2LAPA

Nmr structure of ca2+-bound cabp1 c-domain with rdc
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
70
structure length
70
Chain Sequence
MIGVKELRDAFREFDTNGDGEISTSELREAMRKLLGHQVGHRDIEEIIRDVDLNGDGRVDFEEFVRMMSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords Calcium-binding protein 1
publication title 1H, 15N, and 13C chemical shift assignments for CaBP1 with 3 Ca2+ bound
rcsb
source organism Homo sapiens
total genus 14
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2011-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lapA00
1V1FA 1XFYO 2P6BB 4PHNA 2KGRA 1B1GA 1NX1A 1E8AA 3TZ1A 2ZFDA 3FWBA 2I94A 1KQMB 3WHTB 2KI6C 2BKHB 3CWGA 3DVJA 4GPLB 3I5IB 1G4YR 1J7RA 3LK0A 2EGDA 1SR6B 1DGVA 1BF5A 1A75A 2M1KB 5AXIA 5I2QA 4CIDA 2L2EA 1QIWA 5HKZA 1YRTB 3AAKA 1DJXA 2CCMA 4JWQA 1SY9A 1F55A 1MQ1A 3K21A 4PE0A 3EVUA 2JU0A 1DJWA 1YUUA 2JXLA 2L51A 4CLNA 2KYFA 2F2PA 4YI9A 1IH0A 5B8IB 4NDCA 1CM1A 1RK9A 1DJZA 5KU1A 5G08A 1QJTA 1QLSA 4QJ3B 1DGUA 1TN4A 1CNPA 1J7OA 2KNEA 4HRHA 3WNXB 3O4YA 1C7WA 1XFVO 1ZOTB 1WRKA 1D1OA 1OMVA 4MLWA 3CR4X 1K9UA 2FJUB 2KBIA 4OR9B 1LKJA 1RTP1 4OCIA 4NDDA 4PE7A 1N0YA 3TUYC 1WRZA 4AQJA 1B9AA 1CDPA 1B8LA 2BE4A 2B1UA 1CDMA 1FF1A 1TNPA 1XFWO 2L50A 1RFJA 3OX5A 3LCPC 4GUKA 5IBWA 1NYAA 2KHNA 1AK8A 1XYDA 2LANA 1YUSA 2Y1NA 3LK1A 3PALA 1TRFA 1CLBA 4BY5A 2RGIA 3SG3A 3TS5C 1CMFA 2LP3A 1XFZO 3FWCA 3NSOA 3TDZA 2MAZA 3VGOA 4C0JA 5HYDA 2KFFA 2NLNA 1OMRA 3BUMB 3BUOB 4MRXA 1KQVA 3D0YB 1NSHA 3BOWB 2K7CA 2M0RA 3EKJA 2H2KA 3I5HB 2PSRA 4I5JA 1UP5A 2COLB 2JWWA 1CDLA 2F2OA 2OTGB 1NCZA 1QX7A 2KFGA 1S5GY 1YTZC 5CSNA 4QJ5B 1K8UA 1QVIY 1PRWA 1YUTA 2A4JA 4WRIA 2M29A 1F54A 3CR2A 2M7LA 1TCOB 3BYAA 1AP4A 2LHLA 1NIWA 4JQ0D 2PVBA 1M46A 5CSFA 3TDIA 2Y4QA 5I2OA 1MR8A 2K7DA 2L4IA 1CLMA 1Y1UA 2L5XB 3LLEA 4ZCVA 1N2DA 2H61C 2JNXA 3I5FB 4ORBB 3I5GC 2FOTA 3AKBA 3SG4A 4M2PA 1JBAA 2Q91A 1IJ6A 3C1VA 1SL7A 3DF0B 4JPZB 5DKRA 1UHJA 1L7ZA 1CFFA 5ER5A 2CBLA 1DVIA 3EKHA 3PM8A 1S5GZ 2WCBA 5CSJA 3O6BA 1A03A 2HQ8A 2WOSA 1KCYA 2BECA 1SCMB 3EK4A 2BBNA 4HRGA 4MVFA 3EVRA 1F4OA 1G33A 3JTDC 2OTGC 1EG3A 3OB1B 2K7BA 4GBAA 3RM1A 1J7PA 1L2OB 1QTXA 2WORA 1UHKA 2CTNA 4M2QA 4E68A 1ZUZA 1IQ3A 2LVJA 2JQ6A 3KF9A 2ZN9A 4GFTA 1TNXA 1UHNA 1XO5A 2Q4UA 2K2AA 4C0LA 4CFQA 1WLZA 1WDCC 1QS7A 1PVBA 4YGBB 1N65A 3VRNA 1ALWA 1K94A 1KK8C 1KK7Y 1SPYA 1BOCA 2MLEC 3RLZA 3PSRA 3GK2A 1V1GA 1IJ5A 1MHOA 3D0YA 3DVEA 2LV7A 3BOWA 3DVKA 1FI5A 3AKAA 2JXCA 1B8RA 2LLTA 1OE9B 2CT9A 2NXQA 1OQPA 3JVTC 4GGNA 4DUQA 2KAYA 2IS9A 2L98A 3NSKA 2LMVA 2LUXA 3MSEB 3OB2B 2HQWA 3IQOA 1A2XA 4N1GA 1NX2A 1CB1A 4MN0A 2QACA 2WCFA 3SJSA 4YBHB 3PN7C 1ZFSA 1BODA 2L4HA 4ORCB 2ZNDA 2AAOA 2MJWB 2PMYA 3ZNIA 2CXJA 1NX0A 5BPJA 5KSZA 4P5OE 4QJ4B 4PHMA 3A4UB 1DJYA 3EK7A 3AAJA 5AEQA 1QLKA 1MXEA 1EJ3A 2KAVA 3BXKA 1OOJA 1DJGA 1BU3A 1JF2A 1SW8A 2BL0C 5HKYA 4GGFA 3DD4A 4HREE 1BR1B 1SMGA 1KK7Z 2LVKA 2ZN8A 2V53A 4ZCUA 2E6WA 4PE4A 2LLSA 2WNDA 1CFDA 3KHEA 3DF0A 4U8DA 1NUBA 3ZWHA 1KFUL 1JC2A 2KQ6A 2ZRTA 4PHKA 1W7IB 1S36A 1Y0VH 2AUCA 2M3WA 1QATA 1YVLA 1KQMC 1CFPA 2OS8B 5HLOA 2LVIA 1EL4A 2WCEA 2BCAA 1IG5A 2Y5IA 3I5IC 4MBEA 4A4BA 3NSIA 4DIRA 2I7AA 1S6CA 1SR6C 1XVJA 3IF7A 1AJ5A 1R2UA 2ISDA 2KI4B 1B47A 1KFXS 1S6JA 4YGAA 4FQOA 3A8RA 4DS7A 4YGDB 5HKWA 3GK1A 2F3YA 2O60A 3WXAA 1K2HA 2EC6B 1K90D 3PLFB 2SCPA 2DOQA 1TIZA 3PATA 4C0KA 1B8CA 1YX8A 2KSPA 3M0WA 1IRJA 1A29A 1GJYA 3WHUB 2AMIA 1FW4A 1OZSA 1UHHA 1PVAA 1DF0B 1LXFC 1GGWA 1G8IA 1CTRA 3SIAA 1SNLA 1K96A 1RWYA 2K8MB 1CKKA 1S3PA 2HPSA 2M8UA 3SG6A 4HSZA 3TDUA 2F33A 1PK0D 4MRYA 3GK4X 3FS7A 3HCMA 3BUWB 1BR4B 2MBXA 1JFJA 1WY9A 1KFUS 1SYMA 2VRGA 1XA5A 1NCXA 1RROA 4OKHA 4DCKA 1QIVA 1UUSA 1AHRA 2OS8C 1S6IA 1B4CA 3BUNB 5K89A 2KQYA 4OV2A 1S26D 2BKIB 1SCVA 2JC2A 2JNFA 2LAPA 1F71A 1BT6A 2LUCA 2MA2A 4N1FA 5FYXA 5CPVA 1QXPA 3VROA 5GQQC 1IQ5A 1HQVA 1YR5A 3ICBA 2M49B 2K2FA 1YX7A 1C7VA 4ICBA 2GGMA 3SIBA 3VRPA 2HF5A 3I5HC 4ORAB 4TNCA 4USLA 2JPTA 3VRQA 1CLLA 2JRFA 3PFVA 2R2IA 2PRUA 1JFKA 2MHHA 3KO0A 2BCBA 2OPOA 1TCFA 3EVVA 1RJVA 2KDHA 4YRUA 1JSAA 4WQ3A 2JTZA 2LE9B 1UHIA 2ZNEA 4AOMA 3QRXA 2KGBC 4PCWA 1M31A 5DKQA 4UPGA 5JOLA 2PALA 4DRWA 5TNCA 2LM5A 4GAOA 1SL8A 1JWDA 1K95A 1OSAA 3DVMA 2D8NA 3BQ3A 1QV1A 1NP8A 1PSBA 2KI6D 3SG7A 2NZ0A 1VRKA 2K7OA 2F8PA 1XFUO 2LLUA 3I5FC 4GGFC 1BMOA 1NWDA 1H8BA 1SKTA 1KFXL 1DF0A 1HT9A 1JF0A 1W7JB 3EK8A 4BY4A 1H4BA 4Q04A 1F8HA 3SG5A 4P2YB 1ZMZA 4MSPA 3TUYB 2WC8A 1BJFA 2LCPA 4CFRA 1BG1A 1Q80A 2LMUA 1QV0A 2FCEA 1SK6D 1SCMC 4I5LB 4MZJA 3NSLA 2FCDA 4XJKB 1XK4A 3KEVA 1BLQA 3IQQA 1U5IB 1YRUB 4MZKA 1L2OC 2LC5A 2F3ZA 2O5GA 4R1EA 1CFCA 3VRRA 2I2RE 2LNKA 1IGVA 3TS5B 5CSIA 1MUXA 5KTYA 2LP2A 2E30A 3CS1A 3FIAA 5DKNA 1OMDA 1X02A 1KSMA 4PE1A 1DJHA 2M1UA 1LA0A 2NCPA 3KPXA 2KAXA 2JZIA 2BE6A 3O2PA 3E3RA 3CR5X 5D7FA 1F70A 4A4CA 5AERA 2MLFC 1AJ4A 4NQGA 1SRAA 5ER4X 1CMGA 1B7TY 4M2OA 1MWNA 1CDNA 1NPQA 3CZTX 3CGAA 2HETA 3OX6A 1ZACA 1EG4A 2NCOA 2EHBA 3CTNA 4YGCB 1WRLA 4YI8A 1QASA 4F0ZB 2CNPA 1KSOA 2JULA 1XFXO 2ZKMX 1A4PA 4XYNA 1J1EA 4I5KA 4IL1A 1FBVA 2I18A 3OP0A 4D1EA 1OZOA 2LMTA 1QX2A 3I5GB 2ZRSA 2PASA 2KOTA 4PALA 1JUOA 2JT0A 5JJGA 2L0PA 2JT3A 3O78A 1DJIA 5I2LA 1K93D 5AANA 5D69A 1AUIB 3D10A 1FPWA 1R6PA 1MXLC 1RECA 1WLMA 2GGZA 3GOFA 2KYCA 1LA3A 3SG2A 1SBJA 2M7NA 1KWOB 1ODBA 4YGEB 2M97A 4AQIA 3JTDB 1B7TZ 3CLNA 1A75B 5J3XA 4MEWA 2G2BA 4XJKA 1M63B 2KI4C 1TOPA 1U5IA 2G9BA 3F45A 4PDZA 2KBMA 1J1DA 1IWQA 1Y1XA 2K0JA 2EC6C 4FTGA 1WDCB 3H4SE 1LINA 2LHIA 1J7QA 1KK8B 1M45A 1NCYA 1TTXA 2TN4A 1ALVA 1J55A 2KFHA 1Y1AA 4N5XA 4I5NB 1PALA 2MRDA 1AVSA 2SASA 1YURA 1EXRA 3JVTB 5F6TA 1GQMA 3HX4A 1PSRA 1K9PA 1QX5B 1M39A 1K9KA 1GGZA 1Y6WA 1UWOA 5AFPA 4CPVA 3OHMB 1TNWA 1UURA 2JTTA 2Y1MA 3NXAA 2JOJA 2LVVA 4ETOA 1DT7B 3PN7B 1KWOC 1NX3A 1XK4C 2M9GA 1F4QA 1EH2A 4L9MA 1S1EA 1SL9A 1QVIZ 3LL8B 4WQ2A 1PULA 2GV5A 4OVNF 1IKUA 1DMOA 2JT8A 2K61A 4PHJA 1FI6A 4MZLA 1TNQA 1YVHA 1DTLA 2QPTA 2BCXA 3BUXB 2H61A 4NDBA 1CM4A 2BBMA 2BL0B 5HLVA 1LVCD 1C07A 5I8NA 5PALA 1MF8B 4GNKB
chains in the Genus database with same CATH superfamily
1V1FA 1XFYO 2P6BB 4PHNA 3DY9A 3L47A 2KGRA 1B1GA 1NX1A 1E8AA 3TZ1A 2ZFDA 3S0DA 3FWBA 5FI6A 2I94A 1KQMB 3WHTB 2KI6C 2BKHB 3CWGA 3DVJA 4GPLB 3I5IB 3D78A 1CKKA 1G4YR 1J7RA 3LK0A 2EGDA 1SR6B 1DGVA 1BF5A 1A75A 2M1KB 5AXIA 5I2QA 4CIDA 1P28A 1Z2CB 2L2EA 1QIWA 5HKZA 1YRTB 3AAKA 3FE9A 1DJXA 2CCMA 4JWQA 1SY9A 2BAPA 1F55A 1MQ1A 3K21A 4PE0A 3EVUA 3CYZA 2JU0A 1DJWA 1YUUA 2JXLA 2L51A 1C3ZA 2KYFA 2F2PA 4YI9A 4CLNA 1IH0A 5B8IB 4NDCA 1CM1A 1RK9A 1DJZA 5KU1A 5G08A 1QJTA 1QLSA 4QJ3B 1DGUA 1TN4A 1CNPA 1J7OA 2KNEA 4HRHA 3WNXB 3O4YA 1C7WA 1XFVO 1ZOTB 1WRKA 1D1OA 1OMVA 4MLWA 3CR4X 1K9UA 2FJUB 2KBIA 4OR9B 1LKJA 1RTP1 4OCIA 4NDDA 4PE7A 1N0YA 3R1OA 3TUYC 1WRZA 3DYEA 4AQJA 1B9AA 3CDNA 3FE6A 3N7HA 1CDPA 1B8LA 2BE4A 2B1UA 1CDMA 1FF1A 1TNPA 1XFWO 2L50A 1RFJA 3OX5A 3LCPC 4GUKA 5IBWA 1NYAA 3SIAA 2KHNA 1AK8A 1XYDA 3S0GA 2LANA 1YUSA 2Y1NA 3LK1A 3PALA 1TRFA 2WC6A 1CLBA 4BY5A 2RGIA 4OZDA 3SG3A 3TS5C 2L5YA 1CMFA 2LP3A 3OGNA 1XFZO 3FWCA 3NSOA 3TDZA 2MAZA 2PYQA 3VGOA 4C0JA 5HYDA 2KFFA 2NLNA 1OMRA 3BUMB 3BUOB 4MRXA 1KQVA 3D0YB 1NSHA 3BOWB 2K7CA 2M0RA 3EKJA 2H2KA 3I5HB 2PSRA 4I5JA 1UP5A 2COLB 2JWWA 1CDLA 2F2OA 2OTGB 3VB1A 1NCZA 1QX7A 2ERBA 1S5GY 1YTZC 2KFGA 5CSNA 4QJ5B 5FI2A 5EL2A 3S0FA 1K8UA 1QVIY 1PRWA 1YUTA 2A4JA 1LS8A 4WRIA 2M29A 1F54A 3CR2A 2M7LA 1TCOB 3BJHA 3BYAA 1AP4A 2LHLA 1NIWA 4JQ0D 2PVBA 1M46A 5CSFA 3TDIA 2Y4QA 3BFAA 5I2OA 1MR8A 2K7DA 2L4IA 1CLMA 3OBVA 1Y1UA 2L5XB 3LLEA 4ZCVA 1N2DA 2H61C 2JNXA 3I5FB 4ORBB 1OOHA 3I5GC 2WCMA 2FOTA 3AKBA 3SG4A 4M2PA 1JBAA 2Q91A 1IJ6A 3C1VA 1SL7A 3DF0B 4JPZB 5DKRA 1UHJA 1L7ZA 2QDIA 1CFFA 5ER5A 2CBLA 1DVIA 3EKHA 5HL1A 3PM8A 1S5GZ 2H8VA 2WCBA 3B87A 3O6BA 2HQ8A 2WOSA 5CSJA 1A03A 2BECA 1SCMB 3EK4A 2BBNA 4HRGA 3R1PA 3V2LA 4MVFA 3EVRA 2YGUA 1F4OA 1G33A 3Q8IA 3JTDC 2OTGC 1EG3A 3OB1B 2K7BA 4GBAA 2WCKA 3RM1A 1J7PA 2JPOA 1L2OB 1QTXA 2WORA 1UHKA 3S0BA 4KYNA 2CTNA 4M2QA 3SS5A 4E68A 1ZUZA 1IQ3A 2LVJA 3BFHA 2JQ6A 3KF9A 2ZN9A 4GFTA 1TNXA 1UHNA 1XO5A 2Q4UA 2K2AA 4C0LA 4CFQA 3CZ2A 1WLZA 1WDCC 1QS7A 3NHTA 1PVBA 4YGBB 1N65A 3VRNA 1ALWA 1K94A 1KK8C 1KK7Y 1SPYA 1BOCA 2MLEC 3RLZA 3D77A 3PSRA 3GK2A 1V1GA 1IJ5A 1DC1A 1MHOA 3D0YA 3DVEA 2LV7A 3BOWA 3DVKA 1FI5A 3AKAA 2JXCA 1B8RA 2LLTA 1OE9B 2CT9A 2NXQA 1OQPA 3JVTC 4GGNA 4DUQA 2KAYA 2IS9A 2L98A 3NSKA 2LMVA 2LUXA 3MSEB 3OB2B 2HQWA 3IQOA 1A2XA 4N1GA 1NX2A 1CB1A 4MN0A 2QACA 2WCFA 3SJSA 2KPHA 1OOGA 4YBHB 3PN7C 1ZFSA 1BODA 2L4HA 4ORCB 2ZNDA 2AAOA 2MJWB 2PMYA 3ZNIA 2CXJA 1NX0A 5BPJA 5KSZA 3EG5B 3D75A 4P5OE 3A4UB 1DJYA 3EK7A 4PHMA 3AAJA 5AEQA 1QLKA 4QJ4B 3SS3A 4INXA 1MXEA 1EJ3A 2KAVA 3BXKA 1OOJA 1DJGA 1BU3A 1JF2A 1SW8A 2BL0C 4INWA 4GGFA 5HKYA 3DD4A 4HREE 1BR1B 1SMGA 1KK7Z 2LVKA 2ZN8A 2V53A 4ZCUA 2E6WA 4PE4A 2LLSA 2WNDA 1CFDA 3KHEA 3DF0A 4U8DA 1NUBA 3ZWHA 1KFUL 1JC2A 2KQ6A 2ZRTA 4PHKA 1W7IB 1S36A 1Y0VH 2AUCA 2M3WA 1QATA 1YVLA 1KQMC 1CFPA 2OS8B 5HLOA 2LVIA 1EL4A 2WCEA 2BCAA 1IG5A 2P70A 2Y5IA 3I5IC 4MBEA 4A4BA 3NSIA 4DIRA 2I7AA 1S6CA 1SR6C 1XVJA 3IF7A 1AJ5A 1R2UA 2ISDA 2KI4B 1B47A 1KFXS 1S6JA 4YGAA 4FQOA 3DZTA 3A8RA 4DS7A 4IJ7A 4YGDB 5HKWA 3GK1A 2F3YA 2O60A 3WXAA 1K2HA 2EC6B 1K90D 3PLFB 2SCPA 2DOQA 1TIZA 3PATA 5DICA 4C0KA 3UO9A 1YX8A 1B8CA 2KSPA 3M0WA 1DEKA 1IRJA 3CZ0A 1A29A 1GJYA 3WHUB 1C3YA 2AMIA 1FW4A 1OZSA 2QEHA 1UHHA 1PVAA 1DF0B 1LXFC 1GGWA 1G8IA 1GM0A 1CTRA 1TUJA 1TWOA 1SNLA 3FE8A 1K96A 1RWYA 2K8MB 4PT1A 1S3PA 2HPSA 2M8UA 3SG6A 4HSZA 3TDUA 2F33A 1PK0D 4MRYA 2WCLA 3GK4X 3FS7A 3HCMA 3BUWB 1BR4B 2MBXA 1JFJA 1WY9A 1KFUS 1SYMA 2QEOA 3B86A 2VRGA 1XA5A 1NCXA 1RROA 4OKHA 4DCKA 1QIVA 1UUSA 1AHRA 4JKTA 2OS8C 3S0AA 1S6IA 1B4CA 3B6XA 3BUNB 3L4AA 5K89A 2KQYA 4OV2A 1S26D 2BKIB 1OOFA 1SCVA 2JC2A 2JNFA 2LAPA 1F71A 1OOIX 1BT6A 2LUCA 3CZ1A 3NHIA 2MA2A 4N1FA 1DELA 5CPVA 1QXPA 5FYXA 3VROA 5GQQC 1IQ5A 1HQVA 1YR5A 3ICBA 2M49B 2K2FA 1YX7A 1C7VA 4ICBA 2GGMA 3SIBA 3VRPA 2HF5A 2KLEA 3I5HC 4ORAB 4TNCA 2JPTA 4USLA 3VRQA 1CLLA 2JRFA 3PFVA 2R2IA 1C07A 2PRUA 1JFKA 2MHHA 3KO0A 2BCBA 2OPOA 1TCFA 3EVVA 1RJVA 2KDHA 4YRUA 1JSAA 3B7AA 3NGVA 4WQ3A 3O4XA 2JTZA 2LE9B 1UHIA 2ZNEA 3PJIA 1DQEA 4AOMA 3QRXA 2KGBC 4PCWA 1M31A 5DKQA 3K1EA 5JOLA 2PALA 4UPGA 4DRWA 5TNCA 2LM5A 4GAOA 1SL8A 1JWDA 5FI7A 1K95A 1OSAA 3DVMA 2D8NA 3BQ3A 3D74A 1QV1A 1NP8A 1PSBA 2KI6D 3SG7A 2NZ0A 1VRKA 2K7OA 2F8PA 1XFUO 2LLUA 2WCHA 2WC5A 3I5FC 4GGFC 1BMOA 1NWDA 1H8BA 1SKTA 1KFXL 1DF0A 1HT9A 1JF0A 1W7JB 3EK8A 4BY4A 1H4BA 1T14A 4Q04A 1F8HA 3SG5A 4P2YB 1ZMZA 1ORGA 4MSPA 3TUYB 2WC8A 1BJFA 2LCPA 4CFRA 1BG1A 1Q80A 2LMUA 1QV0A 2FCEA 3D73A 1SK6D 1SCMC 4I5LB 1IIOA 4MZJA 3CABA 3NSLA 5D3OA 2FCDA 4XJKB 1XK4A 3KEVA 1BLQA 3IQQA 1U5IB 3R72A 1YRUB 4MZKA 1L2OC 2LC5A 2F3ZA 2O5GA 4R1EA 3SS4A 3VRRA 1CFCA 2I2RE 5I8NA 3D76A 2LNKA 1IGVA 3TS5B 5CSIA 1MUXA 5KTYA 2LP2A 2E30A 3CS1A 3FIAA 5DKNA 1OMDA 1X02A 1KSMA 4PE1A 1DJHA 2M1UA 1LA0A 2NCPA 3KPXA 2KAXA 2JZIA 2BE6A 3O2PA 3E3RA 3CR5X 1SSEB 1QWVA 5D7FA 1F70A 4A4CA 5AERA 2MLFC 3B88A 1AJ4A 2FJYA 4NQGA 1TUZA 1SRAA 5ER4X 1CMGA 1B7TY 4M2OA 1MWNA 1CDNA 1NPQA 3CZTX 3CGAA 2HETA 3OX6A 3QMEA 1ZACA 1EG4A 3PM2A 2NCOA 2EHBA 3CTNA 4YGCB 3RZSA 1WRLA 4YI8A 1QASA 4F0ZB 2CNPA 1KSOA 2JULA 1XFXO 2ZKMX 1A4PA 2K60A 4XYNA 1J1EA 4I5KA 4IL1A 1FBVA 2I18A 3OP0A 4D1EA 1OZOA 2LMTA 1QX2A 3I5GB 2ZRSA 2PASA 2KOTA 4PALA 1JUOA 2JT0A 5JJGA 2L0PA 2JT3A 3O78A 1DJIA 5I2LA 1K93D 1OW4A 5AANA 5D69A 1AUIB 2QEVA 3UNWA 3DXLA 2KLDA 3D10A 1FPWA 1R6PA 1MXLC 1RECA 1WLMA 2GGZA 3GOFA 2KYCA 1LA3A 3S0EA 1SBJA 3SG2A 2M7NA 1KWOB 1ODBA 4FQTA 4YGEB 2M97A 4AQIA 3JTDB 1B7TZ 3CLNA 1A75B 5J3XA 4MEWA 2G2BA 4XJKA 3R1VA 1M63B 2KI4C 1TOPA 1U5IA 2G9BA 2WCJA 3F45A 1W9ZA 4PDZA 5I94A 2KBMA 1J1DA 2L2CA 1IWQA 1Y1XA 2K0JA 2EC6C 4FTGA 1WDCB 3H4SE 1LINA 2LHIA 3IVTA 1J7QA 1KK8B 1M45A 1NCYA 1TTXA 2TN4A 1ALVA 2PQLA 1J55A 2KFHA 1XFRA 1Y1AA 1KCYA 4JD9A 4N5XA 4I5NB 1PALA 1Z4HA 2MRDA 1AVSA 2SASA 1YURA 1EXRA 2BNXA 3JVTB 1GQMA 3HX4A 5F6TA 1PSRA 1K9PA 1QX5B 1M39A 1K9KA 1GGZA 1Y6WA 1UWOA 5AFPA 2QEBA 4CPVA 3OHMB 1TNWA 1UURA 2JTTA 2Y1MA 3NXAA 2JOJA 2LVVA 4ETOA 1DT7B 3PN7B 1KWOC 1NX3A 1XK4C 2M9GA 1F4QA 1EH2A 4L9MA 1S1EA 1SL9A 1QVIZ 3LL8B 4WQ2A 1PULA 2GV5A 4OVNF 1IKUA 1DMOA 2JT8A 2K61A 4PHJA 1FI6A 4MZLA 1TNQA 1YVHA 1DTLA 2QPTA 3L4LA 2BCXA 3BUXB 2H61A 2GTEA 1CM4A 2BBMA 2BL0B 4NDBA 5HLVA 1LVCD 4F7FA 2P71A 3BFBA 5PALA 1MF8B 4GNKB
chains in the Genus database with same CATH topology
1V1FA 1XFYO 2P6BB 4PHNA 2KGRA 1B1GA 1NX1A 1E8AA 3TZ1A 2ZFDA 3FWBA 2I94A 1KQMB 3WHTB 2KI6C 2BKHB 3CWGA 3DVJA 4GPLB 3I5IB 1G4YR 1J7RA 3LK0A 2EGDA 1SR6B 1DGVA 1BF5A 1A75A 2M1KB 5AXIA 5I2QA 4CIDA 2L2EA 1QIWA 5HKZA 1YRTB 3AAKA 1DJXA 2CCMA 4JWQA 1SY9A 1F55A 1MQ1A 3K21A 4PE0A 3EVUA 2JU0A 1DJWA 1YUUA 2JXLA 2L51A 4CLNA 2KYFA 2F2PA 4YI9A 1IH0A 5B8IB 4NDCA 1CM1A 1RK9A 1DJZA 5KU1A 5G08A 1QJTA 1QLSA 4QJ3B 1DGUA 1TN4A 1CNPA 1J7OA 2KNEA 4HRHA 3WNXB 3O4YA 1C7WA 1XFVO 1ZOTB 1WRKA 1D1OA 1OMVA 4MLWA 3CR4X 1K9UA 2FJUB 2KBIA 4OR9B 1LKJA 1RTP1 4OCIA 4NDDA 4PE7A 1N0YA 3TUYC 1WRZA 4AQJA 1B9AA 1CDPA 1B8LA 2BE4A 2B1UA 1CDMA 1FF1A 1TNPA 1XFWO 2L50A 1RFJA 3OX5A 3LCPC 4GUKA 5IBWA 1NYAA 2KHNA 1AK8A 1XYDA 2LANA 1YUSA 2Y1NA 3LK1A 3PALA 1TRFA 1CLBA 4BY5A 2RGIA 3SG3A 3TS5C 1CMFA 2LP3A 1XFZO 3FWCA 3NSOA 3TDZA 2MAZA 3VGOA 4C0JA 5HYDA 2KFFA 2NLNA 1OMRA 3BUMB 3BUOB 4MRXA 1KQVA 3D0YB 1NSHA 3BOWB 2K7CA 2M0RA 3EKJA 2H2KA 3I5HB 2PSRA 4I5JA 1UP5A 2COLB 2JWWA 1CDLA 2F2OA 2OTGB 1NCZA 1QX7A 2KFGA 1S5GY 1YTZC 5CSNA 4QJ5B 1K8UA 1QVIY 1PRWA 1YUTA 2A4JA 4WRIA 2M29A 1F54A 3CR2A 2M7LA 1TCOB 3BYAA 1AP4A 2LHLA 1NIWA 4JQ0D 2PVBA 1M46A 5CSFA 3TDIA 2Y4QA 5I2OA 1MR8A 2K7DA 2L4IA 1CLMA 1Y1UA 2L5XB 3LLEA 4ZCVA 1N2DA 2H61C 2JNXA 3I5FB 4ORBB 3I5GC 2FOTA 3AKBA 3SG4A 4M2PA 1JBAA 2Q91A 1IJ6A 3C1VA 1SL7A 3DF0B 4JPZB 5DKRA 1UHJA 1L7ZA 1CFFA 5ER5A 2CBLA 1DVIA 3EKHA 3PM8A 1S5GZ 2WCBA 5CSJA 3O6BA 1A03A 2HQ8A 2WOSA 1KCYA 2BECA 1SCMB 3EK4A 2BBNA 4HRGA 4MVFA 3EVRA 1F4OA 1G33A 3JTDC 2OTGC 1EG3A 3OB1B 2K7BA 4GBAA 3RM1A 1J7PA 1L2OB 1QTXA 2WORA 1UHKA 2CTNA 4M2QA 4E68A 1ZUZA 1IQ3A 2LVJA 2JQ6A 3KF9A 2ZN9A 4GFTA 1TNXA 1UHNA 1XO5A 2Q4UA 2K2AA 4C0LA 4CFQA 1WLZA 1WDCC 1QS7A 1PVBA 4YGBB 1N65A 3VRNA 1ALWA 1K94A 1KK8C 1KK7Y 1SPYA 1BOCA 2MLEC 3RLZA 3PSRA 3GK2A 1V1GA 1IJ5A 1MHOA 3D0YA 3DVEA 2LV7A 3BOWA 3DVKA 1FI5A 3AKAA 2JXCA 1B8RA 2LLTA 1OE9B 2CT9A 2NXQA 1OQPA 3JVTC 4GGNA 4DUQA 2KAYA 2IS9A 2L98A 3NSKA 2LMVA 2LUXA 3MSEB 3OB2B 2HQWA 3IQOA 1A2XA 4N1GA 1NX2A 1CB1A 4MN0A 2QACA 2WCFA 3SJSA 4YBHB 3PN7C 1ZFSA 1BODA 2L4HA 4ORCB 2ZNDA 2AAOA 2MJWB 2PMYA 3ZNIA 2CXJA 1NX0A 5BPJA 5KSZA 4P5OE 4QJ4B 4PHMA 3A4UB 1DJYA 3EK7A 3AAJA 5AEQA 1QLKA 1MXEA 1EJ3A 2KAVA 3BXKA 1OOJA 1DJGA 1BU3A 1JF2A 1SW8A 2BL0C 5HKYA 4GGFA 3DD4A 4HREE 1BR1B 1SMGA 1KK7Z 2LVKA 2ZN8A 2V53A 4ZCUA 2E6WA 4PE4A 2LLSA 2WNDA 1CFDA 3KHEA 3DF0A 4U8DA 1NUBA 3ZWHA 1KFUL 1JC2A 2KQ6A 2ZRTA 4PHKA 1W7IB 1S36A 1Y0VH 2AUCA 2M3WA 1QATA 1YVLA 1KQMC 1CFPA 2OS8B 5HLOA 2LVIA 1EL4A 2WCEA 2BCAA 1IG5A 2Y5IA 3I5IC 4MBEA 4A4BA 3NSIA 4DIRA 2I7AA 1S6CA 1SR6C 1XVJA 3IF7A 1AJ5A 1R2UA 2ISDA 2KI4B 1B47A 1KFXS 1S6JA 4YGAA 4FQOA 3A8RA 4DS7A 4YGDB 5HKWA 3GK1A 2F3YA 2O60A 3WXAA 1K2HA 2EC6B 1K90D 3PLFB 2SCPA 2DOQA 1TIZA 3PATA 4C0KA 1B8CA 1YX8A 2KSPA 3M0WA 1IRJA 1A29A 1GJYA 3WHUB 2AMIA 1FW4A 1OZSA 1UHHA 1PVAA 1DF0B 1LXFC 1GGWA 1G8IA 1CTRA 3SIAA 1SNLA 1K96A 1RWYA 2K8MB 1CKKA 1S3PA 2HPSA 2M8UA 3SG6A 4HSZA 3TDUA 2F33A 1PK0D 4MRYA 3GK4X 3FS7A 3HCMA 3BUWB 1BR4B 2MBXA 1JFJA 1WY9A 1KFUS 1SYMA 2VRGA 1XA5A 1NCXA 1RROA 4OKHA 4DCKA 1QIVA 1UUSA 1AHRA 2OS8C 1S6IA 1B4CA 3BUNB 5K89A 2KQYA 4OV2A 1S26D 2BKIB 1SCVA 2JC2A 2JNFA 2LAPA 1F71A 1BT6A 2LUCA 2MA2A 4N1FA 5FYXA 5CPVA 1QXPA 3VROA 5GQQC 1IQ5A 1HQVA 1YR5A 3ICBA 2M49B 2K2FA 1YX7A 1C7VA 4ICBA 2GGMA 3SIBA 3VRPA 2HF5A 3I5HC 4ORAB 4TNCA 4USLA 2JPTA 3VRQA 1CLLA 2JRFA 3PFVA 2R2IA 2PRUA 1JFKA 2MHHA 3KO0A 2BCBA 2OPOA 1TCFA 3EVVA 1RJVA 2KDHA 4YRUA 1JSAA 4WQ3A 2JTZA 2LE9B 1UHIA 2ZNEA 4AOMA 3QRXA 2KGBC 4PCWA 1M31A 5DKQA 4UPGA 5JOLA 2PALA 4DRWA 5TNCA 2LM5A 4GAOA 1SL8A 1JWDA 1K95A 1OSAA 3DVMA 2D8NA 3BQ3A 1QV1A 1NP8A 1PSBA 2KI6D 3SG7A 2NZ0A 1VRKA 2K7OA 2F8PA 1XFUO 2LLUA 3I5FC 4GGFC 1BMOA 1NWDA 1H8BA 1SKTA 1KFXL 1DF0A 1HT9A 1JF0A 1W7JB 3EK8A 4BY4A 1H4BA 4Q04A 1F8HA 3SG5A 4P2YB 1ZMZA 4MSPA 3TUYB 2WC8A 1BJFA 2LCPA 4CFRA 1BG1A 1Q80A 2LMUA 1QV0A 2FCEA 1SK6D 1SCMC 4I5LB 4MZJA 3NSLA 2FCDA 4XJKB 1XK4A 3KEVA 1BLQA 3IQQA 1U5IB 1YRUB 4MZKA 1L2OC 2LC5A 2F3ZA 2O5GA 4R1EA 1CFCA 3VRRA 2I2RE 2LNKA 1IGVA 3TS5B 5CSIA 1MUXA 5KTYA 2LP2A 2E30A 3CS1A 3FIAA 5DKNA 1OMDA 1X02A 1KSMA 4PE1A 1DJHA 2M1UA 1LA0A 2NCPA 3KPXA 2KAXA 2JZIA 2BE6A 3O2PA 3E3RA 3CR5X 5D7FA 1F70A 4A4CA 5AERA 2MLFC 1AJ4A 4NQGA 1SRAA 5ER4X 1CMGA 1B7TY 4M2OA 1MWNA 1CDNA 1NPQA 3CZTX 3CGAA 2HETA 3OX6A 1ZACA 1EG4A 2NCOA 2EHBA 3CTNA 4YGCB 1WRLA 4YI8A 1QASA 4F0ZB 2CNPA 1KSOA 2JULA 1XFXO 2ZKMX 1A4PA 4XYNA 1J1EA 4I5KA 4IL1A 1FBVA 2I18A 3OP0A 4D1EA 1OZOA 2LMTA 1QX2A 3I5GB 2ZRSA 2PASA 2KOTA 4PALA 1JUOA 2JT0A 5JJGA 2L0PA 2JT3A 3O78A 1DJIA 5I2LA 1K93D 5AANA 5D69A 1AUIB 3D10A 1FPWA 1R6PA 1MXLC 1RECA 1WLMA 2GGZA 3GOFA 2KYCA 1LA3A 3SG2A 1SBJA 2M7NA 1KWOB 1ODBA 4YGEB 2M97A 4AQIA 3JTDB 1B7TZ 3CLNA 1A75B 5J3XA 4MEWA 2G2BA 4XJKA 1M63B 2KI4C 1TOPA 1U5IA 2G9BA 3F45A 4PDZA 2KBMA 1J1DA 1IWQA 1Y1XA 2K0JA 2EC6C 4FTGA 1WDCB 3H4SE 1LINA 2LHIA 1J7QA 1KK8B 1M45A 1NCYA 1TTXA 2TN4A 1ALVA 1J55A 2KFHA 1Y1AA 4N5XA 4I5NB 1PALA 2MRDA 1AVSA 2SASA 1YURA 1EXRA 3JVTB 5F6TA 1GQMA 3HX4A 1PSRA 1K9PA 1QX5B 1M39A 1K9KA 1GGZA 1Y6WA 1UWOA 5AFPA 4CPVA 3OHMB 1TNWA 1UURA 2JTTA 2Y1MA 3NXAA 2JOJA 2LVVA 4ETOA 1DT7B 3PN7B 1KWOC 1NX3A 1XK4C 2M9GA 1F4QA 1EH2A 4L9MA 1S1EA 1SL9A 1QVIZ 3LL8B 4WQ2A 1PULA 2GV5A 4OVNF 1IKUA 1DMOA 2JT8A 2K61A 4PHJA 1FI6A 4MZLA 1TNQA 1YVHA 1DTLA 2QPTA 2BCXA 3BUXB 2H61A 4NDBA 1CM4A 2BBMA 2BL0B 5HLVA 1LVCD 1C07A 5I8NA 5PALA 1MF8B 4GNKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V1F A;  1XFY O;  2P6B B;  4PHN A;  2KGR A;  1B1G A;  1NX1 A;  1E8A A;  3TZ1 A;  2ZFD A;  3FWB A;  2I94 A;  1KQM B;  3WHT B;  2KI6 C;  2BKH B;  3CWG A;  3DVJ A;  4GPL B;  3I5I B;  1G4Y R;  1J7R A;  3LK0 A;  2EGD A;  1SR6 B;  1DGV A;  1BF5 A;  1A75 A;  2M1K B;  5AXI A;  5I2Q A;  4CID A;  2L2E A;  1QIW A;  5HKZ A;  1YRT B;  3AAK A;  1DJX A;  2CCM A;  4JWQ A;  1SY9 A;  1F55 A;  1MQ1 A;  3K21 A;  4PE0 A;  3EVU A;  2JU0 A;  1DJW A;  1YUU A;  2JXL A;  2L51 A;  4CLN A;  2KYF A;  2F2P A;  4YI9 A;  1IH0 A;  5B8I B;  4NDC A;  1CM1 A;  1RK9 A;  1DJZ A;  5KU1 A;  5G08 A;  1QJT A;  1QLS A;  4QJ3 B;  1DGU A;  1TN4 A;  1CNP A;  1J7O A;  2KNE A;  4HRH A;  3WNX B;  3O4Y A;  1C7W A;  1XFV O;  1ZOT B;  1WRK A;  1D1O A;  1OMV A;  4MLW A;  3CR4 X;  1K9U A;  2FJU B;  2KBI A;  4OR9 B;  1LKJ A;  1RTP 1;  4OCI A;  4NDD A;  4PE7 A;  1N0Y A;  3TUY C;  1WRZ A;  4AQJ A;  1B9A A;  1CDP A;  1B8L A;  2BE4 A;  2B1U A;  1CDM A;  1FF1 A;  1TNP A;  1XFW O;  2L50 A;  1RFJ A;  3OX5 A;  3LCP C;  4GUK A;  5IBW A;  1NYA A;  2KHN A;  1AK8 A;  1XYD A;  2LAN A;  1YUS A;  2Y1N A;  3LK1 A;  3PAL A;  1TRF A;  1CLB A;  4BY5 A;  2RGI A;  3SG3 A;  3TS5 C;  1CMF A;  2LP3 A;  1XFZ O;  3FWC A;  3NSO A;  3TDZ A;  2MAZ A;  3VGO A;  4C0J A;  5HYD A;  2KFF A;  2NLN A;  1OMR A;  3BUM B;  3BUO B;  4MRX A;  1KQV A;  3D0Y B;  1NSH A;  3BOW B;  2K7C A;  2M0R A;  3EKJ A;  2H2K A;  3I5H B;  2PSR A;  4I5J A;  1UP5 A;  2COL B;  2JWW A;  1CDL A;  2F2O A;  2OTG B;  1NCZ A;  1QX7 A;  2KFG A;  1S5G Y;  1YTZ C;  5CSN A;  4QJ5 B;  1K8U A;  1QVI Y;  1PRW A;  1YUT A;  2A4J A;  4WRI A;  2M29 A;  1F54 A;  3CR2 A;  2M7L A;  1TCO B;  3BYA A;  1AP4 A;  2LHL A;  1NIW A;  4JQ0 D;  2PVB A;  1M46 A;  5CSF A;  3TDI A;  2Y4Q A;  5I2O A;  1MR8 A;  2K7D A;  2L4I A;  1CLM A;  1Y1U A;  2L5X B;  3LLE A;  4ZCV A;  1N2D A;  2H61 C;  2JNX A;  3I5F B;  4ORB B;  3I5G C;  2FOT A;  3AKB A;  3SG4 A;  4M2P A;  1JBA A;  2Q91 A;  1IJ6 A;  3C1V A;  1SL7 A;  3DF0 B;  4JPZ B;  5DKR A;  1UHJ A;  1L7Z A;  1CFF A;  5ER5 A;  2CBL A;  1DVI A;  3EKH A;  3PM8 A;  1S5G Z;  2WCB A;  5CSJ A;  3O6B A;  1A03 A;  2HQ8 A;  2WOS A;  1KCY A;  2BEC A;  1SCM B;  3EK4 A;  2BBN A;  4HRG A;  4MVF A;  3EVR A;  1F4O A;  1G33 A;  3JTD C;  2OTG C;  1EG3 A;  3OB1 B;  2K7B A;  4GBA A;  3RM1 A;  1J7P A;  1L2O B;  1QTX A;  2WOR A;  1UHK A;  2CTN A;  4M2Q A;  4E68 A;  1ZUZ A;  1IQ3 A;  2LVJ A;  2JQ6 A;  3KF9 A;  2ZN9 A;  4GFT A;  1TNX A;  1UHN A;  1XO5 A;  2Q4U A;  2K2A A;  4C0L A;  4CFQ A;  1WLZ A;  1WDC C;  1QS7 A;  1PVB A;  4YGB B;  1N65 A;  3VRN A;  1ALW A;  1K94 A;  1KK8 C;  1KK7 Y;  1SPY A;  1BOC A;  2MLE C;  3RLZ A;  3PSR A;  3GK2 A;  1V1G A;  1IJ5 A;  1MHO A;  3D0Y A;  3DVE A;  2LV7 A;  3BOW A;  3DVK A;  1FI5 A;  3AKA A;  2JXC A;  1B8R A;  2LLT A;  1OE9 B;  2CT9 A;  2NXQ A;  1OQP A;  3JVT C;  4GGN A;  4DUQ A;  2KAY A;  2IS9 A;  2L98 A;  3NSK A;  2LMV A;  2LUX A;  3MSE B;  3OB2 B;  2HQW A;  3IQO A;  1A2X A;  4N1G A;  1NX2 A;  1CB1 A;  4MN0 A;  2QAC A;  2WCF A;  3SJS A;  4YBH B;  3PN7 C;  1ZFS A;  1BOD A;  2L4H A;  4ORC B;  2ZND A;  2AAO A;  2MJW B;  2PMY A;  3ZNI A;  2CXJ A;  1NX0 A;  5BPJ A;  5KSZ A;  4P5O E;  4QJ4 B;  4PHM A;  3A4U B;  1DJY A;  3EK7 A;  3AAJ A;  5AEQ A;  1QLK A;  1MXE A;  1EJ3 A;  2KAV A;  3BXK A;  1OOJ A;  1DJG A;  1BU3 A;  1JF2 A;  1SW8 A;  2BL0 C;  5HKY A;  4GGF A;  3DD4 A;  4HRE E;  1BR1 B;  1SMG A;  1KK7 Z;  2LVK A;  2ZN8 A;  2V53 A;  4ZCU A;  2E6W A;  4PE4 A;  2LLS A;  2WND A;  1CFD A;  3KHE A;  3DF0 A;  4U8D A;  1NUB A;  3ZWH A;  1KFU L;  1JC2 A;  2KQ6 A;  2ZRT A;  4PHK A;  1W7I B;  1S36 A;  1Y0V H;  2AUC A;  2M3W A;  1QAT A;  1YVL A;  1KQM C;  1CFP A;  2OS8 B;  5HLO A;  2LVI A;  1EL4 A;  2WCE A;  2BCA A;  1IG5 A;  2Y5I A;  3I5I C;  4MBE A;  4A4B A;  3NSI A;  4DIR A;  2I7A A;  1S6C A;  1SR6 C;  1XVJ A;  3IF7 A;  1AJ5 A;  1R2U A;  2ISD A;  2KI4 B;  1B47 A;  1KFX S;  1S6J A;  4YGA A;  4FQO A;  3A8R A;  4DS7 A;  4YGD B;  5HKW A;  3GK1 A;  2F3Y A;  2O60 A;  3WXA A;  1K2H A;  2EC6 B;  1K90 D;  3PLF B;  2SCP A;  2DOQ A;  1TIZ A;  3PAT A;  4C0K A;  1B8C A;  1YX8 A;  2KSP A;  3M0W A;  1IRJ A;  1A29 A;  1GJY A;  3WHU B;  2AMI A;  1FW4 A;  1OZS A;  1UHH A;  1PVA A;  1DF0 B;  1LXF C;  1GGW A;  1G8I A;  1CTR A;  3SIA A;  1SNL A;  1K96 A;  1RWY A;  2K8M B;  1CKK A;  1S3P A;  2HPS A;  2M8U A;  3SG6 A;  4HSZ A;  3TDU A;  2F33 A;  1PK0 D;  4MRY A;  3GK4 X;  3FS7 A;  3HCM A;  3BUW B;  1BR4 B;  2MBX A;  1JFJ A;  1WY9 A;  1KFU S;  1SYM A;  2VRG A;  1XA5 A;  1NCX A;  1RRO A;  4OKH A;  4DCK A;  1QIV A;  1UUS A;  1AHR A;  2OS8 C;  1S6I A;  1B4C A;  3BUN B;  5K89 A;  2KQY A;  4OV2 A;  1S26 D;  2BKI B;  1SCV A;  2JC2 A;  2JNF A;  2LAP A;  1F71 A;  1BT6 A;  2LUC A;  2MA2 A;  4N1F A;  5FYX A;  5CPV A;  1QXP A;  3VRO A;  5GQQ C;  1IQ5 A;  1HQV A;  1YR5 A;  3ICB A;  2M49 B;  2K2F A;  1YX7 A;  1C7V A;  4ICB A;  2GGM A;  3SIB A;  3VRP A;  2HF5 A;  3I5H C;  4ORA B;  4TNC A;  4USL A;  2JPT A;  3VRQ A;  1CLL A;  2JRF A;  3PFV A;  2R2I A;  2PRU A;  1JFK A;  2MHH A;  3KO0 A;  2BCB A;  2OPO A;  1TCF A;  3EVV A;  1RJV A;  2KDH A;  4YRU A;  1JSA A;  4WQ3 A;  2JTZ A;  2LE9 B;  1UHI A;  2ZNE A;  4AOM A;  3QRX A;  2KGB C;  4PCW A;  1M31 A;  5DKQ A;  4UPG A;  5JOL A;  2PAL A;  4DRW A;  5TNC A;  2LM5 A;  4GAO A;  1SL8 A;  1JWD A;  1K95 A;  1OSA A;  3DVM A;  2D8N A;  3BQ3 A;  1QV1 A;  1NP8 A;  1PSB A;  2KI6 D;  3SG7 A;  2NZ0 A;  1VRK A;  2K7O A;  2F8P A;  1XFU O;  2LLU A;  3I5F C;  4GGF C;  1BMO A;  1NWD A;  1H8B A;  1SKT A;  1KFX L;  1DF0 A;  1HT9 A;  1JF0 A;  1W7J B;  3EK8 A;  4BY4 A;  1H4B A;  4Q04 A;  1F8H A;  3SG5 A;  4P2Y B;  1ZMZ A;  4MSP A;  3TUY B;  2WC8 A;  1BJF A;  2LCP A;  4CFR A;  1BG1 A;  1Q80 A;  2LMU A;  1QV0 A;  2FCE A;  1SK6 D;  1SCM C;  4I5L B;  4MZJ A;  3NSL A;  2FCD A;  4XJK B;  1XK4 A;  3KEV A;  1BLQ A;  3IQQ A;  1U5I B;  1YRU B;  4MZK A;  1L2O C;  2LC5 A;  2F3Z A;  2O5G A;  4R1E A;  1CFC A;  3VRR A;  2I2R E;  2LNK A;  1IGV A;  3TS5 B;  5CSI A;  1MUX A;  5KTY A;  2LP2 A;  2E30 A;  3CS1 A;  3FIA A;  5DKN A;  1OMD A;  1X02 A;  1KSM A;  4PE1 A;  1DJH A;  2M1U A;  1LA0 A;  2NCP A;  3KPX A;  2KAX A;  2JZI A;  2BE6 A;  3O2P A;  3E3R A;  3CR5 X;  5D7F A;  1F70 A;  4A4C A;  5AER A;  2MLF C;  1AJ4 A;  4NQG A;  1SRA A;  5ER4 X;  1CMG A;  1B7T Y;  4M2O A;  1MWN A;  1CDN A;  1NPQ A;  3CZT X;  3CGA A;  2HET A;  3OX6 A;  1ZAC A;  1EG4 A;  2NCO A;  2EHB A;  3CTN A;  4YGC B;  1WRL A;  4YI8 A;  1QAS A;  4F0Z B;  2CNP A;  1KSO A;  2JUL A;  1XFX O;  2ZKM X;  1A4P A;  4XYN A;  1J1E A;  4I5K A;  4IL1 A;  1FBV A;  2I18 A;  3OP0 A;  4D1E A;  1OZO A;  2LMT A;  1QX2 A;  3I5G B;  2ZRS A;  2PAS A;  2KOT A;  4PAL A;  1JUO A;  2JT0 A;  5JJG A;  2L0P A;  2JT3 A;  3O78 A;  1DJI A;  5I2L A;  1K93 D;  5AAN A;  5D69 A;  1AUI B;  3D10 A;  1FPW A;  1R6P A;  1MXL C;  1REC A;  1WLM A;  2GGZ A;  3GOF A;  2KYC A;  1LA3 A;  3SG2 A;  1SBJ A;  2M7N A;  1KWO B;  1ODB A;  4YGE B;  2M97 A;  4AQI A;  3JTD B;  1B7T Z;  3CLN A;  1A75 B;  5J3X A;  4MEW A;  2G2B A;  4XJK A;  1M63 B;  2KI4 C;  1TOP A;  1U5I A;  2G9B A;  3F45 A;  4PDZ A;  2KBM A;  1J1D A;  1IWQ A;  1Y1X A;  2K0J A;  2EC6 C;  4FTG A;  1WDC B;  3H4S E;  1LIN A;  2LHI A;  1J7Q A;  1KK8 B;  1M45 A;  1NCY A;  1TTX A;  2TN4 A;  1ALV A;  1J55 A;  2KFH A;  1Y1A A;  4N5X A;  4I5N B;  1PAL A;  2MRD A;  1AVS A;  2SAS A;  1YUR A;  1EXR A;  3JVT B;  5F6T A;  1GQM A;  3HX4 A;  1PSR A;  1K9P A;  1QX5 B;  1M39 A;  1K9K A;  1GGZ A;  1Y6W A;  1UWO A;  5AFP A;  4CPV A;  3OHM B;  1TNW A;  1UUR A;  2JTT A;  2Y1M A;  3NXA A;  2JOJ A;  2LVV A;  4ETO A;  1DT7 B;  3PN7 B;  1KWO C;  1NX3 A;  1XK4 C;  2M9G A;  1F4Q A;  1EH2 A;  4L9M A;  1S1E A;  1SL9 A;  1QVI Z;  3LL8 B;  4WQ2 A;  1PUL A;  2GV5 A;  4OVN F;  1IKU A;  1DMO A;  2JT8 A;  2K61 A;  4PHJ A;  1FI6 A;  4MZL A;  1TNQ A;  1YVH A;  1DTL A;  2QPT A;  2BCX A;  3BUX B;  2H61 A;  4NDB A;  1CM4 A;  2BBM A;  2BL0 B;  5HLV A;  1LVC D;  1C07 A;  5I8N A;  5PAL A;  1MF8 B;  4GNK B; 
#chains in the Genus database with same CATH topology
 1V1F A;  1XFY O;  2P6B B;  4PHN A;  3DY9 A;  3L47 A;  2KGR A;  1B1G A;  1NX1 A;  1E8A A;  3TZ1 A;  2ZFD A;  3S0D A;  3FWB A;  5FI6 A;  2I94 A;  1KQM B;  3WHT B;  2KI6 C;  2BKH B;  3CWG A;  3DVJ A;  4GPL B;  3I5I B;  3D78 A;  1CKK A;  1G4Y R;  1J7R A;  3LK0 A;  2EGD A;  1SR6 B;  1DGV A;  1BF5 A;  1A75 A;  2M1K B;  5AXI A;  5I2Q A;  4CID A;  1P28 A;  1Z2C B;  2L2E A;  1QIW A;  5HKZ A;  1YRT B;  3AAK A;  3FE9 A;  1DJX A;  2CCM A;  4JWQ A;  1SY9 A;  2BAP A;  1F55 A;  1MQ1 A;  3K21 A;  4PE0 A;  3EVU A;  3CYZ A;  2JU0 A;  1DJW A;  1YUU A;  2JXL A;  2L51 A;  1C3Z A;  2KYF A;  2F2P A;  4YI9 A;  4CLN A;  1IH0 A;  5B8I B;  4NDC A;  1CM1 A;  1RK9 A;  1DJZ A;  5KU1 A;  5G08 A;  1QJT A;  1QLS A;  4QJ3 B;  1DGU A;  1TN4 A;  1CNP A;  1J7O A;  2KNE A;  4HRH A;  3WNX B;  3O4Y A;  1C7W A;  1XFV O;  1ZOT B;  1WRK A;  1D1O A;  1OMV A;  4MLW A;  3CR4 X;  1K9U A;  2FJU B;  2KBI A;  4OR9 B;  1LKJ A;  1RTP 1;  4OCI A;  4NDD A;  4PE7 A;  1N0Y A;  3R1O A;  3TUY C;  1WRZ A;  3DYE A;  4AQJ A;  1B9A A;  3CDN A;  3FE6 A;  3N7H A;  1CDP A;  1B8L A;  2BE4 A;  2B1U A;  1CDM A;  1FF1 A;  1TNP A;  1XFW O;  2L50 A;  1RFJ A;  3OX5 A;  3LCP C;  4GUK A;  5IBW A;  1NYA A;  3SIA A;  2KHN A;  1AK8 A;  1XYD A;  3S0G A;  2LAN A;  1YUS A;  2Y1N A;  3LK1 A;  3PAL A;  1TRF A;  2WC6 A;  1CLB A;  4BY5 A;  2RGI A;  4OZD A;  3SG3 A;  3TS5 C;  2L5Y A;  1CMF A;  2LP3 A;  3OGN A;  1XFZ O;  3FWC A;  3NSO A;  3TDZ A;  2MAZ A;  2PYQ A;  3VGO A;  4C0J A;  5HYD A;  2KFF A;  2NLN A;  1OMR A;  3BUM B;  3BUO B;  4MRX A;  1KQV A;  3D0Y B;  1NSH A;  3BOW B;  2K7C A;  2M0R A;  3EKJ A;  2H2K A;  3I5H B;  2PSR A;  4I5J A;  1UP5 A;  2COL B;  2JWW A;  1CDL A;  2F2O A;  2OTG B;  3VB1 A;  1NCZ A;  1QX7 A;  2ERB A;  1S5G Y;  1YTZ C;  2KFG A;  5CSN A;  4QJ5 B;  5FI2 A;  5EL2 A;  3S0F A;  1K8U A;  1QVI Y;  1PRW A;  1YUT A;  2A4J A;  1LS8 A;  4WRI A;  2M29 A;  1F54 A;  3CR2 A;  2M7L A;  1TCO B;  3BJH A;  3BYA A;  1AP4 A;  2LHL A;  1NIW A;  4JQ0 D;  2PVB A;  1M46 A;  5CSF A;  3TDI A;  2Y4Q A;  3BFA A;  5I2O A;  1MR8 A;  2K7D A;  2L4I A;  1CLM A;  3OBV A;  1Y1U A;  2L5X B;  3LLE A;  4ZCV A;  1N2D A;  2H61 C;  2JNX A;  3I5F B;  4ORB B;  1OOH A;  3I5G C;  2WCM A;  2FOT A;  3AKB A;  3SG4 A;  4M2P A;  1JBA A;  2Q91 A;  1IJ6 A;  3C1V A;  1SL7 A;  3DF0 B;  4JPZ B;  5DKR A;  1UHJ A;  1L7Z A;  2QDI A;  1CFF A;  5ER5 A;  2CBL A;  1DVI A;  3EKH A;  5HL1 A;  3PM8 A;  1S5G Z;  2H8V A;  2WCB A;  3B87 A;  3O6B A;  2HQ8 A;  2WOS A;  5CSJ A;  1A03 A;  2BEC A;  1SCM B;  3EK4 A;  2BBN A;  4HRG A;  3R1P A;  3V2L A;  4MVF A;  3EVR A;  2YGU A;  1F4O A;  1G33 A;  3Q8I A;  3JTD C;  2OTG C;  1EG3 A;  3OB1 B;  2K7B A;  4GBA A;  2WCK A;  3RM1 A;  1J7P A;  2JPO A;  1L2O B;  1QTX A;  2WOR A;  1UHK A;  3S0B A;  4KYN A;  2CTN A;  4M2Q A;  3SS5 A;  4E68 A;  1ZUZ A;  1IQ3 A;  2LVJ A;  3BFH A;  2JQ6 A;  3KF9 A;  2ZN9 A;  4GFT A;  1TNX A;  1UHN A;  1XO5 A;  2Q4U A;  2K2A A;  4C0L A;  4CFQ A;  3CZ2 A;  1WLZ A;  1WDC C;  1QS7 A;  3NHT A;  1PVB A;  4YGB B;  1N65 A;  3VRN A;  1ALW A;  1K94 A;  1KK8 C;  1KK7 Y;  1SPY A;  1BOC A;  2MLE C;  3RLZ A;  3D77 A;  3PSR A;  3GK2 A;  1V1G A;  1IJ5 A;  1DC1 A;  1MHO A;  3D0Y A;  3DVE A;  2LV7 A;  3BOW A;  3DVK A;  1FI5 A;  3AKA A;  2JXC A;  1B8R A;  2LLT A;  1OE9 B;  2CT9 A;  2NXQ A;  1OQP A;  3JVT C;  4GGN A;  4DUQ A;  2KAY A;  2IS9 A;  2L98 A;  3NSK A;  2LMV A;  2LUX A;  3MSE B;  3OB2 B;  2HQW A;  3IQO A;  1A2X A;  4N1G A;  1NX2 A;  1CB1 A;  4MN0 A;  2QAC A;  2WCF A;  3SJS A;  2KPH A;  1OOG A;  4YBH B;  3PN7 C;  1ZFS A;  1BOD A;  2L4H A;  4ORC B;  2ZND A;  2AAO A;  2MJW B;  2PMY A;  3ZNI A;  2CXJ A;  1NX0 A;  5BPJ A;  5KSZ A;  3EG5 B;  3D75 A;  4P5O E;  3A4U B;  1DJY A;  3EK7 A;  4PHM A;  3AAJ A;  5AEQ A;  1QLK A;  4QJ4 B;  3SS3 A;  4INX A;  1MXE A;  1EJ3 A;  2KAV A;  3BXK A;  1OOJ A;  1DJG A;  1BU3 A;  1JF2 A;  1SW8 A;  2BL0 C;  4INW A;  4GGF A;  5HKY A;  3DD4 A;  4HRE E;  1BR1 B;  1SMG A;  1KK7 Z;  2LVK A;  2ZN8 A;  2V53 A;  4ZCU A;  2E6W A;  4PE4 A;  2LLS A;  2WND A;  1CFD A;  3KHE A;  3DF0 A;  4U8D A;  1NUB A;  3ZWH A;  1KFU L;  1JC2 A;  2KQ6 A;  2ZRT A;  4PHK A;  1W7I B;  1S36 A;  1Y0V H;  2AUC A;  2M3W A;  1QAT A;  1YVL A;  1KQM C;  1CFP A;  2OS8 B;  5HLO A;  2LVI A;  1EL4 A;  2WCE A;  2BCA A;  1IG5 A;  2P70 A;  2Y5I A;  3I5I C;  4MBE A;  4A4B A;  3NSI A;  4DIR A;  2I7A A;  1S6C A;  1SR6 C;  1XVJ A;  3IF7 A;  1AJ5 A;  1R2U A;  2ISD A;  2KI4 B;  1B47 A;  1KFX S;  1S6J A;  4YGA A;  4FQO A;  3DZT A;  3A8R A;  4DS7 A;  4IJ7 A;  4YGD B;  5HKW A;  3GK1 A;  2F3Y A;  2O60 A;  3WXA A;  1K2H A;  2EC6 B;  1K90 D;  3PLF B;  2SCP A;  2DOQ A;  1TIZ A;  3PAT A;  5DIC A;  4C0K A;  3UO9 A;  1YX8 A;  1B8C A;  2KSP A;  3M0W A;  1DEK A;  1IRJ A;  3CZ0 A;  1A29 A;  1GJY A;  3WHU B;  1C3Y A;  2AMI A;  1FW4 A;  1OZS A;  2QEH A;  1UHH A;  1PVA A;  1DF0 B;  1LXF C;  1GGW A;  1G8I A;  1GM0 A;  1CTR A;  1TUJ A;  1TWO A;  1SNL A;  3FE8 A;  1K96 A;  1RWY A;  2K8M B;  4PT1 A;  1S3P A;  2HPS A;  2M8U A;  3SG6 A;  4HSZ A;  3TDU A;  2F33 A;  1PK0 D;  4MRY A;  2WCL A;  3GK4 X;  3FS7 A;  3HCM A;  3BUW B;  1BR4 B;  2MBX A;  1JFJ A;  1WY9 A;  1KFU S;  1SYM A;  2QEO A;  3B86 A;  2VRG A;  1XA5 A;  1NCX A;  1RRO A;  4OKH A;  4DCK A;  1QIV A;  1UUS A;  1AHR A;  4JKT A;  2OS8 C;  3S0A A;  1S6I A;  1B4C A;  3B6X A;  3BUN B;  3L4A A;  5K89 A;  2KQY A;  4OV2 A;  1S26 D;  2BKI B;  1OOF A;  1SCV A;  2JC2 A;  2JNF A;  2LAP A;  1F71 A;  1OOI X;  1BT6 A;  2LUC A;  3CZ1 A;  3NHI A;  2MA2 A;  4N1F A;  1DEL A;  5CPV A;  1QXP A;  5FYX A;  3VRO A;  5GQQ C;  1IQ5 A;  1HQV A;  1YR5 A;  3ICB A;  2M49 B;  2K2F A;  1YX7 A;  1C7V A;  4ICB A;  2GGM A;  3SIB A;  3VRP A;  2HF5 A;  2KLE A;  3I5H C;  4ORA B;  4TNC A;  2JPT A;  4USL A;  3VRQ A;  1CLL A;  2JRF A;  3PFV A;  2R2I A;  1C07 A;  2PRU A;  1JFK A;  2MHH A;  3KO0 A;  2BCB A;  2OPO A;  1TCF A;  3EVV A;  1RJV A;  2KDH A;  4YRU A;  1JSA A;  3B7A A;  3NGV A;  4WQ3 A;  3O4X A;  2JTZ A;  2LE9 B;  1UHI A;  2ZNE A;  3PJI A;  1DQE A;  4AOM A;  3QRX A;  2KGB C;  4PCW A;  1M31 A;  5DKQ A;  3K1E A;  5JOL A;  2PAL A;  4UPG A;  4DRW A;  5TNC A;  2LM5 A;  4GAO A;  1SL8 A;  1JWD A;  5FI7 A;  1K95 A;  1OSA A;  3DVM A;  2D8N A;  3BQ3 A;  3D74 A;  1QV1 A;  1NP8 A;  1PSB A;  2KI6 D;  3SG7 A;  2NZ0 A;  1VRK A;  2K7O A;  2F8P A;  1XFU O;  2LLU A;  2WCH A;  2WC5 A;  3I5F C;  4GGF C;  1BMO A;  1NWD A;  1H8B A;  1SKT A;  1KFX L;  1DF0 A;  1HT9 A;  1JF0 A;  1W7J B;  3EK8 A;  4BY4 A;  1H4B A;  1T14 A;  4Q04 A;  1F8H A;  3SG5 A;  4P2Y B;  1ZMZ A;  1ORG A;  4MSP A;  3TUY B;  2WC8 A;  1BJF A;  2LCP A;  4CFR A;  1BG1 A;  1Q80 A;  2LMU A;  1QV0 A;  2FCE A;  3D73 A;  1SK6 D;  1SCM C;  4I5L B;  1IIO A;  4MZJ A;  3CAB A;  3NSL A;  5D3O A;  2FCD A;  4XJK B;  1XK4 A;  3KEV A;  1BLQ A;  3IQQ A;  1U5I B;  3R72 A;  1YRU B;  4MZK A;  1L2O C;  2LC5 A;  2F3Z A;  2O5G A;  4R1E A;  3SS4 A;  3VRR A;  1CFC A;  2I2R E;  5I8N A;  3D76 A;  2LNK A;  1IGV A;  3TS5 B;  5CSI A;  1MUX A;  5KTY A;  2LP2 A;  2E30 A;  3CS1 A;  3FIA A;  5DKN A;  1OMD A;  1X02 A;  1KSM A;  4PE1 A;  1DJH A;  2M1U A;  1LA0 A;  2NCP A;  3KPX A;  2KAX A;  2JZI A;  2BE6 A;  3O2P A;  3E3R A;  3CR5 X;  1SSE B;  1QWV A;  5D7F A;  1F70 A;  4A4C A;  5AER A;  2MLF C;  3B88 A;  1AJ4 A;  2FJY A;  4NQG A;  1TUZ A;  1SRA A;  5ER4 X;  1CMG A;  1B7T Y;  4M2O A;  1MWN A;  1CDN A;  1NPQ A;  3CZT X;  3CGA A;  2HET A;  3OX6 A;  3QME A;  1ZAC A;  1EG4 A;  3PM2 A;  2NCO A;  2EHB A;  3CTN A;  4YGC B;  3RZS A;  1WRL A;  4YI8 A;  1QAS A;  4F0Z B;  2CNP A;  1KSO A;  2JUL A;  1XFX O;  2ZKM X;  1A4P A;  2K60 A;  4XYN A;  1J1E A;  4I5K A;  4IL1 A;  1FBV A;  2I18 A;  3OP0 A;  4D1E A;  1OZO A;  2LMT A;  1QX2 A;  3I5G B;  2ZRS A;  2PAS A;  2KOT A;  4PAL A;  1JUO A;  2JT0 A;  5JJG A;  2L0P A;  2JT3 A;  3O78 A;  1DJI A;  5I2L A;  1K93 D;  1OW4 A;  5AAN A;  5D69 A;  1AUI B;  2QEV A;  3UNW A;  3DXL A;  2KLD A;  3D10 A;  1FPW A;  1R6P A;  1MXL C;  1REC A;  1WLM A;  2GGZ A;  3GOF A;  2KYC A;  1LA3 A;  3S0E A;  1SBJ A;  3SG2 A;  2M7N A;  1KWO B;  1ODB A;  4FQT A;  4YGE B;  2M97 A;  4AQI A;  3JTD B;  1B7T Z;  3CLN A;  1A75 B;  5J3X A;  4MEW A;  2G2B A;  4XJK A;  3R1V A;  1M63 B;  2KI4 C;  1TOP A;  1U5I A;  2G9B A;  2WCJ A;  3F45 A;  1W9Z A;  4PDZ A;  5I94 A;  2KBM A;  1J1D A;  2L2C A;  1IWQ A;  1Y1X A;  2K0J A;  2EC6 C;  4FTG A;  1WDC B;  3H4S E;  1LIN A;  2LHI A;  3IVT A;  1J7Q A;  1KK8 B;  1M45 A;  1NCY A;  1TTX A;  2TN4 A;  1ALV A;  2PQL A;  1J55 A;  2KFH A;  1XFR A;  1Y1A A;  1KCY A;  4JD9 A;  4N5X A;  4I5N B;  1PAL A;  1Z4H A;  2MRD A;  1AVS A;  2SAS A;  1YUR A;  1EXR A;  2BNX A;  3JVT B;  1GQM A;  3HX4 A;  5F6T A;  1PSR A;  1K9P A;  1QX5 B;  1M39 A;  1K9K A;  1GGZ A;  1Y6W A;  1UWO A;  5AFP A;  2QEB A;  4CPV A;  3OHM B;  1TNW A;  1UUR A;  2JTT A;  2Y1M A;  3NXA A;  2JOJ A;  2LVV A;  4ETO A;  1DT7 B;  3PN7 B;  1KWO C;  1NX3 A;  1XK4 C;  2M9G A;  1F4Q A;  1EH2 A;  4L9M A;  1S1E A;  1SL9 A;  1QVI Z;  3LL8 B;  4WQ2 A;  1PUL A;  2GV5 A;  4OVN F;  1IKU A;  1DMO A;  2JT8 A;  2K61 A;  4PHJ A;  1FI6 A;  4MZL A;  1TNQ A;  1YVH A;  1DTL A;  2QPT A;  3L4L A;  2BCX A;  3BUX B;  2H61 A;  2GTE A;  1CM4 A;  2BBM A;  2BL0 B;  4NDB A;  5HLV A;  1LVC D;  4F7F A;  2P71 A;  3BFB A;  5PAL A;  1MF8 B;  4GNK B; 
#chains in the Genus database with same CATH homology
 1V1F A;  1XFY O;  2P6B B;  4PHN A;  2KGR A;  1B1G A;  1NX1 A;  1E8A A;  3TZ1 A;  2ZFD A;  3FWB A;  2I94 A;  1KQM B;  3WHT B;  2KI6 C;  2BKH B;  3CWG A;  3DVJ A;  4GPL B;  3I5I B;  1G4Y R;  1J7R A;  3LK0 A;  2EGD A;  1SR6 B;  1DGV A;  1BF5 A;  1A75 A;  2M1K B;  5AXI A;  5I2Q A;  4CID A;  2L2E A;  1QIW A;  5HKZ A;  1YRT B;  3AAK A;  1DJX A;  2CCM A;  4JWQ A;  1SY9 A;  1F55 A;  1MQ1 A;  3K21 A;  4PE0 A;  3EVU A;  2JU0 A;  1DJW A;  1YUU A;  2JXL A;  2L51 A;  4CLN A;  2KYF A;  2F2P A;  4YI9 A;  1IH0 A;  5B8I B;  4NDC A;  1CM1 A;  1RK9 A;  1DJZ A;  5KU1 A;  5G08 A;  1QJT A;  1QLS A;  4QJ3 B;  1DGU A;  1TN4 A;  1CNP A;  1J7O A;  2KNE A;  4HRH A;  3WNX B;  3O4Y A;  1C7W A;  1XFV O;  1ZOT B;  1WRK A;  1D1O A;  1OMV A;  4MLW A;  3CR4 X;  1K9U A;  2FJU B;  2KBI A;  4OR9 B;  1LKJ A;  1RTP 1;  4OCI A;  4NDD A;  4PE7 A;  1N0Y A;  3TUY C;  1WRZ A;  4AQJ A;  1B9A A;  1CDP A;  1B8L A;  2BE4 A;  2B1U A;  1CDM A;  1FF1 A;  1TNP A;  1XFW O;  2L50 A;  1RFJ A;  3OX5 A;  3LCP C;  4GUK A;  5IBW A;  1NYA A;  2KHN A;  1AK8 A;  1XYD A;  2LAN A;  1YUS A;  2Y1N A;  3LK1 A;  3PAL A;  1TRF A;  1CLB A;  4BY5 A;  2RGI A;  3SG3 A;  3TS5 C;  1CMF A;  2LP3 A;  1XFZ O;  3FWC A;  3NSO A;  3TDZ A;  2MAZ A;  3VGO A;  4C0J A;  5HYD A;  2KFF A;  2NLN A;  1OMR A;  3BUM B;  3BUO B;  4MRX A;  1KQV A;  3D0Y B;  1NSH A;  3BOW B;  2K7C A;  2M0R A;  3EKJ A;  2H2K A;  3I5H B;  2PSR A;  4I5J A;  1UP5 A;  2COL B;  2JWW A;  1CDL A;  2F2O A;  2OTG B;  1NCZ A;  1QX7 A;  2KFG A;  1S5G Y;  1YTZ C;  5CSN A;  4QJ5 B;  1K8U A;  1QVI Y;  1PRW A;  1YUT A;  2A4J A;  4WRI A;  2M29 A;  1F54 A;  3CR2 A;  2M7L A;  1TCO B;  3BYA A;  1AP4 A;  2LHL A;  1NIW A;  4JQ0 D;  2PVB A;  1M46 A;  5CSF A;  3TDI A;  2Y4Q A;  5I2O A;  1MR8 A;  2K7D A;  2L4I A;  1CLM A;  1Y1U A;  2L5X B;  3LLE A;  4ZCV A;  1N2D A;  2H61 C;  2JNX A;  3I5F B;  4ORB B;  3I5G C;  2FOT A;  3AKB A;  3SG4 A;  4M2P A;  1JBA A;  2Q91 A;  1IJ6 A;  3C1V A;  1SL7 A;  3DF0 B;  4JPZ B;  5DKR A;  1UHJ A;  1L7Z A;  1CFF A;  5ER5 A;  2CBL A;  1DVI A;  3EKH A;  3PM8 A;  1S5G Z;  2WCB A;  5CSJ A;  3O6B A;  1A03 A;  2HQ8 A;  2WOS A;  1KCY A;  2BEC A;  1SCM B;  3EK4 A;  2BBN A;  4HRG A;  4MVF A;  3EVR A;  1F4O A;  1G33 A;  3JTD C;  2OTG C;  1EG3 A;  3OB1 B;  2K7B A;  4GBA A;  3RM1 A;  1J7P A;  1L2O B;  1QTX A;  2WOR A;  1UHK A;  2CTN A;  4M2Q A;  4E68 A;  1ZUZ A;  1IQ3 A;  2LVJ A;  2JQ6 A;  3KF9 A;  2ZN9 A;  4GFT A;  1TNX A;  1UHN A;  1XO5 A;  2Q4U A;  2K2A A;  4C0L A;  4CFQ A;  1WLZ A;  1WDC C;  1QS7 A;  1PVB A;  4YGB B;  1N65 A;  3VRN A;  1ALW A;  1K94 A;  1KK8 C;  1KK7 Y;  1SPY A;  1BOC A;  2MLE C;  3RLZ A;  3PSR A;  3GK2 A;  1V1G A;  1IJ5 A;  1MHO A;  3D0Y A;  3DVE A;  2LV7 A;  3BOW A;  3DVK A;  1FI5 A;  3AKA A;  2JXC A;  1B8R A;  2LLT A;  1OE9 B;  2CT9 A;  2NXQ A;  1OQP A;  3JVT C;  4GGN A;  4DUQ A;  2KAY A;  2IS9 A;  2L98 A;  3NSK A;  2LMV A;  2LUX A;  3MSE B;  3OB2 B;  2HQW A;  3IQO A;  1A2X A;  4N1G A;  1NX2 A;  1CB1 A;  4MN0 A;  2QAC A;  2WCF A;  3SJS A;  4YBH B;  3PN7 C;  1ZFS A;  1BOD A;  2L4H A;  4ORC B;  2ZND A;  2AAO A;  2MJW B;  2PMY A;  3ZNI A;  2CXJ A;  1NX0 A;  5BPJ A;  5KSZ A;  4P5O E;  4QJ4 B;  4PHM A;  3A4U B;  1DJY A;  3EK7 A;  3AAJ A;  5AEQ A;  1QLK A;  1MXE A;  1EJ3 A;  2KAV A;  3BXK A;  1OOJ A;  1DJG A;  1BU3 A;  1JF2 A;  1SW8 A;  2BL0 C;  5HKY A;  4GGF A;  3DD4 A;  4HRE E;  1BR1 B;  1SMG A;  1KK7 Z;  2LVK A;  2ZN8 A;  2V53 A;  4ZCU A;  2E6W A;  4PE4 A;  2LLS A;  2WND A;  1CFD A;  3KHE A;  3DF0 A;  4U8D A;  1NUB A;  3ZWH A;  1KFU L;  1JC2 A;  2KQ6 A;  2ZRT A;  4PHK A;  1W7I B;  1S36 A;  1Y0V H;  2AUC A;  2M3W A;  1QAT A;  1YVL A;  1KQM C;  1CFP A;  2OS8 B;  5HLO A;  2LVI A;  1EL4 A;  2WCE A;  2BCA A;  1IG5 A;  2Y5I A;  3I5I C;  4MBE A;  4A4B A;  3NSI A;  4DIR A;  2I7A A;  1S6C A;  1SR6 C;  1XVJ A;  3IF7 A;  1AJ5 A;  1R2U A;  2ISD A;  2KI4 B;  1B47 A;  1KFX S;  1S6J A;  4YGA A;  4FQO A;  3A8R A;  4DS7 A;  4YGD B;  5HKW A;  3GK1 A;  2F3Y A;  2O60 A;  3WXA A;  1K2H A;  2EC6 B;  1K90 D;  3PLF B;  2SCP A;  2DOQ A;  1TIZ A;  3PAT A;  4C0K A;  1B8C A;  1YX8 A;  2KSP A;  3M0W A;  1IRJ A;  1A29 A;  1GJY A;  3WHU B;  2AMI A;  1FW4 A;  1OZS A;  1UHH A;  1PVA A;  1DF0 B;  1LXF C;  1GGW A;  1G8I A;  1CTR A;  3SIA A;  1SNL A;  1K96 A;  1RWY A;  2K8M B;  1CKK A;  1S3P A;  2HPS A;  2M8U A;  3SG6 A;  4HSZ A;  3TDU A;  2F33 A;  1PK0 D;  4MRY A;  3GK4 X;  3FS7 A;  3HCM A;  3BUW B;  1BR4 B;  2MBX A;  1JFJ A;  1WY9 A;  1KFU S;  1SYM A;  2VRG A;  1XA5 A;  1NCX A;  1RRO A;  4OKH A;  4DCK A;  1QIV A;  1UUS A;  1AHR A;  2OS8 C;  1S6I A;  1B4C A;  3BUN B;  5K89 A;  2KQY A;  4OV2 A;  1S26 D;  2BKI B;  1SCV A;  2JC2 A;  2JNF A;  2LAP A;  1F71 A;  1BT6 A;  2LUC A;  2MA2 A;  4N1F A;  5FYX A;  5CPV A;  1QXP A;  3VRO A;  5GQQ C;  1IQ5 A;  1HQV A;  1YR5 A;  3ICB A;  2M49 B;  2K2F A;  1YX7 A;  1C7V A;  4ICB A;  2GGM A;  3SIB A;  3VRP A;  2HF5 A;  3I5H C;  4ORA B;  4TNC A;  4USL A;  2JPT A;  3VRQ A;  1CLL A;  2JRF A;  3PFV A;  2R2I A;  2PRU A;  1JFK A;  2MHH A;  3KO0 A;  2BCB A;  2OPO A;  1TCF A;  3EVV A;  1RJV A;  2KDH A;  4YRU A;  1JSA A;  4WQ3 A;  2JTZ A;  2LE9 B;  1UHI A;  2ZNE A;  4AOM A;  3QRX A;  2KGB C;  4PCW A;  1M31 A;  5DKQ A;  4UPG A;  5JOL A;  2PAL A;  4DRW A;  5TNC A;  2LM5 A;  4GAO A;  1SL8 A;  1JWD A;  1K95 A;  1OSA A;  3DVM A;  2D8N A;  3BQ3 A;  1QV1 A;  1NP8 A;  1PSB A;  2KI6 D;  3SG7 A;  2NZ0 A;  1VRK A;  2K7O A;  2F8P A;  1XFU O;  2LLU A;  3I5F C;  4GGF C;  1BMO A;  1NWD A;  1H8B A;  1SKT A;  1KFX L;  1DF0 A;  1HT9 A;  1JF0 A;  1W7J B;  3EK8 A;  4BY4 A;  1H4B A;  4Q04 A;  1F8H A;  3SG5 A;  4P2Y B;  1ZMZ A;  4MSP A;  3TUY B;  2WC8 A;  1BJF A;  2LCP A;  4CFR A;  1BG1 A;  1Q80 A;  2LMU A;  1QV0 A;  2FCE A;  1SK6 D;  1SCM C;  4I5L B;  4MZJ A;  3NSL A;  2FCD A;  4XJK B;  1XK4 A;  3KEV A;  1BLQ A;  3IQQ A;  1U5I B;  1YRU B;  4MZK A;  1L2O C;  2LC5 A;  2F3Z A;  2O5G A;  4R1E A;  1CFC A;  3VRR A;  2I2R E;  2LNK A;  1IGV A;  3TS5 B;  5CSI A;  1MUX A;  5KTY A;  2LP2 A;  2E30 A;  3CS1 A;  3FIA A;  5DKN A;  1OMD A;  1X02 A;  1KSM A;  4PE1 A;  1DJH A;  2M1U A;  1LA0 A;  2NCP A;  3KPX A;  2KAX A;  2JZI A;  2BE6 A;  3O2P A;  3E3R A;  3CR5 X;  5D7F A;  1F70 A;  4A4C A;  5AER A;  2MLF C;  1AJ4 A;  4NQG A;  1SRA A;  5ER4 X;  1CMG A;  1B7T Y;  4M2O A;  1MWN A;  1CDN A;  1NPQ A;  3CZT X;  3CGA A;  2HET A;  3OX6 A;  1ZAC A;  1EG4 A;  2NCO A;  2EHB A;  3CTN A;  4YGC B;  1WRL A;  4YI8 A;  1QAS A;  4F0Z B;  2CNP A;  1KSO A;  2JUL A;  1XFX O;  2ZKM X;  1A4P A;  4XYN A;  1J1E A;  4I5K A;  4IL1 A;  1FBV A;  2I18 A;  3OP0 A;  4D1E A;  1OZO A;  2LMT A;  1QX2 A;  3I5G B;  2ZRS A;  2PAS A;  2KOT A;  4PAL A;  1JUO A;  2JT0 A;  5JJG A;  2L0P A;  2JT3 A;  3O78 A;  1DJI A;  5I2L A;  1K93 D;  5AAN A;  5D69 A;  1AUI B;  3D10 A;  1FPW A;  1R6P A;  1MXL C;  1REC A;  1WLM A;  2GGZ A;  3GOF A;  2KYC A;  1LA3 A;  3SG2 A;  1SBJ A;  2M7N A;  1KWO B;  1ODB A;  4YGE B;  2M97 A;  4AQI A;  3JTD B;  1B7T Z;  3CLN A;  1A75 B;  5J3X A;  4MEW A;  2G2B A;  4XJK A;  1M63 B;  2KI4 C;  1TOP A;  1U5I A;  2G9B A;  3F45 A;  4PDZ A;  2KBM A;  1J1D A;  1IWQ A;  1Y1X A;  2K0J A;  2EC6 C;  4FTG A;  1WDC B;  3H4S E;  1LIN A;  2LHI A;  1J7Q A;  1KK8 B;  1M45 A;  1NCY A;  1TTX A;  2TN4 A;  1ALV A;  1J55 A;  2KFH A;  1Y1A A;  4N5X A;  4I5N B;  1PAL A;  2MRD A;  1AVS A;  2SAS A;  1YUR A;  1EXR A;  3JVT B;  5F6T A;  1GQM A;  3HX4 A;  1PSR A;  1K9P A;  1QX5 B;  1M39 A;  1K9K A;  1GGZ A;  1Y6W A;  1UWO A;  5AFP A;  4CPV A;  3OHM B;  1TNW A;  1UUR A;  2JTT A;  2Y1M A;  3NXA A;  2JOJ A;  2LVV A;  4ETO A;  1DT7 B;  3PN7 B;  1KWO C;  1NX3 A;  1XK4 C;  2M9G A;  1F4Q A;  1EH2 A;  4L9M A;  1S1E A;  1SL9 A;  1QVI Z;  3LL8 B;  4WQ2 A;  1PUL A;  2GV5 A;  4OVN F;  1IKU A;  1DMO A;  2JT8 A;  2K61 A;  4PHJ A;  1FI6 A;  4MZL A;  1TNQ A;  1YVH A;  1DTL A;  2QPT A;  2BCX A;  3BUX B;  2H61 A;  4NDB A;  1CM4 A;  2BBM A;  2BL0 B;  5HLV A;  1LVC D;  1C07 A;  5I8N A;  5PAL A;  1MF8 B;  4GNK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...