5AEQA

Neuronal calcium sensor (ncs-1)from rattus norvegicus
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
188
structure length
172
Chain Sequence
GKSNSKLKPEVVEELTRKTYFTEKEVQQWYKGFIKDCPSGQLDAAGFQKDPTKFATFVFNVFDENKDGRIEFSEFIQALSVTSRGTLDEKLRWAFKLYDLDNDGYITRNEMLDIVDAIYQMPEEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEURONAL CALCIUM SENSOR 1
publication title Neuronal Calcium Sensor-1 Binds the D2 Dopamine Receptor and G-Protein-Coupled Receptor Kinase 1 (Grk1) Peptides Using Different Modes of Interactions.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 67
structure length 172
sequence length 188
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5aeqA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5aeqA02
1NUBA 3BOWB 1MUXA 1YUUA 3FWBA 4HRGA 1DMOA 3E3RA 1ZFSA 1SYMA 4CPVA 3VGOA 2LMTA 1PRWA 3KEVA 1RWYA 5CSIA 4FTGA 2KNEA 1CDMA 2K7CA 4USLA 1Y0VH 1XFZO 5AEQA 4MBEA 1M46A 2A4JA 3KHEA 1QATA 2MHHA 1TCOB 5HKZA 2Y5IA 2KSPA 1ZMZA 3PFVA 1MXLC 2HQ8A 4PE7A 1IG5A 1DJHA 3KO0A 4XJKB 2BE6A 1C7VA 1D1OA 2M8UA 2BECA 1K93D 1S6JA 2K2AA 1LINA 1SCMB 2MAZA 4C0LA 4HREE 4MZLA 5HYDA 3PLFB 1QVIY 3KPXA 3CLNA 1S1EA 3SG4A 2KYCA 3TUYC 1CLLA 2LP2A 1N0YA 3OX6A 3EK7A 1S6IA 5D69A 1CNPA 3O78A 1R6PA 2MA2A 2FOTA 3VROA 1B8LA 3IQOA 4M2QA 3CGAA 1RFJA 3K21A 1UHIA 3AAKA 4WQ3A 1S36A 4PHKA 1BLQA 1OQPA 2O60A 2RGIA 5GQQC 3PATA 1XFXO 1SK6D 4GGNA 1BT6A 1PK0D 2L50A 1B4CA 2Y1NA 1EL4A 3CR2A 1N65A 1KFXS 1QLKA 2Q4UA 1DF0A 1RK9A 2BL0B 1QXPA 4I5NB 1KSOA 2LV7A 2LANA 1KSMA 1KQMC 2F2OA 3BQ3A 3SG2A 1K9UA 1QX5B 4MLWA 1LXFC 1F8HA 4CLNA 1HQVA 2PALA 3F45A 1DT7B 3DF0A 1MQ1A 1UHKA 1SKTA 1DGUA 1M63B 2KGBC 1JC2A 1JF0A 4HRHA 1QX2A 1TNXA 1TOPA 2M7NA 1EG4A 4PE4A 2MLFC 1A03A 1R2UA 2MLEC 1H4BA 2ISDA 1RROA 3LCPC 1A75B 2G9BA 2SCPA 2LCPA 3PN7C 1ALVA 1IGVA 1TN4A 1WY9A 2FCEA 2KFFA 2PVBA 2TN4A 1CDNA 1SMGA 1XO5A 2NZ0A 4IL1A 4L9MA 5I2QA 1CTRA 1KK7Y 1QLSA 2M9GA 5KU1A 2ZN8A 2BCAA 2JQ6A 4GGFC 1ODBA 2M1UA 3HCMA 4D1EA 2KYFA 1UURA 2LAPA 1IQ5A 2HPSA 5CPVA 2LM5A 3C1VA 3I5GB 1TIZA 2O5GA 4DIRA 3O6BA 2KI6D 1YX8A 2BBNA 2OS8C 1BG1A 1ZUZA 1U5IB 1K95A 1NX3A 3I5HC 3WHTB 4YGCB 3SJSA 5AXIA 2HETA 1F70A 2LVKA 3OB2B 5DKRA 1QIVA 1OMVA 3QRXA 2E30A 4MN0A 3SG3A 2LC5A 1KWOC 1SW8A 1DJIA 1NCXA 2WOSA 3PM8A 4N5XA 3CR5X 1AVSA 4N1FA 1XA5A 1EXRA 4ORBB 1ALWA 1KK7Z 1SL8A 1TRFA 2K7DA 2L0PA 2OTGB 1IRJA 2ZNDA 3MSEB 4GFTA 3I5FC 4UPGA 1UHJA 2WCBA 1KFXL 3ZWHA 4DUQA 3BUXB 1GGZA 2PMYA 1SR6B 3TS5C 1C07A 5F6TA 4P5OE 1B1GA 2MBXA 2JT3A 2LMVA 3EKHA 4M2PA 1JBAA 2M0RA 1WDCC 2F3ZA 2K61A 2K0JA 1BODA 1QJTA 1A4PA 2D8NA 3PSRA 4YGDB 5J3XA 2ZFDA 3CWGA 2LHLA 3JVTC 3GK2A 2KI4C 4Q04A 1S5GY 1PALA 1DVIA 5JOLA 4GBAA 2GGZA 3FS7A 4DCKA 4QJ5B 5HKYA 1L7ZA 2KBIA 2LHIA 2L5XB 3LLEA 3OHMB 4A4CA 2LVVA 5IBWA 3OP0A 2EC6C 1CFDA 2IS9A 2LMUA 1J7PA 1NWDA 1B8CA 1CLMA 1AK8A 1NSHA 2JRFA 2FJUB 3KF9A 4QJ4B 5BPJA 2CTNA 1YRTB 1M45A 3NSLA 4NDBA 2KQYA 3WXAA 1A29A 5KSZA 2V53A 1UWOA 1AJ4A 1ZACA 2KAYA 4OR9B 2JNXA 4MRYA 1NCYA 2BCBA 1S5GZ 1FF1A 1DJWA 1CFCA 1YUTA 3OX5A 5CSNA 1NP8A 2M97A 2LLUA 5CSJA 1DF0B 1PSRA 4OKHA 1EJ3A 1DJZA 4DRWA 3BUMB 4YGAA 2K8MB 1WRLA 4PHNA 1YRUB 4OCIA 1IWQA 3TUYB 1IH0A 4I5JA 1CDPA 1WLZA 1OSAA 1Y1XA 2JWWA 2JZIA 2QPTA 3DF0B 2LLSA 2NCPA 1QVIZ 2CCMA 2AUCA 2LUXA 3NXAA 3CR4X 2LLTA 4PCWA 2BBMA 3WHUB 2CXJA 2WC8A 1GJYA 2R2IA 4C0JA 1DGVA 3A8RA 1B7TY 4MRXA 2M3WA 3SG5A 5PALA 4FQOA 2L2EA 3DVMA 4NQGA 2DOQA 4JPZB 2JT0A 1LKJA 2WNDA 1V1GA 4YI9A 1J1DA 2EGDA 5D7FA 3EVUA 1PVAA 1RJVA 3BUWB 4A4BA 1J1EA 1ZOTB 4ZCUA 5HKWA 3JTDC 1DJYA 3SIAA 4MZKA 1KQMB 2KFGA 1NCZA 1FBVA 2ZN9A 3O4YA 1K94A 4GNKB 1Y6WA 1AJ5A 2M1KB 1PULA 1TNPA 1XVJA 2GGMA 3D0YB 2ZNEA 3HX4A 4JWQA 1K90D 3I5IC 2Q91A 1K9PA 1B7TZ 3CS1A 2Y4QA 3LK0A 2KQ6A 2BKIB 3PN7B 1V1FA 3SG7A 1JFJA 2NCOA 1CKKA 1K8UA 4CFQA 1GGWA 1EG3A 3H4SE 2JXLA 1F54A 1KQVA 3EVVA 1K9KA 2BCXA 1SL9A 2AMIA 2KAXA 2CT9A 1QIWA 1JSAA 1Y1UA 2I94A 1YR5A 1MR8A 1FI5A 5HLOA 1K2HA 1QV1A 1JFKA 1SL7A 2OS8B 1GQMA 2L51A 2L98A 2LUCA 3I5HB 1W7JB 1C7WA 2G2BA 1XFYO 2KGRA 2FCDA 2PSRA 3BYAA 1KK8C 2VRGA 1LA3A 1Q80A 3AKAA 1NPQA 4P2YB 2NXQA 1KWOB 1EH2A 3D10A 2KHNA 4CIDA 1JF2A 4F0ZB 1IJ6A 1E8AA 1UHHA 1XFVO 2H61C 2WORA 1QX7A 3A4UB 3CTNA 4NDCA 2PRUA 5I2LA 2K2FA 5G08A 3NSIA 1B47A 2PASA 3NSKA 4OV2A 3RM1A 4U8DA 2KOTA 1WLMA 3I5FB 1S6CA 1W7IB 3PALA 4GAOA 4PALA 2H2KA 2P6BB 1B8RA 2KBMA 3TDUA 1TTXA 1OZOA 1OE9B 3TS5B 2JPTA 3AAJA 2F3YA 4MVFA 4MZJA 3RLZA 3BUOB 1F4QA 1NX2A 4MEWA 2CBLA 1YX7A 4ORCB 1JWDA 2HQWA 1KCYA 1OMDA 1CDLA 2K7OA 3LK1A 1BF5A 1NX1A 1JUOA 1RECA 2LE9B 2ZRSA 1WDCB 2QACA 1CFFA 4ORAB 1NIWA 1TNQA 1SCMC 3GOFA 1H8BA 5AANA 4PE0A 4YI8A 3BOWA 2JT8A 3SG6A 2H61A 2I2RE 2EHBA 3JVTB 2KI4B 4QJ3B 2JNFA 2JC2A 1CB1A 1A2XA 3EVRA 1MXEA 3EKJA 3TDIA 2OPOA 3DVKA 4I5LB 1UUSA 1YVHA 1J7OA 4ETOA 4WQ2A 1UHNA 3DVJA 5DKNA 2EC6B 4PE1A 4PHMA 5AERA 4YBHB 1FPWA 2JULA 3DVEA 3WNXB 3FWCA 1QASA 3VRQA 5I2OA 1OZSA 1YUSA 4XJKA 1HT9A 4AOMA 1CLBA 1J7RA 3IQQA 3TZ1A 1SY9A 2L4HA 2B1UA 1SRAA 1S26D 2JTZA 3FIAA 2JOJA 2BL0C 1FI6A 1G8IA 2K7BA 4YRUA 1IJ5A 1J55A 2BE4A 4TNCA 4C0KA 2ZRTA 1IKUA 1MWNA 1J7QA 4BY4A 4I5KA 1L2OC 1IQ3A 1YVLA 2L4IA 2WCEA 1F71A 1SPYA 2COLB 3BXKA 2M7LA 1DJXA 3BUNB 2BKHB 2KI6C 1BR4B 4GPLB 4XYNA 2CNPA 2SASA 5HLVA 1KFUS 2Y1MA 4BY5A 1CMGA 4R1EA 1WRKA 1S3PA 4GUKA 1PSBA 2F33A 2LNKA 5KTYA 1TNWA 4YGBB 1LA0A 5TNCA 1L2OB 1WRZA 1DTLA 1RTP1 1X02A 3GK4X 4HSZA 1CFPA 3VRRA 4ZCVA 1SNLA 1BMOA 1NYAA 1QTXA 3O2PA 4AQJA 2E6WA 2F8PA 4JQ0D 1XFUO 1M39A 4PHJA 4CFRA 2LVJA 1PVBA 1BR1B 5JJGA 5K89A 3DD4A 3M0WA 4WRIA 1OMRA 3I5GC 3IF7A 2GV5A 3JTDB 1OOJA 4ICBA 4OVNF 1CMFA 1TCFA 1AUIB 1QV0A 1MHOA 3OB1B 2KAVA 1YTZC 2JXCA 5ER4X 1N2DA 1B9AA 4YGEB 4NDDA 2WCFA 5ER5A 1F55A 1A75A 1XFWO 1XK4C 2MRDA 1UP5A 4M2OA 2ZKMX 3I5IB 1AP4A 1QS7A 3LL8B 1BJFA 1LVCD 2OTGC 4DS7A 2M29A 4E68A 3TDZA 3AKBA 2HF5A 1XYDA 1YURA 3GK1A 3VRNA 3D0YA 1AHRA 5DKQA 1CM4A 2JU0A 3ZNIA 4AQIA 2LVIA 5AFPA 1SR6C 2KFHA 2M49B 3NSOA 1VRKA 5I8NA 2AAOA 2KDHA 5FYXA 1CM1A 4PDZA 3VRPA 1DJGA 5CSFA 3CZTX 2NLNA 2I18A 1SCVA 2F2PA 1U5IA 1F4OA 1BU3A 3EK4A 1Y1AA 2I7AA 1KFUL 1G33A 1NX0A 3ICBA 1MF8B 5B8IB 1G4YR 2MJWB 1M31A 2JTTA 4MSPA 1K96A 1XK4A 4GGFA 4N1GA 1FW4A 3EK8A 1SBJA 1BOCA 1KK8B 3SIBA 2LP3A
chains in the Genus database with same CATH superfamily
1NUBA 3BFHA 3BOWB 1MUXA 1YUUA 3FWBA 4HRGA 1DMOA 3E3RA 1ZFSA 1SYMA 4CPVA 3VGOA 2LMTA 1PRWA 3KEVA 1RWYA 5CSIA 4FTGA 2KNEA 1CDMA 2K7CA 4USLA 4JKTA 1Y0VH 1XFZO 5AEQA 4MBEA 1M46A 1OOFA 2A4JA 3KHEA 4KYNA 1QATA 2MHHA 1TCOB 5HKZA 2Y5IA 4INWA 2KSPA 3OBVA 1ZMZA 3PFVA 1MXLC 2HQ8A 4PE7A 1IG5A 1DJHA 2WCHA 3KO0A 2BE6A 3R72A 4XJKB 2M8UA 1C7VA 2BECA 1D1OA 1K93D 1S6JA 2K2AA 3CYZA 1LINA 1SCMB 2MAZA 4C0LA 4HREE 3DYEA 4MZLA 5HYDA 3PLFB 1QVIY 3KPXA 3CLNA 1S1EA 3SG4A 2KYCA 3TUYC 1CLLA 2LP2A 1N0YA 3OX6A 3EK7A 1S6IA 1CMFA 5D69A 1CNPA 3O78A 1R6PA 2MA2A 2FOTA 3VROA 1B8LA 3IQOA 4M2QA 3CGAA 1RFJA 3K21A 1DEKA 1UHIA 3AAKA 4WQ3A 1S36A 4PHKA 1BLQA 1OQPA 2O60A 2RGIA 5GQQC 3RZSA 3PATA 1XFXO 4FQTA 3S0GA 1SK6D 4GGNA 1C3YA 1BT6A 1PK0D 2L50A 1B4CA 2Y1NA 1EL4A 3CR2A 1N65A 1KFXS 1QLKA 4NDCA 1DQEA 2Q4UA 1DF0A 1RK9A 2BL0B 1QXPA 4I5NB 1KSOA 2LV7A 2LANA 1KSMA 1KQMC 2F2OA 3BQ3A 3SG2A 1K9UA 1QX5B 1IIOA 4MLWA 1LXFC 1F8HA 4CLNA 1XFRA 1HQVA 2PALA 3F45A 1DT7B 3DF0A 1MQ1A 1UHKA 1SKTA 1OOGA 1TWOA 3PJIA 1DGUA 1M63B 2KGBC 1JC2A 1JF0A 4HRHA 1QX2A 1TNXA 1TOPA 2M7NA 1EG4A 4PE4A 2MLFC 1A03A 1R2UA 2MLEC 5FI7A 1H4BA 2ISDA 1RROA 3K1EA 1A75B 3LCPC 2G9BA 2WCJA 2SCPA 2LCPA 3PN7C 3VB1A 1DELA 2P70A 1ALVA 1IGVA 1TN4A 1WY9A 2FCEA 2KFFA 2KLDA 1T14A 2PVBA 2TN4A 1CDNA 1SMGA 1DC1A 1XO5A 2NZ0A 4IL1A 4L9MA 5I2QA 1CTRA 1KK7Y 2QEVA 1QLSA 2M9GA 5KU1A 2ZN8A 2BCAA 3EG5B 2JQ6A 4GGFC 1ODBA 2WCMA 2M1UA 3HCMA 4D1EA 2KYFA 1UURA 2LAPA 1IQ5A 2HPSA 2QEBA 5CPVA 2LM5A 3C1VA 3DZTA 3I5GB 1TIZA 2O5GA 2WCLA 4DIRA 3O6BA 2KI6D 1YX8A 2BBNA 2OS8C 3FE8A 1ZUZA 1U5IB 1K95A 1NX3A 3I5HC 1BG1A 3WHTB 4YGCB 3SJSA 5AXIA 2HETA 3S0AA 1F70A 2LVKA 2PQLA 3OB2B 5DKRA 1QIVA 1OMVA 3QRXA 2E30A 4MN0A 3SG3A 2LC5A 1KWOC 1SW8A 1DJIA 1NCXA 2WOSA 3PM8A 4N5XA 3CR5X 1AVSA 4N1FA 1XA5A 1EXRA 4ORBB 1ALWA 1KK7Z 1SL8A 1TRFA 2GTEA 2K7DA 2L0PA 1IRJA 2OTGB 2ZNDA 3MSEB 4GFTA 3I5FC 4UPGA 1UHJA 2WCBA 1KFXL 3ZWHA 4DUQA 3BUXB 1GGZA 2PMYA 3CZ0A 3BFBA 1SR6B 3TS5C 1C07A 5F6TA 4P5OE 5FI6A 1B1GA 2MBXA 2JT3A 2LMVA 3EKHA 3UO9A 4M2PA 3NHIA 2K60A 1JBAA 2M0RA 3B6XA 1WDCC 2F3ZA 2K61A 2K0JA 2PYQA 1BODA 1QJTA 1A4PA 2D8NA 3PSRA 3QMEA 4YGDB 5J3XA 2ZFDA 3CWGA 2LHLA 3BJHA 3JVTC 3GK2A 2KI4C 4Q04A 1S5GY 1PALA 1DVIA 5JOLA 4GBAA 2GGZA 3FS7A 4DCKA 4QJ5B 5HKYA 1L7ZA 2KBIA 2LHIA 2L5XB 3LLEA 3OHMB 3S0DA 2LVVA 4A4CA 5IBWA 3OP0A 2EC6C 1CFDA 3FE9A 2IS9A 2LMUA 1J7PA 1NWDA 1B8CA 1CLMA 3FE6A 1AK8A 5FI2A 1NSHA 2JRFA 5I94A 2FJUB 3KF9A 4QJ4B 5BPJA 2CTNA 1YRTB 1M45A 3NSLA 4NDBA 2KQYA 3WXAA 1A29A 5KSZA 2V53A 1UWOA 1AJ4A 2WC5A 1ZACA 1TUJA 2KAYA 2JNXA 4OR9B 4MRYA 1NCYA 2BCBA 1S5GZ 1FF1A 1DJWA 1CFCA 1YUTA 3OX5A 5CSNA 1NP8A 2M97A 2LLUA 4OVNF 5CSJA 1DF0B 1PSRA 4OKHA 1EJ3A 1DJZA 4DRWA 3BUMB 4YGAA 2K8MB 1WRLA 4PHNA 1YRUB 4OCIA 1IWQA 3TUYB 1IH0A 4I5JA 1CDPA 1WLZA 1OSAA 1Y1XA 2JWWA 2JZIA 3R1VA 2QPTA 3DF0B 2LLSA 2NCPA 1QVIZ 2CCMA 2AUCA 2LUXA 3S0FA 3NXAA 3CR4X 2LLTA 4PCWA 2BBMA 3WHUB 2CXJA 2WC8A 1GJYA 2R2IA 4C0JA 1DGVA 3A8RA 1B7TY 4MRXA 2M3WA 3SG5A 5PALA 2WC6A 4FQOA 2L2EA 3DVMA 4NQGA 2DOQA 4JPZB 2JT0A 1LKJA 2WNDA 1V1GA 4YI9A 1J1DA 2EGDA 5D7FA 3EVUA 1PVAA 1RJVA 3BUWB 4A4BA 1J1EA 1ZOTB 4ZCUA 5HKWA 3JTDC 1DJYA 3SIAA 4MZKA 1KQMB 2KFGA 1NCZA 1FBVA 2ZN9A 3O4YA 2QEHA 1K94A 4INXA 4GNKB 1Y6WA 1AJ5A 2M1KB 3S0BA 1PULA 1TNPA 1XVJA 2GGMA 3D0YB 2ZNEA 1ORGA 3SS5A 3HX4A 4JWQA 1K90D 3I5IC 2Q91A 1K9PA 1B7TZ 1C3ZA 3CS1A 1P28A 2Y4QA 3LK0A 2KQ6A 2BKIB 3PN7B 1V1FA 3SG7A 1JFJA 2NCOA 5DICA 3V2LA 1CKKA 1K8UA 4CFQA 1GGWA 1EG3A 3H4SE 5D3OA 2JXLA 1F54A 1KQVA 3EVVA 1K9KA 2BCXA 1SL9A 2WCKA 2AMIA 2KAXA 2CT9A 1QIWA 2KLEA 1JSAA 1Y1UA 3CZ2A 2I94A 1YR5A 1MR8A 1FI5A 5HLOA 2YGUA 1K2HA 5EL2A 1QV1A 1JFKA 1SL7A 2OS8B 1GQMA 2L51A 2L98A 2LUCA 3I5HB 1W7JB 1C7WA 2G2BA 1XFYO 2KGRA 2FCDA 2PSRA 3BYAA 3D78A 1KK8C 2VRGA 1LA3A 1Q80A 3AKAA 1NPQA 4P2YB 2NXQA 1KWOB 1EH2A 3D10A 2KHNA 5HL1A 4CIDA 1JF2A 4F0ZB 1IJ6A 1UHHA 1E8AA 1XFVO 2BNXA 2H61C 1QX7A 1SSEB 2WORA 3A4UB 2PRUA 3CTNA 5I2LA 2K2FA 5G08A 3NSIA 3PM2A 1B47A 2PASA 3CDNA 3D76A 3NSKA 4OV2A 4U8DA 2KOTA 3RM1A 1WLMA 3I5FB 3NGVA 1OOHA 1S6CA 1W7IB 3PALA 4GAOA 4PALA 1W9ZA 2H2KA 2P6BB 1B8RA 3D74A 2KBMA 3TDUA 1TTXA 1OZOA 1OE9B 3TS5B 2JPTA 3AAJA 2F3YA 4MVFA 4MZJA 3RLZA 3BUOB 1F4QA 1NX2A 4MEWA 2CBLA 1YX7A 2FJYA 1Z4HA 2HQWA 4ORCB 1OMDA 1CDLA 3S0EA 1JWDA 1KCYA 2K7OA 3LK1A 1BF5A 1NX1A 1JUOA 1RECA 2LE9B 2ZRSA 1WDCB 2QACA 2L2CA 4ORAB 1NIWA 1CFFA 1TNQA 1SCMC 3GOFA 1H8BA 5AANA 2ERBA 4PE0A 4YI8A 3BOWA 2JT8A 3SG6A 2H61A 2I2RE 2EHBA 3JVTB 2KI4B 4QJ3B 2JNFA 2JC2A 1CB1A 1A2XA 3EVRA 1MXEA 2QEOA 3EKJA 3TDIA 2OPOA 3DVKA 4I5LB 3UNWA 1UUSA 1YVHA 1J7OA 4ETOA 4WQ2A 1UHNA 3DVJA 5DKNA 2EC6B 4PE1A 4PHMA 5AERA 1LS8A 4YBHB 1FPWA 2JULA 3DVEA 3WNXB 3FWCA 1QASA 3VRQA 5I2OA 1OZSA 1YUSA 4XJKA 1HT9A 4AOMA 1CLBA 1J7RA 3IQQA 3TZ1A 1SY9A 2L4HA 2B1UA 1SRAA 1S26D 2JTZA 3FIAA 1OW4A 2JOJA 2BL0C 1FI6A 1G8IA 2K7BA 4YRUA 1IJ5A 1J55A 2BE4A 4TNCA 4C0KA 2ZRTA 1IKUA 1MWNA 1J7QA 4BY4A 4I5KA 1L2OC 1IQ3A 1YVLA 2L4IA 3DXLA 2WCEA 1F71A 1SPYA 3R1OA 2COLB 3BXKA 2M7LA 1DJXA 3BUNB 2BKHB 4JD9A 2KI6C 1BR4B 4GPLB 4XYNA 2CNPA 2SASA 5HLVA 1KFUS 2Y1MA 4BY5A 1CMGA 4R1EA 1WRKA 3B87A 1S3PA 4GUKA 1PSBA 2F33A 2LNKA 5KTYA 1TNWA 4YGBB 1LA0A 5TNCA 1L2OB 1WRZA 1DTLA 1RTP1 1X02A 3GK4X 4HSZA 1CFPA 3VRRA 3CZ1A 4ZCVA 1SNLA 1BMOA 1NYAA 1QTXA 3O2PA 4AQJA 2E6WA 2F8PA 4JQ0D 1XFUO 3B88A 1M39A 4PHJA 4CFRA 1Z2CB 2LVJA 1PVBA 1BR1B 3D73A 3DY9A 5JJGA 3DD4A 3M0WA 4WRIA 5K89A 1OMRA 3I5GC 3IF7A 2GV5A 3JTDB 1OOJA 2JPOA 4ICBA 3D75A 1TCFA 1AUIB 1QV0A 1MHOA 3OB1B 2KAVA 2H8VA 1YTZC 2JXCA 5ER4X 1N2DA 1B9AA 3IVTA 4YGEB 4NDDA 2WCFA 3B7AA 5ER5A 3L47A 1F55A 1A75A 1XFWO 1XK4C 2MRDA 4OZDA 1UP5A 4M2OA 2ZKMX 3I5IB 3OGNA 1QS7A 4F7FA 1AP4A 3LL8B 1BJFA 1LVCD 3SS3A 2OTGC 3Q8IA 4DS7A 2M29A 4E68A 3TDZA 3AKBA 2HF5A 1XYDA 1YURA 3GK1A 3VRNA 3D0YA 1AHRA 5DKQA 1CM4A 2JU0A 3ZNIA 3D77A 4AQIA 3O4XA 4PT1A 2LVIA 5AFPA 1SR6C 2KFHA 2M49B 3NSOA 1VRKA 1OOIX 2AAOA 5I8NA 2KDHA 5FYXA 1CM1A 4IJ7A 2L5YA 3N7HA 4PDZA 3VRPA 1DJGA 2QDIA 5CSFA 3CZTX 2NLNA 2I18A 3R1PA 1SCVA 2F2PA 1U5IA 1F4OA 1BU3A 3EK4A 3SS4A 1Y1AA 2I7AA 3B86A 1KFUL 1G33A 1NX0A 3ICBA 1QWVA 1MF8B 5B8IB 1G4YR 1TUZA 2MJWB 1M31A 2JTTA 2P71A 3BFAA 3CABA 1K96A 1XK4A 3L4LA 2BAPA 4GGFA 4MSPA 3L4AA 4N1GA 1GM0A 2KPHA 1FW4A 3EK8A 1SBJA 1BOCA 1KK8B 3SIBA 2LP3A 3NHTA
chains in the Genus database with same CATH topology
1NUBA 3BOWB 1MUXA 1YUUA 3FWBA 4HRGA 1DMOA 3E3RA 1ZFSA 1SYMA 4CPVA 3VGOA 2LMTA 1PRWA 3KEVA 1RWYA 5CSIA 4FTGA 2KNEA 1CDMA 2K7CA 4USLA 1Y0VH 1XFZO 5AEQA 4MBEA 1M46A 2A4JA 3KHEA 1QATA 2MHHA 1TCOB 5HKZA 2Y5IA 2KSPA 1ZMZA 3PFVA 1MXLC 2HQ8A 4PE7A 1IG5A 1DJHA 3KO0A 4XJKB 2BE6A 1C7VA 1D1OA 2M8UA 2BECA 1K93D 1S6JA 2K2AA 1LINA 1SCMB 2MAZA 4C0LA 4HREE 4MZLA 5HYDA 3PLFB 1QVIY 3KPXA 3CLNA 1S1EA 3SG4A 2KYCA 3TUYC 1CLLA 2LP2A 1N0YA 3OX6A 3EK7A 1S6IA 5D69A 1CNPA 3O78A 1R6PA 2MA2A 2FOTA 3VROA 1B8LA 3IQOA 4M2QA 3CGAA 1RFJA 3K21A 1UHIA 3AAKA 4WQ3A 1S36A 4PHKA 1BLQA 1OQPA 2O60A 2RGIA 5GQQC 3PATA 1XFXO 1SK6D 4GGNA 1BT6A 1PK0D 2L50A 1B4CA 2Y1NA 1EL4A 3CR2A 1N65A 1KFXS 1QLKA 2Q4UA 1DF0A 1RK9A 2BL0B 1QXPA 4I5NB 1KSOA 2LV7A 2LANA 1KSMA 1KQMC 2F2OA 3BQ3A 3SG2A 1K9UA 1QX5B 4MLWA 1LXFC 1F8HA 4CLNA 1HQVA 2PALA 3F45A 1DT7B 3DF0A 1MQ1A 1UHKA 1SKTA 1DGUA 1M63B 2KGBC 1JC2A 1JF0A 4HRHA 1QX2A 1TNXA 1TOPA 2M7NA 1EG4A 4PE4A 2MLFC 1A03A 1R2UA 2MLEC 1H4BA 2ISDA 1RROA 3LCPC 1A75B 2G9BA 2SCPA 2LCPA 3PN7C 1ALVA 1IGVA 1TN4A 1WY9A 2FCEA 2KFFA 2PVBA 2TN4A 1CDNA 1SMGA 1XO5A 2NZ0A 4IL1A 4L9MA 5I2QA 1CTRA 1KK7Y 1QLSA 2M9GA 5KU1A 2ZN8A 2BCAA 2JQ6A 4GGFC 1ODBA 2M1UA 3HCMA 4D1EA 2KYFA 1UURA 2LAPA 1IQ5A 2HPSA 5CPVA 2LM5A 3C1VA 3I5GB 1TIZA 2O5GA 4DIRA 3O6BA 2KI6D 1YX8A 2BBNA 2OS8C 1BG1A 1ZUZA 1U5IB 1K95A 1NX3A 3I5HC 3WHTB 4YGCB 3SJSA 5AXIA 2HETA 1F70A 2LVKA 3OB2B 5DKRA 1QIVA 1OMVA 3QRXA 2E30A 4MN0A 3SG3A 2LC5A 1KWOC 1SW8A 1DJIA 1NCXA 2WOSA 3PM8A 4N5XA 3CR5X 1AVSA 4N1FA 1XA5A 1EXRA 4ORBB 1ALWA 1KK7Z 1SL8A 1TRFA 2K7DA 2L0PA 2OTGB 1IRJA 2ZNDA 3MSEB 4GFTA 3I5FC 4UPGA 1UHJA 2WCBA 1KFXL 3ZWHA 4DUQA 3BUXB 1GGZA 2PMYA 1SR6B 3TS5C 1C07A 5F6TA 4P5OE 1B1GA 2MBXA 2JT3A 2LMVA 3EKHA 4M2PA 1JBAA 2M0RA 1WDCC 2F3ZA 2K61A 2K0JA 1BODA 1QJTA 1A4PA 2D8NA 3PSRA 4YGDB 5J3XA 2ZFDA 3CWGA 2LHLA 3JVTC 3GK2A 2KI4C 4Q04A 1S5GY 1PALA 1DVIA 5JOLA 4GBAA 2GGZA 3FS7A 4DCKA 4QJ5B 5HKYA 1L7ZA 2KBIA 2LHIA 2L5XB 3LLEA 3OHMB 4A4CA 2LVVA 5IBWA 3OP0A 2EC6C 1CFDA 2IS9A 2LMUA 1J7PA 1NWDA 1B8CA 1CLMA 1AK8A 1NSHA 2JRFA 2FJUB 3KF9A 4QJ4B 5BPJA 2CTNA 1YRTB 1M45A 3NSLA 4NDBA 2KQYA 3WXAA 1A29A 5KSZA 2V53A 1UWOA 1AJ4A 1ZACA 2KAYA 4OR9B 2JNXA 4MRYA 1NCYA 2BCBA 1S5GZ 1FF1A 1DJWA 1CFCA 1YUTA 3OX5A 5CSNA 1NP8A 2M97A 2LLUA 5CSJA 1DF0B 1PSRA 4OKHA 1EJ3A 1DJZA 4DRWA 3BUMB 4YGAA 2K8MB 1WRLA 4PHNA 1YRUB 4OCIA 1IWQA 3TUYB 1IH0A 4I5JA 1CDPA 1WLZA 1OSAA 1Y1XA 2JWWA 2JZIA 2QPTA 3DF0B 2LLSA 2NCPA 1QVIZ 2CCMA 2AUCA 2LUXA 3NXAA 3CR4X 2LLTA 4PCWA 2BBMA 3WHUB 2CXJA 2WC8A 1GJYA 2R2IA 4C0JA 1DGVA 3A8RA 1B7TY 4MRXA 2M3WA 3SG5A 5PALA 4FQOA 2L2EA 3DVMA 4NQGA 2DOQA 4JPZB 2JT0A 1LKJA 2WNDA 1V1GA 4YI9A 1J1DA 2EGDA 5D7FA 3EVUA 1PVAA 1RJVA 3BUWB 4A4BA 1J1EA 1ZOTB 4ZCUA 5HKWA 3JTDC 1DJYA 3SIAA 4MZKA 1KQMB 2KFGA 1NCZA 1FBVA 2ZN9A 3O4YA 1K94A 4GNKB 1Y6WA 1AJ5A 2M1KB 1PULA 1TNPA 1XVJA 2GGMA 3D0YB 2ZNEA 3HX4A 4JWQA 1K90D 3I5IC 2Q91A 1K9PA 1B7TZ 3CS1A 2Y4QA 3LK0A 2KQ6A 2BKIB 3PN7B 1V1FA 3SG7A 1JFJA 2NCOA 1CKKA 1K8UA 4CFQA 1GGWA 1EG3A 3H4SE 2JXLA 1F54A 1KQVA 3EVVA 1K9KA 2BCXA 1SL9A 2AMIA 2KAXA 2CT9A 1QIWA 1JSAA 1Y1UA 2I94A 1YR5A 1MR8A 1FI5A 5HLOA 1K2HA 1QV1A 1JFKA 1SL7A 2OS8B 1GQMA 2L51A 2L98A 2LUCA 3I5HB 1W7JB 1C7WA 2G2BA 1XFYO 2KGRA 2FCDA 2PSRA 3BYAA 1KK8C 2VRGA 1LA3A 1Q80A 3AKAA 1NPQA 4P2YB 2NXQA 1KWOB 1EH2A 3D10A 2KHNA 4CIDA 1JF2A 4F0ZB 1IJ6A 1E8AA 1UHHA 1XFVO 2H61C 2WORA 1QX7A 3A4UB 3CTNA 4NDCA 2PRUA 5I2LA 2K2FA 5G08A 3NSIA 1B47A 2PASA 3NSKA 4OV2A 3RM1A 4U8DA 2KOTA 1WLMA 3I5FB 1S6CA 1W7IB 3PALA 4GAOA 4PALA 2H2KA 2P6BB 1B8RA 2KBMA 3TDUA 1TTXA 1OZOA 1OE9B 3TS5B 2JPTA 3AAJA 2F3YA 4MVFA 4MZJA 3RLZA 3BUOB 1F4QA 1NX2A 4MEWA 2CBLA 1YX7A 4ORCB 1JWDA 2HQWA 1KCYA 1OMDA 1CDLA 2K7OA 3LK1A 1BF5A 1NX1A 1JUOA 1RECA 2LE9B 2ZRSA 1WDCB 2QACA 1CFFA 4ORAB 1NIWA 1TNQA 1SCMC 3GOFA 1H8BA 5AANA 4PE0A 4YI8A 3BOWA 2JT8A 3SG6A 2H61A 2I2RE 2EHBA 3JVTB 2KI4B 4QJ3B 2JNFA 2JC2A 1CB1A 1A2XA 3EVRA 1MXEA 3EKJA 3TDIA 2OPOA 3DVKA 4I5LB 1UUSA 1YVHA 1J7OA 4ETOA 4WQ2A 1UHNA 3DVJA 5DKNA 2EC6B 4PE1A 4PHMA 5AERA 4YBHB 1FPWA 2JULA 3DVEA 3WNXB 3FWCA 1QASA 3VRQA 5I2OA 1OZSA 1YUSA 4XJKA 1HT9A 4AOMA 1CLBA 1J7RA 3IQQA 3TZ1A 1SY9A 2L4HA 2B1UA 1SRAA 1S26D 2JTZA 3FIAA 2JOJA 2BL0C 1FI6A 1G8IA 2K7BA 4YRUA 1IJ5A 1J55A 2BE4A 4TNCA 4C0KA 2ZRTA 1IKUA 1MWNA 1J7QA 4BY4A 4I5KA 1L2OC 1IQ3A 1YVLA 2L4IA 2WCEA 1F71A 1SPYA 2COLB 3BXKA 2M7LA 1DJXA 3BUNB 2BKHB 2KI6C 1BR4B 4GPLB 4XYNA 2CNPA 2SASA 5HLVA 1KFUS 2Y1MA 4BY5A 1CMGA 4R1EA 1WRKA 1S3PA 4GUKA 1PSBA 2F33A 2LNKA 5KTYA 1TNWA 4YGBB 1LA0A 5TNCA 1L2OB 1WRZA 1DTLA 1RTP1 1X02A 3GK4X 4HSZA 1CFPA 3VRRA 4ZCVA 1SNLA 1BMOA 1NYAA 1QTXA 3O2PA 4AQJA 2E6WA 2F8PA 4JQ0D 1XFUO 1M39A 4PHJA 4CFRA 2LVJA 1PVBA 1BR1B 5JJGA 5K89A 3DD4A 3M0WA 4WRIA 1OMRA 3I5GC 3IF7A 2GV5A 3JTDB 1OOJA 4ICBA 4OVNF 1CMFA 1TCFA 1AUIB 1QV0A 1MHOA 3OB1B 2KAVA 1YTZC 2JXCA 5ER4X 1N2DA 1B9AA 4YGEB 4NDDA 2WCFA 5ER5A 1F55A 1A75A 1XFWO 1XK4C 2MRDA 1UP5A 4M2OA 2ZKMX 3I5IB 1AP4A 1QS7A 3LL8B 1BJFA 1LVCD 2OTGC 4DS7A 2M29A 4E68A 3TDZA 3AKBA 2HF5A 1XYDA 1YURA 3GK1A 3VRNA 3D0YA 1AHRA 5DKQA 1CM4A 2JU0A 3ZNIA 4AQIA 2LVIA 5AFPA 1SR6C 2KFHA 2M49B 3NSOA 1VRKA 5I8NA 2AAOA 2KDHA 5FYXA 1CM1A 4PDZA 3VRPA 1DJGA 5CSFA 3CZTX 2NLNA 2I18A 1SCVA 2F2PA 1U5IA 1F4OA 1BU3A 3EK4A 1Y1AA 2I7AA 1KFUL 1G33A 1NX0A 3ICBA 1MF8B 5B8IB 1G4YR 2MJWB 1M31A 2JTTA 4MSPA 1K96A 1XK4A 4GGFA 4N1GA 1FW4A 3EK8A 1SBJA 1BOCA 1KK8B 3SIBA 2LP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NUB A;  3BOW B;  1MUX A;  1YUU A;  3FWB A;  4HRG A;  1DMO A;  3E3R A;  1ZFS A;  1SYM A;  4CPV A;  3VGO A;  2LMT A;  1PRW A;  3KEV A;  1RWY A;  5CSI A;  4FTG A;  2KNE A;  1CDM A;  2K7C A;  4USL A;  1Y0V H;  1XFZ O;  5AEQ A;  4MBE A;  1M46 A;  2A4J A;  3KHE A;  1QAT A;  2MHH A;  1TCO B;  5HKZ A;  2Y5I A;  2KSP A;  1ZMZ A;  3PFV A;  1MXL C;  2HQ8 A;  4PE7 A;  1IG5 A;  1DJH A;  3KO0 A;  4XJK B;  2BE6 A;  1C7V A;  1D1O A;  2M8U A;  2BEC A;  1K93 D;  1S6J A;  2K2A A;  1LIN A;  1SCM B;  2MAZ A;  4C0L A;  4HRE E;  4MZL A;  5HYD A;  3PLF B;  1QVI Y;  3KPX A;  3CLN A;  1S1E A;  3SG4 A;  2KYC A;  3TUY C;  1CLL A;  2LP2 A;  1N0Y A;  3OX6 A;  3EK7 A;  1S6I A;  5D69 A;  1CNP A;  3O78 A;  1R6P A;  2MA2 A;  2FOT A;  3VRO A;  1B8L A;  3IQO A;  4M2Q A;  3CGA A;  1RFJ A;  3K21 A;  1UHI A;  3AAK A;  4WQ3 A;  1S36 A;  4PHK A;  1BLQ A;  1OQP A;  2O60 A;  2RGI A;  5GQQ C;  3PAT A;  1XFX O;  1SK6 D;  4GGN A;  1BT6 A;  1PK0 D;  2L50 A;  1B4C A;  2Y1N A;  1EL4 A;  3CR2 A;  1N65 A;  1KFX S;  1QLK A;  2Q4U A;  1DF0 A;  1RK9 A;  2BL0 B;  1QXP A;  4I5N B;  1KSO A;  2LV7 A;  2LAN A;  1KSM A;  1KQM C;  2F2O A;  3BQ3 A;  3SG2 A;  1K9U A;  1QX5 B;  4MLW A;  1LXF C;  1F8H A;  4CLN A;  1HQV A;  2PAL A;  3F45 A;  1DT7 B;  3DF0 A;  1MQ1 A;  1UHK A;  1SKT A;  1DGU A;  1M63 B;  2KGB C;  1JC2 A;  1JF0 A;  4HRH A;  1QX2 A;  1TNX A;  1TOP A;  2M7N A;  1EG4 A;  4PE4 A;  2MLF C;  1A03 A;  1R2U A;  2MLE C;  1H4B A;  2ISD A;  1RRO A;  3LCP C;  1A75 B;  2G9B A;  2SCP A;  2LCP A;  3PN7 C;  1ALV A;  1IGV A;  1TN4 A;  1WY9 A;  2FCE A;  2KFF A;  2PVB A;  2TN4 A;  1CDN A;  1SMG A;  1XO5 A;  2NZ0 A;  4IL1 A;  4L9M A;  5I2Q A;  1CTR A;  1KK7 Y;  1QLS A;  2M9G A;  5KU1 A;  2ZN8 A;  2BCA A;  2JQ6 A;  4GGF C;  1ODB A;  2M1U A;  3HCM A;  4D1E A;  2KYF A;  1UUR A;  2LAP A;  1IQ5 A;  2HPS A;  5CPV A;  2LM5 A;  3C1V A;  3I5G B;  1TIZ A;  2O5G A;  4DIR A;  3O6B A;  2KI6 D;  1YX8 A;  2BBN A;  2OS8 C;  1BG1 A;  1ZUZ A;  1U5I B;  1K95 A;  1NX3 A;  3I5H C;  3WHT B;  4YGC B;  3SJS A;  5AXI A;  2HET A;  1F70 A;  2LVK A;  3OB2 B;  5DKR A;  1QIV A;  1OMV A;  3QRX A;  2E30 A;  4MN0 A;  3SG3 A;  2LC5 A;  1KWO C;  1SW8 A;  1DJI A;  1NCX A;  2WOS A;  3PM8 A;  4N5X A;  3CR5 X;  1AVS A;  4N1F A;  1XA5 A;  1EXR A;  4ORB B;  1ALW A;  1KK7 Z;  1SL8 A;  1TRF A;  2K7D A;  2L0P A;  2OTG B;  1IRJ A;  2ZND A;  3MSE B;  4GFT A;  3I5F C;  4UPG A;  1UHJ A;  2WCB A;  1KFX L;  3ZWH A;  4DUQ A;  3BUX B;  1GGZ A;  2PMY A;  1SR6 B;  3TS5 C;  1C07 A;  5F6T A;  4P5O E;  1B1G A;  2MBX A;  2JT3 A;  2LMV A;  3EKH A;  4M2P A;  1JBA A;  2M0R A;  1WDC C;  2F3Z A;  2K61 A;  2K0J A;  1BOD A;  1QJT A;  1A4P A;  2D8N A;  3PSR A;  4YGD B;  5J3X A;  2ZFD A;  3CWG A;  2LHL A;  3JVT C;  3GK2 A;  2KI4 C;  4Q04 A;  1S5G Y;  1PAL A;  1DVI A;  5JOL A;  4GBA A;  2GGZ A;  3FS7 A;  4DCK A;  4QJ5 B;  5HKY A;  1L7Z A;  2KBI A;  2LHI A;  2L5X B;  3LLE A;  3OHM B;  4A4C A;  2LVV A;  5IBW A;  3OP0 A;  2EC6 C;  1CFD A;  2IS9 A;  2LMU A;  1J7P A;  1NWD A;  1B8C A;  1CLM A;  1AK8 A;  1NSH A;  2JRF A;  2FJU B;  3KF9 A;  4QJ4 B;  5BPJ A;  2CTN A;  1YRT B;  1M45 A;  3NSL A;  4NDB A;  2KQY A;  3WXA A;  1A29 A;  5KSZ A;  2V53 A;  1UWO A;  1AJ4 A;  1ZAC A;  2KAY A;  4OR9 B;  2JNX A;  4MRY A;  1NCY A;  2BCB A;  1S5G Z;  1FF1 A;  1DJW A;  1CFC A;  1YUT A;  3OX5 A;  5CSN A;  1NP8 A;  2M97 A;  2LLU A;  5CSJ A;  1DF0 B;  1PSR A;  4OKH A;  1EJ3 A;  1DJZ A;  4DRW A;  3BUM B;  4YGA A;  2K8M B;  1WRL A;  4PHN A;  1YRU B;  4OCI A;  1IWQ A;  3TUY B;  1IH0 A;  4I5J A;  1CDP A;  1WLZ A;  1OSA A;  1Y1X A;  2JWW A;  2JZI A;  2QPT A;  3DF0 B;  2LLS A;  2NCP A;  1QVI Z;  2CCM A;  2AUC A;  2LUX A;  3NXA A;  3CR4 X;  2LLT A;  4PCW A;  2BBM A;  3WHU B;  2CXJ A;  2WC8 A;  1GJY A;  2R2I A;  4C0J A;  1DGV A;  3A8R A;  1B7T Y;  4MRX A;  2M3W A;  3SG5 A;  5PAL A;  4FQO A;  2L2E A;  3DVM A;  4NQG A;  2DOQ A;  4JPZ B;  2JT0 A;  1LKJ A;  2WND A;  1V1G A;  4YI9 A;  1J1D A;  2EGD A;  5D7F A;  3EVU A;  1PVA A;  1RJV A;  3BUW B;  4A4B A;  1J1E A;  1ZOT B;  4ZCU A;  5HKW A;  3JTD C;  1DJY A;  3SIA A;  4MZK A;  1KQM B;  2KFG A;  1NCZ A;  1FBV A;  2ZN9 A;  3O4Y A;  1K94 A;  4GNK B;  1Y6W A;  1AJ5 A;  2M1K B;  1PUL A;  1TNP A;  1XVJ A;  2GGM A;  3D0Y B;  2ZNE A;  3HX4 A;  4JWQ A;  1K90 D;  3I5I C;  2Q91 A;  1K9P A;  1B7T Z;  3CS1 A;  2Y4Q A;  3LK0 A;  2KQ6 A;  2BKI B;  3PN7 B;  1V1F A;  3SG7 A;  1JFJ A;  2NCO A;  1CKK A;  1K8U A;  4CFQ A;  1GGW A;  1EG3 A;  3H4S E;  2JXL A;  1F54 A;  1KQV A;  3EVV A;  1K9K A;  2BCX A;  1SL9 A;  2AMI A;  2KAX A;  2CT9 A;  1QIW A;  1JSA A;  1Y1U A;  2I94 A;  1YR5 A;  1MR8 A;  1FI5 A;  5HLO A;  1K2H A;  1QV1 A;  1JFK A;  1SL7 A;  2OS8 B;  1GQM A;  2L51 A;  2L98 A;  2LUC A;  3I5H B;  1W7J B;  1C7W A;  2G2B A;  1XFY O;  2KGR A;  2FCD A;  2PSR A;  3BYA A;  1KK8 C;  2VRG A;  1LA3 A;  1Q80 A;  3AKA A;  1NPQ A;  4P2Y B;  2NXQ A;  1KWO B;  1EH2 A;  3D10 A;  2KHN A;  4CID A;  1JF2 A;  4F0Z B;  1IJ6 A;  1E8A A;  1UHH A;  1XFV O;  2H61 C;  2WOR A;  1QX7 A;  3A4U B;  3CTN A;  4NDC A;  2PRU A;  5I2L A;  2K2F A;  5G08 A;  3NSI A;  1B47 A;  2PAS A;  3NSK A;  4OV2 A;  3RM1 A;  4U8D A;  2KOT A;  1WLM A;  3I5F B;  1S6C A;  1W7I B;  3PAL A;  4GAO A;  4PAL A;  2H2K A;  2P6B B;  1B8R A;  2KBM A;  3TDU A;  1TTX A;  1OZO A;  1OE9 B;  3TS5 B;  2JPT A;  3AAJ A;  2F3Y A;  4MVF A;  4MZJ A;  3RLZ A;  3BUO B;  1F4Q A;  1NX2 A;  4MEW A;  2CBL A;  1YX7 A;  4ORC B;  1JWD A;  2HQW A;  1KCY A;  1OMD A;  1CDL A;  2K7O A;  3LK1 A;  1BF5 A;  1NX1 A;  1JUO A;  1REC A;  2LE9 B;  2ZRS A;  1WDC B;  2QAC A;  1CFF A;  4ORA B;  1NIW A;  1TNQ A;  1SCM C;  3GOF A;  1H8B A;  5AAN A;  4PE0 A;  4YI8 A;  3BOW A;  2JT8 A;  3SG6 A;  2H61 A;  2I2R E;  2EHB A;  3JVT B;  2KI4 B;  4QJ3 B;  2JNF A;  2JC2 A;  1CB1 A;  1A2X A;  3EVR A;  1MXE A;  3EKJ A;  3TDI A;  2OPO A;  3DVK A;  4I5L B;  1UUS A;  1YVH A;  1J7O A;  4ETO A;  4WQ2 A;  1UHN A;  3DVJ A;  5DKN A;  2EC6 B;  4PE1 A;  4PHM A;  5AER A;  4YBH B;  1FPW A;  2JUL A;  3DVE A;  3WNX B;  3FWC A;  1QAS A;  3VRQ A;  5I2O A;  1OZS A;  1YUS A;  4XJK A;  1HT9 A;  4AOM A;  1CLB A;  1J7R A;  3IQQ A;  3TZ1 A;  1SY9 A;  2L4H A;  2B1U A;  1SRA A;  1S26 D;  2JTZ A;  3FIA A;  2JOJ A;  2BL0 C;  1FI6 A;  1G8I A;  2K7B A;  4YRU A;  1IJ5 A;  1J55 A;  2BE4 A;  4TNC A;  4C0K A;  2ZRT A;  1IKU A;  1MWN A;  1J7Q A;  4BY4 A;  4I5K A;  1L2O C;  1IQ3 A;  1YVL A;  2L4I A;  2WCE A;  1F71 A;  1SPY A;  2COL B;  3BXK A;  2M7L A;  1DJX A;  3BUN B;  2BKH B;  2KI6 C;  1BR4 B;  4GPL B;  4XYN A;  2CNP A;  2SAS A;  5HLV A;  1KFU S;  2Y1M A;  4BY5 A;  1CMG A;  4R1E A;  1WRK A;  1S3P A;  4GUK A;  1PSB A;  2F33 A;  2LNK A;  5KTY A;  1TNW A;  4YGB B;  1LA0 A;  5TNC A;  1L2O B;  1WRZ A;  1DTL A;  1RTP 1;  1X02 A;  3GK4 X;  4HSZ A;  1CFP A;  3VRR A;  4ZCV A;  1SNL A;  1BMO A;  1NYA A;  1QTX A;  3O2P A;  4AQJ A;  2E6W A;  2F8P A;  4JQ0 D;  1XFU O;  1M39 A;  4PHJ A;  4CFR A;  2LVJ A;  1PVB A;  1BR1 B;  5JJG A;  5K89 A;  3DD4 A;  3M0W A;  4WRI A;  1OMR A;  3I5G C;  3IF7 A;  2GV5 A;  3JTD B;  1OOJ A;  4ICB A;  4OVN F;  1CMF A;  1TCF A;  1AUI B;  1QV0 A;  1MHO A;  3OB1 B;  2KAV A;  1YTZ C;  2JXC A;  5ER4 X;  1N2D A;  1B9A A;  4YGE B;  4NDD A;  2WCF A;  5ER5 A;  1F55 A;  1A75 A;  1XFW O;  1XK4 C;  2MRD A;  1UP5 A;  4M2O A;  2ZKM X;  3I5I B;  1AP4 A;  1QS7 A;  3LL8 B;  1BJF A;  1LVC D;  2OTG C;  4DS7 A;  2M29 A;  4E68 A;  3TDZ A;  3AKB A;  2HF5 A;  1XYD A;  1YUR A;  3GK1 A;  3VRN A;  3D0Y A;  1AHR A;  5DKQ A;  1CM4 A;  2JU0 A;  3ZNI A;  4AQI A;  2LVI A;  5AFP A;  1SR6 C;  2KFH A;  2M49 B;  3NSO A;  1VRK A;  5I8N A;  2AAO A;  2KDH A;  5FYX A;  1CM1 A;  4PDZ A;  3VRP A;  1DJG A;  5CSF A;  3CZT X;  2NLN A;  2I18 A;  1SCV A;  2F2P A;  1U5I A;  1F4O A;  1BU3 A;  3EK4 A;  1Y1A A;  2I7A A;  1KFU L;  1G33 A;  1NX0 A;  3ICB A;  1MF8 B;  5B8I B;  1G4Y R;  2MJW B;  1M31 A;  2JTT A;  4MSP A;  1K96 A;  1XK4 A;  4GGF A;  4N1G A;  1FW4 A;  3EK8 A;  1SBJ A;  1BOC A;  1KK8 B;  3SIB A;  2LP3 A; 
#chains in the Genus database with same CATH topology
 1NUB A;  3BFH A;  3BOW B;  1MUX A;  1YUU A;  3FWB A;  4HRG A;  1DMO A;  3E3R A;  1ZFS A;  1SYM A;  4CPV A;  3VGO A;  2LMT A;  1PRW A;  3KEV A;  1RWY A;  5CSI A;  4FTG A;  2KNE A;  1CDM A;  2K7C A;  4USL A;  4JKT A;  1Y0V H;  1XFZ O;  5AEQ A;  4MBE A;  1M46 A;  1OOF A;  2A4J A;  3KHE A;  4KYN A;  1QAT A;  2MHH A;  1TCO B;  5HKZ A;  2Y5I A;  4INW A;  2KSP A;  3OBV A;  1ZMZ A;  3PFV A;  1MXL C;  2HQ8 A;  4PE7 A;  1IG5 A;  1DJH A;  2WCH A;  3KO0 A;  2BE6 A;  3R72 A;  4XJK B;  2M8U A;  1C7V A;  2BEC A;  1D1O A;  1K93 D;  1S6J A;  2K2A A;  3CYZ A;  1LIN A;  1SCM B;  2MAZ A;  4C0L A;  4HRE E;  3DYE A;  4MZL A;  5HYD A;  3PLF B;  1QVI Y;  3KPX A;  3CLN A;  1S1E A;  3SG4 A;  2KYC A;  3TUY C;  1CLL A;  2LP2 A;  1N0Y A;  3OX6 A;  3EK7 A;  1S6I A;  1CMF A;  5D69 A;  1CNP A;  3O78 A;  1R6P A;  2MA2 A;  2FOT A;  3VRO A;  1B8L A;  3IQO A;  4M2Q A;  3CGA A;  1RFJ A;  3K21 A;  1DEK A;  1UHI A;  3AAK A;  4WQ3 A;  1S36 A;  4PHK A;  1BLQ A;  1OQP A;  2O60 A;  2RGI A;  5GQQ C;  3RZS A;  3PAT A;  1XFX O;  4FQT A;  3S0G A;  1SK6 D;  4GGN A;  1C3Y A;  1BT6 A;  1PK0 D;  2L50 A;  1B4C A;  2Y1N A;  1EL4 A;  3CR2 A;  1N65 A;  1KFX S;  1QLK A;  4NDC A;  1DQE A;  2Q4U A;  1DF0 A;  1RK9 A;  2BL0 B;  1QXP A;  4I5N B;  1KSO A;  2LV7 A;  2LAN A;  1KSM A;  1KQM C;  2F2O A;  3BQ3 A;  3SG2 A;  1K9U A;  1QX5 B;  1IIO A;  4MLW A;  1LXF C;  1F8H A;  4CLN A;  1XFR A;  1HQV A;  2PAL A;  3F45 A;  1DT7 B;  3DF0 A;  1MQ1 A;  1UHK A;  1SKT A;  1OOG A;  1TWO A;  3PJI A;  1DGU A;  1M63 B;  2KGB C;  1JC2 A;  1JF0 A;  4HRH A;  1QX2 A;  1TNX A;  1TOP A;  2M7N A;  1EG4 A;  4PE4 A;  2MLF C;  1A03 A;  1R2U A;  2MLE C;  5FI7 A;  1H4B A;  2ISD A;  1RRO A;  3K1E A;  1A75 B;  3LCP C;  2G9B A;  2WCJ A;  2SCP A;  2LCP A;  3PN7 C;  3VB1 A;  1DEL A;  2P70 A;  1ALV A;  1IGV A;  1TN4 A;  1WY9 A;  2FCE A;  2KFF A;  2KLD A;  1T14 A;  2PVB A;  2TN4 A;  1CDN A;  1SMG A;  1DC1 A;  1XO5 A;  2NZ0 A;  4IL1 A;  4L9M A;  5I2Q A;  1CTR A;  1KK7 Y;  2QEV A;  1QLS A;  2M9G A;  5KU1 A;  2ZN8 A;  2BCA A;  3EG5 B;  2JQ6 A;  4GGF C;  1ODB A;  2WCM A;  2M1U A;  3HCM A;  4D1E A;  2KYF A;  1UUR A;  2LAP A;  1IQ5 A;  2HPS A;  2QEB A;  5CPV A;  2LM5 A;  3C1V A;  3DZT A;  3I5G B;  1TIZ A;  2O5G A;  2WCL A;  4DIR A;  3O6B A;  2KI6 D;  1YX8 A;  2BBN A;  2OS8 C;  3FE8 A;  1ZUZ A;  1U5I B;  1K95 A;  1NX3 A;  3I5H C;  1BG1 A;  3WHT B;  4YGC B;  3SJS A;  5AXI A;  2HET A;  3S0A A;  1F70 A;  2LVK A;  2PQL A;  3OB2 B;  5DKR A;  1QIV A;  1OMV A;  3QRX A;  2E30 A;  4MN0 A;  3SG3 A;  2LC5 A;  1KWO C;  1SW8 A;  1DJI A;  1NCX A;  2WOS A;  3PM8 A;  4N5X A;  3CR5 X;  1AVS A;  4N1F A;  1XA5 A;  1EXR A;  4ORB B;  1ALW A;  1KK7 Z;  1SL8 A;  1TRF A;  2GTE A;  2K7D A;  2L0P A;  1IRJ A;  2OTG B;  2ZND A;  3MSE B;  4GFT A;  3I5F C;  4UPG A;  1UHJ A;  2WCB A;  1KFX L;  3ZWH A;  4DUQ A;  3BUX B;  1GGZ A;  2PMY A;  3CZ0 A;  3BFB A;  1SR6 B;  3TS5 C;  1C07 A;  5F6T A;  4P5O E;  5FI6 A;  1B1G A;  2MBX A;  2JT3 A;  2LMV A;  3EKH A;  3UO9 A;  4M2P A;  3NHI A;  2K60 A;  1JBA A;  2M0R A;  3B6X A;  1WDC C;  2F3Z A;  2K61 A;  2K0J A;  2PYQ A;  1BOD A;  1QJT A;  1A4P A;  2D8N A;  3PSR A;  3QME A;  4YGD B;  5J3X A;  2ZFD A;  3CWG A;  2LHL A;  3BJH A;  3JVT C;  3GK2 A;  2KI4 C;  4Q04 A;  1S5G Y;  1PAL A;  1DVI A;  5JOL A;  4GBA A;  2GGZ A;  3FS7 A;  4DCK A;  4QJ5 B;  5HKY A;  1L7Z A;  2KBI A;  2LHI A;  2L5X B;  3LLE A;  3OHM B;  3S0D A;  2LVV A;  4A4C A;  5IBW A;  3OP0 A;  2EC6 C;  1CFD A;  3FE9 A;  2IS9 A;  2LMU A;  1J7P A;  1NWD A;  1B8C A;  1CLM A;  3FE6 A;  1AK8 A;  5FI2 A;  1NSH A;  2JRF A;  5I94 A;  2FJU B;  3KF9 A;  4QJ4 B;  5BPJ A;  2CTN A;  1YRT B;  1M45 A;  3NSL A;  4NDB A;  2KQY A;  3WXA A;  1A29 A;  5KSZ A;  2V53 A;  1UWO A;  1AJ4 A;  2WC5 A;  1ZAC A;  1TUJ A;  2KAY A;  2JNX A;  4OR9 B;  4MRY A;  1NCY A;  2BCB A;  1S5G Z;  1FF1 A;  1DJW A;  1CFC A;  1YUT A;  3OX5 A;  5CSN A;  1NP8 A;  2M97 A;  2LLU A;  4OVN F;  5CSJ A;  1DF0 B;  1PSR A;  4OKH A;  1EJ3 A;  1DJZ A;  4DRW A;  3BUM B;  4YGA A;  2K8M B;  1WRL A;  4PHN A;  1YRU B;  4OCI A;  1IWQ A;  3TUY B;  1IH0 A;  4I5J A;  1CDP A;  1WLZ A;  1OSA A;  1Y1X A;  2JWW A;  2JZI A;  3R1V A;  2QPT A;  3DF0 B;  2LLS A;  2NCP A;  1QVI Z;  2CCM A;  2AUC A;  2LUX A;  3S0F A;  3NXA A;  3CR4 X;  2LLT A;  4PCW A;  2BBM A;  3WHU B;  2CXJ A;  2WC8 A;  1GJY A;  2R2I A;  4C0J A;  1DGV A;  3A8R A;  1B7T Y;  4MRX A;  2M3W A;  3SG5 A;  5PAL A;  2WC6 A;  4FQO A;  2L2E A;  3DVM A;  4NQG A;  2DOQ A;  4JPZ B;  2JT0 A;  1LKJ A;  2WND A;  1V1G A;  4YI9 A;  1J1D A;  2EGD A;  5D7F A;  3EVU A;  1PVA A;  1RJV A;  3BUW B;  4A4B A;  1J1E A;  1ZOT B;  4ZCU A;  5HKW A;  3JTD C;  1DJY A;  3SIA A;  4MZK A;  1KQM B;  2KFG A;  1NCZ A;  1FBV A;  2ZN9 A;  3O4Y A;  2QEH A;  1K94 A;  4INX A;  4GNK B;  1Y6W A;  1AJ5 A;  2M1K B;  3S0B A;  1PUL A;  1TNP A;  1XVJ A;  2GGM A;  3D0Y B;  2ZNE A;  1ORG A;  3SS5 A;  3HX4 A;  4JWQ A;  1K90 D;  3I5I C;  2Q91 A;  1K9P A;  1B7T Z;  1C3Z A;  3CS1 A;  1P28 A;  2Y4Q A;  3LK0 A;  2KQ6 A;  2BKI B;  3PN7 B;  1V1F A;  3SG7 A;  1JFJ A;  2NCO A;  5DIC A;  3V2L A;  1CKK A;  1K8U A;  4CFQ A;  1GGW A;  1EG3 A;  3H4S E;  5D3O A;  2JXL A;  1F54 A;  1KQV A;  3EVV A;  1K9K A;  2BCX A;  1SL9 A;  2WCK A;  2AMI A;  2KAX A;  2CT9 A;  1QIW A;  2KLE A;  1JSA A;  1Y1U A;  3CZ2 A;  2I94 A;  1YR5 A;  1MR8 A;  1FI5 A;  5HLO A;  2YGU A;  1K2H A;  5EL2 A;  1QV1 A;  1JFK A;  1SL7 A;  2OS8 B;  1GQM A;  2L51 A;  2L98 A;  2LUC A;  3I5H B;  1W7J B;  1C7W A;  2G2B A;  1XFY O;  2KGR A;  2FCD A;  2PSR A;  3BYA A;  3D78 A;  1KK8 C;  2VRG A;  1LA3 A;  1Q80 A;  3AKA A;  1NPQ A;  4P2Y B;  2NXQ A;  1KWO B;  1EH2 A;  3D10 A;  2KHN A;  5HL1 A;  4CID A;  1JF2 A;  4F0Z B;  1IJ6 A;  1UHH A;  1E8A A;  1XFV O;  2BNX A;  2H61 C;  1QX7 A;  1SSE B;  2WOR A;  3A4U B;  2PRU A;  3CTN A;  5I2L A;  2K2F A;  5G08 A;  3NSI A;  3PM2 A;  1B47 A;  2PAS A;  3CDN A;  3D76 A;  3NSK A;  4OV2 A;  4U8D A;  2KOT A;  3RM1 A;  1WLM A;  3I5F B;  3NGV A;  1OOH A;  1S6C A;  1W7I B;  3PAL A;  4GAO A;  4PAL A;  1W9Z A;  2H2K A;  2P6B B;  1B8R A;  3D74 A;  2KBM A;  3TDU A;  1TTX A;  1OZO A;  1OE9 B;  3TS5 B;  2JPT A;  3AAJ A;  2F3Y A;  4MVF A;  4MZJ A;  3RLZ A;  3BUO B;  1F4Q A;  1NX2 A;  4MEW A;  2CBL A;  1YX7 A;  2FJY A;  1Z4H A;  2HQW A;  4ORC B;  1OMD A;  1CDL A;  3S0E A;  1JWD A;  1KCY A;  2K7O A;  3LK1 A;  1BF5 A;  1NX1 A;  1JUO A;  1REC A;  2LE9 B;  2ZRS A;  1WDC B;  2QAC A;  2L2C A;  4ORA B;  1NIW A;  1CFF A;  1TNQ A;  1SCM C;  3GOF A;  1H8B A;  5AAN A;  2ERB A;  4PE0 A;  4YI8 A;  3BOW A;  2JT8 A;  3SG6 A;  2H61 A;  2I2R E;  2EHB A;  3JVT B;  2KI4 B;  4QJ3 B;  2JNF A;  2JC2 A;  1CB1 A;  1A2X A;  3EVR A;  1MXE A;  2QEO A;  3EKJ A;  3TDI A;  2OPO A;  3DVK A;  4I5L B;  3UNW A;  1UUS A;  1YVH A;  1J7O A;  4ETO A;  4WQ2 A;  1UHN A;  3DVJ A;  5DKN A;  2EC6 B;  4PE1 A;  4PHM A;  5AER A;  1LS8 A;  4YBH B;  1FPW A;  2JUL A;  3DVE A;  3WNX B;  3FWC A;  1QAS A;  3VRQ A;  5I2O A;  1OZS A;  1YUS A;  4XJK A;  1HT9 A;  4AOM A;  1CLB A;  1J7R A;  3IQQ A;  3TZ1 A;  1SY9 A;  2L4H A;  2B1U A;  1SRA A;  1S26 D;  2JTZ A;  3FIA A;  1OW4 A;  2JOJ A;  2BL0 C;  1FI6 A;  1G8I A;  2K7B A;  4YRU A;  1IJ5 A;  1J55 A;  2BE4 A;  4TNC A;  4C0K A;  2ZRT A;  1IKU A;  1MWN A;  1J7Q A;  4BY4 A;  4I5K A;  1L2O C;  1IQ3 A;  1YVL A;  2L4I A;  3DXL A;  2WCE A;  1F71 A;  1SPY A;  3R1O A;  2COL B;  3BXK A;  2M7L A;  1DJX A;  3BUN B;  2BKH B;  4JD9 A;  2KI6 C;  1BR4 B;  4GPL B;  4XYN A;  2CNP A;  2SAS A;  5HLV A;  1KFU S;  2Y1M A;  4BY5 A;  1CMG A;  4R1E A;  1WRK A;  3B87 A;  1S3P A;  4GUK A;  1PSB A;  2F33 A;  2LNK A;  5KTY A;  1TNW A;  4YGB B;  1LA0 A;  5TNC A;  1L2O B;  1WRZ A;  1DTL A;  1RTP 1;  1X02 A;  3GK4 X;  4HSZ A;  1CFP A;  3VRR A;  3CZ1 A;  4ZCV A;  1SNL A;  1BMO A;  1NYA A;  1QTX A;  3O2P A;  4AQJ A;  2E6W A;  2F8P A;  4JQ0 D;  1XFU O;  3B88 A;  1M39 A;  4PHJ A;  4CFR A;  1Z2C B;  2LVJ A;  1PVB A;  1BR1 B;  3D73 A;  3DY9 A;  5JJG A;  3DD4 A;  3M0W A;  4WRI A;  5K89 A;  1OMR A;  3I5G C;  3IF7 A;  2GV5 A;  3JTD B;  1OOJ A;  2JPO A;  4ICB A;  3D75 A;  1TCF A;  1AUI B;  1QV0 A;  1MHO A;  3OB1 B;  2KAV A;  2H8V A;  1YTZ C;  2JXC A;  5ER4 X;  1N2D A;  1B9A A;  3IVT A;  4YGE B;  4NDD A;  2WCF A;  3B7A A;  5ER5 A;  3L47 A;  1F55 A;  1A75 A;  1XFW O;  1XK4 C;  2MRD A;  4OZD A;  1UP5 A;  4M2O A;  2ZKM X;  3I5I B;  3OGN A;  1QS7 A;  4F7F A;  1AP4 A;  3LL8 B;  1BJF A;  1LVC D;  3SS3 A;  2OTG C;  3Q8I A;  4DS7 A;  2M29 A;  4E68 A;  3TDZ A;  3AKB A;  2HF5 A;  1XYD A;  1YUR A;  3GK1 A;  3VRN A;  3D0Y A;  1AHR A;  5DKQ A;  1CM4 A;  2JU0 A;  3ZNI A;  3D77 A;  4AQI A;  3O4X A;  4PT1 A;  2LVI A;  5AFP A;  1SR6 C;  2KFH A;  2M49 B;  3NSO A;  1VRK A;  1OOI X;  2AAO A;  5I8N A;  2KDH A;  5FYX A;  1CM1 A;  4IJ7 A;  2L5Y A;  3N7H A;  4PDZ A;  3VRP A;  1DJG A;  2QDI A;  5CSF A;  3CZT X;  2NLN A;  2I18 A;  3R1P A;  1SCV A;  2F2P A;  1U5I A;  1F4O A;  1BU3 A;  3EK4 A;  3SS4 A;  1Y1A A;  2I7A A;  3B86 A;  1KFU L;  1G33 A;  1NX0 A;  3ICB A;  1QWV A;  1MF8 B;  5B8I B;  1G4Y R;  1TUZ A;  2MJW B;  1M31 A;  2JTT A;  2P71 A;  3BFA A;  3CAB A;  1K96 A;  1XK4 A;  3L4L A;  2BAP A;  4GGF A;  4MSP A;  3L4A A;  4N1G A;  1GM0 A;  2KPH A;  1FW4 A;  3EK8 A;  1SBJ A;  1BOC A;  1KK8 B;  3SIB A;  2LP3 A;  3NHT A; 
#chains in the Genus database with same CATH homology
 1NUB A;  3BOW B;  1MUX A;  1YUU A;  3FWB A;  4HRG A;  1DMO A;  3E3R A;  1ZFS A;  1SYM A;  4CPV A;  3VGO A;  2LMT A;  1PRW A;  3KEV A;  1RWY A;  5CSI A;  4FTG A;  2KNE A;  1CDM A;  2K7C A;  4USL A;  1Y0V H;  1XFZ O;  5AEQ A;  4MBE A;  1M46 A;  2A4J A;  3KHE A;  1QAT A;  2MHH A;  1TCO B;  5HKZ A;  2Y5I A;  2KSP A;  1ZMZ A;  3PFV A;  1MXL C;  2HQ8 A;  4PE7 A;  1IG5 A;  1DJH A;  3KO0 A;  4XJK B;  2BE6 A;  1C7V A;  1D1O A;  2M8U A;  2BEC A;  1K93 D;  1S6J A;  2K2A A;  1LIN A;  1SCM B;  2MAZ A;  4C0L A;  4HRE E;  4MZL A;  5HYD A;  3PLF B;  1QVI Y;  3KPX A;  3CLN A;  1S1E A;  3SG4 A;  2KYC A;  3TUY C;  1CLL A;  2LP2 A;  1N0Y A;  3OX6 A;  3EK7 A;  1S6I A;  5D69 A;  1CNP A;  3O78 A;  1R6P A;  2MA2 A;  2FOT A;  3VRO A;  1B8L A;  3IQO A;  4M2Q A;  3CGA A;  1RFJ A;  3K21 A;  1UHI A;  3AAK A;  4WQ3 A;  1S36 A;  4PHK A;  1BLQ A;  1OQP A;  2O60 A;  2RGI A;  5GQQ C;  3PAT A;  1XFX O;  1SK6 D;  4GGN A;  1BT6 A;  1PK0 D;  2L50 A;  1B4C A;  2Y1N A;  1EL4 A;  3CR2 A;  1N65 A;  1KFX S;  1QLK A;  2Q4U A;  1DF0 A;  1RK9 A;  2BL0 B;  1QXP A;  4I5N B;  1KSO A;  2LV7 A;  2LAN A;  1KSM A;  1KQM C;  2F2O A;  3BQ3 A;  3SG2 A;  1K9U A;  1QX5 B;  4MLW A;  1LXF C;  1F8H A;  4CLN A;  1HQV A;  2PAL A;  3F45 A;  1DT7 B;  3DF0 A;  1MQ1 A;  1UHK A;  1SKT A;  1DGU A;  1M63 B;  2KGB C;  1JC2 A;  1JF0 A;  4HRH A;  1QX2 A;  1TNX A;  1TOP A;  2M7N A;  1EG4 A;  4PE4 A;  2MLF C;  1A03 A;  1R2U A;  2MLE C;  1H4B A;  2ISD A;  1RRO A;  3LCP C;  1A75 B;  2G9B A;  2SCP A;  2LCP A;  3PN7 C;  1ALV A;  1IGV A;  1TN4 A;  1WY9 A;  2FCE A;  2KFF A;  2PVB A;  2TN4 A;  1CDN A;  1SMG A;  1XO5 A;  2NZ0 A;  4IL1 A;  4L9M A;  5I2Q A;  1CTR A;  1KK7 Y;  1QLS A;  2M9G A;  5KU1 A;  2ZN8 A;  2BCA A;  2JQ6 A;  4GGF C;  1ODB A;  2M1U A;  3HCM A;  4D1E A;  2KYF A;  1UUR A;  2LAP A;  1IQ5 A;  2HPS A;  5CPV A;  2LM5 A;  3C1V A;  3I5G B;  1TIZ A;  2O5G A;  4DIR A;  3O6B A;  2KI6 D;  1YX8 A;  2BBN A;  2OS8 C;  1BG1 A;  1ZUZ A;  1U5I B;  1K95 A;  1NX3 A;  3I5H C;  3WHT B;  4YGC B;  3SJS A;  5AXI A;  2HET A;  1F70 A;  2LVK A;  3OB2 B;  5DKR A;  1QIV A;  1OMV A;  3QRX A;  2E30 A;  4MN0 A;  3SG3 A;  2LC5 A;  1KWO C;  1SW8 A;  1DJI A;  1NCX A;  2WOS A;  3PM8 A;  4N5X A;  3CR5 X;  1AVS A;  4N1F A;  1XA5 A;  1EXR A;  4ORB B;  1ALW A;  1KK7 Z;  1SL8 A;  1TRF A;  2K7D A;  2L0P A;  2OTG B;  1IRJ A;  2ZND A;  3MSE B;  4GFT A;  3I5F C;  4UPG A;  1UHJ A;  2WCB A;  1KFX L;  3ZWH A;  4DUQ A;  3BUX B;  1GGZ A;  2PMY A;  1SR6 B;  3TS5 C;  1C07 A;  5F6T A;  4P5O E;  1B1G A;  2MBX A;  2JT3 A;  2LMV A;  3EKH A;  4M2P A;  1JBA A;  2M0R A;  1WDC C;  2F3Z A;  2K61 A;  2K0J A;  1BOD A;  1QJT A;  1A4P A;  2D8N A;  3PSR A;  4YGD B;  5J3X A;  2ZFD A;  3CWG A;  2LHL A;  3JVT C;  3GK2 A;  2KI4 C;  4Q04 A;  1S5G Y;  1PAL A;  1DVI A;  5JOL A;  4GBA A;  2GGZ A;  3FS7 A;  4DCK A;  4QJ5 B;  5HKY A;  1L7Z A;  2KBI A;  2LHI A;  2L5X B;  3LLE A;  3OHM B;  4A4C A;  2LVV A;  5IBW A;  3OP0 A;  2EC6 C;  1CFD A;  2IS9 A;  2LMU A;  1J7P A;  1NWD A;  1B8C A;  1CLM A;  1AK8 A;  1NSH A;  2JRF A;  2FJU B;  3KF9 A;  4QJ4 B;  5BPJ A;  2CTN A;  1YRT B;  1M45 A;  3NSL A;  4NDB A;  2KQY A;  3WXA A;  1A29 A;  5KSZ A;  2V53 A;  1UWO A;  1AJ4 A;  1ZAC A;  2KAY A;  4OR9 B;  2JNX A;  4MRY A;  1NCY A;  2BCB A;  1S5G Z;  1FF1 A;  1DJW A;  1CFC A;  1YUT A;  3OX5 A;  5CSN A;  1NP8 A;  2M97 A;  2LLU A;  5CSJ A;  1DF0 B;  1PSR A;  4OKH A;  1EJ3 A;  1DJZ A;  4DRW A;  3BUM B;  4YGA A;  2K8M B;  1WRL A;  4PHN A;  1YRU B;  4OCI A;  1IWQ A;  3TUY B;  1IH0 A;  4I5J A;  1CDP A;  1WLZ A;  1OSA A;  1Y1X A;  2JWW A;  2JZI A;  2QPT A;  3DF0 B;  2LLS A;  2NCP A;  1QVI Z;  2CCM A;  2AUC A;  2LUX A;  3NXA A;  3CR4 X;  2LLT A;  4PCW A;  2BBM A;  3WHU B;  2CXJ A;  2WC8 A;  1GJY A;  2R2I A;  4C0J A;  1DGV A;  3A8R A;  1B7T Y;  4MRX A;  2M3W A;  3SG5 A;  5PAL A;  4FQO A;  2L2E A;  3DVM A;  4NQG A;  2DOQ A;  4JPZ B;  2JT0 A;  1LKJ A;  2WND A;  1V1G A;  4YI9 A;  1J1D A;  2EGD A;  5D7F A;  3EVU A;  1PVA A;  1RJV A;  3BUW B;  4A4B A;  1J1E A;  1ZOT B;  4ZCU A;  5HKW A;  3JTD C;  1DJY A;  3SIA A;  4MZK A;  1KQM B;  2KFG A;  1NCZ A;  1FBV A;  2ZN9 A;  3O4Y A;  1K94 A;  4GNK B;  1Y6W A;  1AJ5 A;  2M1K B;  1PUL A;  1TNP A;  1XVJ A;  2GGM A;  3D0Y B;  2ZNE A;  3HX4 A;  4JWQ A;  1K90 D;  3I5I C;  2Q91 A;  1K9P A;  1B7T Z;  3CS1 A;  2Y4Q A;  3LK0 A;  2KQ6 A;  2BKI B;  3PN7 B;  1V1F A;  3SG7 A;  1JFJ A;  2NCO A;  1CKK A;  1K8U A;  4CFQ A;  1GGW A;  1EG3 A;  3H4S E;  2JXL A;  1F54 A;  1KQV A;  3EVV A;  1K9K A;  2BCX A;  1SL9 A;  2AMI A;  2KAX A;  2CT9 A;  1QIW A;  1JSA A;  1Y1U A;  2I94 A;  1YR5 A;  1MR8 A;  1FI5 A;  5HLO A;  1K2H A;  1QV1 A;  1JFK A;  1SL7 A;  2OS8 B;  1GQM A;  2L51 A;  2L98 A;  2LUC A;  3I5H B;  1W7J B;  1C7W A;  2G2B A;  1XFY O;  2KGR A;  2FCD A;  2PSR A;  3BYA A;  1KK8 C;  2VRG A;  1LA3 A;  1Q80 A;  3AKA A;  1NPQ A;  4P2Y B;  2NXQ A;  1KWO B;  1EH2 A;  3D10 A;  2KHN A;  4CID A;  1JF2 A;  4F0Z B;  1IJ6 A;  1E8A A;  1UHH A;  1XFV O;  2H61 C;  2WOR A;  1QX7 A;  3A4U B;  3CTN A;  4NDC A;  2PRU A;  5I2L A;  2K2F A;  5G08 A;  3NSI A;  1B47 A;  2PAS A;  3NSK A;  4OV2 A;  3RM1 A;  4U8D A;  2KOT A;  1WLM A;  3I5F B;  1S6C A;  1W7I B;  3PAL A;  4GAO A;  4PAL A;  2H2K A;  2P6B B;  1B8R A;  2KBM A;  3TDU A;  1TTX A;  1OZO A;  1OE9 B;  3TS5 B;  2JPT A;  3AAJ A;  2F3Y A;  4MVF A;  4MZJ A;  3RLZ A;  3BUO B;  1F4Q A;  1NX2 A;  4MEW A;  2CBL A;  1YX7 A;  4ORC B;  1JWD A;  2HQW A;  1KCY A;  1OMD A;  1CDL A;  2K7O A;  3LK1 A;  1BF5 A;  1NX1 A;  1JUO A;  1REC A;  2LE9 B;  2ZRS A;  1WDC B;  2QAC A;  1CFF A;  4ORA B;  1NIW A;  1TNQ A;  1SCM C;  3GOF A;  1H8B A;  5AAN A;  4PE0 A;  4YI8 A;  3BOW A;  2JT8 A;  3SG6 A;  2H61 A;  2I2R E;  2EHB A;  3JVT B;  2KI4 B;  4QJ3 B;  2JNF A;  2JC2 A;  1CB1 A;  1A2X A;  3EVR A;  1MXE A;  3EKJ A;  3TDI A;  2OPO A;  3DVK A;  4I5L B;  1UUS A;  1YVH A;  1J7O A;  4ETO A;  4WQ2 A;  1UHN A;  3DVJ A;  5DKN A;  2EC6 B;  4PE1 A;  4PHM A;  5AER A;  4YBH B;  1FPW A;  2JUL A;  3DVE A;  3WNX B;  3FWC A;  1QAS A;  3VRQ A;  5I2O A;  1OZS A;  1YUS A;  4XJK A;  1HT9 A;  4AOM A;  1CLB A;  1J7R A;  3IQQ A;  3TZ1 A;  1SY9 A;  2L4H A;  2B1U A;  1SRA A;  1S26 D;  2JTZ A;  3FIA A;  2JOJ A;  2BL0 C;  1FI6 A;  1G8I A;  2K7B A;  4YRU A;  1IJ5 A;  1J55 A;  2BE4 A;  4TNC A;  4C0K A;  2ZRT A;  1IKU A;  1MWN A;  1J7Q A;  4BY4 A;  4I5K A;  1L2O C;  1IQ3 A;  1YVL A;  2L4I A;  2WCE A;  1F71 A;  1SPY A;  2COL B;  3BXK A;  2M7L A;  1DJX A;  3BUN B;  2BKH B;  2KI6 C;  1BR4 B;  4GPL B;  4XYN A;  2CNP A;  2SAS A;  5HLV A;  1KFU S;  2Y1M A;  4BY5 A;  1CMG A;  4R1E A;  1WRK A;  1S3P A;  4GUK A;  1PSB A;  2F33 A;  2LNK A;  5KTY A;  1TNW A;  4YGB B;  1LA0 A;  5TNC A;  1L2O B;  1WRZ A;  1DTL A;  1RTP 1;  1X02 A;  3GK4 X;  4HSZ A;  1CFP A;  3VRR A;  4ZCV A;  1SNL A;  1BMO A;  1NYA A;  1QTX A;  3O2P A;  4AQJ A;  2E6W A;  2F8P A;  4JQ0 D;  1XFU O;  1M39 A;  4PHJ A;  4CFR A;  2LVJ A;  1PVB A;  1BR1 B;  5JJG A;  5K89 A;  3DD4 A;  3M0W A;  4WRI A;  1OMR A;  3I5G C;  3IF7 A;  2GV5 A;  3JTD B;  1OOJ A;  4ICB A;  4OVN F;  1CMF A;  1TCF A;  1AUI B;  1QV0 A;  1MHO A;  3OB1 B;  2KAV A;  1YTZ C;  2JXC A;  5ER4 X;  1N2D A;  1B9A A;  4YGE B;  4NDD A;  2WCF A;  5ER5 A;  1F55 A;  1A75 A;  1XFW O;  1XK4 C;  2MRD A;  1UP5 A;  4M2O A;  2ZKM X;  3I5I B;  1AP4 A;  1QS7 A;  3LL8 B;  1BJF A;  1LVC D;  2OTG C;  4DS7 A;  2M29 A;  4E68 A;  3TDZ A;  3AKB A;  2HF5 A;  1XYD A;  1YUR A;  3GK1 A;  3VRN A;  3D0Y A;  1AHR A;  5DKQ A;  1CM4 A;  2JU0 A;  3ZNI A;  4AQI A;  2LVI A;  5AFP A;  1SR6 C;  2KFH A;  2M49 B;  3NSO A;  1VRK A;  5I8N A;  2AAO A;  2KDH A;  5FYX A;  1CM1 A;  4PDZ A;  3VRP A;  1DJG A;  5CSF A;  3CZT X;  2NLN A;  2I18 A;  1SCV A;  2F2P A;  1U5I A;  1F4O A;  1BU3 A;  3EK4 A;  1Y1A A;  2I7A A;  1KFU L;  1G33 A;  1NX0 A;  3ICB A;  1MF8 B;  5B8I B;  1G4Y R;  2MJW B;  1M31 A;  2JTT A;  4MSP A;  1K96 A;  1XK4 A;  4GGF A;  4N1G A;  1FW4 A;  3EK8 A;  1SBJ A;  1BOC A;  1KK8 B;  3SIB A;  2LP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...