2LAPA

Nmr structure of ca2+-bound cabp1 c-domain with rdc
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
70
structure length
70
Chain Sequence
MIGVKELRDAFREFDTNGDGEISTSELREAMRKLLGHQVGHRDIEEIIRDVDLNGDGRVDFEEFVRMMSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Calcium-binding protein 1
publication title 1H, 15N, and 13C chemical shift assignments for CaBP1 with 3 Ca2+ bound
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 14
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2011-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lapA00
4PDZA 4PCWA 3LK1A 1BT6A 1MWNA 2KGBC 4PE0A 4DUQA 1ZFSA 1J1EA 1TNXA 2CTNA 5I2QA 3CWGA 1UUSA 3FWBA 2O60A 3TUYB 3SG2A 1W7IB 1TCFA 1M39A 1CFDA 2TN4A 1BR1B 4MLWA 2JRFA 1B7TY 1K94A 2L98A 3NSOA 1RROA 5JJGA 1BJFA 1KQMB 2L5XB 4GUKA 2ZRTA 5DKRA 3D10A 3OX5A 2MHHA 3KHEA 3SG5A 2JTTA 3BQ3A 2LM5A 1G4YR 1SCMC 5BPJA 4YGCB 1DMOA 1GGZA 1F4QA 3OB2B 1J7PA 1LINA 2ZN9A 1F70A 2O5GA 3I5GB 2L2EA 4OKHA 3AAKA 5TNCA 3VRQA 4CFQA 5F6TA 1SY9A 2JXCA 5AERA 1S1EA 4ICBA 3NSIA 4HRGA 1PRWA 1TN4A 1PSBA 2I18A 1AP4A 1M31A 3SG4A 1JSAA 4U8DA 1PVBA 2F2PA 2WCFA 3ZWHA 3CTNA 5D69A 1XFZO 1B8RA 1M45A 1DJZA 1UHJA 1KFXS 1YVLA 1SCVA 5DKNA 2KQYA 4QJ5B 3PATA 4GAOA 3H4SE 4Q04A 4YI8A 2MRDA 1J7QA 1AVSA 1LKJA 1TRFA 1UWOA 5J3XA 1S6JA 4GGNA 1QX5B 3SIBA 4AQIA 4MRYA 1JF0A 2GGMA 4YI9A 4FTGA 1CDPA 3CR5X 4JQ0D 5I2OA 1CKKA 2Y1MA 2JU0A 5D7FA 3TZ1A 1KFUS 2JPTA 2KI4B 3EKJA 4WQ2A 2ISDA 1GJYA 2QPTA 5FYXA 1K96A 1SBJA 4E68A 2OTGC 2LLSA 1OSAA 4P5OE 2AAOA 2KGRA 1S36A 1YRTB 1TNQA 1ZMZA 3LL8B 3OB1B 2NZ0A 1XK4C 3MSEB 3O4YA 2JNFA 3DF0A 2SASA 2CBLA 1SK6D 2PVBA 1J55A 1C07A 4FQOA 1R6PA 3WHUB 1D1OA 2K2AA 1F54A 1KK8C 4GPLB 1SR6B 2KDHA 4MRXA 2L50A 3JVTC 1JBAA 4OR9B 3JTDC 3HCMA 3EVRA 4GGFA 2CCMA 2KBMA 2MBXA 1RWYA 2KFGA 1XFUO 1NUBA 2Q91A 2HETA 3EK7A 1DJWA 2GV5A 3SG7A 1IGVA 1XVJA 4ZCUA 3WNXB 2WCBA 2PSRA 1HT9A 1A75A 1JF2A 3CGAA 2I94A 2EC6B 1IKUA 5KU1A 4USLA 2HQWA 1QTXA 3I5HB 3PM8A 1YURA 1SPYA 2KQ6A 2M3WA 3PN7B 1SL8A 2KNEA 1H4BA 1NX2A 2H2KA 1DF0A 1FW4A 2KBIA 3WHTB 2BL0C 3AKBA 2JZIA 1DF0B 1NX0A 2NXQA 5ER5A 1KFUL 1FI6A 1BODA 2KI6D 1KQVA 1MXEA 3O78A 2G9BA 1AHRA 1QJTA 3RM1A 1ODBA 3TUYC 4PHKA 4CLNA 2K0JA 1PALA 1B8LA 4NQGA 3DVEA 3GK1A 1AUIB 2F3YA 5KSZA 5JOLA 2KFFA 4DRWA 2KI6C 2KOTA 1CLMA 1C7VA 1UP5A 3A4UB 2LCPA 3TS5B 3WXAA 3EVVA 4L9MA 1EH2A 1QV1A 1U5IA 2L51A 1QVIZ 1CB1A 4D1EA 1U5IB 1LVCD 2CXJA 1OMDA 2M1KB 1VRKA 4M2QA 2LC5A 3IF7A 4PE4A 1OZSA 2HQ8A 2ZN8A 1DVIA 2LHIA 4NDDA 1C7WA 1Y1AA 3O2PA 5CSJA 3C1VA 2LNKA 3DD4A 3BUWB 4MVFA 3CR4X 4ZCVA 5IBWA 5HKZA 1UURA 2Y5IA 1R2UA 1XA5A 2PASA 4DS7A 1BMOA 1LA3A 1QLSA 1YX8A 4PE1A 4XJKB 1CDNA 3I5FC 3BUMB 3IQQA 3KPXA 3NXAA 2LMTA 1N2DA 1DJYA 1KK7Z 1PVAA 5AANA 1A03A 1QVIY 1CFFA 4ETOA 1F71A 2KAVA 2R2IA 1CTRA 1QIVA 1DGVA 2MJWB 1EG4A 1E8AA 1JFJA 1FI5A 3LLEA 1WDCB 1QATA 1MQ1A 1FBVA 2BCAA 4DCKA 2K7BA 1CLBA 2JC2A 1A4PA 1NCYA 2COLB 1MR8A 4I5JA 1BU3A 1YUTA 2FCEA 2KYCA 1CM4A 1XFYO 1KWOB 1JC2A 1QASA 2F2OA 4CPVA 2JTZA 4HREE 3SIAA 5GQQC 1S5GZ 2M29A 1XFVO 2LVKA 1KK7Y 1DJHA 1OQPA 2BE6A 3D0YA 1NIWA 2K8MB 1J1DA 3GK4X 1SNLA 2MAZA 1J7OA 1F4OA 3D0YB 3EK8A 4M2PA 2JT8A 4WRIA 3F45A 4YGEB 4DIRA 1MXLC 2NLNA 2D8NA 2F33A 2JQ6A 4YGAA 1SL9A 3OP0A 2E6WA 1M46A 1UHHA 2LAPA 4PHMA 3VGOA 1M63B 2K2FA 1DGUA 5G08A 4MZLA 3BUNB 2LP2A 3DVKA 4C0KA 2M7NA 3CZTX 3I5IB 2K7CA 1Y1XA 1TNPA 2Q4UA 4CIDA 5K89A 2I7AA 1CLLA 1AJ5A 2FCDA 1S6IA 1QX7A 1SMGA 1KSOA 4I5KA 1S5GY 2LUCA 4YGBB 3FWCA 2Y1NA 4GGFC 3KEVA 2KAXA 4OVNF 1QIWA 3QRXA 1DJGA 2ZFDA 3ZNIA 1ZUZA 3BUXB 1NWDA 2JULA 2OS8C 1CFCA 3PFVA 2B1UA 5AEQA 1RECA 1J7RA 2CNPA 2EC6C 2M97A 4A4BA 3BYAA 1KSMA 3DVMA 3I5HC 2LHLA 2LUXA 2ZNDA 4CFRA 2G2BA 3FS7A 3TDZA 1BG1A 1TIZA 3CR2A 2ZRSA 2KAYA 4AQJA 1CMGA 4JPZB 3TDUA 1CMFA 4JWQA 1QXPA 1WY9A 2P6BB 1L2OC 1IWQA 5AXIA 1RK9A 3BUOB 2H61A 2IS9A 4IL1A 1RTP1 1XYDA 3VRPA 3EK4A 2BKIB 2F8PA 1GGWA 1KCYA 1IQ3A 1DTLA 3EVUA 2LV7A 2JT0A 5KTYA 2EHBA 4ORAB 1BOCA 3E3RA 3LCPC 4NDBA 2BKHB 2JWWA 2MLFC 1OMVA 3JVTB 4UPGA 1NP8A 3NSLA 1PK0D 1ALVA 4YBHB 1SYMA 5HLVA 1F55A 2FOTA 1FF1A 2LMVA 2BBNA 1JFKA 1LA0A 2LVJA 1UHKA 2QACA 1AJ4A 1CDMA 4BY4A 2LP3A 3A8RA 1B8CA 1KQMC 1PULA 2MA2A 4BY5A 2OPOA 1K90D 1WLZA 1DJIA 2M49B 3VRRA 1YRUB 2M0RA 1XO5A 1OZOA 2CT9A 1SL7A 2AUCA 2AMIA 2HF5A 1S26D 3I5GC 1F8HA 1EJ3A 2DOQA 2L0PA 1S6CA 3BOWB 1IG5A 1NYAA 1N65A 1UHNA 4MZJA 1B47A 1IJ5A 1WRLA 2WOSA 1CM1A 4HRHA 2BL0B 2FJUB 2L4IA 4XJKA 5CPVA 1NSHA 2BCXA 2MLEC 1WDCC 1CNPA 1JUOA 1JWDA 1GQMA 1YVHA 2LVIA 2SCPA 1BLQA 3OHMB 3PALA 2PMYA 2BE4A 2KFHA 2JXLA 1YTZC 4QJ3B 1KWOC 4M2OA 4A4CA 2K7DA 1ALWA 1EXRA 1NCZA 2ZNEA 2LMUA 4TNCA 1L7ZA 1Y0VH 5B8IB 2EGDA 2I2RE 1MF8B 1YR5A 1K9UA 3GOFA 1TCOB 2F3ZA 2V53A 1YUSA 3K21A 3GK2A 2KI4C 1RJVA 2A4JA 1N0YA 1Y6WA 1A29A 2JOJA 5CSNA 4P2YB 1IRJA 3I5IC 1SCMB 1DJXA 1SW8A 2WNDA 4R1EA 1OE9B 4GFTA 1K9PA 3ICBA 1V1FA 2M8UA 3AKAA 1K2HA 1IJ6A 3OX6A 1ZACA 3IQOA 3SG6A 3SJSA 3I5FB 4OCIA 3HX4A 1K93D 4MBEA 2GGZA 1SR6C 4YRUA 1TOPA 2K7OA 3TDIA 4ORCB 1IQ5A 4PHNA 2LLUA 3CS1A 4N1GA 1NX1A 2L4HA 1SKTA 1XFXO 2VRGA 4F0ZB 3RLZA 1NX3A 2K61A 1G8IA 2LLTA 4HSZA 4C0LA 2JT3A 3EKHA 4N5XA 4AOMA 2NCPA 1V1GA 3PLFB 1TTXA 5HKWA 2LANA 5AFPA 4PHJA 1WRKA 1BR4B 1OMRA 4GNKB 1QLKA 3PSRA 2BCBA 1OOJA 1QX2A 2M9GA 3DVJA 1BF5A 1UHIA 2PALA 2RGIA 4WQ3A 3PN7C 2H61C 1NPQA 3FIAA 4GBAA 4I5LB 1H8BA 1S3PA 2ZKMX 3DF0B 3BXKA 4I5NB 4YGDB 1SRAA 4PE7A 2OTGB 5DKQA 5CSFA 1B9AA 1EG3A 1Q80A 1XK4A 4NDCA 1NCXA 2WC8A 2LVVA 5I8NA 4ORBB 2JNXA 5HLOA 2M1UA 1HQVA 4XYNA 2WORA 2Y4QA 3LK0A 3SG3A 1EL4A 1ZOTB 1QV0A 1WLMA 1K8UA 1K9KA 1RFJA 1YX7A 2BBMA 1CDLA 3KO0A 2KHNA 4MZKA 1CFPA 1KK8B 1XFWO 3CLNA 5I2LA 4MN0A 5CSIA 3NSKA 3TS5C 4QJ4B 1KFXL 2LE9B 2OS8B 4OV2A 3VROA 1AK8A 2WCEA 2KSPA 1WRZA 3JTDB 4MSPA 3AAJA 1YUUA 1DT7B 1Y1UA 1MHOA 3M0WA 5ER4X 1B1GA 1A75B 4C0JA 1PSRA 5PALA 1IH0A 1X02A 5HYDA 1W7JB 1G33A 1A2XA 1TNWA 2M7LA 1B7TZ 1L2OB 4N1FA 2NCOA 3BOWA 2HPSA 4MEWA 1MUXA 1LXFC 3KF9A 1QS7A 2BECA 2PRUA 1B4CA 4PALA 2E30A 3O6BA 5HKYA 2KYFA 1K95A 1FPWA 3VRNA
chains in the Genus database with same CATH superfamily
4PDZA 4PCWA 3LK1A 1BT6A 1MWNA 2KGBC 4PE0A 4DUQA 1ZFSA 1J1EA 3NHIA 1TNXA 1Z2CB 2CTNA 5I2QA 3CWGA 1UUSA 3FWBA 2O60A 3TUYB 3SG2A 1W7IB 1TCFA 1M39A 1CFDA 2TN4A 1BR1B 4MLWA 2JRFA 3CZ1A 1B7TY 2WCKA 2ERBA 1K94A 2L98A 3BJHA 1RROA 3NSOA 1BJFA 1KQMB 5JJGA 2L5XB 4GUKA 2ZRTA 5DKRA 3D10A 3OX5A 2MHHA 3KHEA 3SG5A 2JTTA 3BQ3A 2QEHA 2LM5A 1G4YR 1SCMC 5BPJA 4YGCB 1DMOA 1GGZA 1F4QA 3OB2B 1J7PA 1LINA 2ZN9A 1F70A 2O5GA 3I5GB 2L2EA 4OKHA 3AAKA 5TNCA 3VRQA 3UO9A 5F6TA 4CFQA 1SY9A 2JXCA 5AERA 3R1PA 1S1EA 4ICBA 1SSEB 3NSIA 4HRGA 1PRWA 1TN4A 1PSBA 1TUZA 2I18A 1AP4A 1M31A 2QDIA 3SG4A 3VRNA 1JSAA 4U8DA 1PVBA 2F2PA 2WCFA 3ZWHA 2H8VA 3CTNA 5D69A 1XFZO 1B8RA 1M45A 1DJZA 1UHJA 1KFXS 1YVLA 1SCVA 5DKNA 2KQYA 4QJ5B 3PATA 4GAOA 3H4SE 4Q04A 4YI8A 2MRDA 1J7QA 1AVSA 1LKJA 1TRFA 1UWOA 5J3XA 1S6JA 2WC5A 4GGNA 1QX5B 3SIBA 4AQIA 4MRYA 1JF0A 2GGMA 4YI9A 3BFAA 4FQTA 4FTGA 1CDPA 3CR5X 4JQ0D 5I2OA 1CKKA 2Y1MA 1TWOA 2JU0A 2QEBA 5D7FA 3TZ1A 1KFUS 2JPTA 2KI4B 3EKJA 4WQ2A 2ISDA 1GJYA 2QPTA 5FYXA 1K96A 1SBJA 4E68A 2OTGC 3FE9A 2LLSA 1OSAA 4P5OE 2AAOA 2KGRA 1S36A 1YRTB 1TNQA 1ZMZA 3LL8B 3OB1B 2NZ0A 1XK4C 3MSEB 3O4YA 2JNFA 3DF0A 3R72A 2SASA 3SS4A 2CBLA 2KLEA 1SK6D 2PVBA 1J55A 1C07A 1DC1A 4FQOA 1R6PA 3WHUB 1D1OA 2K2AA 1F54A 1KK8C 4GPLB 1SR6B 2KDHA 4MRXA 2L50A 3JVTC 3DZTA 1JBAA 4OR9B 3JTDC 3HCMA 3EVRA 4GGFA 2CCMA 2KBMA 2MBXA 3SS3A 1RWYA 2KFGA 1XFUO 1NUBA 2Q91A 2HETA 2QEVA 3EK7A 1DJWA 2GV5A 3SG7A 1IGVA 1XVJA 4ZCUA 3WNXB 3L4AA 2WCBA 2PSRA 1HT9A 1A75A 1JF2A 3CGAA 2I94A 2EC6B 1IKUA 5KU1A 4USLA 2HQWA 1QTXA 3I5HB 3NGVA 3PM8A 1YURA 1SPYA 2KQ6A 2M3WA 3PN7B 1SL8A 2KNEA 1H4BA 1NX2A 2H2KA 1DF0A 1OOGA 1FW4A 3CABA 2KBIA 3WHTB 2BL0C 3AKBA 2JZIA 1DF0B 1C3ZA 1NX0A 2NXQA 5ER5A 1W9ZA 4JD9A 1KFUL 4JKTA 2BAPA 1BODA 2KI6D 1FI6A 1MXEA 2PYQA 1KQVA 3O78A 2G9BA 1AHRA 1QJTA 3RM1A 1ODBA 3TUYC 4PHKA 4CLNA 2K0JA 1PALA 1B8LA 4NQGA 1DQEA 3DVEA 3GK1A 1AUIB 1ORGA 2F3YA 5KSZA 5JOLA 2KFFA 1Z4HA 4DRWA 3N7HA 2KI6C 2KOTA 1CLMA 1C7VA 1UP5A 3O4XA 3A4UB 2LCPA 3TS5B 3WXAA 3EVVA 4L9MA 1EH2A 1QV1A 1U5IA 1OOHA 2L51A 2P70A 1QVIZ 1CB1A 4D1EA 1U5IB 1LVCD 2CXJA 1OMDA 1OOIX 2M1KB 3B6XA 1VRKA 4M2QA 2LC5A 3IF7A 4PE4A 1OZSA 2HQ8A 2ZN8A 1DVIA 2LHIA 4NDDA 1C7WA 1LS8A 2FJYA 1Y1AA 3O2PA 5CSJA 3C1VA 2LNKA 3DD4A 4INXA 3BUWB 4MVFA 3CR4X 4ZCVA 5IBWA 4IJ7A 5HKZA 1UURA 2Y5IA 1R2UA 1XA5A 2PASA 4DS7A 1BMOA 1LA3A 1QLSA 1YX8A 4PE1A 4XJKB 1CDNA 3I5FC 1OW4A 3BUMB 3IQQA 3KPXA 3NXAA 2LMTA 1N2DA 1DJYA 1KK7Z 1PVAA 1T14A 3DXLA 2K60A 5AANA 1A03A 1QVIY 1CFFA 4ETOA 1F71A 2KAVA 2R2IA 1CTRA 1QIVA 1DGVA 2MJWB 1EG4A 1E8AA 1JFJA 1FI5A 3LLEA 1WDCB 1XFRA 1QATA 1MQ1A 1FBVA 2BCAA 3D74A 4DCKA 2K7BA 1CLBA 2JC2A 4F7FA 1A4PA 3PJIA 3K1EA 1NCYA 2COLB 1MR8A 4I5JA 1BU3A 1YUTA 2FCEA 2KYCA 3S0GA 1CM4A 1XFYO 1KWOB 1JC2A 1DELA 1QASA 2F2OA 5HL1A 4CPVA 2JTZA 4HREE 3OGNA 3SIAA 5GQQC 1S5GZ 2M29A 1XFVO 2LVKA 3L47A 1KK7Y 1DJHA 1OQPA 2BE6A 3D0YA 1NIWA 2K8MB 2YGUA 1J1DA 3GK4X 3D76A 1SNLA 2QEOA 2MAZA 1J7OA 1F4OA 3D0YB 3EK8A 4M2PA 2JT8A 4WRIA 3F45A 4YGEB 4DIRA 1MXLC 2NLNA 2D8NA 2F33A 2JQ6A 4YGAA 1SL9A 3OP0A 2E6WA 1M46A 1UHHA 2LAPA 4PHMA 3VGOA 1M63B 2K2FA 1DGUA 5G08A 4MZLA 3BUNB 2LP2A 3DVKA 4C0KA 3CZ2A 2M7NA 3CZTX 3I5IB 2K7CA 1Y1XA 1TNPA 2Q4UA 4CIDA 5K89A 2I7AA 3R1VA 1CLLA 1AJ5A 2FCDA 1S6IA 1QX7A 1SMGA 1KSOA 4I5KA 1S5GY 2LUCA 3IVTA 4YGBB 3FWCA 2Y1NA 4GGFC 3KEVA 2KAXA 4OVNF 1QIWA 3QRXA 1DJGA 3EG5B 2ZFDA 3ZNIA 1ZUZA 3BUXB 2GTEA 1NWDA 2JULA 2OS8C 3D78A 1CFCA 3PFVA 2B1UA 5FI2A 3S0DA 5AEQA 1RECA 1J7RA 2CNPA 2EC6C 2M97A 4A4BA 3BYAA 1KSMA 3DVMA 3I5HC 5FI6A 2LHLA 2LUXA 2ZNDA 3Q8IA 4CFRA 2G2BA 3B7AA 3FS7A 3TDZA 1TIZA 3CR2A 1BG1A 2ZRSA 2KAYA 4AQJA 1CMGA 3NHTA 4JPZB 3TDUA 1CMFA 4JWQA 1QXPA 1WY9A 2P6BB 3BFHA 1L2OC 1IWQA 5AXIA 1RK9A 3CYZA 3BUOB 2H61A 2IS9A 5FI7A 4IL1A 1RTP1 4PT1A 1XYDA 3VRPA 3EK4A 3S0FA 2L2CA 2BKIB 2F8PA 1GGWA 1KCYA 1IQ3A 1DTLA 3EVUA 2LV7A 2JT0A 5KTYA 2EHBA 4ORAB 1BOCA 3E3RA 3LCPC 4NDBA 4INWA 2BKHB 2JWWA 2MLFC 1OMVA 3JVTB 4UPGA 1NP8A 3NSLA 1PK0D 1ALVA 4YBHB 1SYMA 5HLVA 3UNWA 1F55A 2FOTA 1FF1A 2LMVA 2BBNA 1JFKA 1LA0A 2LVJA 1UHKA 2QACA 1AJ4A 1CDMA 1GM0A 4BY4A 2LP3A 3A8RA 1B8CA 1KQMC 1PULA 2MA2A 4BY5A 2OPOA 1K90D 1WLZA 1DJIA 2M49B 3VRRA 1YRUB 2M0RA 1XO5A 3V2LA 1OZOA 2CT9A 1SL7A 2AUCA 2AMIA 2HF5A 1S26D 3I5GC 1F8HA 1EJ3A 2DOQA 2L0PA 2WCMA 1S6CA 3BOWB 1IG5A 1NYAA 1N65A 1UHNA 4MZJA 3D75A 1B47A 1IJ5A 1WRLA 2WOSA 1CM1A 4HRHA 2BL0B 2FJUB 2L4IA 4XJKA 5CPVA 1NSHA 2BCXA 1OOFA 1WDCC 2MLEC 1CNPA 3RZSA 1JUOA 1JWDA 1GQMA 3B87A 2WC6A 3QMEA 1YVHA 2LVIA 4KYNA 2SCPA 1BLQA 3OHMB 3PALA 2P71A 2PMYA 2BE4A 2KFHA 2JXLA 1YTZC 4QJ3B 1KWOC 4M2OA 4A4CA 2K7DA 1ALWA 1EXRA 3CZ0A 1NCZA 2ZNEA 2LMUA 4TNCA 1L7ZA 1Y0VH 5B8IB 2EGDA 2I2RE 3FE8A 1MF8B 1YR5A 1K9UA 3GOFA 1TCOB 2F3ZA 2V53A 3S0AA 1YUSA 3K21A 3GK2A 2KI4C 1RJVA 2A4JA 1N0YA 1Y6WA 1A29A 2JOJA 5CSNA 4P2YB 1IRJA 3I5IC 1SCMB 1DJXA 1SW8A 2WNDA 3PM2A 4R1EA 1OE9B 4GFTA 1K9PA 3ICBA 1V1FA 2WCHA 2M8UA 3AKAA 1K2HA 1IJ6A 3OX6A 1ZACA 2WCLA 3IQOA 3SG6A 3SJSA 2BNXA 3I5FB 5DICA 4OCIA 3HX4A 3DY9A 1K93D 4MBEA 2GGZA 1SR6C 4YRUA 1TOPA 2K7OA 3TDIA 4ORCB 1IQ5A 4PHNA 2LLUA 3BFBA 3CS1A 1NX1A 2L4HA 1SKTA 4N1GA 1XFXO 2VRGA 1P28A 4F0ZB 3R1OA 3RLZA 3D73A 1NX3A 2K61A 1G8IA 2LLTA 3CDNA 4HSZA 4C0LA 2JT3A 3EKHA 4N5XA 3S0EA 2NCPA 4AOMA 1V1GA 3PLFB 1TTXA 2L5YA 5HKWA 2LANA 5AFPA 4PHJA 1WRKA 1BR4B 1OMRA 4GNKB 3VB1A 1QLKA 3PSRA 2BCBA 1OOJA 1QX2A 2M9GA 3DVJA 1BF5A 1UHIA 2PALA 2RGIA 1TUJA 4WQ3A 5EL2A 3PN7C 2H61C 1NPQA 3FIAA 4GBAA 4I5LB 3D77A 1H8BA 1S3PA 2ZKMX 3DF0B 5I94A 3BXKA 4I5NB 4YGDB 2WCJA 1SRAA 4PE7A 2OTGB 5DKQA 3OBVA 5D3OA 5CSFA 1B9AA 1EG3A 1Q80A 1XK4A 4NDCA 1NCXA 2WC8A 2LVVA 5I8NA 4ORBB 2JNXA 5HLOA 2M1UA 1HQVA 4OZDA 4XYNA 2WORA 2Y4QA 3LK0A 3SG3A 1EL4A 1ZOTB 1QV0A 1WLMA 3FE6A 1K8UA 1K9KA 1RFJA 1YX7A 2BBMA 1CDLA 3L4LA 3B86A 1DEKA 2KHNA 3KO0A 4MZKA 1CFPA 1KK8B 1QWVA 1XFWO 3CLNA 4MN0A 5CSIA 5I2LA 3NSKA 3TS5C 4QJ4B 1KFXL 2LE9B 2OS8B 4OV2A 3B88A 3SS5A 3VROA 1AK8A 2WCEA 2KSPA 1WRZA 3JTDB 4MSPA 3AAJA 1YUUA 1DT7B 1Y1UA 1MHOA 3M0WA 5ER4X 1B1GA 1A75B 4C0JA 1PSRA 1C3YA 2JPOA 3DYEA 5PALA 1IH0A 1X02A 5HYDA 1IIOA 1W7JB 1G33A 1A2XA 1TNWA 2M7LA 1B7TZ 1L2OB 4N1FA 2NCOA 3BOWA 2HPSA 4MEWA 1MUXA 2PQLA 1LXFC 3KF9A 1QS7A 2BECA 2PRUA 1B4CA 3S0BA 4PALA 2E30A 3O6BA 5HKYA 2KPHA 2KYFA 1K95A 1FPWA 2KLDA
chains in the Genus database with same CATH topology
4PDZA 4PCWA 3LK1A 1BT6A 1MWNA 2KGBC 4PE0A 4DUQA 1ZFSA 1J1EA 1TNXA 2CTNA 5I2QA 3CWGA 1UUSA 3FWBA 2O60A 3TUYB 3SG2A 1W7IB 1TCFA 1M39A 1CFDA 2TN4A 1BR1B 4MLWA 2JRFA 1B7TY 1K94A 2L98A 3NSOA 1RROA 5JJGA 1BJFA 1KQMB 2L5XB 4GUKA 2ZRTA 5DKRA 3D10A 3OX5A 2MHHA 3KHEA 3SG5A 2JTTA 3BQ3A 2LM5A 1G4YR 1SCMC 5BPJA 4YGCB 1DMOA 1GGZA 1F4QA 3OB2B 1J7PA 1LINA 2ZN9A 1F70A 2O5GA 3I5GB 2L2EA 4OKHA 3AAKA 5TNCA 3VRQA 4CFQA 5F6TA 1SY9A 2JXCA 5AERA 1S1EA 4ICBA 3NSIA 4HRGA 1PRWA 1TN4A 1PSBA 2I18A 1AP4A 1M31A 3SG4A 1JSAA 4U8DA 1PVBA 2F2PA 2WCFA 3ZWHA 3CTNA 5D69A 1XFZO 1B8RA 1M45A 1DJZA 1UHJA 1KFXS 1YVLA 1SCVA 5DKNA 2KQYA 4QJ5B 3PATA 4GAOA 3H4SE 4Q04A 4YI8A 2MRDA 1J7QA 1AVSA 1LKJA 1TRFA 1UWOA 5J3XA 1S6JA 4GGNA 1QX5B 3SIBA 4AQIA 4MRYA 1JF0A 2GGMA 4YI9A 4FTGA 1CDPA 3CR5X 4JQ0D 5I2OA 1CKKA 2Y1MA 2JU0A 5D7FA 3TZ1A 1KFUS 2JPTA 2KI4B 3EKJA 4WQ2A 2ISDA 1GJYA 2QPTA 5FYXA 1K96A 1SBJA 4E68A 2OTGC 2LLSA 1OSAA 4P5OE 2AAOA 2KGRA 1S36A 1YRTB 1TNQA 1ZMZA 3LL8B 3OB1B 2NZ0A 1XK4C 3MSEB 3O4YA 2JNFA 3DF0A 2SASA 2CBLA 1SK6D 2PVBA 1J55A 1C07A 4FQOA 1R6PA 3WHUB 1D1OA 2K2AA 1F54A 1KK8C 4GPLB 1SR6B 2KDHA 4MRXA 2L50A 3JVTC 1JBAA 4OR9B 3JTDC 3HCMA 3EVRA 4GGFA 2CCMA 2KBMA 2MBXA 1RWYA 2KFGA 1XFUO 1NUBA 2Q91A 2HETA 3EK7A 1DJWA 2GV5A 3SG7A 1IGVA 1XVJA 4ZCUA 3WNXB 2WCBA 2PSRA 1HT9A 1A75A 1JF2A 3CGAA 2I94A 2EC6B 1IKUA 5KU1A 4USLA 2HQWA 1QTXA 3I5HB 3PM8A 1YURA 1SPYA 2KQ6A 2M3WA 3PN7B 1SL8A 2KNEA 1H4BA 1NX2A 2H2KA 1DF0A 1FW4A 2KBIA 3WHTB 2BL0C 3AKBA 2JZIA 1DF0B 1NX0A 2NXQA 5ER5A 1KFUL 1FI6A 1BODA 2KI6D 1KQVA 1MXEA 3O78A 2G9BA 1AHRA 1QJTA 3RM1A 1ODBA 3TUYC 4PHKA 4CLNA 2K0JA 1PALA 1B8LA 4NQGA 3DVEA 3GK1A 1AUIB 2F3YA 5KSZA 5JOLA 2KFFA 4DRWA 2KI6C 2KOTA 1CLMA 1C7VA 1UP5A 3A4UB 2LCPA 3TS5B 3WXAA 3EVVA 4L9MA 1EH2A 1QV1A 1U5IA 2L51A 1QVIZ 1CB1A 4D1EA 1U5IB 1LVCD 2CXJA 1OMDA 2M1KB 1VRKA 4M2QA 2LC5A 3IF7A 4PE4A 1OZSA 2HQ8A 2ZN8A 1DVIA 2LHIA 4NDDA 1C7WA 1Y1AA 3O2PA 5CSJA 3C1VA 2LNKA 3DD4A 3BUWB 4MVFA 3CR4X 4ZCVA 5IBWA 5HKZA 1UURA 2Y5IA 1R2UA 1XA5A 2PASA 4DS7A 1BMOA 1LA3A 1QLSA 1YX8A 4PE1A 4XJKB 1CDNA 3I5FC 3BUMB 3IQQA 3KPXA 3NXAA 2LMTA 1N2DA 1DJYA 1KK7Z 1PVAA 5AANA 1A03A 1QVIY 1CFFA 4ETOA 1F71A 2KAVA 2R2IA 1CTRA 1QIVA 1DGVA 2MJWB 1EG4A 1E8AA 1JFJA 1FI5A 3LLEA 1WDCB 1QATA 1MQ1A 1FBVA 2BCAA 4DCKA 2K7BA 1CLBA 2JC2A 1A4PA 1NCYA 2COLB 1MR8A 4I5JA 1BU3A 1YUTA 2FCEA 2KYCA 1CM4A 1XFYO 1KWOB 1JC2A 1QASA 2F2OA 4CPVA 2JTZA 4HREE 3SIAA 5GQQC 1S5GZ 2M29A 1XFVO 2LVKA 1KK7Y 1DJHA 1OQPA 2BE6A 3D0YA 1NIWA 2K8MB 1J1DA 3GK4X 1SNLA 2MAZA 1J7OA 1F4OA 3D0YB 3EK8A 4M2PA 2JT8A 4WRIA 3F45A 4YGEB 4DIRA 1MXLC 2NLNA 2D8NA 2F33A 2JQ6A 4YGAA 1SL9A 3OP0A 2E6WA 1M46A 1UHHA 2LAPA 4PHMA 3VGOA 1M63B 2K2FA 1DGUA 5G08A 4MZLA 3BUNB 2LP2A 3DVKA 4C0KA 2M7NA 3CZTX 3I5IB 2K7CA 1Y1XA 1TNPA 2Q4UA 4CIDA 5K89A 2I7AA 1CLLA 1AJ5A 2FCDA 1S6IA 1QX7A 1SMGA 1KSOA 4I5KA 1S5GY 2LUCA 4YGBB 3FWCA 2Y1NA 4GGFC 3KEVA 2KAXA 4OVNF 1QIWA 3QRXA 1DJGA 2ZFDA 3ZNIA 1ZUZA 3BUXB 1NWDA 2JULA 2OS8C 1CFCA 3PFVA 2B1UA 5AEQA 1RECA 1J7RA 2CNPA 2EC6C 2M97A 4A4BA 3BYAA 1KSMA 3DVMA 3I5HC 2LHLA 2LUXA 2ZNDA 4CFRA 2G2BA 3FS7A 3TDZA 1BG1A 1TIZA 3CR2A 2ZRSA 2KAYA 4AQJA 1CMGA 4JPZB 3TDUA 1CMFA 4JWQA 1QXPA 1WY9A 2P6BB 1L2OC 1IWQA 5AXIA 1RK9A 3BUOB 2H61A 2IS9A 4IL1A 1RTP1 1XYDA 3VRPA 3EK4A 2BKIB 2F8PA 1GGWA 1KCYA 1IQ3A 1DTLA 3EVUA 2LV7A 2JT0A 5KTYA 2EHBA 4ORAB 1BOCA 3E3RA 3LCPC 4NDBA 2BKHB 2JWWA 2MLFC 1OMVA 3JVTB 4UPGA 1NP8A 3NSLA 1PK0D 1ALVA 4YBHB 1SYMA 5HLVA 1F55A 2FOTA 1FF1A 2LMVA 2BBNA 1JFKA 1LA0A 2LVJA 1UHKA 2QACA 1AJ4A 1CDMA 4BY4A 2LP3A 3A8RA 1B8CA 1KQMC 1PULA 2MA2A 4BY5A 2OPOA 1K90D 1WLZA 1DJIA 2M49B 3VRRA 1YRUB 2M0RA 1XO5A 1OZOA 2CT9A 1SL7A 2AUCA 2AMIA 2HF5A 1S26D 3I5GC 1F8HA 1EJ3A 2DOQA 2L0PA 1S6CA 3BOWB 1IG5A 1NYAA 1N65A 1UHNA 4MZJA 1B47A 1IJ5A 1WRLA 2WOSA 1CM1A 4HRHA 2BL0B 2FJUB 2L4IA 4XJKA 5CPVA 1NSHA 2BCXA 2MLEC 1WDCC 1CNPA 1JUOA 1JWDA 1GQMA 1YVHA 2LVIA 2SCPA 1BLQA 3OHMB 3PALA 2PMYA 2BE4A 2KFHA 2JXLA 1YTZC 4QJ3B 1KWOC 4M2OA 4A4CA 2K7DA 1ALWA 1EXRA 1NCZA 2ZNEA 2LMUA 4TNCA 1L7ZA 1Y0VH 5B8IB 2EGDA 2I2RE 1MF8B 1YR5A 1K9UA 3GOFA 1TCOB 2F3ZA 2V53A 1YUSA 3K21A 3GK2A 2KI4C 1RJVA 2A4JA 1N0YA 1Y6WA 1A29A 2JOJA 5CSNA 4P2YB 1IRJA 3I5IC 1SCMB 1DJXA 1SW8A 2WNDA 4R1EA 1OE9B 4GFTA 1K9PA 3ICBA 1V1FA 2M8UA 3AKAA 1K2HA 1IJ6A 3OX6A 1ZACA 3IQOA 3SG6A 3SJSA 3I5FB 4OCIA 3HX4A 1K93D 4MBEA 2GGZA 1SR6C 4YRUA 1TOPA 2K7OA 3TDIA 4ORCB 1IQ5A 4PHNA 2LLUA 3CS1A 4N1GA 1NX1A 2L4HA 1SKTA 1XFXO 2VRGA 4F0ZB 3RLZA 1NX3A 2K61A 1G8IA 2LLTA 4HSZA 4C0LA 2JT3A 3EKHA 4N5XA 4AOMA 2NCPA 1V1GA 3PLFB 1TTXA 5HKWA 2LANA 5AFPA 4PHJA 1WRKA 1BR4B 1OMRA 4GNKB 1QLKA 3PSRA 2BCBA 1OOJA 1QX2A 2M9GA 3DVJA 1BF5A 1UHIA 2PALA 2RGIA 4WQ3A 3PN7C 2H61C 1NPQA 3FIAA 4GBAA 4I5LB 1H8BA 1S3PA 2ZKMX 3DF0B 3BXKA 4I5NB 4YGDB 1SRAA 4PE7A 2OTGB 5DKQA 5CSFA 1B9AA 1EG3A 1Q80A 1XK4A 4NDCA 1NCXA 2WC8A 2LVVA 5I8NA 4ORBB 2JNXA 5HLOA 2M1UA 1HQVA 4XYNA 2WORA 2Y4QA 3LK0A 3SG3A 1EL4A 1ZOTB 1QV0A 1WLMA 1K8UA 1K9KA 1RFJA 1YX7A 2BBMA 1CDLA 3KO0A 2KHNA 4MZKA 1CFPA 1KK8B 1XFWO 3CLNA 5I2LA 4MN0A 5CSIA 3NSKA 3TS5C 4QJ4B 1KFXL 2LE9B 2OS8B 4OV2A 3VROA 1AK8A 2WCEA 2KSPA 1WRZA 3JTDB 4MSPA 3AAJA 1YUUA 1DT7B 1Y1UA 1MHOA 3M0WA 5ER4X 1B1GA 1A75B 4C0JA 1PSRA 5PALA 1IH0A 1X02A 5HYDA 1W7JB 1G33A 1A2XA 1TNWA 2M7LA 1B7TZ 1L2OB 4N1FA 2NCOA 3BOWA 2HPSA 4MEWA 1MUXA 1LXFC 3KF9A 1QS7A 2BECA 2PRUA 1B4CA 4PALA 2E30A 3O6BA 5HKYA 2KYFA 1K95A 1FPWA 3VRNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PDZ A;  4PCW A;  3LK1 A;  1BT6 A;  1MWN A;  2KGB C;  4PE0 A;  4DUQ A;  1ZFS A;  1J1E A;  1TNX A;  2CTN A;  5I2Q A;  3CWG A;  1UUS A;  3FWB A;  2O60 A;  3TUY B;  3SG2 A;  1W7I B;  1TCF A;  1M39 A;  1CFD A;  2TN4 A;  1BR1 B;  4MLW A;  2JRF A;  1B7T Y;  1K94 A;  2L98 A;  3NSO A;  1RRO A;  5JJG A;  1BJF A;  1KQM B;  2L5X B;  4GUK A;  2ZRT A;  5DKR A;  3D10 A;  3OX5 A;  2MHH A;  3KHE A;  3SG5 A;  2JTT A;  3BQ3 A;  2LM5 A;  1G4Y R;  1SCM C;  5BPJ A;  4YGC B;  1DMO A;  1GGZ A;  1F4Q A;  3OB2 B;  1J7P A;  1LIN A;  2ZN9 A;  1F70 A;  2O5G A;  3I5G B;  2L2E A;  4OKH A;  3AAK A;  5TNC A;  3VRQ A;  4CFQ A;  5F6T A;  1SY9 A;  2JXC A;  5AER A;  1S1E A;  4ICB A;  3NSI A;  4HRG A;  1PRW A;  1TN4 A;  1PSB A;  2I18 A;  1AP4 A;  1M31 A;  3SG4 A;  1JSA A;  4U8D A;  1PVB A;  2F2P A;  2WCF A;  3ZWH A;  3CTN A;  5D69 A;  1XFZ O;  1B8R A;  1M45 A;  1DJZ A;  1UHJ A;  1KFX S;  1YVL A;  1SCV A;  5DKN A;  2KQY A;  4QJ5 B;  3PAT A;  4GAO A;  3H4S E;  4Q04 A;  4YI8 A;  2MRD A;  1J7Q A;  1AVS A;  1LKJ A;  1TRF A;  1UWO A;  5J3X A;  1S6J A;  4GGN A;  1QX5 B;  3SIB A;  4AQI A;  4MRY A;  1JF0 A;  2GGM A;  4YI9 A;  4FTG A;  1CDP A;  3CR5 X;  4JQ0 D;  5I2O A;  1CKK A;  2Y1M A;  2JU0 A;  5D7F A;  3TZ1 A;  1KFU S;  2JPT A;  2KI4 B;  3EKJ A;  4WQ2 A;  2ISD A;  1GJY A;  2QPT A;  5FYX A;  1K96 A;  1SBJ A;  4E68 A;  2OTG C;  2LLS A;  1OSA A;  4P5O E;  2AAO A;  2KGR A;  1S36 A;  1YRT B;  1TNQ A;  1ZMZ A;  3LL8 B;  3OB1 B;  2NZ0 A;  1XK4 C;  3MSE B;  3O4Y A;  2JNF A;  3DF0 A;  2SAS A;  2CBL A;  1SK6 D;  2PVB A;  1J55 A;  1C07 A;  4FQO A;  1R6P A;  3WHU B;  1D1O A;  2K2A A;  1F54 A;  1KK8 C;  4GPL B;  1SR6 B;  2KDH A;  4MRX A;  2L50 A;  3JVT C;  1JBA A;  4OR9 B;  3JTD C;  3HCM A;  3EVR A;  4GGF A;  2CCM A;  2KBM A;  2MBX A;  1RWY A;  2KFG A;  1XFU O;  1NUB A;  2Q91 A;  2HET A;  3EK7 A;  1DJW A;  2GV5 A;  3SG7 A;  1IGV A;  1XVJ A;  4ZCU A;  3WNX B;  2WCB A;  2PSR A;  1HT9 A;  1A75 A;  1JF2 A;  3CGA A;  2I94 A;  2EC6 B;  1IKU A;  5KU1 A;  4USL A;  2HQW A;  1QTX A;  3I5H B;  3PM8 A;  1YUR A;  1SPY A;  2KQ6 A;  2M3W A;  3PN7 B;  1SL8 A;  2KNE A;  1H4B A;  1NX2 A;  2H2K A;  1DF0 A;  1FW4 A;  2KBI A;  3WHT B;  2BL0 C;  3AKB A;  2JZI A;  1DF0 B;  1NX0 A;  2NXQ A;  5ER5 A;  1KFU L;  1FI6 A;  1BOD A;  2KI6 D;  1KQV A;  1MXE A;  3O78 A;  2G9B A;  1AHR A;  1QJT A;  3RM1 A;  1ODB A;  3TUY C;  4PHK A;  4CLN A;  2K0J A;  1PAL A;  1B8L A;  4NQG A;  3DVE A;  3GK1 A;  1AUI B;  2F3Y A;  5KSZ A;  5JOL A;  2KFF A;  4DRW A;  2KI6 C;  2KOT A;  1CLM A;  1C7V A;  1UP5 A;  3A4U B;  2LCP A;  3TS5 B;  3WXA A;  3EVV A;  4L9M A;  1EH2 A;  1QV1 A;  1U5I A;  2L51 A;  1QVI Z;  1CB1 A;  4D1E A;  1U5I B;  1LVC D;  2CXJ A;  1OMD A;  2M1K B;  1VRK A;  4M2Q A;  2LC5 A;  3IF7 A;  4PE4 A;  1OZS A;  2HQ8 A;  2ZN8 A;  1DVI A;  2LHI A;  4NDD A;  1C7W A;  1Y1A A;  3O2P A;  5CSJ A;  3C1V A;  2LNK A;  3DD4 A;  3BUW B;  4MVF A;  3CR4 X;  4ZCV A;  5IBW A;  5HKZ A;  1UUR A;  2Y5I A;  1R2U A;  1XA5 A;  2PAS A;  4DS7 A;  1BMO A;  1LA3 A;  1QLS A;  1YX8 A;  4PE1 A;  4XJK B;  1CDN A;  3I5F C;  3BUM B;  3IQQ A;  3KPX A;  3NXA A;  2LMT A;  1N2D A;  1DJY A;  1KK7 Z;  1PVA A;  5AAN A;  1A03 A;  1QVI Y;  1CFF A;  4ETO A;  1F71 A;  2KAV A;  2R2I A;  1CTR A;  1QIV A;  1DGV A;  2MJW B;  1EG4 A;  1E8A A;  1JFJ A;  1FI5 A;  3LLE A;  1WDC B;  1QAT A;  1MQ1 A;  1FBV A;  2BCA A;  4DCK A;  2K7B A;  1CLB A;  2JC2 A;  1A4P A;  1NCY A;  2COL B;  1MR8 A;  4I5J A;  1BU3 A;  1YUT A;  2FCE A;  2KYC A;  1CM4 A;  1XFY O;  1KWO B;  1JC2 A;  1QAS A;  2F2O A;  4CPV A;  2JTZ A;  4HRE E;  3SIA A;  5GQQ C;  1S5G Z;  2M29 A;  1XFV O;  2LVK A;  1KK7 Y;  1DJH A;  1OQP A;  2BE6 A;  3D0Y A;  1NIW A;  2K8M B;  1J1D A;  3GK4 X;  1SNL A;  2MAZ A;  1J7O A;  1F4O A;  3D0Y B;  3EK8 A;  4M2P A;  2JT8 A;  4WRI A;  3F45 A;  4YGE B;  4DIR A;  1MXL C;  2NLN A;  2D8N A;  2F33 A;  2JQ6 A;  4YGA A;  1SL9 A;  3OP0 A;  2E6W A;  1M46 A;  1UHH A;  2LAP A;  4PHM A;  3VGO A;  1M63 B;  2K2F A;  1DGU A;  5G08 A;  4MZL A;  3BUN B;  2LP2 A;  3DVK A;  4C0K A;  2M7N A;  3CZT X;  3I5I B;  2K7C A;  1Y1X A;  1TNP A;  2Q4U A;  4CID A;  5K89 A;  2I7A A;  1CLL A;  1AJ5 A;  2FCD A;  1S6I A;  1QX7 A;  1SMG A;  1KSO A;  4I5K A;  1S5G Y;  2LUC A;  4YGB B;  3FWC A;  2Y1N A;  4GGF C;  3KEV A;  2KAX A;  4OVN F;  1QIW A;  3QRX A;  1DJG A;  2ZFD A;  3ZNI A;  1ZUZ A;  3BUX B;  1NWD A;  2JUL A;  2OS8 C;  1CFC A;  3PFV A;  2B1U A;  5AEQ A;  1REC A;  1J7R A;  2CNP A;  2EC6 C;  2M97 A;  4A4B A;  3BYA A;  1KSM A;  3DVM A;  3I5H C;  2LHL A;  2LUX A;  2ZND A;  4CFR A;  2G2B A;  3FS7 A;  3TDZ A;  1BG1 A;  1TIZ A;  3CR2 A;  2ZRS A;  2KAY A;  4AQJ A;  1CMG A;  4JPZ B;  3TDU A;  1CMF A;  4JWQ A;  1QXP A;  1WY9 A;  2P6B B;  1L2O C;  1IWQ A;  5AXI A;  1RK9 A;  3BUO B;  2H61 A;  2IS9 A;  4IL1 A;  1RTP 1;  1XYD A;  3VRP A;  3EK4 A;  2BKI B;  2F8P A;  1GGW A;  1KCY A;  1IQ3 A;  1DTL A;  3EVU A;  2LV7 A;  2JT0 A;  5KTY A;  2EHB A;  4ORA B;  1BOC A;  3E3R A;  3LCP C;  4NDB A;  2BKH B;  2JWW A;  2MLF C;  1OMV A;  3JVT B;  4UPG A;  1NP8 A;  3NSL A;  1PK0 D;  1ALV A;  4YBH B;  1SYM A;  5HLV A;  1F55 A;  2FOT A;  1FF1 A;  2LMV A;  2BBN A;  1JFK A;  1LA0 A;  2LVJ A;  1UHK A;  2QAC A;  1AJ4 A;  1CDM A;  4BY4 A;  2LP3 A;  3A8R A;  1B8C A;  1KQM C;  1PUL A;  2MA2 A;  4BY5 A;  2OPO A;  1K90 D;  1WLZ A;  1DJI A;  2M49 B;  3VRR A;  1YRU B;  2M0R A;  1XO5 A;  1OZO A;  2CT9 A;  1SL7 A;  2AUC A;  2AMI A;  2HF5 A;  1S26 D;  3I5G C;  1F8H A;  1EJ3 A;  2DOQ A;  2L0P A;  1S6C A;  3BOW B;  1IG5 A;  1NYA A;  1N65 A;  1UHN A;  4MZJ A;  1B47 A;  1IJ5 A;  1WRL A;  2WOS A;  1CM1 A;  4HRH A;  2BL0 B;  2FJU B;  2L4I A;  4XJK A;  5CPV A;  1NSH A;  2BCX A;  2MLE C;  1WDC C;  1CNP A;  1JUO A;  1JWD A;  1GQM A;  1YVH A;  2LVI A;  2SCP A;  1BLQ A;  3OHM B;  3PAL A;  2PMY A;  2BE4 A;  2KFH A;  2JXL A;  1YTZ C;  4QJ3 B;  1KWO C;  4M2O A;  4A4C A;  2K7D A;  1ALW A;  1EXR A;  1NCZ A;  2ZNE A;  2LMU A;  4TNC A;  1L7Z A;  1Y0V H;  5B8I B;  2EGD A;  2I2R E;  1MF8 B;  1YR5 A;  1K9U A;  3GOF A;  1TCO B;  2F3Z A;  2V53 A;  1YUS A;  3K21 A;  3GK2 A;  2KI4 C;  1RJV A;  2A4J A;  1N0Y A;  1Y6W A;  1A29 A;  2JOJ A;  5CSN A;  4P2Y B;  1IRJ A;  3I5I C;  1SCM B;  1DJX A;  1SW8 A;  2WND A;  4R1E A;  1OE9 B;  4GFT A;  1K9P A;  3ICB A;  1V1F A;  2M8U A;  3AKA A;  1K2H A;  1IJ6 A;  3OX6 A;  1ZAC A;  3IQO A;  3SG6 A;  3SJS A;  3I5F B;  4OCI A;  3HX4 A;  1K93 D;  4MBE A;  2GGZ A;  1SR6 C;  4YRU A;  1TOP A;  2K7O A;  3TDI A;  4ORC B;  1IQ5 A;  4PHN A;  2LLU A;  3CS1 A;  4N1G A;  1NX1 A;  2L4H A;  1SKT A;  1XFX O;  2VRG A;  4F0Z B;  3RLZ A;  1NX3 A;  2K61 A;  1G8I A;  2LLT A;  4HSZ A;  4C0L A;  2JT3 A;  3EKH A;  4N5X A;  4AOM A;  2NCP A;  1V1G A;  3PLF B;  1TTX A;  5HKW A;  2LAN A;  5AFP A;  4PHJ A;  1WRK A;  1BR4 B;  1OMR A;  4GNK B;  1QLK A;  3PSR A;  2BCB A;  1OOJ A;  1QX2 A;  2M9G A;  3DVJ A;  1BF5 A;  1UHI A;  2PAL A;  2RGI A;  4WQ3 A;  3PN7 C;  2H61 C;  1NPQ A;  3FIA A;  4GBA A;  4I5L B;  1H8B A;  1S3P A;  2ZKM X;  3DF0 B;  3BXK A;  4I5N B;  4YGD B;  1SRA A;  4PE7 A;  2OTG B;  5DKQ A;  5CSF A;  1B9A A;  1EG3 A;  1Q80 A;  1XK4 A;  4NDC A;  1NCX A;  2WC8 A;  2LVV A;  5I8N A;  4ORB B;  2JNX A;  5HLO A;  2M1U A;  1HQV A;  4XYN A;  2WOR A;  2Y4Q A;  3LK0 A;  3SG3 A;  1EL4 A;  1ZOT B;  1QV0 A;  1WLM A;  1K8U A;  1K9K A;  1RFJ A;  1YX7 A;  2BBM A;  1CDL A;  3KO0 A;  2KHN A;  4MZK A;  1CFP A;  1KK8 B;  1XFW O;  3CLN A;  5I2L A;  4MN0 A;  5CSI A;  3NSK A;  3TS5 C;  4QJ4 B;  1KFX L;  2LE9 B;  2OS8 B;  4OV2 A;  3VRO A;  1AK8 A;  2WCE A;  2KSP A;  1WRZ A;  3JTD B;  4MSP A;  3AAJ A;  1YUU A;  1DT7 B;  1Y1U A;  1MHO A;  3M0W A;  5ER4 X;  1B1G A;  1A75 B;  4C0J A;  1PSR A;  5PAL A;  1IH0 A;  1X02 A;  5HYD A;  1W7J B;  1G33 A;  1A2X A;  1TNW A;  2M7L A;  1B7T Z;  1L2O B;  4N1F A;  2NCO A;  3BOW A;  2HPS A;  4MEW A;  1MUX A;  1LXF C;  3KF9 A;  1QS7 A;  2BEC A;  2PRU A;  1B4C A;  4PAL A;  2E30 A;  3O6B A;  5HKY A;  2KYF A;  1K95 A;  1FPW A;  3VRN A; 
#chains in the Genus database with same CATH topology
 4PDZ A;  4PCW A;  3LK1 A;  1BT6 A;  1MWN A;  2KGB C;  4PE0 A;  4DUQ A;  1ZFS A;  1J1E A;  3NHI A;  1TNX A;  1Z2C B;  2CTN A;  5I2Q A;  3CWG A;  1UUS A;  3FWB A;  2O60 A;  3TUY B;  3SG2 A;  1W7I B;  1TCF A;  1M39 A;  1CFD A;  2TN4 A;  1BR1 B;  4MLW A;  2JRF A;  3CZ1 A;  1B7T Y;  2WCK A;  2ERB A;  1K94 A;  2L98 A;  3BJH A;  1RRO A;  3NSO A;  1BJF A;  1KQM B;  5JJG A;  2L5X B;  4GUK A;  2ZRT A;  5DKR A;  3D10 A;  3OX5 A;  2MHH A;  3KHE A;  3SG5 A;  2JTT A;  3BQ3 A;  2QEH A;  2LM5 A;  1G4Y R;  1SCM C;  5BPJ A;  4YGC B;  1DMO A;  1GGZ A;  1F4Q A;  3OB2 B;  1J7P A;  1LIN A;  2ZN9 A;  1F70 A;  2O5G A;  3I5G B;  2L2E A;  4OKH A;  3AAK A;  5TNC A;  3VRQ A;  3UO9 A;  5F6T A;  4CFQ A;  1SY9 A;  2JXC A;  5AER A;  3R1P A;  1S1E A;  4ICB A;  1SSE B;  3NSI A;  4HRG A;  1PRW A;  1TN4 A;  1PSB A;  1TUZ A;  2I18 A;  1AP4 A;  1M31 A;  2QDI A;  3SG4 A;  3VRN A;  1JSA A;  4U8D A;  1PVB A;  2F2P A;  2WCF A;  3ZWH A;  2H8V A;  3CTN A;  5D69 A;  1XFZ O;  1B8R A;  1M45 A;  1DJZ A;  1UHJ A;  1KFX S;  1YVL A;  1SCV A;  5DKN A;  2KQY A;  4QJ5 B;  3PAT A;  4GAO A;  3H4S E;  4Q04 A;  4YI8 A;  2MRD A;  1J7Q A;  1AVS A;  1LKJ A;  1TRF A;  1UWO A;  5J3X A;  1S6J A;  2WC5 A;  4GGN A;  1QX5 B;  3SIB A;  4AQI A;  4MRY A;  1JF0 A;  2GGM A;  4YI9 A;  3BFA A;  4FQT A;  4FTG A;  1CDP A;  3CR5 X;  4JQ0 D;  5I2O A;  1CKK A;  2Y1M A;  1TWO A;  2JU0 A;  2QEB A;  5D7F A;  3TZ1 A;  1KFU S;  2JPT A;  2KI4 B;  3EKJ A;  4WQ2 A;  2ISD A;  1GJY A;  2QPT A;  5FYX A;  1K96 A;  1SBJ A;  4E68 A;  2OTG C;  3FE9 A;  2LLS A;  1OSA A;  4P5O E;  2AAO A;  2KGR A;  1S36 A;  1YRT B;  1TNQ A;  1ZMZ A;  3LL8 B;  3OB1 B;  2NZ0 A;  1XK4 C;  3MSE B;  3O4Y A;  2JNF A;  3DF0 A;  3R72 A;  2SAS A;  3SS4 A;  2CBL A;  2KLE A;  1SK6 D;  2PVB A;  1J55 A;  1C07 A;  1DC1 A;  4FQO A;  1R6P A;  3WHU B;  1D1O A;  2K2A A;  1F54 A;  1KK8 C;  4GPL B;  1SR6 B;  2KDH A;  4MRX A;  2L50 A;  3JVT C;  3DZT A;  1JBA A;  4OR9 B;  3JTD C;  3HCM A;  3EVR A;  4GGF A;  2CCM A;  2KBM A;  2MBX A;  3SS3 A;  1RWY A;  2KFG A;  1XFU O;  1NUB A;  2Q91 A;  2HET A;  2QEV A;  3EK7 A;  1DJW A;  2GV5 A;  3SG7 A;  1IGV A;  1XVJ A;  4ZCU A;  3WNX B;  3L4A A;  2WCB A;  2PSR A;  1HT9 A;  1A75 A;  1JF2 A;  3CGA A;  2I94 A;  2EC6 B;  1IKU A;  5KU1 A;  4USL A;  2HQW A;  1QTX A;  3I5H B;  3NGV A;  3PM8 A;  1YUR A;  1SPY A;  2KQ6 A;  2M3W A;  3PN7 B;  1SL8 A;  2KNE A;  1H4B A;  1NX2 A;  2H2K A;  1DF0 A;  1OOG A;  1FW4 A;  3CAB A;  2KBI A;  3WHT B;  2BL0 C;  3AKB A;  2JZI A;  1DF0 B;  1C3Z A;  1NX0 A;  2NXQ A;  5ER5 A;  1W9Z A;  4JD9 A;  1KFU L;  4JKT A;  2BAP A;  1BOD A;  2KI6 D;  1FI6 A;  1MXE A;  2PYQ A;  1KQV A;  3O78 A;  2G9B A;  1AHR A;  1QJT A;  3RM1 A;  1ODB A;  3TUY C;  4PHK A;  4CLN A;  2K0J A;  1PAL A;  1B8L A;  4NQG A;  1DQE A;  3DVE A;  3GK1 A;  1AUI B;  1ORG A;  2F3Y A;  5KSZ A;  5JOL A;  2KFF A;  1Z4H A;  4DRW A;  3N7H A;  2KI6 C;  2KOT A;  1CLM A;  1C7V A;  1UP5 A;  3O4X A;  3A4U B;  2LCP A;  3TS5 B;  3WXA A;  3EVV A;  4L9M A;  1EH2 A;  1QV1 A;  1U5I A;  1OOH A;  2L51 A;  2P70 A;  1QVI Z;  1CB1 A;  4D1E A;  1U5I B;  1LVC D;  2CXJ A;  1OMD A;  1OOI X;  2M1K B;  3B6X A;  1VRK A;  4M2Q A;  2LC5 A;  3IF7 A;  4PE4 A;  1OZS A;  2HQ8 A;  2ZN8 A;  1DVI A;  2LHI A;  4NDD A;  1C7W A;  1LS8 A;  2FJY A;  1Y1A A;  3O2P A;  5CSJ A;  3C1V A;  2LNK A;  3DD4 A;  4INX A;  3BUW B;  4MVF A;  3CR4 X;  4ZCV A;  5IBW A;  4IJ7 A;  5HKZ A;  1UUR A;  2Y5I A;  1R2U A;  1XA5 A;  2PAS A;  4DS7 A;  1BMO A;  1LA3 A;  1QLS A;  1YX8 A;  4PE1 A;  4XJK B;  1CDN A;  3I5F C;  1OW4 A;  3BUM B;  3IQQ A;  3KPX A;  3NXA A;  2LMT A;  1N2D A;  1DJY A;  1KK7 Z;  1PVA A;  1T14 A;  3DXL A;  2K60 A;  5AAN A;  1A03 A;  1QVI Y;  1CFF A;  4ETO A;  1F71 A;  2KAV A;  2R2I A;  1CTR A;  1QIV A;  1DGV A;  2MJW B;  1EG4 A;  1E8A A;  1JFJ A;  1FI5 A;  3LLE A;  1WDC B;  1XFR A;  1QAT A;  1MQ1 A;  1FBV A;  2BCA A;  3D74 A;  4DCK A;  2K7B A;  1CLB A;  2JC2 A;  4F7F A;  1A4P A;  3PJI A;  3K1E A;  1NCY A;  2COL B;  1MR8 A;  4I5J A;  1BU3 A;  1YUT A;  2FCE A;  2KYC A;  3S0G A;  1CM4 A;  1XFY O;  1KWO B;  1JC2 A;  1DEL A;  1QAS A;  2F2O A;  5HL1 A;  4CPV A;  2JTZ A;  4HRE E;  3OGN A;  3SIA A;  5GQQ C;  1S5G Z;  2M29 A;  1XFV O;  2LVK A;  3L47 A;  1KK7 Y;  1DJH A;  1OQP A;  2BE6 A;  3D0Y A;  1NIW A;  2K8M B;  2YGU A;  1J1D A;  3GK4 X;  3D76 A;  1SNL A;  2QEO A;  2MAZ A;  1J7O A;  1F4O A;  3D0Y B;  3EK8 A;  4M2P A;  2JT8 A;  4WRI A;  3F45 A;  4YGE B;  4DIR A;  1MXL C;  2NLN A;  2D8N A;  2F33 A;  2JQ6 A;  4YGA A;  1SL9 A;  3OP0 A;  2E6W A;  1M46 A;  1UHH A;  2LAP A;  4PHM A;  3VGO A;  1M63 B;  2K2F A;  1DGU A;  5G08 A;  4MZL A;  3BUN B;  2LP2 A;  3DVK A;  4C0K A;  3CZ2 A;  2M7N A;  3CZT X;  3I5I B;  2K7C A;  1Y1X A;  1TNP A;  2Q4U A;  4CID A;  5K89 A;  2I7A A;  3R1V A;  1CLL A;  1AJ5 A;  2FCD A;  1S6I A;  1QX7 A;  1SMG A;  1KSO A;  4I5K A;  1S5G Y;  2LUC A;  3IVT A;  4YGB B;  3FWC A;  2Y1N A;  4GGF C;  3KEV A;  2KAX A;  4OVN F;  1QIW A;  3QRX A;  1DJG A;  3EG5 B;  2ZFD A;  3ZNI A;  1ZUZ A;  3BUX B;  2GTE A;  1NWD A;  2JUL A;  2OS8 C;  3D78 A;  1CFC A;  3PFV A;  2B1U A;  5FI2 A;  3S0D A;  5AEQ A;  1REC A;  1J7R A;  2CNP A;  2EC6 C;  2M97 A;  4A4B A;  3BYA A;  1KSM A;  3DVM A;  3I5H C;  5FI6 A;  2LHL A;  2LUX A;  2ZND A;  3Q8I A;  4CFR A;  2G2B A;  3B7A A;  3FS7 A;  3TDZ A;  1TIZ A;  3CR2 A;  1BG1 A;  2ZRS A;  2KAY A;  4AQJ A;  1CMG A;  3NHT A;  4JPZ B;  3TDU A;  1CMF A;  4JWQ A;  1QXP A;  1WY9 A;  2P6B B;  3BFH A;  1L2O C;  1IWQ A;  5AXI A;  1RK9 A;  3CYZ A;  3BUO B;  2H61 A;  2IS9 A;  5FI7 A;  4IL1 A;  1RTP 1;  4PT1 A;  1XYD A;  3VRP A;  3EK4 A;  3S0F A;  2L2C A;  2BKI B;  2F8P A;  1GGW A;  1KCY A;  1IQ3 A;  1DTL A;  3EVU A;  2LV7 A;  2JT0 A;  5KTY A;  2EHB A;  4ORA B;  1BOC A;  3E3R A;  3LCP C;  4NDB A;  4INW A;  2BKH B;  2JWW A;  2MLF C;  1OMV A;  3JVT B;  4UPG A;  1NP8 A;  3NSL A;  1PK0 D;  1ALV A;  4YBH B;  1SYM A;  5HLV A;  3UNW A;  1F55 A;  2FOT A;  1FF1 A;  2LMV A;  2BBN A;  1JFK A;  1LA0 A;  2LVJ A;  1UHK A;  2QAC A;  1AJ4 A;  1CDM A;  1GM0 A;  4BY4 A;  2LP3 A;  3A8R A;  1B8C A;  1KQM C;  1PUL A;  2MA2 A;  4BY5 A;  2OPO A;  1K90 D;  1WLZ A;  1DJI A;  2M49 B;  3VRR A;  1YRU B;  2M0R A;  1XO5 A;  3V2L A;  1OZO A;  2CT9 A;  1SL7 A;  2AUC A;  2AMI A;  2HF5 A;  1S26 D;  3I5G C;  1F8H A;  1EJ3 A;  2DOQ A;  2L0P A;  2WCM A;  1S6C A;  3BOW B;  1IG5 A;  1NYA A;  1N65 A;  1UHN A;  4MZJ A;  3D75 A;  1B47 A;  1IJ5 A;  1WRL A;  2WOS A;  1CM1 A;  4HRH A;  2BL0 B;  2FJU B;  2L4I A;  4XJK A;  5CPV A;  1NSH A;  2BCX A;  1OOF A;  1WDC C;  2MLE C;  1CNP A;  3RZS A;  1JUO A;  1JWD A;  1GQM A;  3B87 A;  2WC6 A;  3QME A;  1YVH A;  2LVI A;  4KYN A;  2SCP A;  1BLQ A;  3OHM B;  3PAL A;  2P71 A;  2PMY A;  2BE4 A;  2KFH A;  2JXL A;  1YTZ C;  4QJ3 B;  1KWO C;  4M2O A;  4A4C A;  2K7D A;  1ALW A;  1EXR A;  3CZ0 A;  1NCZ A;  2ZNE A;  2LMU A;  4TNC A;  1L7Z A;  1Y0V H;  5B8I B;  2EGD A;  2I2R E;  3FE8 A;  1MF8 B;  1YR5 A;  1K9U A;  3GOF A;  1TCO B;  2F3Z A;  2V53 A;  3S0A A;  1YUS A;  3K21 A;  3GK2 A;  2KI4 C;  1RJV A;  2A4J A;  1N0Y A;  1Y6W A;  1A29 A;  2JOJ A;  5CSN A;  4P2Y B;  1IRJ A;  3I5I C;  1SCM B;  1DJX A;  1SW8 A;  2WND A;  3PM2 A;  4R1E A;  1OE9 B;  4GFT A;  1K9P A;  3ICB A;  1V1F A;  2WCH A;  2M8U A;  3AKA A;  1K2H A;  1IJ6 A;  3OX6 A;  1ZAC A;  2WCL A;  3IQO A;  3SG6 A;  3SJS A;  2BNX A;  3I5F B;  5DIC A;  4OCI A;  3HX4 A;  3DY9 A;  1K93 D;  4MBE A;  2GGZ A;  1SR6 C;  4YRU A;  1TOP A;  2K7O A;  3TDI A;  4ORC B;  1IQ5 A;  4PHN A;  2LLU A;  3BFB A;  3CS1 A;  1NX1 A;  2L4H A;  1SKT A;  4N1G A;  1XFX O;  2VRG A;  1P28 A;  4F0Z B;  3R1O A;  3RLZ A;  3D73 A;  1NX3 A;  2K61 A;  1G8I A;  2LLT A;  3CDN A;  4HSZ A;  4C0L A;  2JT3 A;  3EKH A;  4N5X A;  3S0E A;  2NCP A;  4AOM A;  1V1G A;  3PLF B;  1TTX A;  2L5Y A;  5HKW A;  2LAN A;  5AFP A;  4PHJ A;  1WRK A;  1BR4 B;  1OMR A;  4GNK B;  3VB1 A;  1QLK A;  3PSR A;  2BCB A;  1OOJ A;  1QX2 A;  2M9G A;  3DVJ A;  1BF5 A;  1UHI A;  2PAL A;  2RGI A;  1TUJ A;  4WQ3 A;  5EL2 A;  3PN7 C;  2H61 C;  1NPQ A;  3FIA A;  4GBA A;  4I5L B;  3D77 A;  1H8B A;  1S3P A;  2ZKM X;  3DF0 B;  5I94 A;  3BXK A;  4I5N B;  4YGD B;  2WCJ A;  1SRA A;  4PE7 A;  2OTG B;  5DKQ A;  3OBV A;  5D3O A;  5CSF A;  1B9A A;  1EG3 A;  1Q80 A;  1XK4 A;  4NDC A;  1NCX A;  2WC8 A;  2LVV A;  5I8N A;  4ORB B;  2JNX A;  5HLO A;  2M1U A;  1HQV A;  4OZD A;  4XYN A;  2WOR A;  2Y4Q A;  3LK0 A;  3SG3 A;  1EL4 A;  1ZOT B;  1QV0 A;  1WLM A;  3FE6 A;  1K8U A;  1K9K A;  1RFJ A;  1YX7 A;  2BBM A;  1CDL A;  3L4L A;  3B86 A;  1DEK A;  2KHN A;  3KO0 A;  4MZK A;  1CFP A;  1KK8 B;  1QWV A;  1XFW O;  3CLN A;  4MN0 A;  5CSI A;  5I2L A;  3NSK A;  3TS5 C;  4QJ4 B;  1KFX L;  2LE9 B;  2OS8 B;  4OV2 A;  3B88 A;  3SS5 A;  3VRO A;  1AK8 A;  2WCE A;  2KSP A;  1WRZ A;  3JTD B;  4MSP A;  3AAJ A;  1YUU A;  1DT7 B;  1Y1U A;  1MHO A;  3M0W A;  5ER4 X;  1B1G A;  1A75 B;  4C0J A;  1PSR A;  1C3Y A;  2JPO A;  3DYE A;  5PAL A;  1IH0 A;  1X02 A;  5HYD A;  1IIO A;  1W7J B;  1G33 A;  1A2X A;  1TNW A;  2M7L A;  1B7T Z;  1L2O B;  4N1F A;  2NCO A;  3BOW A;  2HPS A;  4MEW A;  1MUX A;  2PQL A;  1LXF C;  3KF9 A;  1QS7 A;  2BEC A;  2PRU A;  1B4C A;  3S0B A;  4PAL A;  2E30 A;  3O6B A;  5HKY A;  2KPH A;  2KYF A;  1K95 A;  1FPW A;  2KLD A; 
#chains in the Genus database with same CATH homology
 4PDZ A;  4PCW A;  3LK1 A;  1BT6 A;  1MWN A;  2KGB C;  4PE0 A;  4DUQ A;  1ZFS A;  1J1E A;  1TNX A;  2CTN A;  5I2Q A;  3CWG A;  1UUS A;  3FWB A;  2O60 A;  3TUY B;  3SG2 A;  1W7I B;  1TCF A;  1M39 A;  1CFD A;  2TN4 A;  1BR1 B;  4MLW A;  2JRF A;  1B7T Y;  1K94 A;  2L98 A;  3NSO A;  1RRO A;  5JJG A;  1BJF A;  1KQM B;  2L5X B;  4GUK A;  2ZRT A;  5DKR A;  3D10 A;  3OX5 A;  2MHH A;  3KHE A;  3SG5 A;  2JTT A;  3BQ3 A;  2LM5 A;  1G4Y R;  1SCM C;  5BPJ A;  4YGC B;  1DMO A;  1GGZ A;  1F4Q A;  3OB2 B;  1J7P A;  1LIN A;  2ZN9 A;  1F70 A;  2O5G A;  3I5G B;  2L2E A;  4OKH A;  3AAK A;  5TNC A;  3VRQ A;  4CFQ A;  5F6T A;  1SY9 A;  2JXC A;  5AER A;  1S1E A;  4ICB A;  3NSI A;  4HRG A;  1PRW A;  1TN4 A;  1PSB A;  2I18 A;  1AP4 A;  1M31 A;  3SG4 A;  1JSA A;  4U8D A;  1PVB A;  2F2P A;  2WCF A;  3ZWH A;  3CTN A;  5D69 A;  1XFZ O;  1B8R A;  1M45 A;  1DJZ A;  1UHJ A;  1KFX S;  1YVL A;  1SCV A;  5DKN A;  2KQY A;  4QJ5 B;  3PAT A;  4GAO A;  3H4S E;  4Q04 A;  4YI8 A;  2MRD A;  1J7Q A;  1AVS A;  1LKJ A;  1TRF A;  1UWO A;  5J3X A;  1S6J A;  4GGN A;  1QX5 B;  3SIB A;  4AQI A;  4MRY A;  1JF0 A;  2GGM A;  4YI9 A;  4FTG A;  1CDP A;  3CR5 X;  4JQ0 D;  5I2O A;  1CKK A;  2Y1M A;  2JU0 A;  5D7F A;  3TZ1 A;  1KFU S;  2JPT A;  2KI4 B;  3EKJ A;  4WQ2 A;  2ISD A;  1GJY A;  2QPT A;  5FYX A;  1K96 A;  1SBJ A;  4E68 A;  2OTG C;  2LLS A;  1OSA A;  4P5O E;  2AAO A;  2KGR A;  1S36 A;  1YRT B;  1TNQ A;  1ZMZ A;  3LL8 B;  3OB1 B;  2NZ0 A;  1XK4 C;  3MSE B;  3O4Y A;  2JNF A;  3DF0 A;  2SAS A;  2CBL A;  1SK6 D;  2PVB A;  1J55 A;  1C07 A;  4FQO A;  1R6P A;  3WHU B;  1D1O A;  2K2A A;  1F54 A;  1KK8 C;  4GPL B;  1SR6 B;  2KDH A;  4MRX A;  2L50 A;  3JVT C;  1JBA A;  4OR9 B;  3JTD C;  3HCM A;  3EVR A;  4GGF A;  2CCM A;  2KBM A;  2MBX A;  1RWY A;  2KFG A;  1XFU O;  1NUB A;  2Q91 A;  2HET A;  3EK7 A;  1DJW A;  2GV5 A;  3SG7 A;  1IGV A;  1XVJ A;  4ZCU A;  3WNX B;  2WCB A;  2PSR A;  1HT9 A;  1A75 A;  1JF2 A;  3CGA A;  2I94 A;  2EC6 B;  1IKU A;  5KU1 A;  4USL A;  2HQW A;  1QTX A;  3I5H B;  3PM8 A;  1YUR A;  1SPY A;  2KQ6 A;  2M3W A;  3PN7 B;  1SL8 A;  2KNE A;  1H4B A;  1NX2 A;  2H2K A;  1DF0 A;  1FW4 A;  2KBI A;  3WHT B;  2BL0 C;  3AKB A;  2JZI A;  1DF0 B;  1NX0 A;  2NXQ A;  5ER5 A;  1KFU L;  1FI6 A;  1BOD A;  2KI6 D;  1KQV A;  1MXE A;  3O78 A;  2G9B A;  1AHR A;  1QJT A;  3RM1 A;  1ODB A;  3TUY C;  4PHK A;  4CLN A;  2K0J A;  1PAL A;  1B8L A;  4NQG A;  3DVE A;  3GK1 A;  1AUI B;  2F3Y A;  5KSZ A;  5JOL A;  2KFF A;  4DRW A;  2KI6 C;  2KOT A;  1CLM A;  1C7V A;  1UP5 A;  3A4U B;  2LCP A;  3TS5 B;  3WXA A;  3EVV A;  4L9M A;  1EH2 A;  1QV1 A;  1U5I A;  2L51 A;  1QVI Z;  1CB1 A;  4D1E A;  1U5I B;  1LVC D;  2CXJ A;  1OMD A;  2M1K B;  1VRK A;  4M2Q A;  2LC5 A;  3IF7 A;  4PE4 A;  1OZS A;  2HQ8 A;  2ZN8 A;  1DVI A;  2LHI A;  4NDD A;  1C7W A;  1Y1A A;  3O2P A;  5CSJ A;  3C1V A;  2LNK A;  3DD4 A;  3BUW B;  4MVF A;  3CR4 X;  4ZCV A;  5IBW A;  5HKZ A;  1UUR A;  2Y5I A;  1R2U A;  1XA5 A;  2PAS A;  4DS7 A;  1BMO A;  1LA3 A;  1QLS A;  1YX8 A;  4PE1 A;  4XJK B;  1CDN A;  3I5F C;  3BUM B;  3IQQ A;  3KPX A;  3NXA A;  2LMT A;  1N2D A;  1DJY A;  1KK7 Z;  1PVA A;  5AAN A;  1A03 A;  1QVI Y;  1CFF A;  4ETO A;  1F71 A;  2KAV A;  2R2I A;  1CTR A;  1QIV A;  1DGV A;  2MJW B;  1EG4 A;  1E8A A;  1JFJ A;  1FI5 A;  3LLE A;  1WDC B;  1QAT A;  1MQ1 A;  1FBV A;  2BCA A;  4DCK A;  2K7B A;  1CLB A;  2JC2 A;  1A4P A;  1NCY A;  2COL B;  1MR8 A;  4I5J A;  1BU3 A;  1YUT A;  2FCE A;  2KYC A;  1CM4 A;  1XFY O;  1KWO B;  1JC2 A;  1QAS A;  2F2O A;  4CPV A;  2JTZ A;  4HRE E;  3SIA A;  5GQQ C;  1S5G Z;  2M29 A;  1XFV O;  2LVK A;  1KK7 Y;  1DJH A;  1OQP A;  2BE6 A;  3D0Y A;  1NIW A;  2K8M B;  1J1D A;  3GK4 X;  1SNL A;  2MAZ A;  1J7O A;  1F4O A;  3D0Y B;  3EK8 A;  4M2P A;  2JT8 A;  4WRI A;  3F45 A;  4YGE B;  4DIR A;  1MXL C;  2NLN A;  2D8N A;  2F33 A;  2JQ6 A;  4YGA A;  1SL9 A;  3OP0 A;  2E6W A;  1M46 A;  1UHH A;  2LAP A;  4PHM A;  3VGO A;  1M63 B;  2K2F A;  1DGU A;  5G08 A;  4MZL A;  3BUN B;  2LP2 A;  3DVK A;  4C0K A;  2M7N A;  3CZT X;  3I5I B;  2K7C A;  1Y1X A;  1TNP A;  2Q4U A;  4CID A;  5K89 A;  2I7A A;  1CLL A;  1AJ5 A;  2FCD A;  1S6I A;  1QX7 A;  1SMG A;  1KSO A;  4I5K A;  1S5G Y;  2LUC A;  4YGB B;  3FWC A;  2Y1N A;  4GGF C;  3KEV A;  2KAX A;  4OVN F;  1QIW A;  3QRX A;  1DJG A;  2ZFD A;  3ZNI A;  1ZUZ A;  3BUX B;  1NWD A;  2JUL A;  2OS8 C;  1CFC A;  3PFV A;  2B1U A;  5AEQ A;  1REC A;  1J7R A;  2CNP A;  2EC6 C;  2M97 A;  4A4B A;  3BYA A;  1KSM A;  3DVM A;  3I5H C;  2LHL A;  2LUX A;  2ZND A;  4CFR A;  2G2B A;  3FS7 A;  3TDZ A;  1BG1 A;  1TIZ A;  3CR2 A;  2ZRS A;  2KAY A;  4AQJ A;  1CMG A;  4JPZ B;  3TDU A;  1CMF A;  4JWQ A;  1QXP A;  1WY9 A;  2P6B B;  1L2O C;  1IWQ A;  5AXI A;  1RK9 A;  3BUO B;  2H61 A;  2IS9 A;  4IL1 A;  1RTP 1;  1XYD A;  3VRP A;  3EK4 A;  2BKI B;  2F8P A;  1GGW A;  1KCY A;  1IQ3 A;  1DTL A;  3EVU A;  2LV7 A;  2JT0 A;  5KTY A;  2EHB A;  4ORA B;  1BOC A;  3E3R A;  3LCP C;  4NDB A;  2BKH B;  2JWW A;  2MLF C;  1OMV A;  3JVT B;  4UPG A;  1NP8 A;  3NSL A;  1PK0 D;  1ALV A;  4YBH B;  1SYM A;  5HLV A;  1F55 A;  2FOT A;  1FF1 A;  2LMV A;  2BBN A;  1JFK A;  1LA0 A;  2LVJ A;  1UHK A;  2QAC A;  1AJ4 A;  1CDM A;  4BY4 A;  2LP3 A;  3A8R A;  1B8C A;  1KQM C;  1PUL A;  2MA2 A;  4BY5 A;  2OPO A;  1K90 D;  1WLZ A;  1DJI A;  2M49 B;  3VRR A;  1YRU B;  2M0R A;  1XO5 A;  1OZO A;  2CT9 A;  1SL7 A;  2AUC A;  2AMI A;  2HF5 A;  1S26 D;  3I5G C;  1F8H A;  1EJ3 A;  2DOQ A;  2L0P A;  1S6C A;  3BOW B;  1IG5 A;  1NYA A;  1N65 A;  1UHN A;  4MZJ A;  1B47 A;  1IJ5 A;  1WRL A;  2WOS A;  1CM1 A;  4HRH A;  2BL0 B;  2FJU B;  2L4I A;  4XJK A;  5CPV A;  1NSH A;  2BCX A;  2MLE C;  1WDC C;  1CNP A;  1JUO A;  1JWD A;  1GQM A;  1YVH A;  2LVI A;  2SCP A;  1BLQ A;  3OHM B;  3PAL A;  2PMY A;  2BE4 A;  2KFH A;  2JXL A;  1YTZ C;  4QJ3 B;  1KWO C;  4M2O A;  4A4C A;  2K7D A;  1ALW A;  1EXR A;  1NCZ A;  2ZNE A;  2LMU A;  4TNC A;  1L7Z A;  1Y0V H;  5B8I B;  2EGD A;  2I2R E;  1MF8 B;  1YR5 A;  1K9U A;  3GOF A;  1TCO B;  2F3Z A;  2V53 A;  1YUS A;  3K21 A;  3GK2 A;  2KI4 C;  1RJV A;  2A4J A;  1N0Y A;  1Y6W A;  1A29 A;  2JOJ A;  5CSN A;  4P2Y B;  1IRJ A;  3I5I C;  1SCM B;  1DJX A;  1SW8 A;  2WND A;  4R1E A;  1OE9 B;  4GFT A;  1K9P A;  3ICB A;  1V1F A;  2M8U A;  3AKA A;  1K2H A;  1IJ6 A;  3OX6 A;  1ZAC A;  3IQO A;  3SG6 A;  3SJS A;  3I5F B;  4OCI A;  3HX4 A;  1K93 D;  4MBE A;  2GGZ A;  1SR6 C;  4YRU A;  1TOP A;  2K7O A;  3TDI A;  4ORC B;  1IQ5 A;  4PHN A;  2LLU A;  3CS1 A;  4N1G A;  1NX1 A;  2L4H A;  1SKT A;  1XFX O;  2VRG A;  4F0Z B;  3RLZ A;  1NX3 A;  2K61 A;  1G8I A;  2LLT A;  4HSZ A;  4C0L A;  2JT3 A;  3EKH A;  4N5X A;  4AOM A;  2NCP A;  1V1G A;  3PLF B;  1TTX A;  5HKW A;  2LAN A;  5AFP A;  4PHJ A;  1WRK A;  1BR4 B;  1OMR A;  4GNK B;  1QLK A;  3PSR A;  2BCB A;  1OOJ A;  1QX2 A;  2M9G A;  3DVJ A;  1BF5 A;  1UHI A;  2PAL A;  2RGI A;  4WQ3 A;  3PN7 C;  2H61 C;  1NPQ A;  3FIA A;  4GBA A;  4I5L B;  1H8B A;  1S3P A;  2ZKM X;  3DF0 B;  3BXK A;  4I5N B;  4YGD B;  1SRA A;  4PE7 A;  2OTG B;  5DKQ A;  5CSF A;  1B9A A;  1EG3 A;  1Q80 A;  1XK4 A;  4NDC A;  1NCX A;  2WC8 A;  2LVV A;  5I8N A;  4ORB B;  2JNX A;  5HLO A;  2M1U A;  1HQV A;  4XYN A;  2WOR A;  2Y4Q A;  3LK0 A;  3SG3 A;  1EL4 A;  1ZOT B;  1QV0 A;  1WLM A;  1K8U A;  1K9K A;  1RFJ A;  1YX7 A;  2BBM A;  1CDL A;  3KO0 A;  2KHN A;  4MZK A;  1CFP A;  1KK8 B;  1XFW O;  3CLN A;  5I2L A;  4MN0 A;  5CSI A;  3NSK A;  3TS5 C;  4QJ4 B;  1KFX L;  2LE9 B;  2OS8 B;  4OV2 A;  3VRO A;  1AK8 A;  2WCE A;  2KSP A;  1WRZ A;  3JTD B;  4MSP A;  3AAJ A;  1YUU A;  1DT7 B;  1Y1U A;  1MHO A;  3M0W A;  5ER4 X;  1B1G A;  1A75 B;  4C0J A;  1PSR A;  5PAL A;  1IH0 A;  1X02 A;  5HYD A;  1W7J B;  1G33 A;  1A2X A;  1TNW A;  2M7L A;  1B7T Z;  1L2O B;  4N1F A;  2NCO A;  3BOW A;  2HPS A;  4MEW A;  1MUX A;  1LXF C;  3KF9 A;  1QS7 A;  2BEC A;  2PRU A;  1B4C A;  4PAL A;  2E30 A;  3O6B A;  5HKY A;  2KYF A;  1K95 A;  1FPW A;  3VRN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...