5AEQA

Neuronal calcium sensor (ncs-1)from rattus norvegicus
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
188
structure length
172
Chain Sequence
GKSNSKLKPEVVEELTRKTYFTEKEVQQWYKGFIKDCPSGQLDAAGFQKDPTKFATFVFNVFDENKDGRIEFSEFIQALSVTSRGTLDEKLRWAFKLYDLDNDGYITRNEMLDIVDAIYQMPEEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEURONAL CALCIUM SENSOR 1
publication title Neuronal Calcium Sensor-1 Binds the D2 Dopamine Receptor and G-Protein-Coupled Receptor Kinase 1 (Grk1) Peptides Using Different Modes of Interactions.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 67
structure length 172
sequence length 188
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5aeqA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5aeqA02
3PATA 3MSEB 2KGRA 2LUCA 1QLSA 3KPXA 1SCMB 3LK1A 1UP5A 2KI6C 2HETA 1TNXA 1X02A 2BCBA 1DF0A 1XO5A 4N1FA 3RLZA 2JTZA 4WQ2A 1FI6A 3BQ3A 2BL0B 2LHLA 3PLFB 2JNXA 5DKQA 4DRWA 1R2UA 3DF0A 4P5OE 1NWDA 1ZMZA 3I5IB 1CM4A 5IBWA 1DMOA 5I2OA 5CSNA 1YUSA 1XA5A 5AXIA 2HQ8A 3JVTB 3VRRA 3ZNIA 3VRQA 1KFXS 1U5IA 5KU1A 3O6BA 3TDZA 2M1KB 2F3ZA 2BCAA 3CLNA 4NDBA 3KF9A 3H4SE 1S36A 1Y1XA 4DIRA 2ZN9A 4AQJA 1AHRA 1JF2A 2K7DA 4A4CA 3KEVA 4M2PA 1CFFA 2KYFA 2MLFC 2QPTA 2H2KA 5CSFA 1CLMA 2M0RA 2AUCA 1K95A 1SKTA 2AMIA 1QVIY 1ZFSA 3F45A 3ZWHA 3PM8A 3FWCA 1LINA 1YX7A 1XFYO 1IH0A 3QRXA 2COLB 1BJFA 4GFTA 4BY4A 2KI4B 3DD4A 4HRHA 3OX6A 1OMDA 2KHNA 3VGOA 1BR4B 1BU3A 1SNLA 2G2BA 2OPOA 2KBMA 1SCVA 1WDCC 2NCPA 1DGUA 4PDZA 1DJGA 3E3RA 4P2YB 2B1UA 1OMVA 2PSRA 4MSPA 3SG6A 4NQGA 2OTGC 2SCPA 4GNKB 3NSIA 2JXLA 3SIAA 2F2PA 1CMFA 2JOJA 4PE4A 3TDIA 1OMRA 1RTP1 3GOFA 4YGEB 1S6IA 1IJ6A 1LKJA 2BKHB 1DTLA 3PN7B 1ALWA 2CXJA 1SR6C 1GGWA 4ZCVA 1SPYA 2LVIA 2E6WA 1IKUA 2KOTA 3HCMA 3VRPA 1NYAA 1Y1AA 2KQ6A 2M9GA 2HQWA 4WRIA 1MQ1A 1TCOB 4NDDA 2L5XB 1NX1A 2BECA 1YURA 4PHKA 5HLOA 1IRJA 3TUYC 1RK9A 3IF7A 1AK8A 1K2HA 3HX4A 2FCDA 1K9UA 4NDCA 3EVRA 1A29A 1M63B 1N0YA 3TS5C 1SBJA 3AKAA 3K21A 1XFUO 1JF0A 5I2LA 1AVSA 5ER4X 1JWDA 1K9KA 1Y6WA 2JWWA 1TRFA 1KK8C 2LMVA 1A2XA 3I5HC 3TDUA 2CCMA 3D0YA 4IL1A 4YGDB 1KQVA 1TNPA 1F4OA 1HT9A 3WHUB 2LP3A 4YGBB 1SMGA 2L4HA 3I5GC 3WXAA 1SL8A 2A4JA 2WORA 2KFFA 3O4YA 1UHJA 5JJGA 1L2OB 2IS9A 1UHIA 3OX5A 5GQQC 2EGDA 1FI5A 1QJTA 2NXQA 1QS7A 2O60A 4OKHA 2HPSA 2ZNEA 1AJ4A 3SJSA 1OZSA 1YVLA 1CFCA 1S1EA 2K0JA 2RGIA 2EC6C 1PVBA 1G8IA 4PHMA 1UURA 2FCEA 2OS8C 1CFPA 1RECA 4GUKA 1YVHA 2JC2A 2LE9B 4MBEA 1JC2A 2L2EA 5D7FA 3EKJA 2L98A 2CBLA 3GK2A 1QLKA 4DUQA 5B8IB 1C7WA 4OV2A 1N2DA 4GPLB 3BUOB 3CR2A 2KSPA 1XK4C 1YR5A 1A75A 1KSOA 2JQ6A 2JULA 1DF0B 3AAKA 3NSOA 3NSKA 1BR1B 4N5XA 1B47A 4MLWA 1B8RA 1LA3A 2HF5A 5F6TA 2M8UA 1J1EA 4CFQA 2Y1NA 3OB1B 1K90D 3CR5X 3DF0B 1IQ3A 1QVIZ 1V1FA 1KQMB 1NX0A 2ZRSA 1LVCD 2LNKA 1DJZA 2WOSA 1W7JB 1IWQA 1PRWA 2LUXA 1DJIA 2NLNA 3BOWA 5AERA 1H8BA 1GQMA 1U5IB 3BYAA 1KK7Z 1SYMA 1JFKA 1KWOC 2K7OA 1GGZA 2ZN8A 1PVAA 2CT9A 1NIWA 1EJ3A 2JTTA 3JTDC 1YRTB 2JNFA 3I5HB 2JT3A 1YUTA 2JZIA 4UPGA 3AKBA 2O5GA 5FYXA 3SG4A 1PALA 1UUSA 2JU0A 3VRNA 1F71A 4F0ZB 3I5GB 2LVJA 3WNXB 1BF5A 1KK7Y 2KFHA 2KBIA 3LK0A 5I2QA 4TNCA 4YRUA 5CSIA 1WRZA 1MUXA 2H61A 4PHNA 2MBXA 4YGCB 1XVJA 5TNCA 1DJXA 4CPVA 2L0PA 1NX2A 1F55A 3FWBA 1XFVO 2ZRTA 1RWYA 1F70A 1EL4A 2M7NA 2Q4UA 4CFRA 4XJKA 1MXEA 2WNDA 3EK8A 2F2OA 2LMUA 1SW8A 3A4UB 1MHOA 1LA0A 2DOQA 2M49B 3BUWB 3I5FC 2BE4A 1YUUA 3IQOA 1XK4A 2E30A 4JQ0D 4YBHB 4ORAB 2FJUB 2I7AA 3NXAA 1AUIB 2MHHA 2BBMA 3CZTX 2VRGA 2CTNA 1SCMC 1XFXO 2BKIB 3IQQA 1QIWA 4YGAA 5J3XA 1FF1A 1F54A 2F33A 1QASA 2MA2A 5CPVA 4JPZB 2LVVA 4OCIA 1ZACA 1QX7A 4N1GA 1EG3A 1M45A 3PFVA 1R6PA 4MN0A 2K2AA 1CB1A 4CIDA 2PASA 1QX5B 2V53A 2BL0C 2K8MB 1YX8A 4BY5A 1M46A 2WCEA 1BODA 1G4YR 2M29A 3BXKA 5AANA 5HYDA 1M39A 1EXRA 3I5IC 1CDLA 1NCXA 1BMOA 4MEWA 4DCKA 3A8RA 1Y0VH 2LAPA 2PALA 3SIBA 1JSAA 5G08A 3OP0A 1DJHA 2AAOA 5HKZA 3JVTC 4PE1A 1GJYA 1EG4A 2LLTA 3VROA 5DKNA 2KNEA 5ER5A 2KAXA 1TNQA 1UHHA 3D0YB 2JRFA 1JUOA 1J7RA 1RFJA 2KI6D 1RROA 1F4QA 2M3WA 2Q91A 1KFUL 2ZNDA 3AAJA 2WCBA 3LCPC 5DKRA 1CKKA 1IQ5A 4MZKA 1M31A 2K2FA 1QXPA 1WDCB 2BBNA 4ICBA 2GV5A 3DVEA 2JPTA 2LVKA 2PRUA 1PK0D 1B1GA 4M2QA 1S3PA 5HKWA 1AP4A 1B4CA 2KI4C 2OTGB 1LXFC 1PSBA 2KYCA 1NCZA 1CLBA 1UHNA 3O2PA 2MRDA 4GBAA 3EK7A 2TN4A 3O78A 2LC5A 1E8AA 1HQVA 1SR6B 4M2OA 5KSZA 2I2RE 4JWQA 1AJ5A 2LHIA 2LANA 4YI8A 1K94A 1TN4A 1MWNA 3FIAA 2M1UA 3KO0A 4C0KA 2BCXA 4HRGA 1A75B 1C07A 4R1EA 1ZUZA 4L9MA 4WQ3A 4PALA 1DGVA 4I5NB 3PN7C 4ORCB 3CTNA 1NCYA 4I5LB 2ZKMX 1WLMA 5BPJA 2KFGA 3TUYB 3OB2B 1QV0A 1OSAA 1SRAA 2I18A 1ODBA 2GGZA 4MZLA 3CR4X 1WRLA 3SG3A 1J7QA 1CM1A 1J7PA 2BE6A 4MRXA 3TS5B 1J7OA 2G9BA 2M97A 1XFWO 5D69A 1TIZA 1V1GA 1MXLC 2KAVA 3BOWB 4ZCUA 1KK8B 1QX2A 1C7VA 1S6CA 1WRKA 2F8PA 4HREE 4MVFA 1CMGA 1KSMA 1J55A 1K93D 2KQYA 3NSLA 3PALA 1BOCA 1BT6A 1CDNA 5HLVA 4AQIA 3CS1A 4GAOA 2L50A 1NPQA 1B9AA 1WY9A 1QTXA 1YRUB 2LP2A 4PCWA 4AOMA 4C0JA 4OVNF 1DJWA 1BLQA 2LV7A 2I94A 2LLUA 2MJWB 3OHMB 1SY9A 5JOLA 2Y5IA 1J1DA 4FTGA 1KCYA 1SL9A 4GGFC 1PULA 1QV1A 2KAYA 4ORBB 4ETOA 1CNPA 2PMYA 1NX3A 1YTZC 1A03A 4A4BA 4GGNA 1CFDA 3D10A 3FS7A 3DVMA 5AFPA 1N65A 3LL8B 1Y1UA 2EC6B 3SG2A 4E68A 2KDHA 2OS8B 1F8HA 1L2OC 1S26D 2LLSA 3EVVA 1L7ZA 4HSZA 4XJKB 1WLZA 1OOJA 2LM5A 4YI9A 1CTRA 2NZ0A 1DVIA 4PHJA 3M0WA 2QACA 1S6JA 2MAZA 1G33A 1KFUS 4QJ5B 3LLEA 4QJ4B 3DVJA 4PE7A 1EH2A 2K7CA 3EVUA 5HKYA 1KFXL 1SK6D 2K61A 4USLA 1OE9B 1FPWA 2ZFDA 1FW4A 1IGVA 1NSHA 1SL7A 3BUMB 3DVKA 2JXCA 3TZ1A 1XYDA 5CSJA 4CLNA 1VRKA 2NCOA 4DS7A 2LCPA 1JBAA 4OR9B 3EKHA 1D1OA 1NP8A 1DJYA 2PVBA 4I5KA 2WC8A 2FOTA 2MLEC 3EK4A 5K89A 1S5GZ 2P6BB 3RM1A 1KWOB 1A4PA 1TNWA 2D8NA 1ZOTB 3C1VA 4FQOA 4MRYA 1FBVA 1JFJA 1K96A 1Q80A 2JT0A 2K7BA 3SG7A 2ISDA 1KQMC 2L4IA 3JTDB 1QIVA 1XFZO 1TOPA 2M7LA 1W7IB 1K8UA 4QJ3B 5AEQA 1OQPA 3ICBA 2EHBA 1B8LA 3KHEA 4D1EA 4XYNA 1CDMA 2WCFA 1MF8B 4U8DA 3GK1A 1PSRA 1NUBA 5I8NA 1IG5A 1S5GY 4MZJA 4GGFA 2CNPA 1ALVA 2SASA 2F3YA 2GGMA 1B7TZ 1H4BA 1OZOA 1BG1A 1TCFA 2Y4QA 5KTYA 2R2IA 1B8CA 2LMTA 3SG5A 4C0LA 3WHTB 1RJVA 1TTXA 2JT8A 2KGBC 4Q04A 1QATA 2Y1MA 3GK4X 2L51A 1UHKA 1K9PA 4I5JA 3I5FB 1CLLA 4PE0A 3BUXB 1UWOA 3CGAA 1IJ5A 1B7TY 5PALA 3BUNB 2H61C 1DT7B 3CWGA 1CDPA 3PSRA 1MR8A
chains in the Genus database with same CATH superfamily
3PATA 3MSEB 2KGRA 2LUCA 4JKTA 1QLSA 3KPXA 1SCMB 3LK1A 2WC5A 1UP5A 2KI6C 1OW4A 2HETA 3PM2A 1TNXA 1X02A 2BCBA 1DF0A 1XO5A 4N1FA 3RLZA 2FJYA 2JTZA 3R1OA 4WQ2A 1FI6A 3BQ3A 2BL0B 2LHLA 1Z2CB 2JNXA 3D76A 3PLFB 5DKQA 4DRWA 3BJHA 1R2UA 3DF0A 4P5OE 1NWDA 1ZMZA 3I5IB 1CM4A 5IBWA 1DMOA 5I2OA 5CSNA 1YUSA 1XA5A 5AXIA 2HQ8A 3JVTB 3VRRA 3ZNIA 3VRQA 1KFXS 1U5IA 5KU1A 3O6BA 3TDZA 2M1KB 2F3ZA 3DZTA 3S0BA 2BCAA 3CLNA 4NDBA 3FE6A 3H4SE 1S36A 1Y1XA 3KF9A 4DIRA 2ZN9A 4AQJA 1AHRA 1JF2A 3D78A 2K7DA 3OGNA 4A4CA 3S0EA 3KEVA 3QMEA 3CZ2A 4M2PA 3S0FA 2KYFA 2MLFC 1CFFA 2QPTA 2H2KA 2K60A 5CSFA 1CLMA 2M0RA 2AUCA 1K95A 1SKTA 2AMIA 1QVIY 1ZFSA 3F45A 3ZWHA 3PM8A 3FWCA 1LINA 1YX7A 1XFYO 1IH0A 3QRXA 2WCHA 3D77A 1DEKA 2COLB 1BJFA 4GFTA 4KYNA 4BY4A 2KI4B 3DD4A 4HRHA 3OX6A 1OMDA 2KHNA 3VGOA 1BR4B 1BU3A 1SNLA 2G2BA 2WC6A 2OPOA 2KBMA 1SCVA 1WDCC 2NCPA 1DGUA 4PDZA 1DJGA 3E3RA 4P2YB 1IIOA 2B1UA 1OMVA 2PSRA 4MSPA 3SG6A 4NQGA 4F7FA 2OTGC 2SCPA 4GNKB 3NSIA 2JXLA 3SIAA 2F2PA 1CMFA 2JOJA 2KPHA 4PE4A 1OMRA 3TDIA 1RTP1 3GOFA 4YGEB 1S6IA 1IJ6A 1LKJA 2BKHB 1DTLA 3PN7B 1ALWA 2CXJA 1SR6C 1GGWA 4ZCVA 1SPYA 2LVIA 2E6WA 1IKUA 2KOTA 3HCMA 3VRPA 1TWOA 3B88A 1NYAA 1Y1AA 2KQ6A 2M9GA 2HQWA 4WRIA 1MQ1A 1TCOB 1P28A 4NDDA 2L5XB 1NX1A 4INWA 2BECA 1YURA 1Z4HA 4PHKA 1IRJA 5HLOA 1RK9A 3IF7A 3TUYC 1AK8A 1K2HA 3HX4A 2QEVA 2FCDA 1K9UA 4NDCA 3EVRA 1A29A 1M63B 1N0YA 3TS5C 1SBJA 3AKAA 3K21A 1XFUO 1DC1A 1JF0A 5I2LA 1AVSA 5ER4X 1JWDA 1K9KA 1Y6WA 3NHIA 2JWWA 3UNWA 1TRFA 1KK8C 2LMVA 1A2XA 3I5HC 3TDUA 3D74A 2CCMA 3D0YA 2QEBA 4IL1A 4YGDB 1KQVA 1TNPA 1F4OA 2ERBA 1HT9A 3WHUB 2LP3A 4YGBB 1SMGA 2L4HA 3I5GC 3WXAA 1SL8A 2A4JA 5I94A 2WORA 3CABA 2KFFA 3O4YA 1UHJA 5JJGA 1L2OB 2IS9A 1UHIA 3CDNA 3OX5A 5GQQC 2EGDA 1FI5A 3B6XA 1QJTA 2NXQA 1QS7A 2O60A 4OKHA 2HPSA 2ZNEA 3D75A 1AJ4A 3SJSA 1OZSA 1YVLA 1CFCA 1S1EA 2K0JA 2RGIA 1DQEA 1PVBA 2EC6C 1G8IA 3B7AA 4PHMA 1UURA 2FCEA 2OS8C 1CFPA 1RECA 4GUKA 1YVHA 2JC2A 2LE9B 4MBEA 1JC2A 2L2EA 3S0GA 1OOFA 5D7FA 3EKJA 2L98A 2CBLA 3GK2A 1QLKA 4DUQA 5B8IB 1C7WA 4OV2A 1N2DA 4GPLB 3BUOB 3CR2A 3S0AA 2KSPA 1XK4C 1YR5A 1A75A 1KSOA 3L4LA 2JQ6A 2JULA 1DF0B 3AAKA 3NSOA 4INXA 3NSKA 1BR1B 3CZ1A 4N5XA 1B47A 4MLWA 1B8RA 1LA3A 2HF5A 5F6TA 2M8UA 1J1EA 4CFQA 2Y1NA 3OB1B 1K90D 3CR5X 3DF0B 1IQ3A 1QVIZ 1V1FA 1KQMB 1NX0A 2ZRSA 1LVCD 2LNKA 1DJZA 2WOSA 1W7JB 1IWQA 1PRWA 2LUXA 1DJIA 2NLNA 3BOWA 5AERA 1H8BA 1GQMA 2KLDA 1U5IB 3BYAA 1KK7Z 1SYMA 1JFKA 1KWOC 5D3OA 2K7OA 1GGZA 1GM0A 2ZN8A 1PVAA 2CT9A 3CZ0A 1NIWA 1EJ3A 2JTTA 3JTDC 1SSEB 2QEOA 1YRTB 1TUZA 3DXLA 2JNFA 3I5HB 2JT3A 1YUTA 2JZIA 2WCLA 4UPGA 3AKBA 2O5GA 5FYXA 3SG4A 1PALA 1UUSA 1W9ZA 2JU0A 3VRNA 5HL1A 1F71A 4F0ZB 3I5GB 2LVJA 3WNXB 1BF5A 1KK7Y 2KFHA 2KBIA 2KLEA 3R72A 3LK0A 5I2QA 4PT1A 4TNCA 4YRUA 5CSIA 1WRZA 1MUXA 2H61A 4PHNA 2MBXA 4YGCB 1OOHA 1XVJA 5TNCA 1DJXA 4CPVA 2L0PA 1NX2A 1F55A 3FWBA 1XFVO 2ZRTA 1RWYA 1F70A 1EL4A 2M7NA 2Q4UA 4CFRA 4XJKA 1MXEA 3NHTA 5FI2A 3BFHA 3V2LA 2WNDA 3EK8A 2QDIA 2F2OA 2LMUA 1SW8A 3A4UB 1MHOA 1LA0A 2DOQA 2M49B 3BUWB 3I5FC 3BFAA 2BE4A 1YUUA 3IQOA 1XK4A 2E30A 4JQ0D 4YBHB 4ORAB 3RZSA 2FJUB 2I7AA 3NXAA 1AUIB 2MHHA 2BBMA 3CZTX 2VRGA 2CTNA 3PJIA 1SCMC 1XFXO 2BKIB 3IQQA 1QIWA 4YGAA 5J3XA 1FF1A 1F54A 2F33A 2P71A 1QASA 2H8VA 2MA2A 5CPVA 3BFBA 4JPZB 2LVVA 4OCIA 2WCKA 1ZACA 1QX7A 2YGUA 1EG3A 1M45A 4N1GA 4FQTA 3PFVA 1R6PA 4MN0A 2K2AA 1CB1A 4CIDA 2PASA 1QX5B 2V53A 2BL0C 2K8MB 1YX8A 4BY5A 1M46A 2WCEA 1BODA 1G4YR 2M29A 3BXKA 2WCJA 5AANA 5HYDA 1M39A 1EXRA 3I5IC 1CDLA 1NCXA 1BMOA 4MEWA 4DCKA 3A8RA 1Y0VH 2LAPA 2PALA 3SIBA 1JSAA 5G08A 3OP0A 1DJHA 2AAOA 5HKZA 3JVTC 4PE1A 2QEHA 3VB1A 1GJYA 1EG4A 2LLTA 2BNXA 3VROA 2L2CA 5DKNA 2KNEA 3B87A 2KAXA 5ER5A 1TNQA 1UHHA 3D0YB 5EL2A 2JRFA 1JUOA 1J7RA 1RFJA 2KI6D 1RROA 1F4QA 2M3WA 2Q91A 3SS5A 2GTEA 1KFUL 2ZNDA 3AAJA 2WCBA 3LCPC 5DKRA 1CKKA 1IQ5A 3L47A 4MZKA 1M31A 2K2FA 1QXPA 5FI6A 1WDCB 2BBNA 4ICBA 2GV5A 3NGVA 3DVEA 2JPTA 2LVKA 2PRUA 1PK0D 1B1GA 4M2QA 1S3PA 5HKWA 1OOIX 1AP4A 2KI4C 2OTGB 2PYQA 1LXFC 1B4CA 1PSBA 2KYCA 3DYEA 1NCZA 1CLBA 1UHNA 3O2PA 2MRDA 4GBAA 3EK7A 2TN4A 3O78A 2LC5A 1E8AA 1HQVA 1SR6B 4M2OA 5KSZA 2I2RE 4JWQA 1AJ5A 2LHIA 2LANA 4YI8A 1K94A 1TN4A 1MWNA 3FIAA 2M1UA 3KO0A 4C0KA 2BCXA 4HRGA 1A75B 1C07A 4R1EA 1ZUZA 4L9MA 4WQ3A 4PALA 1DGVA 4I5NB 3PN7C 4ORCB 3CTNA 1NCYA 4I5LB 2ZKMX 1WLMA 5BPJA 3SS4A 2KFGA 3TUYB 3OB2B 1QV0A 1OSAA 1SRAA 1OOGA 2I18A 1LS8A 1ODBA 2GGZA 4MZLA 3CR4X 1WRLA 3SG3A 2PQLA 1J7QA 1ORGA 1CM1A 1J7PA 2BE6A 4MRXA 3TS5B 1J7OA 2G9BA 3CYZA 2M97A 1XFWO 4IJ7A 5D69A 1TIZA 1V1GA 1MXLC 2KAVA 3BOWB 4ZCUA 1KK8B 1QX2A 1C7VA 1S6CA 1WRKA 2F8PA 4HREE 3FE9A 4MVFA 1CMGA 4JD9A 1KSMA 1J55A 1K93D 2KQYA 3NSLA 3PALA 1BOCA 1BT6A 1CDNA 5HLVA 4AQIA 3CS1A 2L5YA 4GAOA 2L50A 5DICA 1NPQA 1B9AA 1WY9A 2BAPA 1QTXA 1YRUB 2LP2A 4PCWA 4AOMA 4C0JA 4OVNF 1DJWA 3S0DA 1BLQA 2LV7A 2I94A 2LLUA 2MJWB 3OHMB 1SY9A 5JOLA 3EG5B 2Y5IA 1J1DA 4FTGA 1KCYA 1SL9A 4GGFC 1PULA 1QV1A 2KAYA 4ORBB 4ETOA 1CNPA 2JPOA 2PMYA 1NX3A 1YTZC 1A03A 4A4BA 4GGNA 1CFDA 3D10A 3FS7A 3DVMA 5AFPA 1N65A 3LL8B 1Y1UA 2EC6B 3SG2A 4E68A 5FI7A 2KDHA 2OS8B 1F8HA 1L2OC 1S26D 2LLSA 3EVVA 3IVTA 1L7ZA 4HSZA 4XJKB 3DY9A 3UO9A 1WLZA 2WCMA 1OOJA 2LM5A 4YI9A 1CTRA 2NZ0A 1DVIA 4PHJA 3M0WA 2QACA 1S6JA 2MAZA 1G33A 1KFUS 4QJ5B 3LLEA 4QJ4B 3DVJA 1DELA 4PE7A 1EH2A 1QWVA 2K7CA 3EVUA 5HKYA 1KFXL 1SK6D 2K61A 4USLA 1C3YA 1OE9B 1FPWA 2ZFDA 1FW4A 1IGVA 1NSHA 1SL7A 3BUMB 3OBVA 1C3ZA 3SS3A 3DVKA 2JXCA 3TZ1A 1XYDA 3D73A 3FE8A 5CSJA 4CLNA 1VRKA 2NCOA 4DS7A 2LCPA 1JBAA 4OR9B 3EKHA 1D1OA 1NP8A 1DJYA 2PVBA 4I5KA 2WC8A 2FOTA 2MLEC 3EK4A 5K89A 1S5GZ 2P6BB 3R1VA 3RM1A 1KWOB 1A4PA 1TNWA 2D8NA 1ZOTB 3C1VA 4FQOA 4MRYA 1FBVA 1JFJA 1K96A 1Q80A 2JT0A 2K7BA 3SG7A 2ISDA 3B86A 1KQMC 2L4IA 3JTDB 1QIVA 1XFZO 3N7HA 1TOPA 2M7LA 2P70A 1W7IB 1K8UA 4OZDA 4QJ3B 5AEQA 1OQPA 3ICBA 2EHBA 1B8LA 3KHEA 3Q8IA 1T14A 4D1EA 4XYNA 1CDMA 2WCFA 1MF8B 4U8DA 3GK1A 1PSRA 1NUBA 3K1EA 5I8NA 1IG5A 1S5GY 4MZJA 4GGFA 2CNPA 1ALVA 2SASA 2F3YA 2GGMA 1B7TZ 1H4BA 1OZOA 1BG1A 1TCFA 2Y4QA 3L4AA 5KTYA 2R2IA 1B8CA 2LMTA 3SG5A 4C0LA 3WHTB 1RJVA 1TTXA 2JT8A 2KGBC 3O4XA 4Q04A 1QATA 2Y1MA 3GK4X 2L51A 1UHKA 1K9PA 3R1PA 3I5FB 1CLLA 4I5JA 4PE0A 3BUXB 1UWOA 3CGAA 1IJ5A 1TUJA 1B7TY 1XFRA 3BUNB 5PALA 2H61C 1DT7B 3CWGA 1CDPA 3PSRA 1MR8A
chains in the Genus database with same CATH topology
3PATA 3MSEB 2KGRA 2LUCA 1QLSA 3KPXA 1SCMB 3LK1A 1UP5A 2KI6C 2HETA 1TNXA 1X02A 2BCBA 1DF0A 1XO5A 4N1FA 3RLZA 2JTZA 4WQ2A 1FI6A 3BQ3A 2BL0B 2LHLA 3PLFB 2JNXA 5DKQA 4DRWA 1R2UA 3DF0A 4P5OE 1NWDA 1ZMZA 3I5IB 1CM4A 5IBWA 1DMOA 5I2OA 5CSNA 1YUSA 1XA5A 5AXIA 2HQ8A 3JVTB 3VRRA 3ZNIA 3VRQA 1KFXS 1U5IA 5KU1A 3O6BA 3TDZA 2M1KB 2F3ZA 2BCAA 3CLNA 4NDBA 3KF9A 3H4SE 1S36A 1Y1XA 4DIRA 2ZN9A 4AQJA 1AHRA 1JF2A 2K7DA 4A4CA 3KEVA 4M2PA 1CFFA 2KYFA 2MLFC 2QPTA 2H2KA 5CSFA 1CLMA 2M0RA 2AUCA 1K95A 1SKTA 2AMIA 1QVIY 1ZFSA 3F45A 3ZWHA 3PM8A 3FWCA 1LINA 1YX7A 1XFYO 1IH0A 3QRXA 2COLB 1BJFA 4GFTA 4BY4A 2KI4B 3DD4A 4HRHA 3OX6A 1OMDA 2KHNA 3VGOA 1BR4B 1BU3A 1SNLA 2G2BA 2OPOA 2KBMA 1SCVA 1WDCC 2NCPA 1DGUA 4PDZA 1DJGA 3E3RA 4P2YB 2B1UA 1OMVA 2PSRA 4MSPA 3SG6A 4NQGA 2OTGC 2SCPA 4GNKB 3NSIA 2JXLA 3SIAA 2F2PA 1CMFA 2JOJA 4PE4A 3TDIA 1OMRA 1RTP1 3GOFA 4YGEB 1S6IA 1IJ6A 1LKJA 2BKHB 1DTLA 3PN7B 1ALWA 2CXJA 1SR6C 1GGWA 4ZCVA 1SPYA 2LVIA 2E6WA 1IKUA 2KOTA 3HCMA 3VRPA 1NYAA 1Y1AA 2KQ6A 2M9GA 2HQWA 4WRIA 1MQ1A 1TCOB 4NDDA 2L5XB 1NX1A 2BECA 1YURA 4PHKA 5HLOA 1IRJA 3TUYC 1RK9A 3IF7A 1AK8A 1K2HA 3HX4A 2FCDA 1K9UA 4NDCA 3EVRA 1A29A 1M63B 1N0YA 3TS5C 1SBJA 3AKAA 3K21A 1XFUO 1JF0A 5I2LA 1AVSA 5ER4X 1JWDA 1K9KA 1Y6WA 2JWWA 1TRFA 1KK8C 2LMVA 1A2XA 3I5HC 3TDUA 2CCMA 3D0YA 4IL1A 4YGDB 1KQVA 1TNPA 1F4OA 1HT9A 3WHUB 2LP3A 4YGBB 1SMGA 2L4HA 3I5GC 3WXAA 1SL8A 2A4JA 2WORA 2KFFA 3O4YA 1UHJA 5JJGA 1L2OB 2IS9A 1UHIA 3OX5A 5GQQC 2EGDA 1FI5A 1QJTA 2NXQA 1QS7A 2O60A 4OKHA 2HPSA 2ZNEA 1AJ4A 3SJSA 1OZSA 1YVLA 1CFCA 1S1EA 2K0JA 2RGIA 2EC6C 1PVBA 1G8IA 4PHMA 1UURA 2FCEA 2OS8C 1CFPA 1RECA 4GUKA 1YVHA 2JC2A 2LE9B 4MBEA 1JC2A 2L2EA 5D7FA 3EKJA 2L98A 2CBLA 3GK2A 1QLKA 4DUQA 5B8IB 1C7WA 4OV2A 1N2DA 4GPLB 3BUOB 3CR2A 2KSPA 1XK4C 1YR5A 1A75A 1KSOA 2JQ6A 2JULA 1DF0B 3AAKA 3NSOA 3NSKA 1BR1B 4N5XA 1B47A 4MLWA 1B8RA 1LA3A 2HF5A 5F6TA 2M8UA 1J1EA 4CFQA 2Y1NA 3OB1B 1K90D 3CR5X 3DF0B 1IQ3A 1QVIZ 1V1FA 1KQMB 1NX0A 2ZRSA 1LVCD 2LNKA 1DJZA 2WOSA 1W7JB 1IWQA 1PRWA 2LUXA 1DJIA 2NLNA 3BOWA 5AERA 1H8BA 1GQMA 1U5IB 3BYAA 1KK7Z 1SYMA 1JFKA 1KWOC 2K7OA 1GGZA 2ZN8A 1PVAA 2CT9A 1NIWA 1EJ3A 2JTTA 3JTDC 1YRTB 2JNFA 3I5HB 2JT3A 1YUTA 2JZIA 4UPGA 3AKBA 2O5GA 5FYXA 3SG4A 1PALA 1UUSA 2JU0A 3VRNA 1F71A 4F0ZB 3I5GB 2LVJA 3WNXB 1BF5A 1KK7Y 2KFHA 2KBIA 3LK0A 5I2QA 4TNCA 4YRUA 5CSIA 1WRZA 1MUXA 2H61A 4PHNA 2MBXA 4YGCB 1XVJA 5TNCA 1DJXA 4CPVA 2L0PA 1NX2A 1F55A 3FWBA 1XFVO 2ZRTA 1RWYA 1F70A 1EL4A 2M7NA 2Q4UA 4CFRA 4XJKA 1MXEA 2WNDA 3EK8A 2F2OA 2LMUA 1SW8A 3A4UB 1MHOA 1LA0A 2DOQA 2M49B 3BUWB 3I5FC 2BE4A 1YUUA 3IQOA 1XK4A 2E30A 4JQ0D 4YBHB 4ORAB 2FJUB 2I7AA 3NXAA 1AUIB 2MHHA 2BBMA 3CZTX 2VRGA 2CTNA 1SCMC 1XFXO 2BKIB 3IQQA 1QIWA 4YGAA 5J3XA 1FF1A 1F54A 2F33A 1QASA 2MA2A 5CPVA 4JPZB 2LVVA 4OCIA 1ZACA 1QX7A 4N1GA 1EG3A 1M45A 3PFVA 1R6PA 4MN0A 2K2AA 1CB1A 4CIDA 2PASA 1QX5B 2V53A 2BL0C 2K8MB 1YX8A 4BY5A 1M46A 2WCEA 1BODA 1G4YR 2M29A 3BXKA 5AANA 5HYDA 1M39A 1EXRA 3I5IC 1CDLA 1NCXA 1BMOA 4MEWA 4DCKA 3A8RA 1Y0VH 2LAPA 2PALA 3SIBA 1JSAA 5G08A 3OP0A 1DJHA 2AAOA 5HKZA 3JVTC 4PE1A 1GJYA 1EG4A 2LLTA 3VROA 5DKNA 2KNEA 5ER5A 2KAXA 1TNQA 1UHHA 3D0YB 2JRFA 1JUOA 1J7RA 1RFJA 2KI6D 1RROA 1F4QA 2M3WA 2Q91A 1KFUL 2ZNDA 3AAJA 2WCBA 3LCPC 5DKRA 1CKKA 1IQ5A 4MZKA 1M31A 2K2FA 1QXPA 1WDCB 2BBNA 4ICBA 2GV5A 3DVEA 2JPTA 2LVKA 2PRUA 1PK0D 1B1GA 4M2QA 1S3PA 5HKWA 1AP4A 1B4CA 2KI4C 2OTGB 1LXFC 1PSBA 2KYCA 1NCZA 1CLBA 1UHNA 3O2PA 2MRDA 4GBAA 3EK7A 2TN4A 3O78A 2LC5A 1E8AA 1HQVA 1SR6B 4M2OA 5KSZA 2I2RE 4JWQA 1AJ5A 2LHIA 2LANA 4YI8A 1K94A 1TN4A 1MWNA 3FIAA 2M1UA 3KO0A 4C0KA 2BCXA 4HRGA 1A75B 1C07A 4R1EA 1ZUZA 4L9MA 4WQ3A 4PALA 1DGVA 4I5NB 3PN7C 4ORCB 3CTNA 1NCYA 4I5LB 2ZKMX 1WLMA 5BPJA 2KFGA 3TUYB 3OB2B 1QV0A 1OSAA 1SRAA 2I18A 1ODBA 2GGZA 4MZLA 3CR4X 1WRLA 3SG3A 1J7QA 1CM1A 1J7PA 2BE6A 4MRXA 3TS5B 1J7OA 2G9BA 2M97A 1XFWO 5D69A 1TIZA 1V1GA 1MXLC 2KAVA 3BOWB 4ZCUA 1KK8B 1QX2A 1C7VA 1S6CA 1WRKA 2F8PA 4HREE 4MVFA 1CMGA 1KSMA 1J55A 1K93D 2KQYA 3NSLA 3PALA 1BOCA 1BT6A 1CDNA 5HLVA 4AQIA 3CS1A 4GAOA 2L50A 1NPQA 1B9AA 1WY9A 1QTXA 1YRUB 2LP2A 4PCWA 4AOMA 4C0JA 4OVNF 1DJWA 1BLQA 2LV7A 2I94A 2LLUA 2MJWB 3OHMB 1SY9A 5JOLA 2Y5IA 1J1DA 4FTGA 1KCYA 1SL9A 4GGFC 1PULA 1QV1A 2KAYA 4ORBB 4ETOA 1CNPA 2PMYA 1NX3A 1YTZC 1A03A 4A4BA 4GGNA 1CFDA 3D10A 3FS7A 3DVMA 5AFPA 1N65A 3LL8B 1Y1UA 2EC6B 3SG2A 4E68A 2KDHA 2OS8B 1F8HA 1L2OC 1S26D 2LLSA 3EVVA 1L7ZA 4HSZA 4XJKB 1WLZA 1OOJA 2LM5A 4YI9A 1CTRA 2NZ0A 1DVIA 4PHJA 3M0WA 2QACA 1S6JA 2MAZA 1G33A 1KFUS 4QJ5B 3LLEA 4QJ4B 3DVJA 4PE7A 1EH2A 2K7CA 3EVUA 5HKYA 1KFXL 1SK6D 2K61A 4USLA 1OE9B 1FPWA 2ZFDA 1FW4A 1IGVA 1NSHA 1SL7A 3BUMB 3DVKA 2JXCA 3TZ1A 1XYDA 5CSJA 4CLNA 1VRKA 2NCOA 4DS7A 2LCPA 1JBAA 4OR9B 3EKHA 1D1OA 1NP8A 1DJYA 2PVBA 4I5KA 2WC8A 2FOTA 2MLEC 3EK4A 5K89A 1S5GZ 2P6BB 3RM1A 1KWOB 1A4PA 1TNWA 2D8NA 1ZOTB 3C1VA 4FQOA 4MRYA 1FBVA 1JFJA 1K96A 1Q80A 2JT0A 2K7BA 3SG7A 2ISDA 1KQMC 2L4IA 3JTDB 1QIVA 1XFZO 1TOPA 2M7LA 1W7IB 1K8UA 4QJ3B 5AEQA 1OQPA 3ICBA 2EHBA 1B8LA 3KHEA 4D1EA 4XYNA 1CDMA 2WCFA 1MF8B 4U8DA 3GK1A 1PSRA 1NUBA 5I8NA 1IG5A 1S5GY 4MZJA 4GGFA 2CNPA 1ALVA 2SASA 2F3YA 2GGMA 1B7TZ 1H4BA 1OZOA 1BG1A 1TCFA 2Y4QA 5KTYA 2R2IA 1B8CA 2LMTA 3SG5A 4C0LA 3WHTB 1RJVA 1TTXA 2JT8A 2KGBC 4Q04A 1QATA 2Y1MA 3GK4X 2L51A 1UHKA 1K9PA 4I5JA 3I5FB 1CLLA 4PE0A 3BUXB 1UWOA 3CGAA 1IJ5A 1B7TY 5PALA 3BUNB 2H61C 1DT7B 3CWGA 1CDPA 3PSRA 1MR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PAT A;  3MSE B;  2KGR A;  2LUC A;  1QLS A;  3KPX A;  1SCM B;  3LK1 A;  1UP5 A;  2KI6 C;  2HET A;  1TNX A;  1X02 A;  2BCB A;  1DF0 A;  1XO5 A;  4N1F A;  3RLZ A;  2JTZ A;  4WQ2 A;  1FI6 A;  3BQ3 A;  2BL0 B;  2LHL A;  3PLF B;  2JNX A;  5DKQ A;  4DRW A;  1R2U A;  3DF0 A;  4P5O E;  1NWD A;  1ZMZ A;  3I5I B;  1CM4 A;  5IBW A;  1DMO A;  5I2O A;  5CSN A;  1YUS A;  1XA5 A;  5AXI A;  2HQ8 A;  3JVT B;  3VRR A;  3ZNI A;  3VRQ A;  1KFX S;  1U5I A;  5KU1 A;  3O6B A;  3TDZ A;  2M1K B;  2F3Z A;  2BCA A;  3CLN A;  4NDB A;  3KF9 A;  3H4S E;  1S36 A;  1Y1X A;  4DIR A;  2ZN9 A;  4AQJ A;  1AHR A;  1JF2 A;  2K7D A;  4A4C A;  3KEV A;  4M2P A;  1CFF A;  2KYF A;  2MLF C;  2QPT A;  2H2K A;  5CSF A;  1CLM A;  2M0R A;  2AUC A;  1K95 A;  1SKT A;  2AMI A;  1QVI Y;  1ZFS A;  3F45 A;  3ZWH A;  3PM8 A;  3FWC A;  1LIN A;  1YX7 A;  1XFY O;  1IH0 A;  3QRX A;  2COL B;  1BJF A;  4GFT A;  4BY4 A;  2KI4 B;  3DD4 A;  4HRH A;  3OX6 A;  1OMD A;  2KHN A;  3VGO A;  1BR4 B;  1BU3 A;  1SNL A;  2G2B A;  2OPO A;  2KBM A;  1SCV A;  1WDC C;  2NCP A;  1DGU A;  4PDZ A;  1DJG A;  3E3R A;  4P2Y B;  2B1U A;  1OMV A;  2PSR A;  4MSP A;  3SG6 A;  4NQG A;  2OTG C;  2SCP A;  4GNK B;  3NSI A;  2JXL A;  3SIA A;  2F2P A;  1CMF A;  2JOJ A;  4PE4 A;  3TDI A;  1OMR A;  1RTP 1;  3GOF A;  4YGE B;  1S6I A;  1IJ6 A;  1LKJ A;  2BKH B;  1DTL A;  3PN7 B;  1ALW A;  2CXJ A;  1SR6 C;  1GGW A;  4ZCV A;  1SPY A;  2LVI A;  2E6W A;  1IKU A;  2KOT A;  3HCM A;  3VRP A;  1NYA A;  1Y1A A;  2KQ6 A;  2M9G A;  2HQW A;  4WRI A;  1MQ1 A;  1TCO B;  4NDD A;  2L5X B;  1NX1 A;  2BEC A;  1YUR A;  4PHK A;  5HLO A;  1IRJ A;  3TUY C;  1RK9 A;  3IF7 A;  1AK8 A;  1K2H A;  3HX4 A;  2FCD A;  1K9U A;  4NDC A;  3EVR A;  1A29 A;  1M63 B;  1N0Y A;  3TS5 C;  1SBJ A;  3AKA A;  3K21 A;  1XFU O;  1JF0 A;  5I2L A;  1AVS A;  5ER4 X;  1JWD A;  1K9K A;  1Y6W A;  2JWW A;  1TRF A;  1KK8 C;  2LMV A;  1A2X A;  3I5H C;  3TDU A;  2CCM A;  3D0Y A;  4IL1 A;  4YGD B;  1KQV A;  1TNP A;  1F4O A;  1HT9 A;  3WHU B;  2LP3 A;  4YGB B;  1SMG A;  2L4H A;  3I5G C;  3WXA A;  1SL8 A;  2A4J A;  2WOR A;  2KFF A;  3O4Y A;  1UHJ A;  5JJG A;  1L2O B;  2IS9 A;  1UHI A;  3OX5 A;  5GQQ C;  2EGD A;  1FI5 A;  1QJT A;  2NXQ A;  1QS7 A;  2O60 A;  4OKH A;  2HPS A;  2ZNE A;  1AJ4 A;  3SJS A;  1OZS A;  1YVL A;  1CFC A;  1S1E A;  2K0J A;  2RGI A;  2EC6 C;  1PVB A;  1G8I A;  4PHM A;  1UUR A;  2FCE A;  2OS8 C;  1CFP A;  1REC A;  4GUK A;  1YVH A;  2JC2 A;  2LE9 B;  4MBE A;  1JC2 A;  2L2E A;  5D7F A;  3EKJ A;  2L98 A;  2CBL A;  3GK2 A;  1QLK A;  4DUQ A;  5B8I B;  1C7W A;  4OV2 A;  1N2D A;  4GPL B;  3BUO B;  3CR2 A;  2KSP A;  1XK4 C;  1YR5 A;  1A75 A;  1KSO A;  2JQ6 A;  2JUL A;  1DF0 B;  3AAK A;  3NSO A;  3NSK A;  1BR1 B;  4N5X A;  1B47 A;  4MLW A;  1B8R A;  1LA3 A;  2HF5 A;  5F6T A;  2M8U A;  1J1E A;  4CFQ A;  2Y1N A;  3OB1 B;  1K90 D;  3CR5 X;  3DF0 B;  1IQ3 A;  1QVI Z;  1V1F A;  1KQM B;  1NX0 A;  2ZRS A;  1LVC D;  2LNK A;  1DJZ A;  2WOS A;  1W7J B;  1IWQ A;  1PRW A;  2LUX A;  1DJI A;  2NLN A;  3BOW A;  5AER A;  1H8B A;  1GQM A;  1U5I B;  3BYA A;  1KK7 Z;  1SYM A;  1JFK A;  1KWO C;  2K7O A;  1GGZ A;  2ZN8 A;  1PVA A;  2CT9 A;  1NIW A;  1EJ3 A;  2JTT A;  3JTD C;  1YRT B;  2JNF A;  3I5H B;  2JT3 A;  1YUT A;  2JZI A;  4UPG A;  3AKB A;  2O5G A;  5FYX A;  3SG4 A;  1PAL A;  1UUS A;  2JU0 A;  3VRN A;  1F71 A;  4F0Z B;  3I5G B;  2LVJ A;  3WNX B;  1BF5 A;  1KK7 Y;  2KFH A;  2KBI A;  3LK0 A;  5I2Q A;  4TNC A;  4YRU A;  5CSI A;  1WRZ A;  1MUX A;  2H61 A;  4PHN A;  2MBX A;  4YGC B;  1XVJ A;  5TNC A;  1DJX A;  4CPV A;  2L0P A;  1NX2 A;  1F55 A;  3FWB A;  1XFV O;  2ZRT A;  1RWY A;  1F70 A;  1EL4 A;  2M7N A;  2Q4U A;  4CFR A;  4XJK A;  1MXE A;  2WND A;  3EK8 A;  2F2O A;  2LMU A;  1SW8 A;  3A4U B;  1MHO A;  1LA0 A;  2DOQ A;  2M49 B;  3BUW B;  3I5F C;  2BE4 A;  1YUU A;  3IQO A;  1XK4 A;  2E30 A;  4JQ0 D;  4YBH B;  4ORA B;  2FJU B;  2I7A A;  3NXA A;  1AUI B;  2MHH A;  2BBM A;  3CZT X;  2VRG A;  2CTN A;  1SCM C;  1XFX O;  2BKI B;  3IQQ A;  1QIW A;  4YGA A;  5J3X A;  1FF1 A;  1F54 A;  2F33 A;  1QAS A;  2MA2 A;  5CPV A;  4JPZ B;  2LVV A;  4OCI A;  1ZAC A;  1QX7 A;  4N1G A;  1EG3 A;  1M45 A;  3PFV A;  1R6P A;  4MN0 A;  2K2A A;  1CB1 A;  4CID A;  2PAS A;  1QX5 B;  2V53 A;  2BL0 C;  2K8M B;  1YX8 A;  4BY5 A;  1M46 A;  2WCE A;  1BOD A;  1G4Y R;  2M29 A;  3BXK A;  5AAN A;  5HYD A;  1M39 A;  1EXR A;  3I5I C;  1CDL A;  1NCX A;  1BMO A;  4MEW A;  4DCK A;  3A8R A;  1Y0V H;  2LAP A;  2PAL A;  3SIB A;  1JSA A;  5G08 A;  3OP0 A;  1DJH A;  2AAO A;  5HKZ A;  3JVT C;  4PE1 A;  1GJY A;  1EG4 A;  2LLT A;  3VRO A;  5DKN A;  2KNE A;  5ER5 A;  2KAX A;  1TNQ A;  1UHH A;  3D0Y B;  2JRF A;  1JUO A;  1J7R A;  1RFJ A;  2KI6 D;  1RRO A;  1F4Q A;  2M3W A;  2Q91 A;  1KFU L;  2ZND A;  3AAJ A;  2WCB A;  3LCP C;  5DKR A;  1CKK A;  1IQ5 A;  4MZK A;  1M31 A;  2K2F A;  1QXP A;  1WDC B;  2BBN A;  4ICB A;  2GV5 A;  3DVE A;  2JPT A;  2LVK A;  2PRU A;  1PK0 D;  1B1G A;  4M2Q A;  1S3P A;  5HKW A;  1AP4 A;  1B4C A;  2KI4 C;  2OTG B;  1LXF C;  1PSB A;  2KYC A;  1NCZ A;  1CLB A;  1UHN A;  3O2P A;  2MRD A;  4GBA A;  3EK7 A;  2TN4 A;  3O78 A;  2LC5 A;  1E8A A;  1HQV A;  1SR6 B;  4M2O A;  5KSZ A;  2I2R E;  4JWQ A;  1AJ5 A;  2LHI A;  2LAN A;  4YI8 A;  1K94 A;  1TN4 A;  1MWN A;  3FIA A;  2M1U A;  3KO0 A;  4C0K A;  2BCX A;  4HRG A;  1A75 B;  1C07 A;  4R1E A;  1ZUZ A;  4L9M A;  4WQ3 A;  4PAL A;  1DGV A;  4I5N B;  3PN7 C;  4ORC B;  3CTN A;  1NCY A;  4I5L B;  2ZKM X;  1WLM A;  5BPJ A;  2KFG A;  3TUY B;  3OB2 B;  1QV0 A;  1OSA A;  1SRA A;  2I18 A;  1ODB A;  2GGZ A;  4MZL A;  3CR4 X;  1WRL A;  3SG3 A;  1J7Q A;  1CM1 A;  1J7P A;  2BE6 A;  4MRX A;  3TS5 B;  1J7O A;  2G9B A;  2M97 A;  1XFW O;  5D69 A;  1TIZ A;  1V1G A;  1MXL C;  2KAV A;  3BOW B;  4ZCU A;  1KK8 B;  1QX2 A;  1C7V A;  1S6C A;  1WRK A;  2F8P A;  4HRE E;  4MVF A;  1CMG A;  1KSM A;  1J55 A;  1K93 D;  2KQY A;  3NSL A;  3PAL A;  1BOC A;  1BT6 A;  1CDN A;  5HLV A;  4AQI A;  3CS1 A;  4GAO A;  2L50 A;  1NPQ A;  1B9A A;  1WY9 A;  1QTX A;  1YRU B;  2LP2 A;  4PCW A;  4AOM A;  4C0J A;  4OVN F;  1DJW A;  1BLQ A;  2LV7 A;  2I94 A;  2LLU A;  2MJW B;  3OHM B;  1SY9 A;  5JOL A;  2Y5I A;  1J1D A;  4FTG A;  1KCY A;  1SL9 A;  4GGF C;  1PUL A;  1QV1 A;  2KAY A;  4ORB B;  4ETO A;  1CNP A;  2PMY A;  1NX3 A;  1YTZ C;  1A03 A;  4A4B A;  4GGN A;  1CFD A;  3D10 A;  3FS7 A;  3DVM A;  5AFP A;  1N65 A;  3LL8 B;  1Y1U A;  2EC6 B;  3SG2 A;  4E68 A;  2KDH A;  2OS8 B;  1F8H A;  1L2O C;  1S26 D;  2LLS A;  3EVV A;  1L7Z A;  4HSZ A;  4XJK B;  1WLZ A;  1OOJ A;  2LM5 A;  4YI9 A;  1CTR A;  2NZ0 A;  1DVI A;  4PHJ A;  3M0W A;  2QAC A;  1S6J A;  2MAZ A;  1G33 A;  1KFU S;  4QJ5 B;  3LLE A;  4QJ4 B;  3DVJ A;  4PE7 A;  1EH2 A;  2K7C A;  3EVU A;  5HKY A;  1KFX L;  1SK6 D;  2K61 A;  4USL A;  1OE9 B;  1FPW A;  2ZFD A;  1FW4 A;  1IGV A;  1NSH A;  1SL7 A;  3BUM B;  3DVK A;  2JXC A;  3TZ1 A;  1XYD A;  5CSJ A;  4CLN A;  1VRK A;  2NCO A;  4DS7 A;  2LCP A;  1JBA A;  4OR9 B;  3EKH A;  1D1O A;  1NP8 A;  1DJY A;  2PVB A;  4I5K A;  2WC8 A;  2FOT A;  2MLE C;  3EK4 A;  5K89 A;  1S5G Z;  2P6B B;  3RM1 A;  1KWO B;  1A4P A;  1TNW A;  2D8N A;  1ZOT B;  3C1V A;  4FQO A;  4MRY A;  1FBV A;  1JFJ A;  1K96 A;  1Q80 A;  2JT0 A;  2K7B A;  3SG7 A;  2ISD A;  1KQM C;  2L4I A;  3JTD B;  1QIV A;  1XFZ O;  1TOP A;  2M7L A;  1W7I B;  1K8U A;  4QJ3 B;  5AEQ A;  1OQP A;  3ICB A;  2EHB A;  1B8L A;  3KHE A;  4D1E A;  4XYN A;  1CDM A;  2WCF A;  1MF8 B;  4U8D A;  3GK1 A;  1PSR A;  1NUB A;  5I8N A;  1IG5 A;  1S5G Y;  4MZJ A;  4GGF A;  2CNP A;  1ALV A;  2SAS A;  2F3Y A;  2GGM A;  1B7T Z;  1H4B A;  1OZO A;  1BG1 A;  1TCF A;  2Y4Q A;  5KTY A;  2R2I A;  1B8C A;  2LMT A;  3SG5 A;  4C0L A;  3WHT B;  1RJV A;  1TTX A;  2JT8 A;  2KGB C;  4Q04 A;  1QAT A;  2Y1M A;  3GK4 X;  2L51 A;  1UHK A;  1K9P A;  4I5J A;  3I5F B;  1CLL A;  4PE0 A;  3BUX B;  1UWO A;  3CGA A;  1IJ5 A;  1B7T Y;  5PAL A;  3BUN B;  2H61 C;  1DT7 B;  3CWG A;  1CDP A;  3PSR A;  1MR8 A; 
#chains in the Genus database with same CATH topology
 3PAT A;  3MSE B;  2KGR A;  2LUC A;  4JKT A;  1QLS A;  3KPX A;  1SCM B;  3LK1 A;  2WC5 A;  1UP5 A;  2KI6 C;  1OW4 A;  2HET A;  3PM2 A;  1TNX A;  1X02 A;  2BCB A;  1DF0 A;  1XO5 A;  4N1F A;  3RLZ A;  2FJY A;  2JTZ A;  3R1O A;  4WQ2 A;  1FI6 A;  3BQ3 A;  2BL0 B;  2LHL A;  1Z2C B;  2JNX A;  3D76 A;  3PLF B;  5DKQ A;  4DRW A;  3BJH A;  1R2U A;  3DF0 A;  4P5O E;  1NWD A;  1ZMZ A;  3I5I B;  1CM4 A;  5IBW A;  1DMO A;  5I2O A;  5CSN A;  1YUS A;  1XA5 A;  5AXI A;  2HQ8 A;  3JVT B;  3VRR A;  3ZNI A;  3VRQ A;  1KFX S;  1U5I A;  5KU1 A;  3O6B A;  3TDZ A;  2M1K B;  2F3Z A;  3DZT A;  3S0B A;  2BCA A;  3CLN A;  4NDB A;  3FE6 A;  3H4S E;  1S36 A;  1Y1X A;  3KF9 A;  4DIR A;  2ZN9 A;  4AQJ A;  1AHR A;  1JF2 A;  3D78 A;  2K7D A;  3OGN A;  4A4C A;  3S0E A;  3KEV A;  3QME A;  3CZ2 A;  4M2P A;  3S0F A;  2KYF A;  2MLF C;  1CFF A;  2QPT A;  2H2K A;  2K60 A;  5CSF A;  1CLM A;  2M0R A;  2AUC A;  1K95 A;  1SKT A;  2AMI A;  1QVI Y;  1ZFS A;  3F45 A;  3ZWH A;  3PM8 A;  3FWC A;  1LIN A;  1YX7 A;  1XFY O;  1IH0 A;  3QRX A;  2WCH A;  3D77 A;  1DEK A;  2COL B;  1BJF A;  4GFT A;  4KYN A;  4BY4 A;  2KI4 B;  3DD4 A;  4HRH A;  3OX6 A;  1OMD A;  2KHN A;  3VGO A;  1BR4 B;  1BU3 A;  1SNL A;  2G2B A;  2WC6 A;  2OPO A;  2KBM A;  1SCV A;  1WDC C;  2NCP A;  1DGU A;  4PDZ A;  1DJG A;  3E3R A;  4P2Y B;  1IIO A;  2B1U A;  1OMV A;  2PSR A;  4MSP A;  3SG6 A;  4NQG A;  4F7F A;  2OTG C;  2SCP A;  4GNK B;  3NSI A;  2JXL A;  3SIA A;  2F2P A;  1CMF A;  2JOJ A;  2KPH A;  4PE4 A;  1OMR A;  3TDI A;  1RTP 1;  3GOF A;  4YGE B;  1S6I A;  1IJ6 A;  1LKJ A;  2BKH B;  1DTL A;  3PN7 B;  1ALW A;  2CXJ A;  1SR6 C;  1GGW A;  4ZCV A;  1SPY A;  2LVI A;  2E6W A;  1IKU A;  2KOT A;  3HCM A;  3VRP A;  1TWO A;  3B88 A;  1NYA A;  1Y1A A;  2KQ6 A;  2M9G A;  2HQW A;  4WRI A;  1MQ1 A;  1TCO B;  1P28 A;  4NDD A;  2L5X B;  1NX1 A;  4INW A;  2BEC A;  1YUR A;  1Z4H A;  4PHK A;  1IRJ A;  5HLO A;  1RK9 A;  3IF7 A;  3TUY C;  1AK8 A;  1K2H A;  3HX4 A;  2QEV A;  2FCD A;  1K9U A;  4NDC A;  3EVR A;  1A29 A;  1M63 B;  1N0Y A;  3TS5 C;  1SBJ A;  3AKA A;  3K21 A;  1XFU O;  1DC1 A;  1JF0 A;  5I2L A;  1AVS A;  5ER4 X;  1JWD A;  1K9K A;  1Y6W A;  3NHI A;  2JWW A;  3UNW A;  1TRF A;  1KK8 C;  2LMV A;  1A2X A;  3I5H C;  3TDU A;  3D74 A;  2CCM A;  3D0Y A;  2QEB A;  4IL1 A;  4YGD B;  1KQV A;  1TNP A;  1F4O A;  2ERB A;  1HT9 A;  3WHU B;  2LP3 A;  4YGB B;  1SMG A;  2L4H A;  3I5G C;  3WXA A;  1SL8 A;  2A4J A;  5I94 A;  2WOR A;  3CAB A;  2KFF A;  3O4Y A;  1UHJ A;  5JJG A;  1L2O B;  2IS9 A;  1UHI A;  3CDN A;  3OX5 A;  5GQQ C;  2EGD A;  1FI5 A;  3B6X A;  1QJT A;  2NXQ A;  1QS7 A;  2O60 A;  4OKH A;  2HPS A;  2ZNE A;  3D75 A;  1AJ4 A;  3SJS A;  1OZS A;  1YVL A;  1CFC A;  1S1E A;  2K0J A;  2RGI A;  1DQE A;  1PVB A;  2EC6 C;  1G8I A;  3B7A A;  4PHM A;  1UUR A;  2FCE A;  2OS8 C;  1CFP A;  1REC A;  4GUK A;  1YVH A;  2JC2 A;  2LE9 B;  4MBE A;  1JC2 A;  2L2E A;  3S0G A;  1OOF A;  5D7F A;  3EKJ A;  2L98 A;  2CBL A;  3GK2 A;  1QLK A;  4DUQ A;  5B8I B;  1C7W A;  4OV2 A;  1N2D A;  4GPL B;  3BUO B;  3CR2 A;  3S0A A;  2KSP A;  1XK4 C;  1YR5 A;  1A75 A;  1KSO A;  3L4L A;  2JQ6 A;  2JUL A;  1DF0 B;  3AAK A;  3NSO A;  4INX A;  3NSK A;  1BR1 B;  3CZ1 A;  4N5X A;  1B47 A;  4MLW A;  1B8R A;  1LA3 A;  2HF5 A;  5F6T A;  2M8U A;  1J1E A;  4CFQ A;  2Y1N A;  3OB1 B;  1K90 D;  3CR5 X;  3DF0 B;  1IQ3 A;  1QVI Z;  1V1F A;  1KQM B;  1NX0 A;  2ZRS A;  1LVC D;  2LNK A;  1DJZ A;  2WOS A;  1W7J B;  1IWQ A;  1PRW A;  2LUX A;  1DJI A;  2NLN A;  3BOW A;  5AER A;  1H8B A;  1GQM A;  2KLD A;  1U5I B;  3BYA A;  1KK7 Z;  1SYM A;  1JFK A;  1KWO C;  5D3O A;  2K7O A;  1GGZ A;  1GM0 A;  2ZN8 A;  1PVA A;  2CT9 A;  3CZ0 A;  1NIW A;  1EJ3 A;  2JTT A;  3JTD C;  1SSE B;  2QEO A;  1YRT B;  1TUZ A;  3DXL A;  2JNF A;  3I5H B;  2JT3 A;  1YUT A;  2JZI A;  2WCL A;  4UPG A;  3AKB A;  2O5G A;  5FYX A;  3SG4 A;  1PAL A;  1UUS A;  1W9Z A;  2JU0 A;  3VRN A;  5HL1 A;  1F71 A;  4F0Z B;  3I5G B;  2LVJ A;  3WNX B;  1BF5 A;  1KK7 Y;  2KFH A;  2KBI A;  2KLE A;  3R72 A;  3LK0 A;  5I2Q A;  4PT1 A;  4TNC A;  4YRU A;  5CSI A;  1WRZ A;  1MUX A;  2H61 A;  4PHN A;  2MBX A;  4YGC B;  1OOH A;  1XVJ A;  5TNC A;  1DJX A;  4CPV A;  2L0P A;  1NX2 A;  1F55 A;  3FWB A;  1XFV O;  2ZRT A;  1RWY A;  1F70 A;  1EL4 A;  2M7N A;  2Q4U A;  4CFR A;  4XJK A;  1MXE A;  3NHT A;  5FI2 A;  3BFH A;  3V2L A;  2WND A;  3EK8 A;  2QDI A;  2F2O A;  2LMU A;  1SW8 A;  3A4U B;  1MHO A;  1LA0 A;  2DOQ A;  2M49 B;  3BUW B;  3I5F C;  3BFA A;  2BE4 A;  1YUU A;  3IQO A;  1XK4 A;  2E30 A;  4JQ0 D;  4YBH B;  4ORA B;  3RZS A;  2FJU B;  2I7A A;  3NXA A;  1AUI B;  2MHH A;  2BBM A;  3CZT X;  2VRG A;  2CTN A;  3PJI A;  1SCM C;  1XFX O;  2BKI B;  3IQQ A;  1QIW A;  4YGA A;  5J3X A;  1FF1 A;  1F54 A;  2F33 A;  2P71 A;  1QAS A;  2H8V A;  2MA2 A;  5CPV A;  3BFB A;  4JPZ B;  2LVV A;  4OCI A;  2WCK A;  1ZAC A;  1QX7 A;  2YGU A;  1EG3 A;  1M45 A;  4N1G A;  4FQT A;  3PFV A;  1R6P A;  4MN0 A;  2K2A A;  1CB1 A;  4CID A;  2PAS A;  1QX5 B;  2V53 A;  2BL0 C;  2K8M B;  1YX8 A;  4BY5 A;  1M46 A;  2WCE A;  1BOD A;  1G4Y R;  2M29 A;  3BXK A;  2WCJ A;  5AAN A;  5HYD A;  1M39 A;  1EXR A;  3I5I C;  1CDL A;  1NCX A;  1BMO A;  4MEW A;  4DCK A;  3A8R A;  1Y0V H;  2LAP A;  2PAL A;  3SIB A;  1JSA A;  5G08 A;  3OP0 A;  1DJH A;  2AAO A;  5HKZ A;  3JVT C;  4PE1 A;  2QEH A;  3VB1 A;  1GJY A;  1EG4 A;  2LLT A;  2BNX A;  3VRO A;  2L2C A;  5DKN A;  2KNE A;  3B87 A;  2KAX A;  5ER5 A;  1TNQ A;  1UHH A;  3D0Y B;  5EL2 A;  2JRF A;  1JUO A;  1J7R A;  1RFJ A;  2KI6 D;  1RRO A;  1F4Q A;  2M3W A;  2Q91 A;  3SS5 A;  2GTE A;  1KFU L;  2ZND A;  3AAJ A;  2WCB A;  3LCP C;  5DKR A;  1CKK A;  1IQ5 A;  3L47 A;  4MZK A;  1M31 A;  2K2F A;  1QXP A;  5FI6 A;  1WDC B;  2BBN A;  4ICB A;  2GV5 A;  3NGV A;  3DVE A;  2JPT A;  2LVK A;  2PRU A;  1PK0 D;  1B1G A;  4M2Q A;  1S3P A;  5HKW A;  1OOI X;  1AP4 A;  2KI4 C;  2OTG B;  2PYQ A;  1LXF C;  1B4C A;  1PSB A;  2KYC A;  3DYE A;  1NCZ A;  1CLB A;  1UHN A;  3O2P A;  2MRD A;  4GBA A;  3EK7 A;  2TN4 A;  3O78 A;  2LC5 A;  1E8A A;  1HQV A;  1SR6 B;  4M2O A;  5KSZ A;  2I2R E;  4JWQ A;  1AJ5 A;  2LHI A;  2LAN A;  4YI8 A;  1K94 A;  1TN4 A;  1MWN A;  3FIA A;  2M1U A;  3KO0 A;  4C0K A;  2BCX A;  4HRG A;  1A75 B;  1C07 A;  4R1E A;  1ZUZ A;  4L9M A;  4WQ3 A;  4PAL A;  1DGV A;  4I5N B;  3PN7 C;  4ORC B;  3CTN A;  1NCY A;  4I5L B;  2ZKM X;  1WLM A;  5BPJ A;  3SS4 A;  2KFG A;  3TUY B;  3OB2 B;  1QV0 A;  1OSA A;  1SRA A;  1OOG A;  2I18 A;  1LS8 A;  1ODB A;  2GGZ A;  4MZL A;  3CR4 X;  1WRL A;  3SG3 A;  2PQL A;  1J7Q A;  1ORG A;  1CM1 A;  1J7P A;  2BE6 A;  4MRX A;  3TS5 B;  1J7O A;  2G9B A;  3CYZ A;  2M97 A;  1XFW O;  4IJ7 A;  5D69 A;  1TIZ A;  1V1G A;  1MXL C;  2KAV A;  3BOW B;  4ZCU A;  1KK8 B;  1QX2 A;  1C7V A;  1S6C A;  1WRK A;  2F8P A;  4HRE E;  3FE9 A;  4MVF A;  1CMG A;  4JD9 A;  1KSM A;  1J55 A;  1K93 D;  2KQY A;  3NSL A;  3PAL A;  1BOC A;  1BT6 A;  1CDN A;  5HLV A;  4AQI A;  3CS1 A;  2L5Y A;  4GAO A;  2L50 A;  5DIC A;  1NPQ A;  1B9A A;  1WY9 A;  2BAP A;  1QTX A;  1YRU B;  2LP2 A;  4PCW A;  4AOM A;  4C0J A;  4OVN F;  1DJW A;  3S0D A;  1BLQ A;  2LV7 A;  2I94 A;  2LLU A;  2MJW B;  3OHM B;  1SY9 A;  5JOL A;  3EG5 B;  2Y5I A;  1J1D A;  4FTG A;  1KCY A;  1SL9 A;  4GGF C;  1PUL A;  1QV1 A;  2KAY A;  4ORB B;  4ETO A;  1CNP A;  2JPO A;  2PMY A;  1NX3 A;  1YTZ C;  1A03 A;  4A4B A;  4GGN A;  1CFD A;  3D10 A;  3FS7 A;  3DVM A;  5AFP A;  1N65 A;  3LL8 B;  1Y1U A;  2EC6 B;  3SG2 A;  4E68 A;  5FI7 A;  2KDH A;  2OS8 B;  1F8H A;  1L2O C;  1S26 D;  2LLS A;  3EVV A;  3IVT A;  1L7Z A;  4HSZ A;  4XJK B;  3DY9 A;  3UO9 A;  1WLZ A;  2WCM A;  1OOJ A;  2LM5 A;  4YI9 A;  1CTR A;  2NZ0 A;  1DVI A;  4PHJ A;  3M0W A;  2QAC A;  1S6J A;  2MAZ A;  1G33 A;  1KFU S;  4QJ5 B;  3LLE A;  4QJ4 B;  3DVJ A;  1DEL A;  4PE7 A;  1EH2 A;  1QWV A;  2K7C A;  3EVU A;  5HKY A;  1KFX L;  1SK6 D;  2K61 A;  4USL A;  1C3Y A;  1OE9 B;  1FPW A;  2ZFD A;  1FW4 A;  1IGV A;  1NSH A;  1SL7 A;  3BUM B;  3OBV A;  1C3Z A;  3SS3 A;  3DVK A;  2JXC A;  3TZ1 A;  1XYD A;  3D73 A;  3FE8 A;  5CSJ A;  4CLN A;  1VRK A;  2NCO A;  4DS7 A;  2LCP A;  1JBA A;  4OR9 B;  3EKH A;  1D1O A;  1NP8 A;  1DJY A;  2PVB A;  4I5K A;  2WC8 A;  2FOT A;  2MLE C;  3EK4 A;  5K89 A;  1S5G Z;  2P6B B;  3R1V A;  3RM1 A;  1KWO B;  1A4P A;  1TNW A;  2D8N A;  1ZOT B;  3C1V A;  4FQO A;  4MRY A;  1FBV A;  1JFJ A;  1K96 A;  1Q80 A;  2JT0 A;  2K7B A;  3SG7 A;  2ISD A;  3B86 A;  1KQM C;  2L4I A;  3JTD B;  1QIV A;  1XFZ O;  3N7H A;  1TOP A;  2M7L A;  2P70 A;  1W7I B;  1K8U A;  4OZD A;  4QJ3 B;  5AEQ A;  1OQP A;  3ICB A;  2EHB A;  1B8L A;  3KHE A;  3Q8I A;  1T14 A;  4D1E A;  4XYN A;  1CDM A;  2WCF A;  1MF8 B;  4U8D A;  3GK1 A;  1PSR A;  1NUB A;  3K1E A;  5I8N A;  1IG5 A;  1S5G Y;  4MZJ A;  4GGF A;  2CNP A;  1ALV A;  2SAS A;  2F3Y A;  2GGM A;  1B7T Z;  1H4B A;  1OZO A;  1BG1 A;  1TCF A;  2Y4Q A;  3L4A A;  5KTY A;  2R2I A;  1B8C A;  2LMT A;  3SG5 A;  4C0L A;  3WHT B;  1RJV A;  1TTX A;  2JT8 A;  2KGB C;  3O4X A;  4Q04 A;  1QAT A;  2Y1M A;  3GK4 X;  2L51 A;  1UHK A;  1K9P A;  3R1P A;  3I5F B;  1CLL A;  4I5J A;  4PE0 A;  3BUX B;  1UWO A;  3CGA A;  1IJ5 A;  1TUJ A;  1B7T Y;  1XFR A;  3BUN B;  5PAL A;  2H61 C;  1DT7 B;  3CWG A;  1CDP A;  3PSR A;  1MR8 A; 
#chains in the Genus database with same CATH homology
 3PAT A;  3MSE B;  2KGR A;  2LUC A;  1QLS A;  3KPX A;  1SCM B;  3LK1 A;  1UP5 A;  2KI6 C;  2HET A;  1TNX A;  1X02 A;  2BCB A;  1DF0 A;  1XO5 A;  4N1F A;  3RLZ A;  2JTZ A;  4WQ2 A;  1FI6 A;  3BQ3 A;  2BL0 B;  2LHL A;  3PLF B;  2JNX A;  5DKQ A;  4DRW A;  1R2U A;  3DF0 A;  4P5O E;  1NWD A;  1ZMZ A;  3I5I B;  1CM4 A;  5IBW A;  1DMO A;  5I2O A;  5CSN A;  1YUS A;  1XA5 A;  5AXI A;  2HQ8 A;  3JVT B;  3VRR A;  3ZNI A;  3VRQ A;  1KFX S;  1U5I A;  5KU1 A;  3O6B A;  3TDZ A;  2M1K B;  2F3Z A;  2BCA A;  3CLN A;  4NDB A;  3KF9 A;  3H4S E;  1S36 A;  1Y1X A;  4DIR A;  2ZN9 A;  4AQJ A;  1AHR A;  1JF2 A;  2K7D A;  4A4C A;  3KEV A;  4M2P A;  1CFF A;  2KYF A;  2MLF C;  2QPT A;  2H2K A;  5CSF A;  1CLM A;  2M0R A;  2AUC A;  1K95 A;  1SKT A;  2AMI A;  1QVI Y;  1ZFS A;  3F45 A;  3ZWH A;  3PM8 A;  3FWC A;  1LIN A;  1YX7 A;  1XFY O;  1IH0 A;  3QRX A;  2COL B;  1BJF A;  4GFT A;  4BY4 A;  2KI4 B;  3DD4 A;  4HRH A;  3OX6 A;  1OMD A;  2KHN A;  3VGO A;  1BR4 B;  1BU3 A;  1SNL A;  2G2B A;  2OPO A;  2KBM A;  1SCV A;  1WDC C;  2NCP A;  1DGU A;  4PDZ A;  1DJG A;  3E3R A;  4P2Y B;  2B1U A;  1OMV A;  2PSR A;  4MSP A;  3SG6 A;  4NQG A;  2OTG C;  2SCP A;  4GNK B;  3NSI A;  2JXL A;  3SIA A;  2F2P A;  1CMF A;  2JOJ A;  4PE4 A;  3TDI A;  1OMR A;  1RTP 1;  3GOF A;  4YGE B;  1S6I A;  1IJ6 A;  1LKJ A;  2BKH B;  1DTL A;  3PN7 B;  1ALW A;  2CXJ A;  1SR6 C;  1GGW A;  4ZCV A;  1SPY A;  2LVI A;  2E6W A;  1IKU A;  2KOT A;  3HCM A;  3VRP A;  1NYA A;  1Y1A A;  2KQ6 A;  2M9G A;  2HQW A;  4WRI A;  1MQ1 A;  1TCO B;  4NDD A;  2L5X B;  1NX1 A;  2BEC A;  1YUR A;  4PHK A;  5HLO A;  1IRJ A;  3TUY C;  1RK9 A;  3IF7 A;  1AK8 A;  1K2H A;  3HX4 A;  2FCD A;  1K9U A;  4NDC A;  3EVR A;  1A29 A;  1M63 B;  1N0Y A;  3TS5 C;  1SBJ A;  3AKA A;  3K21 A;  1XFU O;  1JF0 A;  5I2L A;  1AVS A;  5ER4 X;  1JWD A;  1K9K A;  1Y6W A;  2JWW A;  1TRF A;  1KK8 C;  2LMV A;  1A2X A;  3I5H C;  3TDU A;  2CCM A;  3D0Y A;  4IL1 A;  4YGD B;  1KQV A;  1TNP A;  1F4O A;  1HT9 A;  3WHU B;  2LP3 A;  4YGB B;  1SMG A;  2L4H A;  3I5G C;  3WXA A;  1SL8 A;  2A4J A;  2WOR A;  2KFF A;  3O4Y A;  1UHJ A;  5JJG A;  1L2O B;  2IS9 A;  1UHI A;  3OX5 A;  5GQQ C;  2EGD A;  1FI5 A;  1QJT A;  2NXQ A;  1QS7 A;  2O60 A;  4OKH A;  2HPS A;  2ZNE A;  1AJ4 A;  3SJS A;  1OZS A;  1YVL A;  1CFC A;  1S1E A;  2K0J A;  2RGI A;  2EC6 C;  1PVB A;  1G8I A;  4PHM A;  1UUR A;  2FCE A;  2OS8 C;  1CFP A;  1REC A;  4GUK A;  1YVH A;  2JC2 A;  2LE9 B;  4MBE A;  1JC2 A;  2L2E A;  5D7F A;  3EKJ A;  2L98 A;  2CBL A;  3GK2 A;  1QLK A;  4DUQ A;  5B8I B;  1C7W A;  4OV2 A;  1N2D A;  4GPL B;  3BUO B;  3CR2 A;  2KSP A;  1XK4 C;  1YR5 A;  1A75 A;  1KSO A;  2JQ6 A;  2JUL A;  1DF0 B;  3AAK A;  3NSO A;  3NSK A;  1BR1 B;  4N5X A;  1B47 A;  4MLW A;  1B8R A;  1LA3 A;  2HF5 A;  5F6T A;  2M8U A;  1J1E A;  4CFQ A;  2Y1N A;  3OB1 B;  1K90 D;  3CR5 X;  3DF0 B;  1IQ3 A;  1QVI Z;  1V1F A;  1KQM B;  1NX0 A;  2ZRS A;  1LVC D;  2LNK A;  1DJZ A;  2WOS A;  1W7J B;  1IWQ A;  1PRW A;  2LUX A;  1DJI A;  2NLN A;  3BOW A;  5AER A;  1H8B A;  1GQM A;  1U5I B;  3BYA A;  1KK7 Z;  1SYM A;  1JFK A;  1KWO C;  2K7O A;  1GGZ A;  2ZN8 A;  1PVA A;  2CT9 A;  1NIW A;  1EJ3 A;  2JTT A;  3JTD C;  1YRT B;  2JNF A;  3I5H B;  2JT3 A;  1YUT A;  2JZI A;  4UPG A;  3AKB A;  2O5G A;  5FYX A;  3SG4 A;  1PAL A;  1UUS A;  2JU0 A;  3VRN A;  1F71 A;  4F0Z B;  3I5G B;  2LVJ A;  3WNX B;  1BF5 A;  1KK7 Y;  2KFH A;  2KBI A;  3LK0 A;  5I2Q A;  4TNC A;  4YRU A;  5CSI A;  1WRZ A;  1MUX A;  2H61 A;  4PHN A;  2MBX A;  4YGC B;  1XVJ A;  5TNC A;  1DJX A;  4CPV A;  2L0P A;  1NX2 A;  1F55 A;  3FWB A;  1XFV O;  2ZRT A;  1RWY A;  1F70 A;  1EL4 A;  2M7N A;  2Q4U A;  4CFR A;  4XJK A;  1MXE A;  2WND A;  3EK8 A;  2F2O A;  2LMU A;  1SW8 A;  3A4U B;  1MHO A;  1LA0 A;  2DOQ A;  2M49 B;  3BUW B;  3I5F C;  2BE4 A;  1YUU A;  3IQO A;  1XK4 A;  2E30 A;  4JQ0 D;  4YBH B;  4ORA B;  2FJU B;  2I7A A;  3NXA A;  1AUI B;  2MHH A;  2BBM A;  3CZT X;  2VRG A;  2CTN A;  1SCM C;  1XFX O;  2BKI B;  3IQQ A;  1QIW A;  4YGA A;  5J3X A;  1FF1 A;  1F54 A;  2F33 A;  1QAS A;  2MA2 A;  5CPV A;  4JPZ B;  2LVV A;  4OCI A;  1ZAC A;  1QX7 A;  4N1G A;  1EG3 A;  1M45 A;  3PFV A;  1R6P A;  4MN0 A;  2K2A A;  1CB1 A;  4CID A;  2PAS A;  1QX5 B;  2V53 A;  2BL0 C;  2K8M B;  1YX8 A;  4BY5 A;  1M46 A;  2WCE A;  1BOD A;  1G4Y R;  2M29 A;  3BXK A;  5AAN A;  5HYD A;  1M39 A;  1EXR A;  3I5I C;  1CDL A;  1NCX A;  1BMO A;  4MEW A;  4DCK A;  3A8R A;  1Y0V H;  2LAP A;  2PAL A;  3SIB A;  1JSA A;  5G08 A;  3OP0 A;  1DJH A;  2AAO A;  5HKZ A;  3JVT C;  4PE1 A;  1GJY A;  1EG4 A;  2LLT A;  3VRO A;  5DKN A;  2KNE A;  5ER5 A;  2KAX A;  1TNQ A;  1UHH A;  3D0Y B;  2JRF A;  1JUO A;  1J7R A;  1RFJ A;  2KI6 D;  1RRO A;  1F4Q A;  2M3W A;  2Q91 A;  1KFU L;  2ZND A;  3AAJ A;  2WCB A;  3LCP C;  5DKR A;  1CKK A;  1IQ5 A;  4MZK A;  1M31 A;  2K2F A;  1QXP A;  1WDC B;  2BBN A;  4ICB A;  2GV5 A;  3DVE A;  2JPT A;  2LVK A;  2PRU A;  1PK0 D;  1B1G A;  4M2Q A;  1S3P A;  5HKW A;  1AP4 A;  1B4C A;  2KI4 C;  2OTG B;  1LXF C;  1PSB A;  2KYC A;  1NCZ A;  1CLB A;  1UHN A;  3O2P A;  2MRD A;  4GBA A;  3EK7 A;  2TN4 A;  3O78 A;  2LC5 A;  1E8A A;  1HQV A;  1SR6 B;  4M2O A;  5KSZ A;  2I2R E;  4JWQ A;  1AJ5 A;  2LHI A;  2LAN A;  4YI8 A;  1K94 A;  1TN4 A;  1MWN A;  3FIA A;  2M1U A;  3KO0 A;  4C0K A;  2BCX A;  4HRG A;  1A75 B;  1C07 A;  4R1E A;  1ZUZ A;  4L9M A;  4WQ3 A;  4PAL A;  1DGV A;  4I5N B;  3PN7 C;  4ORC B;  3CTN A;  1NCY A;  4I5L B;  2ZKM X;  1WLM A;  5BPJ A;  2KFG A;  3TUY B;  3OB2 B;  1QV0 A;  1OSA A;  1SRA A;  2I18 A;  1ODB A;  2GGZ A;  4MZL A;  3CR4 X;  1WRL A;  3SG3 A;  1J7Q A;  1CM1 A;  1J7P A;  2BE6 A;  4MRX A;  3TS5 B;  1J7O A;  2G9B A;  2M97 A;  1XFW O;  5D69 A;  1TIZ A;  1V1G A;  1MXL C;  2KAV A;  3BOW B;  4ZCU A;  1KK8 B;  1QX2 A;  1C7V A;  1S6C A;  1WRK A;  2F8P A;  4HRE E;  4MVF A;  1CMG A;  1KSM A;  1J55 A;  1K93 D;  2KQY A;  3NSL A;  3PAL A;  1BOC A;  1BT6 A;  1CDN A;  5HLV A;  4AQI A;  3CS1 A;  4GAO A;  2L50 A;  1NPQ A;  1B9A A;  1WY9 A;  1QTX A;  1YRU B;  2LP2 A;  4PCW A;  4AOM A;  4C0J A;  4OVN F;  1DJW A;  1BLQ A;  2LV7 A;  2I94 A;  2LLU A;  2MJW B;  3OHM B;  1SY9 A;  5JOL A;  2Y5I A;  1J1D A;  4FTG A;  1KCY A;  1SL9 A;  4GGF C;  1PUL A;  1QV1 A;  2KAY A;  4ORB B;  4ETO A;  1CNP A;  2PMY A;  1NX3 A;  1YTZ C;  1A03 A;  4A4B A;  4GGN A;  1CFD A;  3D10 A;  3FS7 A;  3DVM A;  5AFP A;  1N65 A;  3LL8 B;  1Y1U A;  2EC6 B;  3SG2 A;  4E68 A;  2KDH A;  2OS8 B;  1F8H A;  1L2O C;  1S26 D;  2LLS A;  3EVV A;  1L7Z A;  4HSZ A;  4XJK B;  1WLZ A;  1OOJ A;  2LM5 A;  4YI9 A;  1CTR A;  2NZ0 A;  1DVI A;  4PHJ A;  3M0W A;  2QAC A;  1S6J A;  2MAZ A;  1G33 A;  1KFU S;  4QJ5 B;  3LLE A;  4QJ4 B;  3DVJ A;  4PE7 A;  1EH2 A;  2K7C A;  3EVU A;  5HKY A;  1KFX L;  1SK6 D;  2K61 A;  4USL A;  1OE9 B;  1FPW A;  2ZFD A;  1FW4 A;  1IGV A;  1NSH A;  1SL7 A;  3BUM B;  3DVK A;  2JXC A;  3TZ1 A;  1XYD A;  5CSJ A;  4CLN A;  1VRK A;  2NCO A;  4DS7 A;  2LCP A;  1JBA A;  4OR9 B;  3EKH A;  1D1O A;  1NP8 A;  1DJY A;  2PVB A;  4I5K A;  2WC8 A;  2FOT A;  2MLE C;  3EK4 A;  5K89 A;  1S5G Z;  2P6B B;  3RM1 A;  1KWO B;  1A4P A;  1TNW A;  2D8N A;  1ZOT B;  3C1V A;  4FQO A;  4MRY A;  1FBV A;  1JFJ A;  1K96 A;  1Q80 A;  2JT0 A;  2K7B A;  3SG7 A;  2ISD A;  1KQM C;  2L4I A;  3JTD B;  1QIV A;  1XFZ O;  1TOP A;  2M7L A;  1W7I B;  1K8U A;  4QJ3 B;  5AEQ A;  1OQP A;  3ICB A;  2EHB A;  1B8L A;  3KHE A;  4D1E A;  4XYN A;  1CDM A;  2WCF A;  1MF8 B;  4U8D A;  3GK1 A;  1PSR A;  1NUB A;  5I8N A;  1IG5 A;  1S5G Y;  4MZJ A;  4GGF A;  2CNP A;  1ALV A;  2SAS A;  2F3Y A;  2GGM A;  1B7T Z;  1H4B A;  1OZO A;  1BG1 A;  1TCF A;  2Y4Q A;  5KTY A;  2R2I A;  1B8C A;  2LMT A;  3SG5 A;  4C0L A;  3WHT B;  1RJV A;  1TTX A;  2JT8 A;  2KGB C;  4Q04 A;  1QAT A;  2Y1M A;  3GK4 X;  2L51 A;  1UHK A;  1K9P A;  4I5J A;  3I5F B;  1CLL A;  4PE0 A;  3BUX B;  1UWO A;  3CGA A;  1IJ5 A;  1B7T Y;  5PAL A;  3BUN B;  2H61 C;  1DT7 B;  3CWG A;  1CDP A;  3PSR A;  1MR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...