 2CTNA 2NCOA 2Y5IA 2OTGC 1N65A 1QATA 5I2QA 1N0YA 4YRUA 4A4BA 2FOTA 1JUOA 3MSEB 1K93D 1CTRA 1TNPA 2I94A 2LM5A 1B1GA 3LCPC 2BECA 2LHIA 4M2QA 3TDIA 1KQVA 1BJFA 4HREE 3CS1A 1GQMA 2LP2A 3FWBA 3EK8A 1SMGA 1R6PA 4YBHB 5HLVA 1Y6WA 1TOPA 1BR4B 2D8NA 4FQOA 2KGRA 5CPVA 3DD4A 3BOWA 1DJYA 1DTLA 2EC6B 2O5GA 5BPJA 3EK7A 3EK4A 1DF0B 2OTGB 1DVIA 2LE9B 4GBAA 2MAZA 1KCYA 3BUOB 1CLLA 4CPVA 4ORAB 2MA2A 2LANA 5KTYA 1XK4C 2LLUA 1FI6A 1OMVA 1IWQA 2PRUA 4BY5A 1S26D 5B8IB 1KWOC 4GGFC 3DVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M9G A;  3D0Y B;  2MJW B;  4ICB A;  1LXF C;  1XFW O;  1C7V A;  1F70 A;  1DJI A;  1XFX O;  2HF5 A;  1KSM A;  1KSO A;  2WOR A;  4ORC B;  2ZKM X;  4OVN F;  3BUN B;  1X02 A;  1WRL A;  4R1E A;  2JZI A;  1AJ5 A;  3DF0 A;  2K7O A;  2OPO A;  3OX5 A;  1DJH A;  4C0L A;  1A75 B;  3ICB A;  1SRA A;  3FIA A;  1CFC A;  2KDH A;  1QLK A;  2LC5 A;  2LNK A;  4CLN A;  2ZRS A;  5KU1 A;  1QJT A;  4WQ3 A;  2DOQ A;  3EVU A;  3VGO A;  1JF2 A;  1JBA A;  1AK8 A;  3I5H C;  1UWO A;  1L2O C;  4QJ5 B;  3M0W A;  1MXE A;  1TIZ A;  5HYD A;  3BXK A;  1EG3 A;  4AQI A;  3SG3 A;  2MRD A;  1R2U A;  3SG7 A;  1K8U A;  1XO5 A;  2MBX A;  1KK7 Y;  1G8I A;  5J3X A;  4CFQ A;  1QAS A;  1YUU A;  3OHM B;  2M8U A;  3VRO A;  4DRW A;  2F3Y A;  1HT9 A;  2K0J A;  5AAN A;  1WY9 A;  4USL A;  1UHH A;  2M97 A;  3BQ3 A;  1NIW A;  2F8P A;  3SG4 A;  3WHT B;  1BOD A;  1FI5 A;  3PFV A;  1CFF A;  2KHN A;  5JJG A;  1PSR A;  1AP4 A;  3KF9 A;  5KSZ A;  3AAJ A;  4PE7 A;  2LP3 A;  3RM1 A;  4JQ0 D;  1EH2 A;  1L2O B;  1ZAC A;  3HX4 A;  1NX3 A;  4FTG A;  2M3W A;  1DMO A;  1QV0 A;  4WRI A;  1NWD A;  2Q91 A;  3K21 A;  1TN4 A;  1YX8 A;  3CGA A;  3GK2 A;  2WCE A;  1S36 A;  1XA5 A;  2JPT A;  1PUL A;  3O2P A;  1CFP A;  3O78 A;  2KSP A;  2SCP A;  3F45 A;  1LA0 A;  1QX5 B;  1ZFS A;  1B8R A;  2BKI B;  2ZN8 A;  3BUM B;  2ISD A;  2PAL A;  2RGI A;  2CBL A;  2LVI A;  3BUX B;  2QAC A;  3NXA A;  3SJS A;  3PLF B;  2PSR A;  3LK1 A;  2BCA A;  2K61 A;  4Q04 A;  2BBM A;  3VRR A;  2GGM A;  4F0Z B;  3JTD C;  2GV5 A;  3JVT C;  1AUI B;  4C0K A;  3D10 A;  1BLQ A;  4OV2 A;  2H61 A;  4L9M A;  1OMD A;  1F4Q A;  1PRW A;  1UUR A;  3BYA A;  4DCK A;  1S3P A;  2KGB C;  5PAL A;  2JNF A;  1DJW A;  4M2O A;  2MHH A;  5FYX A;  2AMI A;  1JFK A;  2LHL A;  1U5I B;  1S6C A;  1SL7 A;  2G9B A;  2JT0 A;  1FPW A;  2EC6 C;  3I5G C;  1CKK A;  5HKZ A;  2WCF A;  1B8L A;  1SPY A;  3JVT B;  1A29 A;  4MBE A;  1DJG A;  3KO0 A;  1H4B A;  1S6J A;  1ODB A;  3BOW B;  4YI9 A;  2I7A A;  3VRN A;  2WOS A;  1RTP 1;  3EKH A;  1NPQ A;  3E3R A;  1DJZ A;  1E8A A;  2LVV A;  1S5G Y;  2JTZ A;  4I5N B;  1OZS A;  4DS7 A;  1BR1 B;  2BCX A;  3I5I C;  3VRQ A;  1K9P A;  2ZRT A;  1BMO A;  5TNC A;  5HLO A;  1YVH A;  1OSA A;  1DT7 B;  1RWY A;  1PVA A;  1UUS A;  2JNX A;  4MRX A;  3NSO A;  1HQV A;  3LL8 B;  3I5G B;  3EKJ A;  1SW8 A;  2LVJ A;  1K9K A;  1QIV A;  1S1E A;  2ZN9 A;  4YGC B;  3A8R A;  1WLZ A;  1CMG A;  3OX6 A;  1YTZ C;  2KQ6 A;  1K94 A;  3CWG A;  3EVR A;  3H4S E;  3ZWH A;  1KFX L;  3I5I B;  2L98 A;  1SCM C;  5F6T A;  2M1K B;  2Y1N A;  1YRU B;  1QIW A;  1UP5 A;  1IKU A;  1BU3 A;  4C0J A;  1TNQ A;  1ALV A;  2PMY A;  2BCB A;  1QTX A;  4ETO A;  1FF1 A;  1B4C A;  1XVJ A;  2V53 A;  1J1D A;  4OCI A;  1YRT B;  4P5O E;  2I2R E;  2L51 A;  4GAO A;  4PHK A;  1CFD A;  1AJ4 A;  1F71 A;  3GK4 X;  3BUW B;  1QVI Z;  1SYM A;  4GPL B;  2HET A;  1CDN A;  3TZ1 A;  1SK6 D;  3TS5 C;  1YR5 A;  2LV7 A;  1DF0 A;  2MLE C;  4DUQ A;  4UPG A;  1SCM B;  4ORB B;  4PHM A;  4PE0 A;  3I5F C;  1ZUZ A;  4XJK A;  5CSI A;  1QXP A;  1EXR A;  4JPZ B;  1KFU L;  1RJV A;  1CMF A;  2BKH B;  1MUX A;  2JC2 A;  2LLT A;  3SG2 A;  2JT8 A;  4PE4 A;  1WRZ A;  1DGU A;  1IG5 A;  4GUK A;  1SNL A;  1BG1 A;  3CR2 A;  1GGW A;  1OOJ A;  1NX1 A;  1TRF A;  4D1E A;  2LUX A;  2KI4 B;  3C1V A;  5I2O A;  2NXQ A;  1W7J B;  4MLW A;  2HQ8 A;  1SY9 A;  4E68 A;  3TS5 B;  2OS8 C;  1LKJ A;  2KOT A;  2L2E A;  1CB1 A;  2FCE A;  1B9A A;  1NP8 A;  3LK0 A;  3AKB A;  3NSK A;  4QJ3 B;  1MHO A;  3I5F B;  3VRP A;  4PDZ A;  1DJX A;  1IH0 A;  2K2F A;  1QS7 A;  1A75 A;  1OMR A;  4HRG A;  2ZND A;  2M49 B;  1B47 A;  1XFU O;  1TTX A;  2H2K A;  1J1E A;  4MRY A;  1C7W A;  2O60 A;  2NCP A;  4YGE B;  1B7T Z;  5ER5 A;  1REC A;  4PHJ A;  1J55 A;  3KHE A;  2OS8 B;  1FW4 A;  1SCV A;  1M39 A;  1NCZ A;  1KFX S;  2FJU B;  5HKY A;  1LIN A;  2ZNE A;  2IS9 A;  1WDC C;  1A4P A;  2WCB A;  1RK9 A;  2JXC A;  3IQO A;  3O6B A;  4BY4 A;  3RLZ A;  1F8H A;  4YGD B;  3A4U B;  3TUY C;  4P2Y B;  1Y1X A;  2L4I A;  1QX7 A;  1WRK A;  2LAP A;  1IRJ A;  1NX0 A;  2HQW A;  1KQM C;  2R2I A;  3PAT A;  1AVS A;  1Q80 A;  1VRK A;  2BL0 C;  1ZMZ A;  1EJ3 A;  1PK0 D;  3SIA A;  5AEQ A;  3SG5 A;  2M1U A;  1L7Z A;  1SKT A;  4A4C A;  4HRH A;  1WDC B;  2JRF A;  2Y1M A;  1CNP A;  1KFU S;  1CM1 A;  3CLN A;  1B7T Y;  4AOM A;  3NSI A;  1M46 A;  2L5X B;  2KQY A;  1UHN A;  2WND A;  2KBI A;  2JUL A;  4ZCV A;  3TUY B;  3SG6 A;  3QRX A;  3LLE A;  1J7O A;  4YGA A;  4MZL A;  1KQM B;  1NX2 A;  4JWQ A;  2KFG A;  4PCW A;  2M7N A;  1NUB A;  2BL0 B;  1ZOT B;  1J7P A;  1CLB A;  1QX2 A;  2F2P A;  1JF0 A;  5I8N A;  2JXL A;  2KAX A;  4N5X A;  5CSN A;  2K7C A;  1TNX A;  4GFT A;  5ER4 X;  3GOF A;  3PSR A;  2M29 A;  3PM8 A;  1PAL A;  3SIB A;  1TCO B;  3FS7 A;  1NCX A;  1U5I A;  2EHB A;  2AAO A;  1NYA A;  2M0R A;  4CFR A;  3DF0 B;  1OQP A;  1IQ3 A;  1CDP A;  1LA3 A;  2K7D A;  1XFZ O;  3DVE A;  3DVJ A;  2WC8 A;  2KAV A;  5HKW A;  1H8B A;  1B8C A;  1CDM A;  2VRG A;  4IL1 A;  1IGV A;  4N1G A;  2LVK A;  1AHR A;  3ZNI A;  5AER A;  3KPX A;  1IJ6 A;  2EGD A;  2ZFD A;  2E30 A;  2PAS A;  4XJK B;  1J7Q A;  1M45 A;  1Y1A A;  2BBN A;  2JQ6 A;  1G33 A;  1MXL C;  2KI4 C;  3WHU B;  1KK7 Z;  4CID A;  1C07 A;  3IQQ A;  3WNX B;  1JWD A;  4N1F A;  1WLM A;  1K90 D;  2KNE A;  1TNW A;  1F4O A;  2I18 A;  2CCM A;  1S6I A;  1JC2 A;  1K9U A;  2HPS A;  4QJ4 B;  2F33 A;  4WQ2 A;  1BF5 A;  1Y0V H;  5D7F A;  1MR8 A;  1OE9 B;  2KFH A;  1M31 A;  2L50 A;  2JTT A;  2E6W A;  2Q4U A;  4PAL A;  3WXA A;  1Y1U A;  2FCD A;  2B1U A;  2NLN A;  4NQG A;  2CNP A;  5G08 A;  2LMT A;  1JSA A;  2K7B A;  1XFY O;  2KYC A;  1F54 A;  1MF8 B;  4OR9 B;  1QV1 A;  1OZO A;  3HCM A;  4PHN A;  2H61 C;  1CLM A;  3EVV A;  1NCY A;  1SL9 A;  4ZCU A;  1RFJ A;  1JFJ A;  3D0Y A;  2JOJ A;  3CZT X;  4NDD A;  2SAS A;  1YUS A;  1FBV A;  4HSZ A;  4YI8 A;  1GGZ A;  1KK8 C;  4XYN A;  4MZJ A;  1KWO B;  2BE4 A;  2LCP A;  1D1O A;  2K8M B;  5AFP A;  1TCF A;  1XYD A;  3TDZ A;  4GGN A;  2Y4Q A;  2M7L A;  3PN7 C;  1MQ1 A;  2CT9 A;  1DGV A;  1QVI Y;  3KEV A;  5DKN A;  1SR6 C;  4MVF A;  4U8D A;  5GQQ C;  1XK4 A;  2F3Z A;  2JT3 A;  3AKA A;  2LLS A;  5D69 A;  3CR5 X;  1RRO A;  3OB1 B;  4AQJ A;  1PVB A;  3CR4 X;  4GGF A;  4I5J A;  5I2L A;  1YX7 A;  1EG4 A;  2LUC A;  1K95 A;  5JOL A;  5CSF A;  2KI6 C;  1W7I B;  1MWN A;  2CXJ A;  2NZ0 A;  3I5H B;  4DIR A;  2MLF C;  1KK8 B;  1V1G A;  2A4J A;  3DVK A;  3IF7 A;  1PSB A;  1UHJ A;  4GNK B;  2L0P A;  4I5K A;  3TDU A;  2JWW A;  2KBM A;  4MEW A;  2PVB A;  1UHI A;  1QLS A;  3PN7 B;  5IBW A;  3OP0 A;  4M2P A;  1SR6 B;  2KAY A;  4MN0 A;  1M63 B;  2GGZ A;  1LVC D;  4MZK A;  1YUT A;  4NDB A;  3O4Y A;  4TNC A;  3AAK A;  1S5G Z;  1YVL A;  1V1F A;  2JU0 A;  4PE1 A;  2G2B A;  2L4H A;  5DKQ A;  2AUC A;  1J7R A;  1SL8 A;  5AXI A;  1UHK A;  1YUR A;  3PAL A;  3FWC A;  1GJY A;  2QPT A;  1K96 A;  2KI6 D;  5DKR A;  1A2X A;  4MSP A;  2TN4 A;  4I5L B;  1G4Y R;  2F2O A;  1BT6 A;  1CDL A;  2LMU A;  4OKH A;  1SBJ A;  1A03 A;  1IQ5 A;  2K2A A;  2KFF A;  3CTN A;  2COL B;  1EL4 A;  1ALW A;  1CM4 A;  1BOC A;  1N2D A;  5K89 A;  3OB2 B;  1K2H A;  2P6B B;  5CSJ A;  3NSL A;  1F55 A;  2KYF A;  1XFV O;  4NDC A;  1IJ5 A;  2LMV A;  4YGB B;  1NSH A;  3GK1 A;  3JTD B;  2BE6 A;  2CTN A;  2NCO A;  2Y5I A;  2OTG C;  1N65 A;  1QAT A;  5I2Q A;  1N0Y A;  4YRU A;  4A4B A;  2FOT A;  1JUO A;  3MSE B;  1K93 D;  1CTR A;  1TNP A;  2I94 A;  2LM5 A;  1B1G A;  3LCP C;  2BEC A;  2LHI A;  4M2Q A;  3TDI A;  1KQV A;  1BJF A;  4HRE E;  3CS1 A;  1GQM A;  2LP2 A;  3FWB A;  3EK8 A;  1SMG A;  1R6P A;  4YBH B;  5HLV A;  1Y6W A;  1TOP A;  1BR4 B;  2D8N A;  4FQO A;  2KGR A;  5CPV A;  3DD4 A;  3BOW A;  1DJY A;  1DTL A;  2EC6 B;  2O5G A;  5BPJ A;  3EK7 A;  3EK4 A;  1DF0 B;  2OTG B;  1DVI A;  2LE9 B;  4GBA A;  2MAZ A;  1KCY A;  3BUO B;  1CLL A;  4CPV A;  4ORA B;  2MA2 A;  2LAN A;  5KTY A;  1XK4 C;  2LLU A;  1FI6 A;  1OMV A;  1IWQ A;  2PRU A;  4BY5 A;  1S26 D;  5B8I B;  1KWO C;  4GGF C;  3DVM A; 
#chains in the Genus database with same CATH topology
 2M9G A;  3D0Y B;  2MJW B;  4ICB A;  1LXF C;  1XFW O;  1C7V A;  1TUZ A;  1DJI A;  1F70 A;  1XFX O;  2HF5 A;  1KSM A;  1KSO A;  2WOR A;  4ORC B;  2ZKM X;  4OVN F;  3BUN B;  1X02 A;  1WRL A;  3O4X A;  2PQL A;  4R1E A;  2JZI A;  1AJ5 A;  3DF0 A;  2K7O A;  2OPO A;  3OX5 A;  1DJH A;  4C0L A;  1A75 B;  3ICB A;  1SRA A;  3FIA A;  1CFC A;  2KDH A;  1QLK A;  2LC5 A;  2LNK A;  4IJ7 A;  2ZRS A;  4CLN A;  5I94 A;  1QJT A;  5KU1 A;  4WQ3 A;  2DOQ A;  3EVU A;  3VGO A;  1JF2 A;  1JBA A;  1AK8 A;  3I5H C;  3D78 A;  1UWO A;  1L2O C;  4QJ5 B;  3M0W A;  1MXE A;  1TIZ A;  5HYD A;  3BXK A;  1EG3 A;  4AQI A;  3SG3 A;  2MRD A;  1R2U A;  3SG7 A;  1K8U A;  1XO5 A;  2MBX A;  1KK7 Y;  1G8I A;  5J3X A;  4CFQ A;  1QAS A;  1YUU A;  3OHM B;  2M8U A;  1OOG A;  3VRO A;  4DRW A;  2F3Y A;  1HT9 A;  2K0J A;  3BFB A;  5AAN A;  1WY9 A;  4USL A;  1UHH A;  2M97 A;  3BQ3 A;  1NIW A;  2F8P A;  3SG4 A;  3WHT B;  1BOD A;  1FI5 A;  3PFV A;  3NHI A;  2KHN A;  5JJG A;  1PSR A;  1AP4 A;  1CFF A;  3NGV A;  3KF9 A;  5KSZ A;  3AAJ A;  4PE7 A;  2LP3 A;  3RM1 A;  4JQ0 D;  1EH2 A;  1L2O B;  1ZAC A;  3HX4 A;  4INW A;  3PJI A;  1NX3 A;  4FTG A;  2M3W A;  1DMO A;  1QV0 A;  3RZS A;  4WRI A;  1NWD A;  2Q91 A;  1QWV A;  3K21 A;  1TN4 A;  1YX8 A;  3CGA A;  3GK2 A;  2WCE A;  1S36 A;  1XA5 A;  2GTE A;  2JPT A;  1PUL A;  3O2P A;  1CFP A;  3O78 A;  2KSP A;  2QEB A;  2SCP A;  3F45 A;  1LA0 A;  1QX5 B;  1ZFS A;  1B8R A;  2BKI B;  2ZN8 A;  3BUM B;  3S0F A;  2ISD A;  2PAL A;  2RGI A;  2CBL A;  2LVI A;  3BUX B;  2QAC A;  3NXA A;  3SJS A;  3PLF B;  2PSR A;  3LK1 A;  2BCA A;  2K61 A;  4Q04 A;  2BBM A;  3VRR A;  2GGM A;  4F0Z B;  3JTD C;  2GV5 A;  3VB1 A;  3JVT C;  4OZD A;  1LS8 A;  1AUI B;  2QEV A;  4C0K A;  3D10 A;  1BLQ A;  2BAP A;  4OV2 A;  4F7F A;  2H61 A;  4L9M A;  1OMD A;  1F4Q A;  1PRW A;  1UUR A;  3BYA A;  4DCK A;  1S3P A;  2KGB C;  5PAL A;  1SSE B;  2JNF A;  1DJW A;  4M2O A;  2MHH A;  5FYX A;  2AMI A;  1JFK A;  2K60 A;  2LHL A;  1U5I B;  1S6C A;  1SL7 A;  2G9B A;  2JT0 A;  1FPW A;  2EC6 C;  3I5G C;  1CKK A;  5HKZ A;  2WCF A;  1B8L A;  1SPY A;  3JVT B;  4KYN A;  1A29 A;  3BFH A;  4MBE A;  1DJG A;  3KO0 A;  1H4B A;  1S6J A;  1ODB A;  3BOW B;  4YI9 A;  2I7A A;  3VRN A;  2WOS A;  1RTP 1;  3EKH A;  1NPQ A;  2QEH A;  3E3R A;  1DJZ A;  1E8A A;  2LVV A;  1S5G Y;  2JTZ A;  3L4A A;  1OZS A;  4I5N B;  4DS7 A;  1BR1 B;  1Z2C B;  2BCX A;  3I5I C;  3VRQ A;  1K9P A;  1TWO A;  2ZRT A;  1BMO A;  5TNC A;  2WCK A;  5HLO A;  1YVH A;  1OSA A;  3CDN A;  1RWY A;  1DT7 B;  1PVA A;  3SS5 A;  1UUS A;  2JNX A;  3Q8I A;  3NSO A;  4MRX A;  1HQV A;  3LL8 B;  3I5G B;  3EKJ A;  1SW8 A;  2LVJ A;  1K9K A;  1QIV A;  1S1E A;  2ZN9 A;  3UNW A;  4YGC B;  3A8R A;  1WLZ A;  1Z4H A;  1CMG A;  3OX6 A;  3R1O A;  1YTZ C;  2KQ6 A;  1K94 A;  3CZ0 A;  3CWG A;  3EVR A;  3H4S E;  3ZWH A;  1KFX L;  3I5I B;  2L98 A;  1SCM C;  5F6T A;  2M1K B;  2Y1N A;  1YRU B;  1QIW A;  1UP5 A;  1IKU A;  1BU3 A;  4C0J A;  1TNQ A;  1ALV A;  2PMY A;  2BCB A;  1QTX A;  2WC5 A;  4ETO A;  1FF1 A;  1B4C A;  1XVJ A;  2V53 A;  1J1D A;  4OCI A;  1YRT B;  4P5O E;  2I2R E;  2L51 A;  4GAO A;  4PHK A;  1CFD A;  1AJ4 A;  1F71 A;  3GK4 X;  2KLD A;  3BUW B;  1QVI Z;  1SYM A;  4GPL B;  2HET A;  1CDN A;  3TZ1 A;  1SK6 D;  3TS5 C;  2QDI A;  1YR5 A;  2LV7 A;  1DF0 A;  2MLE C;  4DUQ A;  4UPG A;  1SCM B;  4ORB B;  4PHM A;  4JKT A;  3I5F C;  1ZUZ A;  4PE0 A;  3NHT A;  4XJK A;  5CSI A;  1QXP A;  1EXR A;  4JPZ B;  1KFU L;  3R1P A;  1RJV A;  2H8V A;  5DIC A;  1CMF A;  2BKH B;  1MUX A;  2JC2 A;  2LLT A;  3SG2 A;  2JT8 A;  4PE4 A;  1WRZ A;  3CAB A;  1DGU A;  1IG5 A;  4GUK A;  1SNL A;  1BG1 A;  3CR2 A;  1GGW A;  1OOJ A;  1NX1 A;  1TRF A;  3S0G A;  4D1E A;  2LUX A;  2KI4 B;  3C1V A;  5I2O A;  2NXQ A;  1W7J B;  4MLW A;  2HQ8 A;  1SY9 A;  4E68 A;  3D76 A;  3TS5 B;  2OS8 C;  1LKJ A;  2KOT A;  2L2E A;  1CB1 A;  2FCE A;  1B9A A;  1NP8 A;  2WCL A;  3LK0 A;  1OW4 A;  3AKB A;  3NSK A;  4QJ3 B;  1MHO A;  3I5F B;  3VRP A;  4PDZ A;  1DJX A;  1IH0 A;  2K2F A;  1QS7 A;  1A75 A;  3R1V A;  1OMR A;  4HRG A;  2ZND A;  2M49 B;  1B47 A;  1T14 A;  1XFU O;  1TTX A;  2H2K A;  1J1E A;  4MRY A;  1C7W A;  2QEO A;  3OGN A;  2O60 A;  2NCP A;  4YGE B;  1B7T Z;  2WCH A;  5ER5 A;  1REC A;  4PHJ A;  1J55 A;  3KHE A;  2OS8 B;  1FW4 A;  1SCV A;  1M39 A;  3UO9 A;  1NCZ A;  1DEK A;  1KFX S;  2FJU B;  5HKY A;  1LIN A;  2BNX A;  3D74 A;  2ZNE A;  2IS9 A;  1WDC C;  1A4P A;  2WCB A;  1RK9 A;  3B87 A;  2JXC A;  3IQO A;  3O6B A;  4BY4 A;  3RLZ A;  1F8H A;  4YGD B;  3A4U B;  3TUY C;  4P2Y B;  1Y1X A;  2L4I A;  1QX7 A;  1WRK A;  2LAP A;  3DZT A;  3BJH A;  1IRJ A;  1NX0 A;  2HQW A;  1KQM C;  2R2I A;  3PAT A;  1AVS A;  1Q80 A;  1VRK A;  2BL0 C;  1ZMZ A;  1EJ3 A;  1PK0 D;  3SIA A;  3R72 A;  5AEQ A;  1ORG A;  3SG5 A;  3IVT A;  2M1U A;  1L7Z A;  1SKT A;  4A4C A;  4HRH A;  1WDC B;  3QME A;  2JRF A;  2Y1M A;  1CNP A;  1KFU S;  1CM1 A;  3CLN A;  1B7T Y;  4AOM A;  3L4L A;  1M46 A;  2L5X B;  2KQY A;  1UHN A;  2WND A;  2KBI A;  2JUL A;  3NSI A;  4ZCV A;  3TUY B;  3B7A A;  3SG6 A;  3QRX A;  3LLE A;  1J7O A;  4YGA A;  4MZL A;  1KQM B;  1NX2 A;  4JWQ A;  2KFG A;  4PCW A;  2M7N A;  1NUB A;  2BL0 B;  1ZOT B;  1J7P A;  1CLB A;  1QX2 A;  2F2P A;  1JF0 A;  5I8N A;  2JXL A;  2KAX A;  4N5X A;  1IIO A;  5CSN A;  2K7C A;  1TNX A;  4GFT A;  4JD9 A;  5ER4 X;  4INX A;  2L5Y A;  3GOF A;  3PSR A;  2M29 A;  3PM8 A;  1PAL A;  3SIB A;  4FQT A;  1TCO B;  3FS7 A;  1NCX A;  4PT1 A;  1TUJ A;  1U5I A;  2WC6 A;  1GM0 A;  2EHB A;  2AAO A;  1NYA A;  2M0R A;  4CFR A;  5EL2 A;  3DXL A;  3DF0 B;  3S0D A;  1OQP A;  3BFA A;  1IQ3 A;  1CDP A;  1LA3 A;  2K7D A;  1XFZ O;  3DVE A;  3DVJ A;  2WC8 A;  2KAV A;  5HKW A;  1H8B A;  1B8C A;  1CDM A;  2VRG A;  4IL1 A;  1IGV A;  4N1G A;  2LVK A;  1AHR A;  5FI6 A;  3D77 A;  3ZNI A;  5AER A;  3KPX A;  1IJ6 A;  2EGD A;  2WCJ A;  2E30 A;  2PAS A;  2ZFD A;  4XJK B;  1J7Q A;  1M45 A;  1Y1A A;  2BBN A;  2JQ6 A;  1G33 A;  1MXL C;  2KI4 C;  3WHU B;  1KK7 Z;  4CID A;  2P71 A;  1C07 A;  3IQQ A;  3WNX B;  1JWD A;  4N1F A;  1WLM A;  1XFR A;  1K90 D;  2KNE A;  1TNW A;  1F4O A;  2I18 A;  2CCM A;  1S6I A;  1JC2 A;  1K9U A;  2ERB A;  2HPS A;  2F33 A;  4WQ2 A;  4QJ4 B;  1Y0V H;  5D7F A;  1MR8 A;  1OE9 B;  2KFH A;  1M31 A;  2L50 A;  1BF5 A;  2JTT A;  2E6W A;  2Q4U A;  4PAL A;  3WXA A;  1Y1U A;  2FCD A;  2B1U A;  2NLN A;  4NQG A;  2CNP A;  5D3O A;  2JPO A;  1OOF A;  2LMT A;  5G08 A;  1JSA A;  2K7B A;  1XFY O;  2KYC A;  3DY9 A;  1F54 A;  1W9Z A;  3S0A A;  1MF8 B;  4OR9 B;  3S0B A;  1QV1 A;  1OZO A;  3HCM A;  4PHN A;  1P28 A;  2H61 C;  1CLM A;  3EVV A;  1NCY A;  1SL9 A;  4ZCU A;  1RFJ A;  1JFJ A;  3D0Y A;  2JOJ A;  3CZT X;  4NDD A;  2SAS A;  1YUS A;  1FBV A;  4HSZ A;  4YI8 A;  1GGZ A;  1KK8 C;  4XYN A;  4MZJ A;  1KWO B;  2BE4 A;  2LCP A;  1D1O A;  2K8M B;  3FE8 A;  1TCF A;  1XYD A;  3TDZ A;  5AFP A;  4GGN A;  2Y4Q A;  3SS3 A;  2M7L A;  2PYQ A;  3PN7 C;  1MQ1 A;  2CT9 A;  1DGV A;  1QVI Y;  3KEV A;  5DKN A;  1SR6 C;  4MVF A;  4U8D A;  1DEL A;  5GQQ C;  1XK4 A;  2F3Z A;  2JT3 A;  3AKA A;  2LLS A;  5D69 A;  5FI2 A;  3FE9 A;  3V2L A;  3CR5 X;  1RRO A;  3OB1 B;  4AQJ A;  1PVB A;  3CR4 X;  3CYZ A;  4GGF A;  4I5J A;  5I2L A;  1YX7 A;  1EG4 A;  2LUC A;  1K95 A;  5JOL A;  3FE6 A;  5CSF A;  2KI6 C;  3B86 A;  1W7I B;  1MWN A;  2CXJ A;  2NZ0 A;  3I5H B;  4DIR A;  2MLF C;  2WCM A;  1KK8 B;  1V1G A;  2A4J A;  3DVK A;  3IF7 A;  1PSB A;  1UHJ A;  4GNK B;  2L0P A;  4I5K A;  3TDU A;  2JWW A;  3DYE A;  2KBM A;  4MEW A;  2PVB A;  1UHI A;  1QLS A;  3PN7 B;  2L2C A;  5FI7 A;  3EG5 B;  5IBW A;  3B6X A;  3OP0 A;  4M2P A;  2KLE A;  1C3Z A;  1SR6 B;  2KAY A;  1C3Y A;  4MN0 A;  1OOI X;  1M63 B;  2GGZ A;  1LVC D;  4MZK A;  1YUT A;  4NDB A;  3O4Y A;  4TNC A;  3AAK A;  1S5G Z;  1YVL A;  1V1F A;  2JU0 A;  4PE1 A;  2G2B A;  2L4H A;  5DKQ A;  2AUC A;  1J7R A;  1SL8 A;  5AXI A;  1UHK A;  1YUR A;  3PAL A;  3FWC A;  1GJY A;  2QPT A;  1K96 A;  2KI6 D;  5DKR A;  1A2X A;  3D73 A;  2TN4 A;  4MSP A;  5HL1 A;  4I5L B;  1G4Y R;  2F2O A;  1BT6 A;  1CDL A;  2LMU A;  4OKH A;  1SBJ A;  1A03 A;  1DC1 A;  1IQ5 A;  2K2A A;  2KFF A;  3CTN A;  2COL B;  1EL4 A;  1ALW A;  3N7H A;  1CM4 A;  1BOC A;  1N2D A;  3K1E A;  5K89 A;  3OB2 B;  1K2H A;  2P6B B;  5CSJ A;  3NSL A;  1F55 A;  2KYF A;  1OOH A;  1XFV O;  4NDC A;  1IJ5 A;  2LMV A;  4YGB B;  1NSH A;  3GK1 A;  3JTD B;  3PM2 A;  2BE6 A;  2CTN A;  2NCO A;  2Y5I A;  2OTG C;  1N65 A;  1QAT A;  2YGU A;  5I2Q A;  1N0Y A;  4YRU A;  4A4B A;  2FOT A;  1JUO A;  3MSE B;  3CZ1 A;  1K93 D;  1CTR A;  1TNP A;  2I94 A;  2LM5 A;  1B1G A;  3LCP C;  2BEC A;  2LHI A;  4M2Q A;  3TDI A;  1KQV A;  1BJF A;  4HRE E;  3CS1 A;  1GQM A;  2LP2 A;  3FWB A;  3EK8 A;  1SMG A;  1R6P A;  2KPH A;  4YBH B;  5HLV A;  1Y6W A;  1TOP A;  1BR4 B;  2D8N A;  4FQO A;  2P70 A;  2KGR A;  5CPV A;  3DD4 A;  3BOW A;  1DJY A;  1DTL A;  2EC6 B;  2O5G A;  3S0E A;  5BPJ A;  3EK7 A;  3EK4 A;  1DF0 B;  3OBV A;  2OTG B;  3SS4 A;  1DVI A;  2LE9 B;  4GBA A;  3D75 A;  3CZ2 A;  2MAZ A;  1KCY A;  3B88 A;  3BUO B;  1CLL A;  4CPV A;  4ORA B;  2MA2 A;  2LAN A;  5KTY A;  1XK4 C;  3L47 A;  2LLU A;  1FI6 A;  1DQE A;  1IWQ A;  1OMV A;  2PRU A;  2FJY A;  4BY5 A;  1S26 D;  5B8I B;  1KWO C;  4GGF C;  3DVM A; 
#chains in the Genus database with same CATH homology
 2M9G A;  3D0Y B;  2MJW B;  4ICB A;  1LXF C;  1XFW O;  1C7V A;  1F70 A;  1DJI A;  1XFX O;  2HF5 A;  1KSM A;  1KSO A;  2WOR A;  4ORC B;  2ZKM X;  4OVN F;  3BUN B;  1X02 A;  1WRL A;  4R1E A;  2JZI A;  1AJ5 A;  3DF0 A;  2K7O A;  2OPO A;  3OX5 A;  1DJH A;  4C0L A;  1A75 B;  3ICB A;  1SRA A;  3FIA A;  1CFC A;  2KDH A;  1QLK A;  2LC5 A;  2LNK A;  4CLN A;  2ZRS A;  5KU1 A;  1QJT A;  4WQ3 A;  2DOQ A;  3EVU A;  3VGO A;  1JF2 A;  1JBA A;  1AK8 A;  3I5H C;  1UWO A;  1L2O C;  4QJ5 B;  3M0W A;  1MXE A;  1TIZ A;  5HYD A;  3BXK A;  1EG3 A;  4AQI A;  3SG3 A;  2MRD A;  1R2U A;  3SG7 A;  1K8U A;  1XO5 A;  2MBX A;  1KK7 Y;  1G8I A;  5J3X A;  4CFQ A;  1QAS A;  1YUU A;  3OHM B;  2M8U A;  3VRO A;  4DRW A;  2F3Y A;  1HT9 A;  2K0J A;  5AAN A;  1WY9 A;  4USL A;  1UHH A;  2M97 A;  3BQ3 A;  1NIW A;  2F8P A;  3SG4 A;  3WHT B;  1BOD A;  1FI5 A;  3PFV A;  1CFF A;  2KHN A;  5JJG A;  1PSR A;  1AP4 A;  3KF9 A;  5KSZ A;  3AAJ A;  4PE7 A;  2LP3 A;  3RM1 A;  4JQ0 D;  1EH2 A;  1L2O B;  1ZAC A;  3HX4 A;  1NX3 A;  4FTG A;  2M3W A;  1DMO A;  1QV0 A;  4WRI A;  1NWD A;  2Q91 A;  3K21 A;  1TN4 A;  1YX8 A;  3CGA A;  3GK2 A;  2WCE A;  1S36 A;  1XA5 A;  2JPT A;  1PUL A;  3O2P A;  1CFP A;  3O78 A;  2KSP A;  2SCP A;  3F45 A;  1LA0 A;  1QX5 B;  1ZFS A;  1B8R A;  2BKI B;  2ZN8 A;  3BUM B;  2ISD A;  2PAL A;  2RGI A;  2CBL A;  2LVI A;  3BUX B;  2QAC A;  3NXA A;  3SJS A;  3PLF B;  2PSR A;  3LK1 A;  2BCA A;  2K61 A;  4Q04 A;  2BBM A;  3VRR A;  2GGM A;  4F0Z B;  3JTD C;  2GV5 A;  3JVT C;  1AUI B;  4C0K A;  3D10 A;  1BLQ A;  4OV2 A;  2H61 A;  4L9M A;  1OMD A;  1F4Q A;  1PRW A;  1UUR A;  3BYA A;  4DCK A;  1S3P A;  2KGB C;  5PAL A;  2JNF A;  1DJW A;  4M2O A;  2MHH A;  5FYX A;  2AMI A;  1JFK A;  2LHL A;  1U5I B;  1S6C A;  1SL7 A;  2G9B A;  2JT0 A;  1FPW A;  2EC6 C;  3I5G C;  1CKK A;  5HKZ A;  2WCF A;  1B8L A;  1SPY A;  3JVT B;  1A29 A;  4MBE A;  1DJG A;  3KO0 A;  1H4B A;  1S6J A;  1ODB A;  3BOW B;  4YI9 A;  2I7A A;  3VRN A;  2WOS A;  1RTP 1;  3EKH A;  1NPQ A;  3E3R A;  1DJZ A;  1E8A A;  2LVV A;  1S5G Y;  2JTZ A;  4I5N B;  1OZS A;  4DS7 A;  1BR1 B;  2BCX A;  3I5I C;  3VRQ A;  1K9P A;  2ZRT A;  1BMO A;  5TNC A;  5HLO A;  1YVH A;  1OSA A;  1DT7 B;  1RWY A;  1PVA A;  1UUS A;  2JNX A;  4MRX A;  3NSO A;  1HQV A;  3LL8 B;  3I5G B;  3EKJ A;  1SW8 A;  2LVJ A;  1K9K A;  1QIV A;  1S1E A;  2ZN9 A;  4YGC B;  3A8R A;  1WLZ A;  1CMG A;  3OX6 A;  1YTZ C;  2KQ6 A;  1K94 A;  3CWG A;  3EVR A;  3H4S E;  3ZWH A;  1KFX L;  3I5I B;  2L98 A;  1SCM C;  5F6T A;  2M1K B;  2Y1N A;  1YRU B;  1QIW A;  1UP5 A;  1IKU A;  1BU3 A;  4C0J A;  1TNQ A;  1ALV A;  2PMY A;  2BCB A;  1QTX A;  4ETO A;  1FF1 A;  1B4C A;  1XVJ A;  2V53 A;  1J1D A;  4OCI A;  1YRT B;  4P5O E;  2I2R E;  2L51 A;  4GAO A;  4PHK A;  1CFD A;  1AJ4 A;  1F71 A;  3GK4 X;  3BUW B;  1QVI Z;  1SYM A;  4GPL B;  2HET A;  1CDN A;  3TZ1 A;  1SK6 D;  3TS5 C;  1YR5 A;  2LV7 A;  1DF0 A;  2MLE C;  4DUQ A;  4UPG A;  1SCM B;  4ORB B;  4PHM A;  4PE0 A;  3I5F C;  1ZUZ A;  4XJK A;  5CSI A;  1QXP A;  1EXR A;  4JPZ B;  1KFU L;  1RJV A;  1CMF A;  2BKH B;  1MUX A;  2JC2 A;  2LLT A;  3SG2 A;  2JT8 A;  4PE4 A;  1WRZ A;  1DGU A;  1IG5 A;  4GUK A;  1SNL A;  1BG1 A;  3CR2 A;  1GGW A;  1OOJ A;  1NX1 A;  1TRF A;  4D1E A;  2LUX A;  2KI4 B;  3C1V A;  5I2O A;  2NXQ A;  1W7J B;  4MLW A;  2HQ8 A;  1SY9 A;  4E68 A;  3TS5 B;  2OS8 C;  1LKJ A;  2KOT A;  2L2E A;  1CB1 A;  2FCE A;  1B9A A;  1NP8 A;  3LK0 A;  3AKB A;  3NSK A;  4QJ3 B;  1MHO A;  3I5F B;  3VRP A;  4PDZ A;  1DJX A;  1IH0 A;  2K2F A;  1QS7 A;  1A75 A;  1OMR A;  4HRG A;  2ZND A;  2M49 B;  1B47 A;  1XFU O;  1TTX A;  2H2K A;  1J1E A;  4MRY A;  1C7W A;  2O60 A;  2NCP A;  4YGE B;  1B7T Z;  5ER5 A;  1REC A;  4PHJ A;  1J55 A;  3KHE A;  2OS8 B;  1FW4 A;  1SCV A;  1M39 A;  1NCZ A;  1KFX S;  2FJU B;  5HKY A;  1LIN A;  2ZNE A;  2IS9 A;  1WDC C;  1A4P A;  2WCB A;  1RK9 A;  2JXC A;  3IQO A;  3O6B A;  4BY4 A;  3RLZ A;  1F8H A;  4YGD B;  3A4U B;  3TUY C;  4P2Y B;  1Y1X A;  2L4I A;  1QX7 A;  1WRK A;  2LAP A;  1IRJ A;  1NX0 A;  2HQW A;  1KQM C;  2R2I A;  3PAT A;  1AVS A;  1Q80 A;  1VRK A;  2BL0 C;  1ZMZ A;  1EJ3 A;  1PK0 D;  3SIA A;  5AEQ A;  3SG5 A;  2M1U A;  1L7Z A;  1SKT A;  4A4C A;  4HRH A;  1WDC B;  2JRF A;  2Y1M A;  1CNP A;  1KFU S;  1CM1 A;  3CLN A;  1B7T Y;  4AOM A;  3NSI A;  1M46 A;  2L5X B;  2KQY A;  1UHN A;  2WND A;  2KBI A;  2JUL A;  4ZCV A;  3TUY B;  3SG6 A;  3QRX A;  3LLE A;  1J7O A;  4YGA A;  4MZL A;  1KQM B;  1NX2 A;  4JWQ A;  2KFG A;  4PCW A;  2M7N A;  1NUB A;  2BL0 B;  1ZOT B;  1J7P A;  1CLB A;  1QX2 A;  2F2P A;  1JF0 A;  5I8N A;  2JXL A;  2KAX A;  4N5X A;  5CSN A;  2K7C A;  1TNX A;  4GFT A;  5ER4 X;  3GOF A;  3PSR A;  2M29 A;  3PM8 A;  1PAL A;  3SIB A;  1TCO B;  3FS7 A;  1NCX A;  1U5I A;  2EHB A;  2AAO A;  1NYA A;  2M0R A;  4CFR A;  3DF0 B;  1OQP A;  1IQ3 A;  1CDP A;  1LA3 A;  2K7D A;  1XFZ O;  3DVE A;  3DVJ A;  2WC8 A;  2KAV A;  5HKW A;  1H8B A;  1B8C A;  1CDM A;  2VRG A;  4IL1 A;  1IGV A;  4N1G A;  2LVK A;  1AHR A;  3ZNI A;  5AER A;  3KPX A;  1IJ6 A;  2EGD A;  2ZFD A;  2E30 A;  2PAS A;  4XJK B;  1J7Q A;  1M45 A;  1Y1A A;  2BBN A;  2JQ6 A;  1G33 A;  1MXL C;  2KI4 C;  3WHU B;  1KK7 Z;  4CID A;  1C07 A;  3IQQ A;  3WNX B;  1JWD A;  4N1F A;  1WLM A;  1K90 D;  2KNE A;  1TNW A;  1F4O A;  2I18 A;  2CCM A;  1S6I A;  1JC2 A;  1K9U A;  2HPS A;  4QJ4 B;  2F33 A;  4WQ2 A;  1BF5 A;  1Y0V H;  5D7F A;  1MR8 A;  1OE9 B;  2KFH A;  1M31 A;  2L50 A;  2JTT A;  2E6W A;  2Q4U A;  4PAL A;  3WXA A;  1Y1U A;  2FCD A;  2B1U A;  2NLN A;  4NQG A;  2CNP A;  5G08 A;  2LMT A;  1JSA A;  2K7B A;  1XFY O;  2KYC A;  1F54 A;  1MF8 B;  4OR9 B;  1QV1 A;  1OZO A;  3HCM A;  4PHN A;  2H61 C;  1CLM A;  3EVV A;  1NCY A;  1SL9 A;  4ZCU A;  1RFJ A;  1JFJ A;  3D0Y A;  2JOJ A;  3CZT X;  4NDD A;  2SAS A;  1YUS A;  1FBV A;  4HSZ A;  4YI8 A;  1GGZ A;  1KK8 C;  4XYN A;  4MZJ A;  1KWO B;  2BE4 A;  2LCP A;  1D1O A;  2K8M B;  5AFP A;  1TCF A;  1XYD A;  3TDZ A;  4GGN A;  2Y4Q A;  2M7L A;  3PN7 C;  1MQ1 A;  2CT9 A;  1DGV A;  1QVI Y;  3KEV A;  5DKN A;  1SR6 C;  4MVF A;  4U8D A;  5GQQ C;  1XK4 A;  2F3Z A;  2JT3 A;  3AKA A;  2LLS A;  5D69 A;  3CR5 X;  1RRO A;  3OB1 B;  4AQJ A;  1PVB A;  3CR4 X;  4GGF A;  4I5J A;  5I2L A;  1YX7 A;  1EG4 A;  2LUC A;  1K95 A;  5JOL A;  5CSF A;  2KI6 C;  1W7I B;  1MWN A;  2CXJ A;  2NZ0 A;  3I5H B;  4DIR A;  2MLF C;  1KK8 B;  1V1G A;  2A4J A;  3DVK A;  3IF7 A;  1PSB A;  1UHJ A;  4GNK B;  2L0P A;  4I5K A;  3TDU A;  2JWW A;  2KBM A;  4MEW A;  2PVB A;  1UHI A;  1QLS A;  3PN7 B;  5IBW A;  3OP0 A;  4M2P A;  1SR6 B;  2KAY A;  4MN0 A;  1M63 B;  2GGZ A;  1LVC D;  4MZK A;  1YUT A;  4NDB A;  3O4Y A;  4TNC A;  3AAK A;  1S5G Z;  1YVL A;  1V1F A;  2JU0 A;  4PE1 A;  2G2B A;  2L4H A;  5DKQ A;  2AUC A;  1J7R A;  1SL8 A;  5AXI A;  1UHK A;  1YUR A;  3PAL A;  3FWC A;  1GJY A;  2QPT A;  1K96 A;  2KI6 D;  5DKR A;  1A2X A;  4MSP A;  2TN4 A;  4I5L B;  1G4Y R;  2F2O A;  1BT6 A;  1CDL A;  2LMU A;  4OKH A;  1SBJ A;  1A03 A;  1IQ5 A;  2K2A A;  2KFF A;  3CTN A;  2COL B;  1EL4 A;  1ALW A;  1CM4 A;  1BOC A;  1N2D A;  5K89 A;  3OB2 B;  1K2H A;  2P6B B;  5CSJ A;  3NSL A;  1F55 A;  2KYF A;  1XFV O;  4NDC A;  1IJ5 A;  2LMV A;  4YGB B;  1NSH A;  3GK1 A;  3JTD B;  2BE6 A;  2CTN A;  2NCO A;  2Y5I A;  2OTG C;  1N65 A;  1QAT A;  5I2Q A;  1N0Y A;  4YRU A;  4A4B A;  2FOT A;  1JUO A;  3MSE B;  1K93 D;  1CTR A;  1TNP A;  2I94 A;  2LM5 A;  1B1G A;  3LCP C;  2BEC A;  2LHI A;  4M2Q A;  3TDI A;  1KQV A;  1BJF A;  4HRE E;  3CS1 A;  1GQM A;  2LP2 A;  3FWB A;  3EK8 A;  1SMG A;  1R6P A;  4YBH B;  5HLV A;  1Y6W A;  1TOP A;  1BR4 B;  2D8N A;  4FQO A;  2KGR A;  5CPV A;  3DD4 A;  3BOW A;  1DJY A;  1DTL A;  2EC6 B;  2O5G A;  5BPJ A;  3EK7 A;  3EK4 A;  1DF0 B;  2OTG B;  1DVI A;  2LE9 B;  4GBA A;  2MAZ A;  1KCY A;  3BUO B;  1CLL A;  4CPV A;  4ORA B;  2MA2 A;  2LAN A;  5KTY A;  1XK4 C;  2LLU A;  1FI6 A;  1OMV A;  1IWQ A;  2PRU A;  4BY5 A;  1S26 D;  5B8I B;  1KWO C;  4GGF C;  3DVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...