5AEQA

Neuronal calcium sensor (ncs-1)from rattus norvegicus
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
188
structure length
172
Chain Sequence
b'GKSNSKLKPEVVEELTRKTYFTEKEVQQWYKGFIKDCPSGQLDAAGFQKDPTKFATFVFNVFDENKDGRIEFSEFIQALSVTSRGTLDEKLRWAFKLYDLDNDGYITRNEMLDIVDAIYQMPEEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEURONAL CALCIUM SENSOR 1
publication title Neuronal Calcium Sensor-1 Binds the D2 Dopamine Receptor and G-Protein-Coupled Receptor Kinase 1 (Grk1) Peptides Using Different Modes of Interactions.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 67
structure length 172
sequence length 188
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5aeqA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5aeqA02
3OX5A 3CTNA 2HETA 1KQVA 1IJ6A 4YI9A 4E68A 5K89A 2L4IA 1MXLC 2KFHA 3D0YA 5HKWA 3JTDB 1LXFC 1TIZA 2PMYA 3I5IC 2CXJA 4PHMA 5D7FA 5HKYA 1B9AA 2BCAA 2I7AA 1QATA 2KFFA 2ZRTA 1TCOB 1SL8A 3EVUA 2JWWA 1KK7Y 5HYDA 2LHLA 3TUYC 1XO5A 4FQOA 1CDMA 3TDZA 3BQ3A 1F54A 4MN0A 5CSNA 4C0KA 2F8PA 2GGZA 1H4BA 2KOTA 2L0PA 1WRZA 1SCMB 4GAOA 1FW4A 2MBXA 1JFKA 2K7DA 1QJTA 2BCXA 3SG5A 1XFXO 2WCEA 2PASA 1DGVA 1KQMC 5CPVA 1S5GY 1LINA 2KAXA 3DD4A 4YGCB 1YRTB 4OCIA 1GJYA 4DRWA 3GK2A 3A4UB 3TS5C 1WDCC 2GGMA 3PFVA 2LMTA 2KI4C 4PHJA 2ZNDA 2WC8A 4PE0A 4QJ5B 4OVNF 2B1UA 1JSAA 2BECA 1NP8A 1F70A 1QV1A 4MVFA 1K94A 1KFUS 1ZFSA 1ZOTB 4U8DA 1CLBA 2M9GA 2WNDA 4YGAA 4YRUA 2K0JA 1J7RA 1L2OB 1OOJA 2PRUA 2BL0C 2ZNEA 1BR1B 1YTZC 2LP3A 1IRJA 4PALA 1OZSA 5DKRA 4PHNA 2BCBA 1CFPA 1NIWA 2O5GA 3BOWB 1QS7A 2E30A 1DGUA 4ICBA 2R2IA 3PN7C 2MRDA 3BXKA 4GBAA 1AK8A 1NX3A 3FS7A 1RJVA 4GGFA 4PCWA 1JUOA 1K9KA 2F3ZA 2KYFA 2BBNA 3AKAA 5AXIA 1YURA 2LCPA 3FIAA 2F2OA 2ZKMX 4M2PA 1EL4A 3SG7A 2BE4A 5AFPA 1C7WA 1KFXL 1QIVA 3AAKA 3PALA 1NPQA 1OMDA 2MLFC 4MRXA 1PVAA 2WCFA 3CLNA 1NSHA 3DVKA 1A2XA 1QLSA 1S5GZ 1TCFA 2HQWA 1CFCA 1SNLA 2M97A 3ICBA 2D8NA 4Q04A 2ZN9A 5I2QA 1JWDA 1QX5B 1YR5A 4MZLA 1LA0A 2H61C 3C1VA 3I5IB 4PDZA 1J7QA 4OKHA 1NWDA 4WQ2A 2ZRSA 4JWQA 1GGWA 3NXAA 2CCMA 1AHRA 3NSOA 1F55A 3OX6A 1DJXA 1UHKA 2IS9A 4WRIA 3EKJA 2G9BA 1K96A 1K2HA 1Y1XA 5GQQC 3DVJA 1DJGA 1DF0A 2FJUB 3LLEA 1AP4A 5HLVA 1DJYA 2F33A 1OSAA 1QTXA 1TNPA 3D10A 2E6WA 2LLSA 1SYMA 1PVBA 2MA2A 2Y4QA 3LL8B 4P5OE 3LK1A 2KSPA 1SPYA 3DF0B 1LKJA 1CM1A 1DTLA 1RTP1 2JTTA 2JZIA 3SG2A 5CSFA 1CKKA 1A29A 2JT3A 2I18A 4OV2A 2M29A 2I2RE 1SBJA 2P6BB 2OS8C 3CS1A 3I5GC 1MR8A 5AEQA 1ALWA 1CTRA 1KWOC 3JVTC 1YVLA 1RWYA 2LAPA 3VRNA 3WNXB 2WORA 1Y1AA 1BODA 1IH0A 3MSEB 1J7PA 1F4QA 1QLKA 3LCPC 5J3XA 1J7OA 2EHBA 1MHOA 1V1GA 2ZN8A 2K2AA 3CR2A 2L5XB 1ODBA 1K9PA 2HPSA 3HCMA 4MSPA 2LE9B 2L98A 2LANA 3O6BA 1N0YA 5D69A 2Y1MA 3NSIA 5ER5A 4A4BA 1JFJA 1R2UA 1BU3A 3EK4A 3BOWA 1UP5A 2OTGC 1W7IB 3CR5X 3PN7B 1PRWA 1JF2A 4I5LB 2BKIB 1BJFA 5DKQA 2L4HA 1EG4A 1SR6C 3CWGA 1PK0D 2L2EA 4DS7A 2LVKA 1NX2A 2H2KA 3EVRA 1S1EA 2A4JA 5JOLA 2EC6C 1IGVA 1OE9B 2KHNA 1TN4A 3VRRA 3DVEA 2JXCA 1IG5A 2LVIA 1KSMA 1B7TY 2ISDA 4OR9B 1SK6D 1CDLA 4UPGA 1Y1UA 4YGBB 4HRHA 3BUWB 3EK8A 1PULA 1K95A 1MUXA 4ZCVA 1A75B 2RGIA 4HSZA 5AANA 1MF8B 5KTYA 1M46A 1NYAA 2Q4UA 1BF5A 1TNXA 2KAYA 2K8MB 1CMFA 2NCOA 2O60A 1Y0VH 2KAVA 2V53A 4N1FA 1CFDA 4GGFC 1FI5A 3I5HC 1BR4B 2M0RA 1KK8B 3GK1A 1RFJA 1TNQA 3O4YA 1TTXA 3KPXA 3NSLA 1K8UA 4FTGA 1ZMZA 1IQ5A 3GOFA 3ZNIA 1XFUO 4NDCA 4QJ3B 1CLMA 1W7JB 4L9MA 1K90D 3WHUB 2L51A 2LLUA 1IWQA 3EK7A 2K7OA 4MEWA 2CT9A 3F45A 3PATA 2KBIA 1FI6A 1KK7Z 1XK4A 4I5KA 1M39A 1XFWO 1Y6WA 2JPTA 3DF0A 4I5JA 3JTDC 4NQGA 3M0WA 4GUKA 2F2PA 2OS8B 3I5GB 2NLNA 4CPVA 1XA5A 2LVVA 1DT7B 1QIWA 1QVIY 4XJKB 1NCYA 1KCYA 3SIBA 1SY9A 4HREE 1BOCA 3CGAA 1VRKA 2CNPA 2M7LA 4I5NB 1B7TZ 1JF0A 1M63B 3OP0A 3RLZA 1R6PA 1F4OA 1SCMC 3SG4A 1SL9A 1ZUZA 1QX7A 4M2OA 2F3YA 4PHKA 2JRFA 1B8CA 1UURA 4JQ0D 4MZJA 1DJWA 4YGDB 3WHTB 5KSZA 1BG1A 4ORBB 3TUYB 2LC5A 4MZKA 1YUUA 2FCDA 1X02A 4IL1A 3VRPA 1KFXS 1PSBA 3BUOB 1S6CA 3IQOA 4CIDA 5DKNA 3BUMB 1B4CA 2AUCA 3QRXA 2VRGA 3WXAA 2JT8A 1KQMB 1OMVA 1B8RA 4R1EA 3VROA 1UHIA 1ZACA 1GGZA 1XVJA 4MLWA 2JT0A 1SRAA 3VRQA 1LA3A 3TS5B 1B8LA 1WDCB 3PLFB 1AJ5A 1G8IA 1UHHA 1GQMA 2KI4B 1BT6A 1G33A 5TNCA 4PE7A 5JJGA 2AAOA 1H8BA 1J55A 1U5IB 1QXPA 4YI8A 2TN4A 3KF9A 3OB2B 2JC2A 2PVBA 3SIAA 1XFYO 3ZWHA 2M1KB 3BUXB 1Q80A 2AMIA 1CMGA 3AKBA 2BL0B 4C0LA 3I5HB 3SJSA 2M1UA 1YUTA 1QASA 1LVCD 2LLTA 2M3WA 5G08A 1S6JA 1TOPA 1CDNA 4CFRA 5I2LA 3VGOA 1BMOA 1AVSA 1S6IA 1EJ3A 2LM5A 3LK0A 4DCKA 2L50A 1MWNA 2DOQA 4MBEA 1S3PA 4YBHB 4N5XA 1RECA 4QJ4B 4USLA 1DJHA 5KU1A 2FOTA 2SASA 2KNEA 3FWBA 3OHMB 1J1EA 1OMRA 2MJWB 5F6TA 1YX7A 2JNFA 2FCEA 1UUSA 1NUBA 4N1GA 3O78A 4AQIA 4F0ZB 5ER4X 3PSRA 4AOMA 2M7NA 4NDDA 2NCPA 1B1GA 4MRYA 3KHEA 1K9UA 1SL7A 4JPZB 1IKUA 1NCXA 1KFUL 2MAZA 3IQQA 4XJKA 1CM4A 1F71A 1A03A 1BLQA 2LUXA 4PE1A 1WLMA 1DF0B 1WRLA 1DMOA 1EG3A 3EKHA 2KDHA 2KI6C 3IF7A 1HQVA 2K7BA 5PALA 2KQYA 1FF1A 2JQ6A 2MLEC 2COLB 1C07A 1XK4C 1NX1A 2JU0A 1QX2A 1NX0A 1K93D 2KI6D 2SCPA 1J1DA 5CSIA 3CR4X 1DJZA 1MQ1A 2K2FA 2Q91A 3I5FC 2JULA 4ORAB 3E3RA 1PALA 2HF5A 3HX4A 2M8UA 2KGBC 2LUCA 1NCZA 2KYCA 3BYAA 1G4YR 1XFVO 1SMGA 4YGEB 1AJ4A 3D0YB 1XYDA 2K7CA 4WQ3A 1AUIB 2NZ0A 2LMVA 4M2QA 1TNWA 1SCVA 1KSOA 3TZ1A 1YX8A 3TDIA 3K21A 1F8HA 1E8AA 2CTNA 3NSKA 4C0JA 3BUNB 3OB1B 2MHHA 1U5IA 5I2OA 1KWOB 3JVTB 1WLZA 3AAJA 1TRFA 1IJ5A 1CFFA 2LNKA 1YRUB 3O2PA 4ORCB 4CLNA 4ZCUA 1M45A 1L7ZA 4GFTA 2LMUA 3A8RA 2BKHB 1D1OA 1RROA 1A4PA 2QPTA 2LP2A 2Y1NA 2ZFDA 2JTZA 1EXRA 2CBLA 2JOJA 2KQ6A 3KEVA 2I94A 3KO0A 2LV7A 3SG3A 1HT9A 1S26D 5HKZA 1OQPA 1WY9A 2KBMA 1B47A 1JC2A 2OTGB 4GPLB 5BPJA 1DJIA 3RM1A 4ETOA 1SR6B 1UWOA 3TDUA 2LHIA 1CLLA 2JNXA 3H4SE 4NDBA 4DIRA 1XFZO 2KFGA 3EVVA 5FYXA 1EH2A 3PM8A 1JBAA 2EC6B 3GK4X 1SKTA 4CFQA 1S36A 4A4CA 5HLOA 1M31A 1YUSA 4GGNA 1L2OC 5I8NA 1N65A 2WOSA 4PE4A 1FBVA 4GNKB 1KK8C 1MXEA 3CZTX 2QACA 3SG6A 1PSRA 1QV0A 2KGRA 2LVJA 1DVIA 2WCBA 1A75A 2PALA 5AERA 2BBMA 1FPWA 4TNCA 2H61A 4HRGA 3DVMA 1CNPA 1YVHA 4DUQA 5CSJA 3FWCA 1CB1A 1ALVA 1UHJA 2EGDA 2Y5IA 1QVIZ 4P2YB 1UHNA 1OZOA 2K61A 2OPOA 2HQ8A 4AQJA 4XYNA 2M49B 1N2DA 2GV5A 2JXLA 2NXQA 1C7VA 1WRKA 1CDPA 2G2BA 4BY5A 2BE6A 3I5FB 1V1FA 5IBWA 4BY4A 1SW8A 2PSRA 5B8IB 1IQ3A 1RK9A 4D1EA
chains in the Genus database with same CATH superfamily
3OX5A 3CTNA 2HETA 1KQVA 1IJ6A 4YI9A 4E68A 5K89A 2L4IA 1MXLC 2KFHA 3D0YA 5HKWA 1SSEB 3DYEA 3JTDB 1LXFC 1TIZA 2PMYA 3SS3A 3I5IC 2CXJA 4PHMA 5D7FA 5HKYA 1B9AA 2BCAA 2YGUA 2I7AA 2WCKA 1QATA 2KFFA 2ZRTA 4JD9A 1TCOB 1SL8A 3EVUA 2JWWA 1KK7Y 5HYDA 2LHLA 3TUYC 1XO5A 4FQOA 1CDMA 3TDZA 3BQ3A 1F54A 4MN0A 5CSNA 4C0KA 2F8PA 2GGZA 1H4BA 2KOTA 2L0PA 1WRZA 1SCMB 4GAOA 1FW4A 2MBXA 1JFKA 2K7DA 1QJTA 2BCXA 3SG5A 1TUZA 1XFXO 2WCEA 2PASA 1DGVA 1KQMC 5CPVA 1S5GY 2WCMA 1LINA 2KAXA 3DD4A 4YGCB 1YRTB 4OCIA 1GJYA 4DRWA 3GK2A 3A4UB 3TS5C 1WDCC 2GGMA 3PFVA 1OW4A 2LMTA 2KI4C 3B86A 4PHJA 2ZNDA 2WC8A 2FJYA 4PE0A 4OVNF 4QJ5B 2B1UA 1JSAA 2BECA 1NP8A 1F70A 1QV1A 4MVFA 1K94A 1KFUS 1ZOTB 1XFRA 1ZFSA 4U8DA 1CLBA 2M9GA 2WNDA 3OBVA 4YGAA 4YRUA 2K0JA 1J7RA 1L2OB 1OOJA 2PRUA 2BL0C 1C3YA 2ZNEA 1BR1B 1YTZC 2LP3A 1IRJA 4PALA 1OZSA 5DKRA 4PHNA 2WCLA 2BCBA 1CFPA 1NIWA 2O5GA 3BFAA 3BOWB 3CDNA 1QS7A 2E30A 1DGUA 4ICBA 2R2IA 2WC5A 3PN7C 2MRDA 3BXKA 4GBAA 1AK8A 3DZTA 3SS4A 1NX3A 3FS7A 1RJVA 4GGFA 4PCWA 1JUOA 1K9KA 2F3ZA 2KYFA 2BBNA 3AKAA 3EG5B 5AXIA 1YURA 2LCPA 3FIAA 2F2OA 2ZKMX 4M2PA 1EL4A 3OGNA 2BE4A 3SG7A 5AFPA 5EL2A 1C7WA 1KFXL 1QIVA 3AAKA 3PALA 1NPQA 1OMDA 2MLFC 3L4AA 4MRXA 1PVAA 2WCFA 3CLNA 1NSHA 3DVKA 4INXA 1A2XA 3L47A 1QLSA 1S5GZ 1TCFA 2HQWA 1CFCA 1SNLA 2M97A 1IIOA 3ICBA 2D8NA 4Q04A 2ZN9A 5I2QA 1JWDA 1QX5B 1YR5A 4MZLA 1LA0A 2H61C 3C1VA 3I5IB 4PDZA 1J7QA 4OKHA 1NWDA 4WQ2A 3K1EA 2ZRSA 4JWQA 1GGWA 3NXAA 2CCMA 1AHRA 3NSOA 1F55A 2L5YA 3OX6A 1DJXA 1UHKA 2IS9A 3R72A 4WRIA 5HL1A 3EKJA 2G9BA 1K96A 1K2HA 1Y1XA 3O4XA 5FI6A 5GQQC 3DVJA 1DJGA 1DF0A 2FJUB 3LLEA 1AP4A 5HLVA 2P71A 1DJYA 2F33A 1OSAA 1QTXA 1TNPA 3D10A 2E6WA 1OOIX 2KLDA 2LLSA 4JKTA 1SYMA 1PVBA 2MA2A 2Y4QA 3LL8B 4P5OE 3LK1A 3DXLA 2KSPA 1SPYA 2QEHA 3DF0B 5FI2A 1LKJA 1CM1A 1DTLA 1RTP1 2JTTA 2JZIA 3SG2A 5CSFA 1CKKA 1A29A 2JT3A 2L2CA 2I18A 4OV2A 2M29A 2I2RE 1SBJA 2P6BB 2OS8C 3CS1A 3I5GC 1MR8A 5AEQA 1ALWA 2QEVA 2WCJA 1W9ZA 1CTRA 1KWOC 3JVTC 1YVLA 1RWYA 2LAPA 3VRNA 3WNXB 2WORA 1Y1AA 1BODA 1IH0A 3MSEB 1J7PA 1F4QA 4F7FA 1QLKA 3LCPC 5J3XA 1J7OA 2EHBA 1MHOA 1V1GA 2ZN8A 2K2AA 3CR2A 2L5XB 1ODBA 1K9PA 2HPSA 3HCMA 4MSPA 3B88A 2LE9B 2L98A 3SS5A 2LANA 2KLEA 3O6BA 1N0YA 1DC1A 5D69A 2Y1MA 3NSIA 5ER5A 4A4BA 1JFJA 1R2UA 1BU3A 2BAPA 2ERBA 2WC6A 3EK4A 3BOWA 1UP5A 2OTGC 1W7IB 1OOHA 1Z2CB 3CR5X 1PRWA 1JF2A 2K60A 2BKIB 1BJFA 3PN7B 4I5LB 5DKQA 2L4HA 1EG4A 1SR6C 1DQEA 3CWGA 1PK0D 2L2EA 4DS7A 2LVKA 1NX2A 2H2KA 3EVRA 1S1EA 2A4JA 5JOLA 2EC6C 1IGVA 1OE9B 2KHNA 1TN4A 3VRRA 3DVEA 2H8VA 2JXCA 3B87A 1IG5A 2LVIA 1KSMA 1B7TY 2ISDA 4OR9B 1SK6D 1CDLA 4UPGA 1Y1UA 4YGBB 2JPOA 4HRHA 3BUWB 3EK8A 1PULA 1QWVA 1K95A 1MUXA 4ZCVA 1A75B 2RGIA 4HSZA 5AANA 1MF8B 5KTYA 1M46A 1NYAA 2Q4UA 1BF5A 1TNXA 2KAYA 2K8MB 1CMFA 2NCOA 2O60A 1Y0VH 2KAVA 2V53A 4N1FA 1CFDA 4GGFC 3BJHA 1FI5A 3I5HC 5D3OA 1BR4B 2M0RA 1KK8B 3GK1A 2BNXA 1RFJA 1TNQA 3O4YA 1TTXA 3KPXA 3NSLA 1K8UA 4FTGA 1TUJA 2KPHA 1ZMZA 1C3ZA 3B6XA 1IQ5A 3GOFA 3ZNIA 1XFUO 4NDCA 4QJ3B 1CLMA 1W7JB 2QEBA 1K90D 4L9MA 3WHUB 2L51A 3FE6A 2LLUA 1IWQA 3EK7A 2K7OA 4MEWA 2CT9A 3F45A 3PATA 2KBIA 4FQTA 1FI6A 1KK7Z 1XK4A 3QMEA 4I5KA 1M39A 1XFWO 1Y6WA 2JPTA 3DF0A 4I5JA 3JTDC 4NQGA 3M0WA 4GUKA 2F2PA 2OS8B 3FE9A 3I5GB 3S0AA 2NLNA 1OOFA 4CPVA 3S0GA 1XA5A 2LVVA 3S0DA 1DT7B 3R1VA 1QIWA 1QVIY 4XJKB 1NCYA 4OZDA 1KCYA 4INWA 1SY9A 4HREE 3SIBA 3CGAA 1BOCA 1VRKA 2CNPA 3NHIA 2M7LA 4I5NB 1B7TZ 1JF0A 3B7AA 1M63B 3OP0A 3RLZA 1R6PA 3PM2A 1F4OA 1SCMC 3SG4A 1SL9A 1ZUZA 1QX7A 4M2OA 2F3YA 4PHKA 2JRFA 1B8CA 1UURA 4JQ0D 4MZJA 1DJWA 4YGDB 3WHTB 5KSZA 1BG1A 4ORBB 3TUYB 2LC5A 4MZKA 4KYNA 1YUUA 2FCDA 1X02A 3DY9A 4IL1A 3VRPA 1KFXS 1PSBA 3BUOB 1S6CA 3IQOA 4CIDA 5DKNA 3BUMB 1B4CA 2AUCA 3QRXA 2VRGA 3WXAA 2JT8A 1KQMB 1OMVA 1B8RA 4R1EA 3VROA 1UHIA 3R1PA 3S0EA 1ZACA 1GGZA 1XVJA 4MLWA 3BFBA 3S0BA 2JT0A 1ORGA 1SRAA 3VRQA 1LA3A 3TS5B 1B8LA 1WDCB 3PLFB 1AJ5A 1G8IA 3D75A 1UHHA 5I94A 1GQMA 2KI4B 1Z4HA 1BT6A 1G33A 5TNCA 4PE7A 5JJGA 2AAOA 1H8BA 1J55A 1U5IB 1QXPA 4YI8A 2TN4A 3KF9A 3OB2B 2JC2A 2PVBA 3SIAA 1XFYO 3ZWHA 2M1KB 3BUXB 1Q80A 2AMIA 1CMGA 3AKBA 2BL0B 4C0LA 3I5HB 3SJSA 2M1UA 3NHTA 1YUTA 1QASA 2PQLA 1LVCD 2LLTA 2M3WA 5G08A 1S6JA 1TOPA 3Q8IA 1CDNA 4CFRA 5I2LA 3VGOA 1BMOA 1AVSA 1S6IA 1EJ3A 2LM5A 3LK0A 4DCKA 2L50A 1MWNA 2DOQA 4MBEA 1S3PA 4YBHB 4N5XA 1RECA 4QJ4B 4USLA 1DJHA 5KU1A 2FOTA 2SASA 2KNEA 3FWBA 3OHMB 1J1EA 1OMRA 2MJWB 3D74A 5F6TA 1YX7A 2JNFA 2QDIA 2FCEA 3N7HA 1UUSA 1NUBA 4N1GA 3O78A 4AQIA 4F0ZB 5ER4X 3PSRA 4AOMA 2GTEA 2M7NA 4NDDA 2NCPA 3R1OA 1B1GA 4MRYA 3KHEA 1K9UA 1SL7A 4JPZB 1IKUA 3L4LA 1NCXA 1KFUL 2MAZA 3IQQA 4IJ7A 4XJKA 1CM4A 1F71A 1A03A 3BFHA 1BLQA 3D73A 2LUXA 4PE1A 1WLMA 1DF0B 1WRLA 3CYZA 3V2LA 1DMOA 3CABA 1EG3A 3EKHA 2KDHA 2KI6C 5DICA 3IF7A 1HQVA 2K7BA 5PALA 2KQYA 1FF1A 2JQ6A 2MLEC 3PJIA 2COLB 1C07A 1XK4C 1NX1A 2JU0A 3CZ1A 1QX2A 1NX0A 1K93D 2KI6D 2SCPA 1LS8A 1J1DA 5CSIA 3CR4X 2QEOA 3D78A 1DJZA 1MQ1A 2K2FA 2Q91A 3I5FC 2JULA 4ORAB 3E3RA 1PALA 2HF5A 3HX4A 2M8UA 2KGBC 2LUCA 1NCZA 2KYCA 3BYAA 1G4YR 1XFVO 1SMGA 4YGEB 1AJ4A 3D0YB 1XYDA 2K7CA 4WQ3A 1AUIB 2NZ0A 2LMVA 4M2QA 2P70A 1TNWA 3D76A 3UNWA 1SCVA 1KSOA 3TZ1A 1YX8A 3TDIA 3K21A 1F8HA 1E8AA 2CTNA 3NSKA 4C0JA 3BUNB 3OB1B 2MHHA 1U5IA 5I2OA 1KWOB 3JVTB 1WLZA 3RZSA 3AAJA 4PT1A 1TRFA 1IJ5A 1CFFA 2LNKA 1YRUB 3O2PA 4ORCB 4CLNA 4ZCUA 1M45A 1L7ZA 4GFTA 2LMUA 3A8RA 1T14A 2BKHB 1D1OA 1RROA 1A4PA 2QPTA 1OOGA 2LP2A 2Y1NA 2ZFDA 2JTZA 1EXRA 2CBLA 2JOJA 2KQ6A 3CZ0A 3KEVA 2I94A 3KO0A 5FI7A 3D77A 2LV7A 3SG3A 1HT9A 1S26D 5HKZA 1OQPA 1WY9A 3VB1A 2KBMA 1B47A 1JC2A 1P28A 2OTGB 4GPLB 5BPJA 1DJIA 3RM1A 4ETOA 1SR6B 1DEKA 1UWOA 3TDUA 2LHIA 1CLLA 2JNXA 3H4SE 4NDBA 4DIRA 1XFZO 2KFGA 3EVVA 5FYXA 1EH2A 3PM8A 1JBAA 2EC6B 3GK4X 1SKTA 1DELA 4CFQA 1S36A 4A4CA 5HLOA 1M31A 1YUSA 4GGNA 1L2OC 5I8NA 1N65A 2WOSA 4PE4A 1FBVA 4GNKB 1KK8C 1MXEA 3CZTX 3FE8A 2QACA 3SG6A 1PSRA 1QV0A 3NGVA 2KGRA 2LVJA 1DVIA 2WCBA 3UO9A 3S0FA 1A75A 2PALA 5AERA 2BBMA 1FPWA 4TNCA 2H61A 4HRGA 2WCHA 3DVMA 1CNPA 1YVHA 4DUQA 5CSJA 3FWCA 1CB1A 1ALVA 1UHJA 2EGDA 2Y5IA 1QVIZ 4P2YB 1UHNA 1OZOA 2K61A 2OPOA 3CZ2A 2HQ8A 4AQJA 4XYNA 3IVTA 2M49B 1N2DA 2GV5A 2JXLA 2NXQA 1C7VA 1WRKA 1TWOA 1GM0A 1CDPA 2G2BA 4BY5A 2BE6A 2PYQA 3I5FB 1V1FA 5IBWA 4BY4A 1SW8A 2PSRA 5B8IB 1IQ3A 1RK9A 4D1EA
chains in the Genus database with same CATH topology
3OX5A 3CTNA 2HETA 1KQVA 1IJ6A 4YI9A 4E68A 5K89A 2L4IA 1MXLC 2KFHA 3D0YA 5HKWA 3JTDB 1LXFC 1TIZA 2PMYA 3I5IC 2CXJA 4PHMA 5D7FA 5HKYA 1B9AA 2BCAA 2I7AA 1QATA 2KFFA 2ZRTA 1TCOB 1SL8A 3EVUA 2JWWA 1KK7Y 5HYDA 2LHLA 3TUYC 1XO5A 4FQOA 1CDMA 3TDZA 3BQ3A 1F54A 4MN0A 5CSNA 4C0KA 2F8PA 2GGZA 1H4BA 2KOTA 2L0PA 1WRZA 1SCMB 4GAOA 1FW4A 2MBXA 1JFKA 2K7DA 1QJTA 2BCXA 3SG5A 1XFXO 2WCEA 2PASA 1DGVA 1KQMC 5CPVA 1S5GY 1LINA 2KAXA 3DD4A 4YGCB 1YRTB 4OCIA 1GJYA 4DRWA 3GK2A 3A4UB 3TS5C 1WDCC 2GGMA 3PFVA 2LMTA 2KI4C 4PHJA 2ZNDA 2WC8A 4PE0A 4QJ5B 4OVNF 2B1UA 1JSAA 2BECA 1NP8A 1F70A 1QV1A 4MVFA 1K94A 1KFUS 1ZFSA 1ZOTB 4U8DA 1CLBA 2M9GA 2WNDA 4YGAA 4YRUA 2K0JA 1J7RA 1L2OB 1OOJA 2PRUA 2BL0C 2ZNEA 1BR1B 1YTZC 2LP3A 1IRJA 4PALA 1OZSA 5DKRA 4PHNA 2BCBA 1CFPA 1NIWA 2O5GA 3BOWB 1QS7A 2E30A 1DGUA 4ICBA 2R2IA 3PN7C 2MRDA 3BXKA 4GBAA 1AK8A 1NX3A 3FS7A 1RJVA 4GGFA 4PCWA 1JUOA 1K9KA 2F3ZA 2KYFA 2BBNA 3AKAA 5AXIA 1YURA 2LCPA 3FIAA 2F2OA 2ZKMX 4M2PA 1EL4A 3SG7A 2BE4A 5AFPA 1C7WA 1KFXL 1QIVA 3AAKA 3PALA 1NPQA 1OMDA 2MLFC 4MRXA 1PVAA 2WCFA 3CLNA 1NSHA 3DVKA 1A2XA 1QLSA 1S5GZ 1TCFA 2HQWA 1CFCA 1SNLA 2M97A 3ICBA 2D8NA 4Q04A 2ZN9A 5I2QA 1JWDA 1QX5B 1YR5A 4MZLA 1LA0A 2H61C 3C1VA 3I5IB 4PDZA 1J7QA 4OKHA 1NWDA 4WQ2A 2ZRSA 4JWQA 1GGWA 3NXAA 2CCMA 1AHRA 3NSOA 1F55A 3OX6A 1DJXA 1UHKA 2IS9A 4WRIA 3EKJA 2G9BA 1K96A 1K2HA 1Y1XA 5GQQC 3DVJA 1DJGA 1DF0A 2FJUB 3LLEA 1AP4A 5HLVA 1DJYA 2F33A 1OSAA 1QTXA 1TNPA 3D10A 2E6WA 2LLSA 1SYMA 1PVBA 2MA2A 2Y4QA 3LL8B 4P5OE 3LK1A 2KSPA 1SPYA 3DF0B 1LKJA 1CM1A 1DTLA 1RTP1 2JTTA 2JZIA 3SG2A 5CSFA 1CKKA 1A29A 2JT3A 2I18A 4OV2A 2M29A 2I2RE 1SBJA 2P6BB 2OS8C 3CS1A 3I5GC 1MR8A 5AEQA 1ALWA 1CTRA 1KWOC 3JVTC 1YVLA 1RWYA 2LAPA 3VRNA 3WNXB 2WORA 1Y1AA 1BODA 1IH0A 3MSEB 1J7PA 1F4QA 1QLKA 3LCPC 5J3XA 1J7OA 2EHBA 1MHOA 1V1GA 2ZN8A 2K2AA 3CR2A 2L5XB 1ODBA 1K9PA 2HPSA 3HCMA 4MSPA 2LE9B 2L98A 2LANA 3O6BA 1N0YA 5D69A 2Y1MA 3NSIA 5ER5A 4A4BA 1JFJA 1R2UA 1BU3A 3EK4A 3BOWA 1UP5A 2OTGC 1W7IB 3CR5X 3PN7B 1PRWA 1JF2A 4I5LB 2BKIB 1BJFA 5DKQA 2L4HA 1EG4A 1SR6C 3CWGA 1PK0D 2L2EA 4DS7A 2LVKA 1NX2A 2H2KA 3EVRA 1S1EA 2A4JA 5JOLA 2EC6C 1IGVA 1OE9B 2KHNA 1TN4A 3VRRA 3DVEA 2JXCA 1IG5A 2LVIA 1KSMA 1B7TY 2ISDA 4OR9B 1SK6D 1CDLA 4UPGA 1Y1UA 4YGBB 4HRHA 3BUWB 3EK8A 1PULA 1K95A 1MUXA 4ZCVA 1A75B 2RGIA 4HSZA 5AANA 1MF8B 5KTYA 1M46A 1NYAA 2Q4UA 1BF5A 1TNXA 2KAYA 2K8MB 1CMFA 2NCOA 2O60A 1Y0VH 2KAVA 2V53A 4N1FA 1CFDA 4GGFC 1FI5A 3I5HC 1BR4B 2M0RA 1KK8B 3GK1A 1RFJA 1TNQA 3O4YA 1TTXA 3KPXA 3NSLA 1K8UA 4FTGA 1ZMZA 1IQ5A 3GOFA 3ZNIA 1XFUO 4NDCA 4QJ3B 1CLMA 1W7JB 4L9MA 1K90D 3WHUB 2L51A 2LLUA 1IWQA 3EK7A 2K7OA 4MEWA 2CT9A 3F45A 3PATA 2KBIA 1FI6A 1KK7Z 1XK4A 4I5KA 1M39A 1XFWO 1Y6WA 2JPTA 3DF0A 4I5JA 3JTDC 4NQGA 3M0WA 4GUKA 2F2PA 2OS8B 3I5GB 2NLNA 4CPVA 1XA5A 2LVVA 1DT7B 1QIWA 1QVIY 4XJKB 1NCYA 1KCYA 3SIBA 1SY9A 4HREE 1BOCA 3CGAA 1VRKA 2CNPA 2M7LA 4I5NB 1B7TZ 1JF0A 1M63B 3OP0A 3RLZA 1R6PA 1F4OA 1SCMC 3SG4A 1SL9A 1ZUZA 1QX7A 4M2OA 2F3YA 4PHKA 2JRFA 1B8CA 1UURA 4JQ0D 4MZJA 1DJWA 4YGDB 3WHTB 5KSZA 1BG1A 4ORBB 3TUYB 2LC5A 4MZKA 1YUUA 2FCDA 1X02A 4IL1A 3VRPA 1KFXS 1PSBA 3BUOB 1S6CA 3IQOA 4CIDA 5DKNA 3BUMB 1B4CA 2AUCA 3QRXA 2VRGA 3WXAA 2JT8A 1KQMB 1OMVA 1B8RA 4R1EA 3VROA 1UHIA 1ZACA 1GGZA 1XVJA 4MLWA 2JT0A 1SRAA 3VRQA 1LA3A 3TS5B 1B8LA 1WDCB 3PLFB 1AJ5A 1G8IA 1UHHA 1GQMA 2KI4B 1BT6A 1G33A 5TNCA 4PE7A 5JJGA 2AAOA 1H8BA 1J55A 1U5IB 1QXPA 4YI8A 2TN4A 3KF9A 3OB2B 2JC2A 2PVBA 3SIAA 1XFYO 3ZWHA 2M1KB 3BUXB 1Q80A 2AMIA 1CMGA 3AKBA 2BL0B 4C0LA 3I5HB 3SJSA 2M1UA 1YUTA 1QASA 1LVCD 2LLTA 2M3WA 5G08A 1S6JA 1TOPA 1CDNA 4CFRA 5I2LA 3VGOA 1BMOA 1AVSA 1S6IA 1EJ3A 2LM5A 3LK0A 4DCKA 2L50A 1MWNA 2DOQA 4MBEA 1S3PA 4YBHB 4N5XA 1RECA 4QJ4B 4USLA 1DJHA 5KU1A 2FOTA 2SASA 2KNEA 3FWBA 3OHMB 1J1EA 1OMRA 2MJWB 5F6TA 1YX7A 2JNFA 2FCEA 1UUSA 1NUBA 4N1GA 3O78A 4AQIA 4F0ZB 5ER4X 3PSRA 4AOMA 2M7NA 4NDDA 2NCPA 1B1GA 4MRYA 3KHEA 1K9UA 1SL7A 4JPZB 1IKUA 1NCXA 1KFUL 2MAZA 3IQQA 4XJKA 1CM4A 1F71A 1A03A 1BLQA 2LUXA 4PE1A 1WLMA 1DF0B 1WRLA 1DMOA 1EG3A 3EKHA 2KDHA 2KI6C 3IF7A 1HQVA 2K7BA 5PALA 2KQYA 1FF1A 2JQ6A 2MLEC 2COLB 1C07A 1XK4C 1NX1A 2JU0A 1QX2A 1NX0A 1K93D 2KI6D 2SCPA 1J1DA 5CSIA 3CR4X 1DJZA 1MQ1A 2K2FA 2Q91A 3I5FC 2JULA 4ORAB 3E3RA 1PALA 2HF5A 3HX4A 2M8UA 2KGBC 2LUCA 1NCZA 2KYCA 3BYAA 1G4YR 1XFVO 1SMGA 4YGEB 1AJ4A 3D0YB 1XYDA 2K7CA 4WQ3A 1AUIB 2NZ0A 2LMVA 4M2QA 1TNWA 1SCVA 1KSOA 3TZ1A 1YX8A 3TDIA 3K21A 1F8HA 1E8AA 2CTNA 3NSKA 4C0JA 3BUNB 3OB1B 2MHHA 1U5IA 5I2OA 1KWOB 3JVTB 1WLZA 3AAJA 1TRFA 1IJ5A 1CFFA 2LNKA 1YRUB 3O2PA 4ORCB 4CLNA 4ZCUA 1M45A 1L7ZA 4GFTA 2LMUA 3A8RA 2BKHB 1D1OA 1RROA 1A4PA 2QPTA 2LP2A 2Y1NA 2ZFDA 2JTZA 1EXRA 2CBLA 2JOJA 2KQ6A 3KEVA 2I94A 3KO0A 2LV7A 3SG3A 1HT9A 1S26D 5HKZA 1OQPA 1WY9A 2KBMA 1B47A 1JC2A 2OTGB 4GPLB 5BPJA 1DJIA 3RM1A 4ETOA 1SR6B 1UWOA 3TDUA 2LHIA 1CLLA 2JNXA 3H4SE 4NDBA 4DIRA 1XFZO 2KFGA 3EVVA 5FYXA 1EH2A 3PM8A 1JBAA 2EC6B 3GK4X 1SKTA 4CFQA 1S36A 4A4CA 5HLOA 1M31A 1YUSA 4GGNA 1L2OC 5I8NA 1N65A 2WOSA 4PE4A 1FBVA 4GNKB 1KK8C 1MXEA 3CZTX 2QACA 3SG6A 1PSRA 1QV0A 2KGRA 2LVJA 1DVIA 2WCBA 1A75A 2PALA 5AERA 2BBMA 1FPWA 4TNCA 2H61A 4HRGA 3DVMA 1CNPA 1YVHA 4DUQA 5CSJA 3FWCA 1CB1A 1ALVA 1UHJA 2EGDA 2Y5IA 1QVIZ 4P2YB 1UHNA 1OZOA 2K61A 2OPOA 2HQ8A 4AQJA 4XYNA 2M49B 1N2DA 2GV5A 2JXLA 2NXQA 1C7VA 1WRKA 1CDPA 2G2BA 4BY5A 2BE6A 3I5FB 1V1FA 5IBWA 4BY4A 1SW8A 2PSRA 5B8IB 1IQ3A 1RK9A 4D1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OX5 A;  3CTN A;  2HET A;  1KQV A;  1IJ6 A;  4YI9 A;  4E68 A;  5K89 A;  2L4I A;  1MXL C;  2KFH A;  3D0Y A;  5HKW A;  3JTD B;  1LXF C;  1TIZ A;  2PMY A;  3I5I C;  2CXJ A;  4PHM A;  5D7F A;  5HKY A;  1B9A A;  2BCA A;  2I7A A;  1QAT A;  2KFF A;  2ZRT A;  1TCO B;  1SL8 A;  3EVU A;  2JWW A;  1KK7 Y;  5HYD A;  2LHL A;  3TUY C;  1XO5 A;  4FQO A;  1CDM A;  3TDZ A;  3BQ3 A;  1F54 A;  4MN0 A;  5CSN A;  4C0K A;  2F8P A;  2GGZ A;  1H4B A;  2KOT A;  2L0P A;  1WRZ A;  1SCM B;  4GAO A;  1FW4 A;  2MBX A;  1JFK A;  2K7D A;  1QJT A;  2BCX A;  3SG5 A;  1XFX O;  2WCE A;  2PAS A;  1DGV A;  1KQM C;  5CPV A;  1S5G Y;  1LIN A;  2KAX A;  3DD4 A;  4YGC B;  1YRT B;  4OCI A;  1GJY A;  4DRW A;  3GK2 A;  3A4U B;  3TS5 C;  1WDC C;  2GGM A;  3PFV A;  2LMT A;  2KI4 C;  4PHJ A;  2ZND A;  2WC8 A;  4PE0 A;  4QJ5 B;  4OVN F;  2B1U A;  1JSA A;  2BEC A;  1NP8 A;  1F70 A;  1QV1 A;  4MVF A;  1K94 A;  1KFU S;  1ZFS A;  1ZOT B;  4U8D A;  1CLB A;  2M9G A;  2WND A;  4YGA A;  4YRU A;  2K0J A;  1J7R A;  1L2O B;  1OOJ A;  2PRU A;  2BL0 C;  2ZNE A;  1BR1 B;  1YTZ C;  2LP3 A;  1IRJ A;  4PAL A;  1OZS A;  5DKR A;  4PHN A;  2BCB A;  1CFP A;  1NIW A;  2O5G A;  3BOW B;  1QS7 A;  2E30 A;  1DGU A;  4ICB A;  2R2I A;  3PN7 C;  2MRD A;  3BXK A;  4GBA A;  1AK8 A;  1NX3 A;  3FS7 A;  1RJV A;  4GGF A;  4PCW A;  1JUO A;  1K9K A;  2F3Z A;  2KYF A;  2BBN A;  3AKA A;  5AXI A;  1YUR A;  2LCP A;  3FIA A;  2F2O A;  2ZKM X;  4M2P A;  1EL4 A;  3SG7 A;  2BE4 A;  5AFP A;  1C7W A;  1KFX L;  1QIV A;  3AAK A;  3PAL A;  1NPQ A;  1OMD A;  2MLF C;  4MRX A;  1PVA A;  2WCF A;  3CLN A;  1NSH A;  3DVK A;  1A2X A;  1QLS A;  1S5G Z;  1TCF A;  2HQW A;  1CFC A;  1SNL A;  2M97 A;  3ICB A;  2D8N A;  4Q04 A;  2ZN9 A;  5I2Q A;  1JWD A;  1QX5 B;  1YR5 A;  4MZL A;  1LA0 A;  2H61 C;  3C1V A;  3I5I B;  4PDZ A;  1J7Q A;  4OKH A;  1NWD A;  4WQ2 A;  2ZRS A;  4JWQ A;  1GGW A;  3NXA A;  2CCM A;  1AHR A;  3NSO A;  1F55 A;  3OX6 A;  1DJX A;  1UHK A;  2IS9 A;  4WRI A;  3EKJ A;  2G9B A;  1K96 A;  1K2H A;  1Y1X A;  5GQQ C;  3DVJ A;  1DJG A;  1DF0 A;  2FJU B;  3LLE A;  1AP4 A;  5HLV A;  1DJY A;  2F33 A;  1OSA A;  1QTX A;  1TNP A;  3D10 A;  2E6W A;  2LLS A;  1SYM A;  1PVB A;  2MA2 A;  2Y4Q A;  3LL8 B;  4P5O E;  3LK1 A;  2KSP A;  1SPY A;  3DF0 B;  1LKJ A;  1CM1 A;  1DTL A;  1RTP 1;  2JTT A;  2JZI A;  3SG2 A;  5CSF A;  1CKK A;  1A29 A;  2JT3 A;  2I18 A;  4OV2 A;  2M29 A;  2I2R E;  1SBJ A;  2P6B B;  2OS8 C;  3CS1 A;  3I5G C;  1MR8 A;  5AEQ A;  1ALW A;  1CTR A;  1KWO C;  3JVT C;  1YVL A;  1RWY A;  2LAP A;  3VRN A;  3WNX B;  2WOR A;  1Y1A A;  1BOD A;  1IH0 A;  3MSE B;  1J7P A;  1F4Q A;  1QLK A;  3LCP C;  5J3X A;  1J7O A;  2EHB A;  1MHO A;  1V1G A;  2ZN8 A;  2K2A A;  3CR2 A;  2L5X B;  1ODB A;  1K9P A;  2HPS A;  3HCM A;  4MSP A;  2LE9 B;  2L98 A;  2LAN A;  3O6B A;  1N0Y A;  5D69 A;  2Y1M A;  3NSI A;  5ER5 A;  4A4B A;  1JFJ A;  1R2U A;  1BU3 A;  3EK4 A;  3BOW A;  1UP5 A;  2OTG C;  1W7I B;  3CR5 X;  3PN7 B;  1PRW A;  1JF2 A;  4I5L B;  2BKI B;  1BJF A;  5DKQ A;  2L4H A;  1EG4 A;  1SR6 C;  3CWG A;  1PK0 D;  2L2E A;  4DS7 A;  2LVK A;  1NX2 A;  2H2K A;  3EVR A;  1S1E A;  2A4J A;  5JOL A;  2EC6 C;  1IGV A;  1OE9 B;  2KHN A;  1TN4 A;  3VRR A;  3DVE A;  2JXC A;  1IG5 A;  2LVI A;  1KSM A;  1B7T Y;  2ISD A;  4OR9 B;  1SK6 D;  1CDL A;  4UPG A;  1Y1U A;  4YGB B;  4HRH A;  3BUW B;  3EK8 A;  1PUL A;  1K95 A;  1MUX A;  4ZCV A;  1A75 B;  2RGI A;  4HSZ A;  5AAN A;  1MF8 B;  5KTY A;  1M46 A;  1NYA A;  2Q4U A;  1BF5 A;  1TNX A;  2KAY A;  2K8M B;  1CMF A;  2NCO A;  2O60 A;  1Y0V H;  2KAV A;  2V53 A;  4N1F A;  1CFD A;  4GGF C;  1FI5 A;  3I5H C;  1BR4 B;  2M0R A;  1KK8 B;  3GK1 A;  1RFJ A;  1TNQ A;  3O4Y A;  1TTX A;  3KPX A;  3NSL A;  1K8U A;  4FTG A;  1ZMZ A;  1IQ5 A;  3GOF A;  3ZNI A;  1XFU O;  4NDC A;  4QJ3 B;  1CLM A;  1W7J B;  4L9M A;  1K90 D;  3WHU B;  2L51 A;  2LLU A;  1IWQ A;  3EK7 A;  2K7O A;  4MEW A;  2CT9 A;  3F45 A;  3PAT A;  2KBI A;  1FI6 A;  1KK7 Z;  1XK4 A;  4I5K A;  1M39 A;  1XFW O;  1Y6W A;  2JPT A;  3DF0 A;  4I5J A;  3JTD C;  4NQG A;  3M0W A;  4GUK A;  2F2P A;  2OS8 B;  3I5G B;  2NLN A;  4CPV A;  1XA5 A;  2LVV A;  1DT7 B;  1QIW A;  1QVI Y;  4XJK B;  1NCY A;  1KCY A;  3SIB A;  1SY9 A;  4HRE E;  1BOC A;  3CGA A;  1VRK A;  2CNP A;  2M7L A;  4I5N B;  1B7T Z;  1JF0 A;  1M63 B;  3OP0 A;  3RLZ A;  1R6P A;  1F4O A;  1SCM C;  3SG4 A;  1SL9 A;  1ZUZ A;  1QX7 A;  4M2O A;  2F3Y A;  4PHK A;  2JRF A;  1B8C A;  1UUR A;  4JQ0 D;  4MZJ A;  1DJW A;  4YGD B;  3WHT B;  5KSZ A;  1BG1 A;  4ORB B;  3TUY B;  2LC5 A;  4MZK A;  1YUU A;  2FCD A;  1X02 A;  4IL1 A;  3VRP A;  1KFX S;  1PSB A;  3BUO B;  1S6C A;  3IQO A;  4CID A;  5DKN A;  3BUM B;  1B4C A;  2AUC A;  3QRX A;  2VRG A;  3WXA A;  2JT8 A;  1KQM B;  1OMV A;  1B8R A;  4R1E A;  3VRO A;  1UHI A;  1ZAC A;  1GGZ A;  1XVJ A;  4MLW A;  2JT0 A;  1SRA A;  3VRQ A;  1LA3 A;  3TS5 B;  1B8L A;  1WDC B;  3PLF B;  1AJ5 A;  1G8I A;  1UHH A;  1GQM A;  2KI4 B;  1BT6 A;  1G33 A;  5TNC A;  4PE7 A;  5JJG A;  2AAO A;  1H8B A;  1J55 A;  1U5I B;  1QXP A;  4YI8 A;  2TN4 A;  3KF9 A;  3OB2 B;  2JC2 A;  2PVB A;  3SIA A;  1XFY O;  3ZWH A;  2M1K B;  3BUX B;  1Q80 A;  2AMI A;  1CMG A;  3AKB A;  2BL0 B;  4C0L A;  3I5H B;  3SJS A;  2M1U A;  1YUT A;  1QAS A;  1LVC D;  2LLT A;  2M3W A;  5G08 A;  1S6J A;  1TOP A;  1CDN A;  4CFR A;  5I2L A;  3VGO A;  1BMO A;  1AVS A;  1S6I A;  1EJ3 A;  2LM5 A;  3LK0 A;  4DCK A;  2L50 A;  1MWN A;  2DOQ A;  4MBE A;  1S3P A;  4YBH B;  4N5X A;  1REC A;  4QJ4 B;  4USL A;  1DJH A;  5KU1 A;  2FOT A;  2SAS A;  2KNE A;  3FWB A;  3OHM B;  1J1E A;  1OMR A;  2MJW B;  5F6T A;  1YX7 A;  2JNF A;  2FCE A;  1UUS A;  1NUB A;  4N1G A;  3O78 A;  4AQI A;  4F0Z B;  5ER4 X;  3PSR A;  4AOM A;  2M7N A;  4NDD A;  2NCP A;  1B1G A;  4MRY A;  3KHE A;  1K9U A;  1SL7 A;  4JPZ B;  1IKU A;  1NCX A;  1KFU L;  2MAZ A;  3IQQ A;  4XJK A;  1CM4 A;  1F71 A;  1A03 A;  1BLQ A;  2LUX A;  4PE1 A;  1WLM A;  1DF0 B;  1WRL A;  1DMO A;  1EG3 A;  3EKH A;  2KDH A;  2KI6 C;  3IF7 A;  1HQV A;  2K7B A;  5PAL A;  2KQY A;  1FF1 A;  2JQ6 A;  2MLE C;  2COL B;  1C07 A;  1XK4 C;  1NX1 A;  2JU0 A;  1QX2 A;  1NX0 A;  1K93 D;  2KI6 D;  2SCP A;  1J1D A;  5CSI A;  3CR4 X;  1DJZ A;  1MQ1 A;  2K2F A;  2Q91 A;  3I5F C;  2JUL A;  4ORA B;  3E3R A;  1PAL A;  2HF5 A;  3HX4 A;  2M8U A;  2KGB C;  2LUC A;  1NCZ A;  2KYC A;  3BYA A;  1G4Y R;  1XFV O;  1SMG A;  4YGE B;  1AJ4 A;  3D0Y B;  1XYD A;  2K7C A;  4WQ3 A;  1AUI B;  2NZ0 A;  2LMV A;  4M2Q A;  1TNW A;  1SCV A;  1KSO A;  3TZ1 A;  1YX8 A;  3TDI A;  3K21 A;  1F8H A;  1E8A A;  2CTN A;  3NSK A;  4C0J A;  3BUN B;  3OB1 B;  2MHH A;  1U5I A;  5I2O A;  1KWO B;  3JVT B;  1WLZ A;  3AAJ A;  1TRF A;  1IJ5 A;  1CFF A;  2LNK A;  1YRU B;  3O2P A;  4ORC B;  4CLN A;  4ZCU A;  1M45 A;  1L7Z A;  4GFT A;  2LMU A;  3A8R A;  2BKH B;  1D1O A;  1RRO A;  1A4P A;  2QPT A;  2LP2 A;  2Y1N A;  2ZFD A;  2JTZ A;  1EXR A;  2CBL A;  2JOJ A;  2KQ6 A;  3KEV A;  2I94 A;  3KO0 A;  2LV7 A;  3SG3 A;  1HT9 A;  1S26 D;  5HKZ A;  1OQP A;  1WY9 A;  2KBM A;  1B47 A;  1JC2 A;  2OTG B;  4GPL B;  5BPJ A;  1DJI A;  3RM1 A;  4ETO A;  1SR6 B;  1UWO A;  3TDU A;  2LHI A;  1CLL A;  2JNX A;  3H4S E;  4NDB A;  4DIR A;  1XFZ O;  2KFG A;  3EVV A;  5FYX A;  1EH2 A;  3PM8 A;  1JBA A;  2EC6 B;  3GK4 X;  1SKT A;  4CFQ A;  1S36 A;  4A4C A;  5HLO A;  1M31 A;  1YUS A;  4GGN A;  1L2O C;  5I8N A;  1N65 A;  2WOS A;  4PE4 A;  1FBV A;  4GNK B;  1KK8 C;  1MXE A;  3CZT X;  2QAC A;  3SG6 A;  1PSR A;  1QV0 A;  2KGR A;  2LVJ A;  1DVI A;  2WCB A;  1A75 A;  2PAL A;  5AER A;  2BBM A;  1FPW A;  4TNC A;  2H61 A;  4HRG A;  3DVM A;  1CNP A;  1YVH A;  4DUQ A;  5CSJ A;  3FWC A;  1CB1 A;  1ALV A;  1UHJ A;  2EGD A;  2Y5I A;  1QVI Z;  4P2Y B;  1UHN A;  1OZO A;  2K61 A;  2OPO A;  2HQ8 A;  4AQJ A;  4XYN A;  2M49 B;  1N2D A;  2GV5 A;  2JXL A;  2NXQ A;  1C7V A;  1WRK A;  1CDP A;  2G2B A;  4BY5 A;  2BE6 A;  3I5F B;  1V1F A;  5IBW A;  4BY4 A;  1SW8 A;  2PSR A;  5B8I B;  1IQ3 A;  1RK9 A;  4D1E A; 
#chains in the Genus database with same CATH topology
 3OX5 A;  3CTN A;  2HET A;  1KQV A;  1IJ6 A;  4YI9 A;  4E68 A;  5K89 A;  2L4I A;  1MXL C;  2KFH A;  3D0Y A;  5HKW A;  1SSE B;  3DYE A;  3JTD B;  1LXF C;  1TIZ A;  2PMY A;  3SS3 A;  3I5I C;  2CXJ A;  4PHM A;  5D7F A;  5HKY A;  1B9A A;  2BCA A;  2YGU A;  2I7A A;  2WCK A;  1QAT A;  2KFF A;  2ZRT A;  4JD9 A;  1TCO B;  1SL8 A;  3EVU A;  2JWW A;  1KK7 Y;  5HYD A;  2LHL A;  3TUY C;  1XO5 A;  4FQO A;  1CDM A;  3TDZ A;  3BQ3 A;  1F54 A;  4MN0 A;  5CSN A;  4C0K A;  2F8P A;  2GGZ A;  1H4B A;  2KOT A;  2L0P A;  1WRZ A;  1SCM B;  4GAO A;  1FW4 A;  2MBX A;  1JFK A;  2K7D A;  1QJT A;  2BCX A;  3SG5 A;  1TUZ A;  1XFX O;  2WCE A;  2PAS A;  1DGV A;  1KQM C;  5CPV A;  1S5G Y;  2WCM A;  1LIN A;  2KAX A;  3DD4 A;  4YGC B;  1YRT B;  4OCI A;  1GJY A;  4DRW A;  3GK2 A;  3A4U B;  3TS5 C;  1WDC C;  2GGM A;  3PFV A;  1OW4 A;  2LMT A;  2KI4 C;  3B86 A;  4PHJ A;  2ZND A;  2WC8 A;  2FJY A;  4PE0 A;  4OVN F;  4QJ5 B;  2B1U A;  1JSA A;  2BEC A;  1NP8 A;  1F70 A;  1QV1 A;  4MVF A;  1K94 A;  1KFU S;  1ZOT B;  1XFR A;  1ZFS A;  4U8D A;  1CLB A;  2M9G A;  2WND A;  3OBV A;  4YGA A;  4YRU A;  2K0J A;  1J7R A;  1L2O B;  1OOJ A;  2PRU A;  2BL0 C;  1C3Y A;  2ZNE A;  1BR1 B;  1YTZ C;  2LP3 A;  1IRJ A;  4PAL A;  1OZS A;  5DKR A;  4PHN A;  2WCL A;  2BCB A;  1CFP A;  1NIW A;  2O5G A;  3BFA A;  3BOW B;  3CDN A;  1QS7 A;  2E30 A;  1DGU A;  4ICB A;  2R2I A;  2WC5 A;  3PN7 C;  2MRD A;  3BXK A;  4GBA A;  1AK8 A;  3DZT A;  3SS4 A;  1NX3 A;  3FS7 A;  1RJV A;  4GGF A;  4PCW A;  1JUO A;  1K9K A;  2F3Z A;  2KYF A;  2BBN A;  3AKA A;  3EG5 B;  5AXI A;  1YUR A;  2LCP A;  3FIA A;  2F2O A;  2ZKM X;  4M2P A;  1EL4 A;  3OGN A;  2BE4 A;  3SG7 A;  5AFP A;  5EL2 A;  1C7W A;  1KFX L;  1QIV A;  3AAK A;  3PAL A;  1NPQ A;  1OMD A;  2MLF C;  3L4A A;  4MRX A;  1PVA A;  2WCF A;  3CLN A;  1NSH A;  3DVK A;  4INX A;  1A2X A;  3L47 A;  1QLS A;  1S5G Z;  1TCF A;  2HQW A;  1CFC A;  1SNL A;  2M97 A;  1IIO A;  3ICB A;  2D8N A;  4Q04 A;  2ZN9 A;  5I2Q A;  1JWD A;  1QX5 B;  1YR5 A;  4MZL A;  1LA0 A;  2H61 C;  3C1V A;  3I5I B;  4PDZ A;  1J7Q A;  4OKH A;  1NWD A;  4WQ2 A;  3K1E A;  2ZRS A;  4JWQ A;  1GGW A;  3NXA A;  2CCM A;  1AHR A;  3NSO A;  1F55 A;  2L5Y A;  3OX6 A;  1DJX A;  1UHK A;  2IS9 A;  3R72 A;  4WRI A;  5HL1 A;  3EKJ A;  2G9B A;  1K96 A;  1K2H A;  1Y1X A;  3O4X A;  5FI6 A;  5GQQ C;  3DVJ A;  1DJG A;  1DF0 A;  2FJU B;  3LLE A;  1AP4 A;  5HLV A;  2P71 A;  1DJY A;  2F33 A;  1OSA A;  1QTX A;  1TNP A;  3D10 A;  2E6W A;  1OOI X;  2KLD A;  2LLS A;  4JKT A;  1SYM A;  1PVB A;  2MA2 A;  2Y4Q A;  3LL8 B;  4P5O E;  3LK1 A;  3DXL A;  2KSP A;  1SPY A;  2QEH A;  3DF0 B;  5FI2 A;  1LKJ A;  1CM1 A;  1DTL A;  1RTP 1;  2JTT A;  2JZI A;  3SG2 A;  5CSF A;  1CKK A;  1A29 A;  2JT3 A;  2L2C A;  2I18 A;  4OV2 A;  2M29 A;  2I2R E;  1SBJ A;  2P6B B;  2OS8 C;  3CS1 A;  3I5G C;  1MR8 A;  5AEQ A;  1ALW A;  2QEV A;  2WCJ A;  1W9Z A;  1CTR A;  1KWO C;  3JVT C;  1YVL A;  1RWY A;  2LAP A;  3VRN A;  3WNX B;  2WOR A;  1Y1A A;  1BOD A;  1IH0 A;  3MSE B;  1J7P A;  1F4Q A;  4F7F A;  1QLK A;  3LCP C;  5J3X A;  1J7O A;  2EHB A;  1MHO A;  1V1G A;  2ZN8 A;  2K2A A;  3CR2 A;  2L5X B;  1ODB A;  1K9P A;  2HPS A;  3HCM A;  4MSP A;  3B88 A;  2LE9 B;  2L98 A;  3SS5 A;  2LAN A;  2KLE A;  3O6B A;  1N0Y A;  1DC1 A;  5D69 A;  2Y1M A;  3NSI A;  5ER5 A;  4A4B A;  1JFJ A;  1R2U A;  1BU3 A;  2BAP A;  2ERB A;  2WC6 A;  3EK4 A;  3BOW A;  1UP5 A;  2OTG C;  1W7I B;  1OOH A;  1Z2C B;  3CR5 X;  1PRW A;  1JF2 A;  2K60 A;  2BKI B;  1BJF A;  3PN7 B;  4I5L B;  5DKQ A;  2L4H A;  1EG4 A;  1SR6 C;  1DQE A;  3CWG A;  1PK0 D;  2L2E A;  4DS7 A;  2LVK A;  1NX2 A;  2H2K A;  3EVR A;  1S1E A;  2A4J A;  5JOL A;  2EC6 C;  1IGV A;  1OE9 B;  2KHN A;  1TN4 A;  3VRR A;  3DVE A;  2H8V A;  2JXC A;  3B87 A;  1IG5 A;  2LVI A;  1KSM A;  1B7T Y;  2ISD A;  4OR9 B;  1SK6 D;  1CDL A;  4UPG A;  1Y1U A;  4YGB B;  2JPO A;  4HRH A;  3BUW B;  3EK8 A;  1PUL A;  1QWV A;  1K95 A;  1MUX A;  4ZCV A;  1A75 B;  2RGI A;  4HSZ A;  5AAN A;  1MF8 B;  5KTY A;  1M46 A;  1NYA A;  2Q4U A;  1BF5 A;  1TNX A;  2KAY A;  2K8M B;  1CMF A;  2NCO A;  2O60 A;  1Y0V H;  2KAV A;  2V53 A;  4N1F A;  1CFD A;  4GGF C;  3BJH A;  1FI5 A;  3I5H C;  5D3O A;  1BR4 B;  2M0R A;  1KK8 B;  3GK1 A;  2BNX A;  1RFJ A;  1TNQ A;  3O4Y A;  1TTX A;  3KPX A;  3NSL A;  1K8U A;  4FTG A;  1TUJ A;  2KPH A;  1ZMZ A;  1C3Z A;  3B6X A;  1IQ5 A;  3GOF A;  3ZNI A;  1XFU O;  4NDC A;  4QJ3 B;  1CLM A;  1W7J B;  2QEB A;  1K90 D;  4L9M A;  3WHU B;  2L51 A;  3FE6 A;  2LLU A;  1IWQ A;  3EK7 A;  2K7O A;  4MEW A;  2CT9 A;  3F45 A;  3PAT A;  2KBI A;  4FQT A;  1FI6 A;  1KK7 Z;  1XK4 A;  3QME A;  4I5K A;  1M39 A;  1XFW O;  1Y6W A;  2JPT A;  3DF0 A;  4I5J A;  3JTD C;  4NQG A;  3M0W A;  4GUK A;  2F2P A;  2OS8 B;  3FE9 A;  3I5G B;  3S0A A;  2NLN A;  1OOF A;  4CPV A;  3S0G A;  1XA5 A;  2LVV A;  3S0D A;  1DT7 B;  3R1V A;  1QIW A;  1QVI Y;  4XJK B;  1NCY A;  4OZD A;  1KCY A;  4INW A;  1SY9 A;  4HRE E;  3SIB A;  3CGA A;  1BOC A;  1VRK A;  2CNP A;  3NHI A;  2M7L A;  4I5N B;  1B7T Z;  1JF0 A;  3B7A A;  1M63 B;  3OP0 A;  3RLZ A;  1R6P A;  3PM2 A;  1F4O A;  1SCM C;  3SG4 A;  1SL9 A;  1ZUZ A;  1QX7 A;  4M2O A;  2F3Y A;  4PHK A;  2JRF A;  1B8C A;  1UUR A;  4JQ0 D;  4MZJ A;  1DJW A;  4YGD B;  3WHT B;  5KSZ A;  1BG1 A;  4ORB B;  3TUY B;  2LC5 A;  4MZK A;  4KYN A;  1YUU A;  2FCD A;  1X02 A;  3DY9 A;  4IL1 A;  3VRP A;  1KFX S;  1PSB A;  3BUO B;  1S6C A;  3IQO A;  4CID A;  5DKN A;  3BUM B;  1B4C A;  2AUC A;  3QRX A;  2VRG A;  3WXA A;  2JT8 A;  1KQM B;  1OMV A;  1B8R A;  4R1E A;  3VRO A;  1UHI A;  3R1P A;  3S0E A;  1ZAC A;  1GGZ A;  1XVJ A;  4MLW A;  3BFB A;  3S0B A;  2JT0 A;  1ORG A;  1SRA A;  3VRQ A;  1LA3 A;  3TS5 B;  1B8L A;  1WDC B;  3PLF B;  1AJ5 A;  1G8I A;  3D75 A;  1UHH A;  5I94 A;  1GQM A;  2KI4 B;  1Z4H A;  1BT6 A;  1G33 A;  5TNC A;  4PE7 A;  5JJG A;  2AAO A;  1H8B A;  1J55 A;  1U5I B;  1QXP A;  4YI8 A;  2TN4 A;  3KF9 A;  3OB2 B;  2JC2 A;  2PVB A;  3SIA A;  1XFY O;  3ZWH A;  2M1K B;  3BUX B;  1Q80 A;  2AMI A;  1CMG A;  3AKB A;  2BL0 B;  4C0L A;  3I5H B;  3SJS A;  2M1U A;  3NHT A;  1YUT A;  1QAS A;  2PQL A;  1LVC D;  2LLT A;  2M3W A;  5G08 A;  1S6J A;  1TOP A;  3Q8I A;  1CDN A;  4CFR A;  5I2L A;  3VGO A;  1BMO A;  1AVS A;  1S6I A;  1EJ3 A;  2LM5 A;  3LK0 A;  4DCK A;  2L50 A;  1MWN A;  2DOQ A;  4MBE A;  1S3P A;  4YBH B;  4N5X A;  1REC A;  4QJ4 B;  4USL A;  1DJH A;  5KU1 A;  2FOT A;  2SAS A;  2KNE A;  3FWB A;  3OHM B;  1J1E A;  1OMR A;  2MJW B;  3D74 A;  5F6T A;  1YX7 A;  2JNF A;  2QDI A;  2FCE A;  3N7H A;  1UUS A;  1NUB A;  4N1G A;  3O78 A;  4AQI A;  4F0Z B;  5ER4 X;  3PSR A;  4AOM A;  2GTE A;  2M7N A;  4NDD A;  2NCP A;  3R1O A;  1B1G A;  4MRY A;  3KHE A;  1K9U A;  1SL7 A;  4JPZ B;  1IKU A;  3L4L A;  1NCX A;  1KFU L;  2MAZ A;  3IQQ A;  4IJ7 A;  4XJK A;  1CM4 A;  1F71 A;  1A03 A;  3BFH A;  1BLQ A;  3D73 A;  2LUX A;  4PE1 A;  1WLM A;  1DF0 B;  1WRL A;  3CYZ A;  3V2L A;  1DMO A;  3CAB A;  1EG3 A;  3EKH A;  2KDH A;  2KI6 C;  5DIC A;  3IF7 A;  1HQV A;  2K7B A;  5PAL A;  2KQY A;  1FF1 A;  2JQ6 A;  2MLE C;  3PJI A;  2COL B;  1C07 A;  1XK4 C;  1NX1 A;  2JU0 A;  3CZ1 A;  1QX2 A;  1NX0 A;  1K93 D;  2KI6 D;  2SCP A;  1LS8 A;  1J1D A;  5CSI A;  3CR4 X;  2QEO A;  3D78 A;  1DJZ A;  1MQ1 A;  2K2F A;  2Q91 A;  3I5F C;  2JUL A;  4ORA B;  3E3R A;  1PAL A;  2HF5 A;  3HX4 A;  2M8U A;  2KGB C;  2LUC A;  1NCZ A;  2KYC A;  3BYA A;  1G4Y R;  1XFV O;  1SMG A;  4YGE B;  1AJ4 A;  3D0Y B;  1XYD A;  2K7C A;  4WQ3 A;  1AUI B;  2NZ0 A;  2LMV A;  4M2Q A;  2P70 A;  1TNW A;  3D76 A;  3UNW A;  1SCV A;  1KSO A;  3TZ1 A;  1YX8 A;  3TDI A;  3K21 A;  1F8H A;  1E8A A;  2CTN A;  3NSK A;  4C0J A;  3BUN B;  3OB1 B;  2MHH A;  1U5I A;  5I2O A;  1KWO B;  3JVT B;  1WLZ A;  3RZS A;  3AAJ A;  4PT1 A;  1TRF A;  1IJ5 A;  1CFF A;  2LNK A;  1YRU B;  3O2P A;  4ORC B;  4CLN A;  4ZCU A;  1M45 A;  1L7Z A;  4GFT A;  2LMU A;  3A8R A;  1T14 A;  2BKH B;  1D1O A;  1RRO A;  1A4P A;  2QPT A;  1OOG A;  2LP2 A;  2Y1N A;  2ZFD A;  2JTZ A;  1EXR A;  2CBL A;  2JOJ A;  2KQ6 A;  3CZ0 A;  3KEV A;  2I94 A;  3KO0 A;  5FI7 A;  3D77 A;  2LV7 A;  3SG3 A;  1HT9 A;  1S26 D;  5HKZ A;  1OQP A;  1WY9 A;  3VB1 A;  2KBM A;  1B47 A;  1JC2 A;  1P28 A;  2OTG B;  4GPL B;  5BPJ A;  1DJI A;  3RM1 A;  4ETO A;  1SR6 B;  1DEK A;  1UWO A;  3TDU A;  2LHI A;  1CLL A;  2JNX A;  3H4S E;  4NDB A;  4DIR A;  1XFZ O;  2KFG A;  3EVV A;  5FYX A;  1EH2 A;  3PM8 A;  1JBA A;  2EC6 B;  3GK4 X;  1SKT A;  1DEL A;  4CFQ A;  1S36 A;  4A4C A;  5HLO A;  1M31 A;  1YUS A;  4GGN A;  1L2O C;  5I8N A;  1N65 A;  2WOS A;  4PE4 A;  1FBV A;  4GNK B;  1KK8 C;  1MXE A;  3CZT X;  3FE8 A;  2QAC A;  3SG6 A;  1PSR A;  1QV0 A;  3NGV A;  2KGR A;  2LVJ A;  1DVI A;  2WCB A;  3UO9 A;  3S0F A;  1A75 A;  2PAL A;  5AER A;  2BBM A;  1FPW A;  4TNC A;  2H61 A;  4HRG A;  2WCH A;  3DVM A;  1CNP A;  1YVH A;  4DUQ A;  5CSJ A;  3FWC A;  1CB1 A;  1ALV A;  1UHJ A;  2EGD A;  2Y5I A;  1QVI Z;  4P2Y B;  1UHN A;  1OZO A;  2K61 A;  2OPO A;  3CZ2 A;  2HQ8 A;  4AQJ A;  4XYN A;  3IVT A;  2M49 B;  1N2D A;  2GV5 A;  2JXL A;  2NXQ A;  1C7V A;  1WRK A;  1TWO A;  1GM0 A;  1CDP A;  2G2B A;  4BY5 A;  2BE6 A;  2PYQ A;  3I5F B;  1V1F A;  5IBW A;  4BY4 A;  1SW8 A;  2PSR A;  5B8I B;  1IQ3 A;  1RK9 A;  4D1E A; 
#chains in the Genus database with same CATH homology
 3OX5 A;  3CTN A;  2HET A;  1KQV A;  1IJ6 A;  4YI9 A;  4E68 A;  5K89 A;  2L4I A;  1MXL C;  2KFH A;  3D0Y A;  5HKW A;  3JTD B;  1LXF C;  1TIZ A;  2PMY A;  3I5I C;  2CXJ A;  4PHM A;  5D7F A;  5HKY A;  1B9A A;  2BCA A;  2I7A A;  1QAT A;  2KFF A;  2ZRT A;  1TCO B;  1SL8 A;  3EVU A;  2JWW A;  1KK7 Y;  5HYD A;  2LHL A;  3TUY C;  1XO5 A;  4FQO A;  1CDM A;  3TDZ A;  3BQ3 A;  1F54 A;  4MN0 A;  5CSN A;  4C0K A;  2F8P A;  2GGZ A;  1H4B A;  2KOT A;  2L0P A;  1WRZ A;  1SCM B;  4GAO A;  1FW4 A;  2MBX A;  1JFK A;  2K7D A;  1QJT A;  2BCX A;  3SG5 A;  1XFX O;  2WCE A;  2PAS A;  1DGV A;  1KQM C;  5CPV A;  1S5G Y;  1LIN A;  2KAX A;  3DD4 A;  4YGC B;  1YRT B;  4OCI A;  1GJY A;  4DRW A;  3GK2 A;  3A4U B;  3TS5 C;  1WDC C;  2GGM A;  3PFV A;  2LMT A;  2KI4 C;  4PHJ A;  2ZND A;  2WC8 A;  4PE0 A;  4QJ5 B;  4OVN F;  2B1U A;  1JSA A;  2BEC A;  1NP8 A;  1F70 A;  1QV1 A;  4MVF A;  1K94 A;  1KFU S;  1ZFS A;  1ZOT B;  4U8D A;  1CLB A;  2M9G A;  2WND A;  4YGA A;  4YRU A;  2K0J A;  1J7R A;  1L2O B;  1OOJ A;  2PRU A;  2BL0 C;  2ZNE A;  1BR1 B;  1YTZ C;  2LP3 A;  1IRJ A;  4PAL A;  1OZS A;  5DKR A;  4PHN A;  2BCB A;  1CFP A;  1NIW A;  2O5G A;  3BOW B;  1QS7 A;  2E30 A;  1DGU A;  4ICB A;  2R2I A;  3PN7 C;  2MRD A;  3BXK A;  4GBA A;  1AK8 A;  1NX3 A;  3FS7 A;  1RJV A;  4GGF A;  4PCW A;  1JUO A;  1K9K A;  2F3Z A;  2KYF A;  2BBN A;  3AKA A;  5AXI A;  1YUR A;  2LCP A;  3FIA A;  2F2O A;  2ZKM X;  4M2P A;  1EL4 A;  3SG7 A;  2BE4 A;  5AFP A;  1C7W A;  1KFX L;  1QIV A;  3AAK A;  3PAL A;  1NPQ A;  1OMD A;  2MLF C;  4MRX A;  1PVA A;  2WCF A;  3CLN A;  1NSH A;  3DVK A;  1A2X A;  1QLS A;  1S5G Z;  1TCF A;  2HQW A;  1CFC A;  1SNL A;  2M97 A;  3ICB A;  2D8N A;  4Q04 A;  2ZN9 A;  5I2Q A;  1JWD A;  1QX5 B;  1YR5 A;  4MZL A;  1LA0 A;  2H61 C;  3C1V A;  3I5I B;  4PDZ A;  1J7Q A;  4OKH A;  1NWD A;  4WQ2 A;  2ZRS A;  4JWQ A;  1GGW A;  3NXA A;  2CCM A;  1AHR A;  3NSO A;  1F55 A;  3OX6 A;  1DJX A;  1UHK A;  2IS9 A;  4WRI A;  3EKJ A;  2G9B A;  1K96 A;  1K2H A;  1Y1X A;  5GQQ C;  3DVJ A;  1DJG A;  1DF0 A;  2FJU B;  3LLE A;  1AP4 A;  5HLV A;  1DJY A;  2F33 A;  1OSA A;  1QTX A;  1TNP A;  3D10 A;  2E6W A;  2LLS A;  1SYM A;  1PVB A;  2MA2 A;  2Y4Q A;  3LL8 B;  4P5O E;  3LK1 A;  2KSP A;  1SPY A;  3DF0 B;  1LKJ A;  1CM1 A;  1DTL A;  1RTP 1;  2JTT A;  2JZI A;  3SG2 A;  5CSF A;  1CKK A;  1A29 A;  2JT3 A;  2I18 A;  4OV2 A;  2M29 A;  2I2R E;  1SBJ A;  2P6B B;  2OS8 C;  3CS1 A;  3I5G C;  1MR8 A;  5AEQ A;  1ALW A;  1CTR A;  1KWO C;  3JVT C;  1YVL A;  1RWY A;  2LAP A;  3VRN A;  3WNX B;  2WOR A;  1Y1A A;  1BOD A;  1IH0 A;  3MSE B;  1J7P A;  1F4Q A;  1QLK A;  3LCP C;  5J3X A;  1J7O A;  2EHB A;  1MHO A;  1V1G A;  2ZN8 A;  2K2A A;  3CR2 A;  2L5X B;  1ODB A;  1K9P A;  2HPS A;  3HCM A;  4MSP A;  2LE9 B;  2L98 A;  2LAN A;  3O6B A;  1N0Y A;  5D69 A;  2Y1M A;  3NSI A;  5ER5 A;  4A4B A;  1JFJ A;  1R2U A;  1BU3 A;  3EK4 A;  3BOW A;  1UP5 A;  2OTG C;  1W7I B;  3CR5 X;  3PN7 B;  1PRW A;  1JF2 A;  4I5L B;  2BKI B;  1BJF A;  5DKQ A;  2L4H A;  1EG4 A;  1SR6 C;  3CWG A;  1PK0 D;  2L2E A;  4DS7 A;  2LVK A;  1NX2 A;  2H2K A;  3EVR A;  1S1E A;  2A4J A;  5JOL A;  2EC6 C;  1IGV A;  1OE9 B;  2KHN A;  1TN4 A;  3VRR A;  3DVE A;  2JXC A;  1IG5 A;  2LVI A;  1KSM A;  1B7T Y;  2ISD A;  4OR9 B;  1SK6 D;  1CDL A;  4UPG A;  1Y1U A;  4YGB B;  4HRH A;  3BUW B;  3EK8 A;  1PUL A;  1K95 A;  1MUX A;  4ZCV A;  1A75 B;  2RGI A;  4HSZ A;  5AAN A;  1MF8 B;  5KTY A;  1M46 A;  1NYA A;  2Q4U A;  1BF5 A;  1TNX A;  2KAY A;  2K8M B;  1CMF A;  2NCO A;  2O60 A;  1Y0V H;  2KAV A;  2V53 A;  4N1F A;  1CFD A;  4GGF C;  1FI5 A;  3I5H C;  1BR4 B;  2M0R A;  1KK8 B;  3GK1 A;  1RFJ A;  1TNQ A;  3O4Y A;  1TTX A;  3KPX A;  3NSL A;  1K8U A;  4FTG A;  1ZMZ A;  1IQ5 A;  3GOF A;  3ZNI A;  1XFU O;  4NDC A;  4QJ3 B;  1CLM A;  1W7J B;  4L9M A;  1K90 D;  3WHU B;  2L51 A;  2LLU A;  1IWQ A;  3EK7 A;  2K7O A;  4MEW A;  2CT9 A;  3F45 A;  3PAT A;  2KBI A;  1FI6 A;  1KK7 Z;  1XK4 A;  4I5K A;  1M39 A;  1XFW O;  1Y6W A;  2JPT A;  3DF0 A;  4I5J A;  3JTD C;  4NQG A;  3M0W A;  4GUK A;  2F2P A;  2OS8 B;  3I5G B;  2NLN A;  4CPV A;  1XA5 A;  2LVV A;  1DT7 B;  1QIW A;  1QVI Y;  4XJK B;  1NCY A;  1KCY A;  3SIB A;  1SY9 A;  4HRE E;  1BOC A;  3CGA A;  1VRK A;  2CNP A;  2M7L A;  4I5N B;  1B7T Z;  1JF0 A;  1M63 B;  3OP0 A;  3RLZ A;  1R6P A;  1F4O A;  1SCM C;  3SG4 A;  1SL9 A;  1ZUZ A;  1QX7 A;  4M2O A;  2F3Y A;  4PHK A;  2JRF A;  1B8C A;  1UUR A;  4JQ0 D;  4MZJ A;  1DJW A;  4YGD B;  3WHT B;  5KSZ A;  1BG1 A;  4ORB B;  3TUY B;  2LC5 A;  4MZK A;  1YUU A;  2FCD A;  1X02 A;  4IL1 A;  3VRP A;  1KFX S;  1PSB A;  3BUO B;  1S6C A;  3IQO A;  4CID A;  5DKN A;  3BUM B;  1B4C A;  2AUC A;  3QRX A;  2VRG A;  3WXA A;  2JT8 A;  1KQM B;  1OMV A;  1B8R A;  4R1E A;  3VRO A;  1UHI A;  1ZAC A;  1GGZ A;  1XVJ A;  4MLW A;  2JT0 A;  1SRA A;  3VRQ A;  1LA3 A;  3TS5 B;  1B8L A;  1WDC B;  3PLF B;  1AJ5 A;  1G8I A;  1UHH A;  1GQM A;  2KI4 B;  1BT6 A;  1G33 A;  5TNC A;  4PE7 A;  5JJG A;  2AAO A;  1H8B A;  1J55 A;  1U5I B;  1QXP A;  4YI8 A;  2TN4 A;  3KF9 A;  3OB2 B;  2JC2 A;  2PVB A;  3SIA A;  1XFY O;  3ZWH A;  2M1K B;  3BUX B;  1Q80 A;  2AMI A;  1CMG A;  3AKB A;  2BL0 B;  4C0L A;  3I5H B;  3SJS A;  2M1U A;  1YUT A;  1QAS A;  1LVC D;  2LLT A;  2M3W A;  5G08 A;  1S6J A;  1TOP A;  1CDN A;  4CFR A;  5I2L A;  3VGO A;  1BMO A;  1AVS A;  1S6I A;  1EJ3 A;  2LM5 A;  3LK0 A;  4DCK A;  2L50 A;  1MWN A;  2DOQ A;  4MBE A;  1S3P A;  4YBH B;  4N5X A;  1REC A;  4QJ4 B;  4USL A;  1DJH A;  5KU1 A;  2FOT A;  2SAS A;  2KNE A;  3FWB A;  3OHM B;  1J1E A;  1OMR A;  2MJW B;  5F6T A;  1YX7 A;  2JNF A;  2FCE A;  1UUS A;  1NUB A;  4N1G A;  3O78 A;  4AQI A;  4F0Z B;  5ER4 X;  3PSR A;  4AOM A;  2M7N A;  4NDD A;  2NCP A;  1B1G A;  4MRY A;  3KHE A;  1K9U A;  1SL7 A;  4JPZ B;  1IKU A;  1NCX A;  1KFU L;  2MAZ A;  3IQQ A;  4XJK A;  1CM4 A;  1F71 A;  1A03 A;  1BLQ A;  2LUX A;  4PE1 A;  1WLM A;  1DF0 B;  1WRL A;  1DMO A;  1EG3 A;  3EKH A;  2KDH A;  2KI6 C;  3IF7 A;  1HQV A;  2K7B A;  5PAL A;  2KQY A;  1FF1 A;  2JQ6 A;  2MLE C;  2COL B;  1C07 A;  1XK4 C;  1NX1 A;  2JU0 A;  1QX2 A;  1NX0 A;  1K93 D;  2KI6 D;  2SCP A;  1J1D A;  5CSI A;  3CR4 X;  1DJZ A;  1MQ1 A;  2K2F A;  2Q91 A;  3I5F C;  2JUL A;  4ORA B;  3E3R A;  1PAL A;  2HF5 A;  3HX4 A;  2M8U A;  2KGB C;  2LUC A;  1NCZ A;  2KYC A;  3BYA A;  1G4Y R;  1XFV O;  1SMG A;  4YGE B;  1AJ4 A;  3D0Y B;  1XYD A;  2K7C A;  4WQ3 A;  1AUI B;  2NZ0 A;  2LMV A;  4M2Q A;  1TNW A;  1SCV A;  1KSO A;  3TZ1 A;  1YX8 A;  3TDI A;  3K21 A;  1F8H A;  1E8A A;  2CTN A;  3NSK A;  4C0J A;  3BUN B;  3OB1 B;  2MHH A;  1U5I A;  5I2O A;  1KWO B;  3JVT B;  1WLZ A;  3AAJ A;  1TRF A;  1IJ5 A;  1CFF A;  2LNK A;  1YRU B;  3O2P A;  4ORC B;  4CLN A;  4ZCU A;  1M45 A;  1L7Z A;  4GFT A;  2LMU A;  3A8R A;  2BKH B;  1D1O A;  1RRO A;  1A4P A;  2QPT A;  2LP2 A;  2Y1N A;  2ZFD A;  2JTZ A;  1EXR A;  2CBL A;  2JOJ A;  2KQ6 A;  3KEV A;  2I94 A;  3KO0 A;  2LV7 A;  3SG3 A;  1HT9 A;  1S26 D;  5HKZ A;  1OQP A;  1WY9 A;  2KBM A;  1B47 A;  1JC2 A;  2OTG B;  4GPL B;  5BPJ A;  1DJI A;  3RM1 A;  4ETO A;  1SR6 B;  1UWO A;  3TDU A;  2LHI A;  1CLL A;  2JNX A;  3H4S E;  4NDB A;  4DIR A;  1XFZ O;  2KFG A;  3EVV A;  5FYX A;  1EH2 A;  3PM8 A;  1JBA A;  2EC6 B;  3GK4 X;  1SKT A;  4CFQ A;  1S36 A;  4A4C A;  5HLO A;  1M31 A;  1YUS A;  4GGN A;  1L2O C;  5I8N A;  1N65 A;  2WOS A;  4PE4 A;  1FBV A;  4GNK B;  1KK8 C;  1MXE A;  3CZT X;  2QAC A;  3SG6 A;  1PSR A;  1QV0 A;  2KGR A;  2LVJ A;  1DVI A;  2WCB A;  1A75 A;  2PAL A;  5AER A;  2BBM A;  1FPW A;  4TNC A;  2H61 A;  4HRG A;  3DVM A;  1CNP A;  1YVH A;  4DUQ A;  5CSJ A;  3FWC A;  1CB1 A;  1ALV A;  1UHJ A;  2EGD A;  2Y5I A;  1QVI Z;  4P2Y B;  1UHN A;  1OZO A;  2K61 A;  2OPO A;  2HQ8 A;  4AQJ A;  4XYN A;  2M49 B;  1N2D A;  2GV5 A;  2JXL A;  2NXQ A;  1C7V A;  1WRK A;  1CDP A;  2G2B A;  4BY5 A;  2BE6 A;  3I5F B;  1V1F A;  5IBW A;  4BY4 A;  1SW8 A;  2PSR A;  5B8I B;  1IQ3 A;  1RK9 A;  4D1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...