3SIAA

Crystal structure of ure3-binding protein, (d127a,n129a) mutant, iodide phased
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
214
structure length
212
Chain Sequence
NFCLWNLQPIQGSWMGAACIYQMPPSVRNTWWFPLLNTIPLDQYTRIYQWFMGVDRDRSGTLEINELMMGQFPGGIRLSPQTALRMMRIFDTDFNGHISFYEFMAMYKFMELAYNLFVMNARARSGTLEPHEILPALQQLGFYINQRTSLLLHRLFAMAFCDLNCWIAICAFAAQTRSAYQMIFMNPYYGPMKPFNPMEFGKFLDVVTSLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URE3-BP sequence specific DNA binding protein
publication title Crystal structure of URE3-binding protein
rcsb
source organism Entamoeba histolytica
molecule tags Dna binding protein
total genus 73
structure length 212
sequence length 214
ec nomenclature
pdb deposition date 2011-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3siaA01
2JULA 3EKJA 4MLWA 4XJKB 1UHNA 1LKJA 2TN4A 3BXKA 5HLOA 2LNKA 4U8DA 2JPTA 1RECA 1G8IA 4N1GA 1FI6A 3EK8A 3WHTB 2PALA 1R6PA 3A4UB 5I2OA 1TTXA 2QPTA 3IQQA 1IG5A 4NDCA 2F3ZA 3K21A 2BBNA 4PE0A 2HQWA 4DUQA 5TNCA 5ER4X 2K8MB 3VROA 1BR1B 3A8RA 2KSPA 1CDMA 1S5GZ 3BQ3A 2L0PA 3DD4A 5KU1A 2P6BB 1F4OA 3CWGA 2G9BA 3NSKA 1TCFA 4PHNA 5CSJA 4YBHB 3VGOA 1LA0A 2WCFA 1K9UA 2KOTA 2LC5A 1ZOTB 4AQIA 1K96A 1B8CA 1B7TY 2LANA 1QS7A 1R2UA 1JBAA 5CSIA 3RM1A 4HSZA 2LLUA 2VRGA 3OX6A 3PM8A 2O5GA 5HLVA 1OQPA 3CZTX 3OHMB 3LLEA 2KYCA 1J7PA 3GOFA 4PDZA 2G2BA 3SG6A 4CFRA 2LMVA 1PALA 2PMYA 2K7BA 3JTDB 2GV5A 2LUCA 2MLFC 1QXPA 1XVJA 1A4PA 3KEVA 1JF0A 5BPJA 1MHOA 2PVBA 2KFHA 1SL9A 1SNLA 1UHHA 1V1FA 2MRDA 3BUXB 5CPVA 5DKNA 1J7QA 1CFDA 2Y5IA 1OMRA 1C07A 1B7TZ 2JOJA 2JNFA 2EC6B 1X02A 3GK1A 4N5XA 4NQGA 1G4YR 2KDHA 2WCEA 1GGZA 3TDUA 5ER5A 1SK6D 3BYAA 2K7OA 3H4SE 1KSOA 2SCPA 3ICBA 3LK1A 4GPLB 2LHIA 1IKUA 2LP3A 3SJSA 4HREE 1BG1A 3EK4A 3BUOB 4GGFA 3CR5X 4C0JA 4YGBB 2K0JA 4WRIA 2BCXA 1DGUA 4ORCB 3TS5B 1XFWO 1KFUS 2ZN8A 3I5IB 2ZNEA 3D0YA 3CR4X 2WC8A 5HYDA 1IGVA 1S3PA 2L98A 2M0RA 1SYMA 1D1OA 3SIAA 4MZJA 2M3WA 1PRWA 3TDZA 1L7ZA 1W7IB 2BL0B 3DVKA 3PN7B 1CLLA 5KTYA 3CLNA 1TN4A 4BY5A 2WNDA 1G33A 1DT7B 1KCYA 3JTDC 1EG3A 2KI6C 2SASA 1GJYA 2KNEA 2BECA 4PE7A 5HKZA 1PVAA 3JVTB 2FJUB 1K9PA 1DJYA 1SW8A 1CKKA 3EK7A 1VRKA 4MRYA 3WXAA 1WLZA 4PHJA 1OMDA 2JNXA 2CTNA 3AAKA 1W7JB 2EC6C 4A4BA 5IBWA 4Q04A 2OPOA 1XYDA 4GAOA 2ZRTA 4YGAA 1OMVA 1CFCA 1CFFA 1CLMA 1KK8B 1UP5A 1NX2A 4CIDA 1RJVA 2KBMA 3OB1B 2KAVA 1SPYA 4M2OA 1F70A 3C1VA 1A75A 3KO0A 3IQOA 1OZOA 3TUYB 4A4CA 2LM5A 3WNXB 1KK7Y 2WCBA 4QJ4B 3TS5C 1WRLA 1MF8B 1PSBA 1CDPA 2KGRA 3I5IC 1OZSA 3BUWB 1Y1UA 4AOMA 2MLEC 3CS1A 2OS8B 1CB1A 2CCMA 2FCEA 2KAYA 2JU0A 2EHBA 1BR4B 2AAOA 2HETA 5J3XA 1S36A 5HKWA 3PN7C 1CDLA 2JC2A 1OE9B 5F6TA 1M31A 1NSHA 3KPXA 1DJXA 1JFJA 1S6CA 1CM1A 4DS7A 1BODA 4MN0A 2F3YA 2KFFA 3JVTC 4MBEA 2Y1MA 4CLNA 5G08A 4DCKA 1KK7Z 3O6BA 2JT8A 3MSEB 4XYNA 3SG2A 1TRFA 1B8RA 5D7FA 3BUMB 1HQVA 1J7RA 1M45A 1J1DA 3QRXA 4MZKA 2BBMA 1UHIA 5HKYA 2HF5A 2LUXA 1SCVA 3PSRA 1A2XA 1PVBA 1BU3A 1ALVA 2F2PA 3LK0A 2ZRSA 1KK8C 1OOJA 2NZ0A 3D0YB 1QV0A 2B1UA 3NXAA 4TNCA 1QIVA 4WQ3A 1NX0A 3NSLA 3DVJA 3WHUB 2CBLA 4M2QA 2WOSA 2JQ6A 3DF0B 3TUYC 1QLSA 3EVRA 2F2OA 3CTNA 4ZCUA 2KQYA 1J7OA 2JTZA 4MZLA 4UPGA 1NUBA 2JT3A 2OS8C 3VRPA 2LP2A 3HCMA 1CMFA 2R2IA 1K95A 1UHKA 1DF0A 2H61A 1DVIA 1NCXA 4JPZB 5I2QA 2D8NA 5KSZA 4YRUA 2QACA 4C0LA 2LHLA 4OVNF 1KFUL 1BJFA 1TNPA 4ORBB 2KYFA 2M9GA 2ZFDA 2K7DA 2MAZA 1DGVA 4R1EA 1DJZA 2FOTA 1XK4A 2WORA 5B8IB 1Y1XA 4OR9B 1MQ1A 2AMIA 3KHEA 1A03A 2K7CA 1SL7A 4MVFA 1FI5A 2M1UA 2HQ8A 1IQ5A 5I2LA 1QATA 1A75B 4GGFC 4MEWA 4YGEB 4I5JA 2K61A 2BE6A 1HT9A 1MUXA 4C0KA 2JRFA 1MR8A 4I5NB 1LXFC 1YVLA 1KQVA 2ZKMX 5CSFA 1EL4A 2L51A 1ZMZA 2BCBA 2GGZA 1XFVO 1S1EA 1FPWA 4MSPA 3FIAA 2K2AA 4JQ0D 1XFZO 1WRZA 4NDBA 1CLBA 1CNPA 1BMOA 1TIZA 1TNQA 1H8BA 1NIWA 1K94A 3I5GB 1H4BA 3DF0A 2LMUA 1AJ4A 3PFVA 3KF9A 3I5FB 1S6IA 4HRHA 2O60A 1AJ5A 1Q80A 3NSOA 1EJ3A 1WDCB 2OTGB 1JWDA 3D10A 2K2FA 1PULA 4PE1A 4YI9A 2LVJA 3FWCA 4PHMA 5D69A 3F45A 5GQQC 1KQMB 1ZFSA 1ALWA 2LMTA 3ZWHA 1C7WA 1QLKA 2LLTA 1SMGA 3EKHA 1C7VA 1JUOA 1K90D 4N1FA 4YGCB 1FF1A 1XA5A 3SIBA 4I5KA 2BKIB 2GGMA 3LCPC 3EVUA 1AK8A 2EGDA 1SKTA 1XO5A 3GK4X 4OCIA 2F8PA 1YR5A 5I8NA 1JC2A 2PASA 2JXCA 1RROA 1JF2A 2L2EA 1B9AA 1F4QA 4P2YB 1PK0D 1QTXA 3OX5A 3E3RA 1SCMB 1IH0A 1DF0B 1NX3A 4FTGA 4M2PA 1K2HA 3I5GC 1KWOB 2Q91A 4AQJA 3VRRA 4BY4A 2BL0C 2LAPA 1CM4A 1YX7A 1DTLA 2KGBC 5AXIA 2Y1NA 1IQ3A 3I5FC 1YUSA 2Q4UA 1N2DA 2L4IA 1WDCC 2OTGC 4CPVA 3VRNA 4OKHA 2CNPA 1K8UA 1DJWA 1YUUA 3O78A 3AKAA 1YTZC 1KSMA 1M39A 1NP8A 2L4HA 4HRGA 3TZ1A 5AFPA 1L2OB 2JWWA 3VRQA 2LVVA 1B47A 4GNKB 1KFXS 1YX8A 1NCYA 2F33A 1QASA 1TOPA 2CXJA 5FYXA 1UWOA 4QJ3B 1YRUB 1QX2A 1QJTA 2E6WA 1K9KA 1GGWA 1F8HA 1YRTB 3OB2B 2PRUA 2ZNDA 5AERA 1TCOB 1NPQA 1F71A 1RFJA 1YURA 2M1KB 4E68A 3BOWA 5JOLA 2KI4B 2KI6D 2MBXA 1QX5B 1S26D 2RGIA 1B8LA 1QIWA 2FCDA 1CDNA 4P5OE 1ZUZA 2ISDA 2KAXA 1BT6A 1SCMC 4NDDA 2H61C 1SY9A 4PALA 2BKHB 1E8AA 1JSAA 1A29A 1KWOC 1TNWA 2MJWB 3CGAA 1S6JA 2CT9A 2M7NA 4PHKA 1DJIA 2LV7A 2LLSA 1XK4C 2AUCA 2JZIA 4WQ2A 4ETOA 3EVVA 3M0WA 4YI8A 1ODBA 1Y6WA 3RLZA 5JJGA 1QVIY 1OSAA 1DJGA 2JTTA 1J55A 3NSIA 4DIRA 1U5IA 2PSRA 3GK2A 3SG5A 2NLNA 2HPSA 1BLQA 1L2OC 2IS9A 3DVMA 1XFXO 1UURA 3CR2A 1CFPA 5PALA 1NX1A 2ZN9A 1M63B 4IL1A 1MXLC 2MHHA 1SRAA 1AVSA 4GBAA 4ICBA 3FS7A 1RWYA 2MA2A 1UHJA 1GQMA 4XJKA 3PATA 2DOQA 3OP0A 3I5HB 2M7LA 4USLA 1ZACA 2A4JA 2H2KA 2KI4C 1QVIZ 2NCOA 1QV1A 2BE4A 1B4CA 4JWQA 4YGDB 3PLFB 4GFTA 3SG4A 3IF7A 4GUKA 2V53A 1SR6B 1M46A 5DKRA 4PE4A 1IJ5A 2BCAA 1N65A 2LE9B 2JXLA 1WLMA 4MRXA 2LVKA 4I5LB 5CSNA 1Y0VH 2I2RE 2I94A 4QJ5B 1V1GA 1JFKA 2M8UA 1QX7A 3PALA 4GGNA 1DJHA 1F55A 3TDIA 3ZNIA 4OV2A 2JT0A 2LVIA 1BF5A 3AKBA 2KBIA 3O4YA 3HX4A 1XFYO 4PCWA 3BOWB 3DVEA 2M29A 1WRKA 2E30A 1WY9A 1Y1AA 1J1EA 1NWDA 1AP4A 2L5XB 5DKQA 1EH2A 1NYAA 1YVHA 3FWBA 3I5HC 1N0YA 2LCPA 2I18A 1RTP1 1KFXL 2NXQA 1K93D 1B1GA 4DRWA 3SG7A 3SG3A 1CMGA 4FQOA 1IWQA 4ZCVA 1LA3A 1YUTA 5K89A 2Y4QA 3BUNB 1XFUO 1FBVA 2KQ6A 4L9MA 4ORAB 2KFGA 4CFQA 4D1EA 1SR6C 1LINA 1NCZA 1CTRA 1DMOA 1F54A 1TNXA 1RK9A 5AEQA 1EG4A 2NCPA 1EXRA 1MXEA 3AAJA 1U5IB 2M97A 1BOCA 2M49B 1AHRA 4F0ZB 3O2PA 2I7AA 1UUSA 2L50A 1IJ6A 1LVCD 1SL8A 1S5GY 2KHNA 5AANA 1KQMC 1PSRA 1AUIB 1MWNA 1FW4A 1IRJA 3LL8B 1SBJA 2COLB
chains in the Genus database with same CATH superfamily
2JULA 3EKJA 4MLWA 4XJKB 1UHNA 1LKJA 2TN4A 3BXKA 5HLOA 2LNKA 4U8DA 2JPTA 1RECA 1G8IA 4N1GA 1FI6A 3N7HA 3EK8A 3WHTB 2PALA 1R6PA 3A4UB 5I2OA 1TTXA 2QPTA 3IQQA 1IG5A 4NDCA 2F3ZA 3K21A 2BBNA 4PE0A 2HQWA 4DUQA 2KPHA 5TNCA 5ER4X 2K8MB 3VROA 1BR1B 3A8RA 3B7AA 2KSPA 1CDMA 1S5GZ 3BQ3A 2L0PA 3DD4A 5KU1A 2P6BB 1F4OA 3CWGA 2G9BA 3NSKA 1TCFA 4PHNA 5CSJA 2QDIA 4YBHB 3VGOA 1LA0A 2WCFA 1K9UA 2KOTA 2LC5A 1ZOTB 4AQIA 1K96A 1B8CA 1B7TY 2LANA 1QS7A 1R2UA 1JBAA 5CSIA 3RM1A 4HSZA 2LLUA 2VRGA 3OX6A 3PM8A 1DEKA 2O5GA 5HLVA 3BFBA 1OQPA 3CZTX 3OHMB 3LLEA 2KYCA 2ERBA 1J7PA 3GOFA 3B87A 2G2BA 4PDZA 3SG6A 4CFRA 3S0AA 2LMVA 4INWA 1PALA 3OGNA 2PMYA 2K7BA 3JTDB 3R1OA 2GV5A 2LUCA 2MLFC 1QXPA 1XVJA 1A4PA 3KEVA 1JF0A 5BPJA 1MHOA 2PVBA 2KFHA 3DY9A 1SL9A 1SNLA 1UHHA 1V1FA 2MRDA 3BUXB 5CPVA 5DKNA 1J7QA 3EG5B 1CFDA 2Y5IA 1OMRA 3SS5A 3BFHA 1C07A 1B7TZ 2JOJA 2JNFA 2EC6B 1X02A 3GK1A 4N5XA 4NQGA 1G4YR 3V2LA 1Z4HA 3QMEA 1TUJA 2KDHA 2WCEA 1GGZA 1XFRA 3TDUA 5ER5A 1SK6D 3BYAA 2K7OA 3H4SE 1KSOA 2SCPA 3ICBA 3LK1A 4GPLB 2LHIA 1IKUA 3NGVA 2LP3A 3SJSA 4HREE 4F7FA 3S0FA 1BG1A 3EK4A 3BUOB 4GGFA 3CR5X 4C0JA 4YGBB 3B88A 2K0JA 4WRIA 2BCXA 1DGUA 4ORCB 3TS5B 1XFWO 1KFUS 2ZN8A 3I5IB 2ZNEA 3D0YA 3CR4X 2WC8A 5HYDA 1IGVA 1S3PA 2L98A 2M0RA 1SYMA 1D1OA 3SIAA 4MZJA 3IVTA 2M3WA 1PRWA 3TDZA 1L7ZA 1W7IB 3R1PA 2BL0B 3DVKA 3PN7B 1CLLA 3S0BA 5KTYA 3CLNA 1TN4A 4BY5A 2WNDA 1G33A 1DT7B 1KCYA 3JTDC 1EG3A 2KI6C 1P28A 1GJYA 2KNEA 2BECA 2QEHA 2SASA 2QEBA 4PE7A 5HKZA 1PVAA 3JVTB 2FJUB 1K9PA 1DJYA 1SW8A 3PM2A 1CKKA 3EK7A 1VRKA 3NHIA 4MRYA 3WXAA 1WLZA 4PHJA 1OMDA 2JNXA 2CTNA 3AAKA 1W7JB 2EC6C 3D74A 3D77A 3L4LA 4A4BA 5IBWA 4Q04A 2OPOA 1XYDA 4GAOA 2ZRTA 3S0GA 4YGAA 1OMVA 1CFCA 1CFFA 1CLMA 1KK8B 1UP5A 1NX2A 4CIDA 1RJVA 2KBMA 3OB1B 2KAVA 1SPYA 4M2OA 1F70A 3C1VA 1A75A 2PQLA 3KO0A 3IQOA 1OZOA 3TUYB 4A4CA 2LM5A 3BJHA 4KYNA 3WNXB 1KK7Y 3D75A 2WCBA 4QJ4B 2JPOA 3TS5C 1WRLA 1LS8A 1MF8B 1PSBA 1CDPA 2KGRA 3I5IC 1GM0A 5HL1A 1OZSA 3BUWB 1Y1UA 4AOMA 2MLEC 3CS1A 2OS8B 1CB1A 2CCMA 2FCEA 2KAYA 2JU0A 2EHBA 1BR4B 2AAOA 2HETA 5J3XA 1S36A 5HKWA 3PN7C 1CDLA 2JC2A 1OE9B 5F6TA 3FE6A 1M31A 1NSHA 3KPXA 1DJXA 1TUZA 1JFJA 1S6CA 1CM1A 4DS7A 1BODA 4MN0A 2F3YA 2KFFA 3JVTC 4MBEA 2Y1MA 4CLNA 5G08A 4DCKA 1KK7Z 3O6BA 2JT8A 3CZ1A 3MSEB 4XYNA 2WCLA 3SG2A 1TRFA 1B8RA 5D7FA 3BUMB 1HQVA 1J7RA 1M45A 1J1DA 3QRXA 4MZKA 2BBMA 1UHIA 5HKYA 2HF5A 4JD9A 2LUXA 1SCVA 3PSRA 1A2XA 1PVBA 1BU3A 1ALVA 2F2PA 3LK0A 2ZRSA 1KK8C 1OOJA 3DZTA 4FQTA 2NZ0A 3D0YB 4JKTA 1QV0A 5EL2A 2B1UA 3NXAA 4TNCA 1QIVA 4WQ3A 1NX0A 3B6XA 3NSLA 3DVJA 1OOIX 2CBLA 4M2QA 3WHUB 2WOSA 1C3YA 2JQ6A 3DF0B 3TUYC 1QLSA 3EVRA 2F2OA 3CTNA 1T14A 4ZCUA 2KQYA 1J7OA 2JTZA 4MZLA 4UPGA 1NUBA 2JT3A 2OS8C 3VRPA 2LP2A 3HCMA 1CMFA 2R2IA 1K95A 5FI2A 1UHKA 1DF0A 2H61A 2H8VA 3FE9A 1DVIA 1NCXA 4JPZB 5I2QA 2D8NA 5KSZA 4YRUA 2QACA 4C0LA 2LHLA 4OVNF 1KFUL 1BJFA 1TNPA 4ORBB 2KYFA 2M9GA 2ZFDA 2K7DA 2MAZA 1DGVA 4R1EA 1DJZA 2FOTA 1XK4A 2WORA 5B8IB 1Y1XA 4OR9B 1MQ1A 2AMIA 2L5YA 3KHEA 1A03A 2K7CA 1SL7A 2WCMA 4MVFA 3S0DA 1FI5A 2M1UA 2HQ8A 1IQ5A 5I2LA 1QATA 3R72A 1A75B 4GGFC 4MEWA 4YGEB 4I5JA 2K61A 3CZ0A 1HT9A 1MUXA 2BE6A 4C0KA 2JRFA 1MR8A 2PYQA 4I5NB 1LXFC 1YVLA 1KQVA 2ZKMX 5CSFA 1EL4A 2QEOA 2L51A 1QWVA 1ZMZA 2BCBA 1XFVO 1S1EA 2GGZA 3R1VA 4MSPA 1FPWA 3FIAA 2K2AA 4JQ0D 1XFZO 1WRZA 4NDBA 1CLBA 1CNPA 1BMOA 1TIZA 1TNQA 1H8BA 1NIWA 1K94A 2WC6A 3I5GB 1SSEB 2K60A 3CYZA 3DF0A 2LMUA 1AJ4A 3PFVA 1H4BA 3FE8A 3UNWA 3KF9A 3I5FB 1S6IA 4HRHA 2O60A 1AJ5A 1Q80A 3NSOA 1EJ3A 1WDCB 2OTGB 1JWDA 3D10A 2K2FA 1PULA 4PE1A 4YI9A 3D76A 1TWOA 2LVJA 2YGUA 3FWCA 4PHMA 5D69A 2FJYA 3F45A 5GQQC 1KQMB 1ZFSA 1ALWA 2LMTA 3DYEA 3ZWHA 1C7WA 4IJ7A 1QLKA 2LLTA 1SMGA 2P70A 3EKHA 1C7VA 1JUOA 1K90D 1DC1A 1IIOA 3S0EA 4N1FA 4YGCB 1FF1A 1XA5A 3SIBA 4I5KA 2BKIB 2GGMA 3LCPC 3EVUA 3NHTA 1AK8A 2EGDA 1SKTA 3CDNA 1XO5A 3GK4X 3PJIA 1W9ZA 4OCIA 2F8PA 1YR5A 5I8NA 1JC2A 2PASA 2JXCA 2QEVA 1RROA 1JF2A 2L2EA 3CABA 1B9AA 1F4QA 4P2YB 1PK0D 1QTXA 3OX5A 3E3RA 1SCMB 1IH0A 1DF0B 1NX3A 4FTGA 4M2PA 1K2HA 3I5GC 1KWOB 4INXA 2Q91A 4AQJA 3VRRA 4BY4A 2BL0C 2LAPA 1CM4A 1OW4A 1DTLA 1YX7A 1Z2CB 2KGBC 2Y1NA 5AXIA 1IQ3A 3I5FC 1YUSA 2Q4UA 1N2DA 2L4IA 1WDCC 2OTGC 4CPVA 3VRNA 3DXLA 2CNPA 1K8UA 4OKHA 1DJWA 1YUUA 3B86A 3O78A 3AKAA 1YTZC 2WC5A 1KSMA 1M39A 1NP8A 2L4HA 4HRGA 3TZ1A 5AFPA 1L2OB 2JWWA 3VRQA 2LVVA 1B47A 4GNKB 1KFXS 1YX8A 1NCYA 2F33A 1QASA 1TOPA 2CXJA 5FYXA 1UWOA 4QJ3B 2WCHA 1YRUB 1QX2A 1QJTA 2E6WA 1K9KA 1GGWA 1F8HA 1YRTB 3OB2B 1OOFA 2PRUA 2ZNDA 5AERA 1TCOB 1NPQA 5DICA 1F71A 3K1EA 1RFJA 1YURA 2M1KB 4E68A 3BOWA 5JOLA 2KI4B 2KI6D 1C3ZA 1ORGA 2MBXA 1QX5B 1S26D 2RGIA 1B8LA 1QIWA 2FCDA 1CDNA 4P5OE 1ZUZA 2ISDA 2KAXA 1BT6A 1SCMC 2KLEA 2H61C 4NDDA 1SY9A 4PALA 2BKHB 1E8AA 3D78A 5FI6A 1JSAA 1A29A 1KWOC 1TNWA 2MJWB 3CGAA 1S6JA 2CT9A 2M7NA 4PHKA 1DJIA 3BFAA 2LV7A 3RZSA 2LLSA 1XK4C 2AUCA 2JZIA 4WQ2A 4ETOA 3EVVA 3M0WA 3D73A 1ODBA 4YI8A 1Y6WA 3RLZA 5JJGA 1QVIY 1OSAA 1DJGA 2JTTA 1J55A 3NSIA 4DIRA 1OOHA 1U5IA 2PSRA 3GK2A 2NLNA 3SG5A 2HPSA 1BLQA 1L2OC 2IS9A 2GTEA 1XFXO 3DVMA 1UURA 3CR2A 1CFPA 5PALA 1NX1A 2ZN9A 1M63B 4IL1A 1MXLC 2MHHA 1SRAA 1AVSA 4GBAA 3L4AA 4ICBA 3FS7A 1RWYA 2MA2A 1UHJA 1GQMA 4XJKA 3PATA 2DOQA 3OP0A 3I5HB 2M7LA 4USLA 4OZDA 1ZACA 1OOGA 2A4JA 3UO9A 2H2KA 2WCJA 2KI4C 1QVIZ 2NCOA 1QV1A 2BE4A 1B4CA 4JWQA 4YGDB 5I94A 3PLFB 4GFTA 3SG4A 3IF7A 4GUKA 2V53A 1SR6B 1M46A 5DKRA 4PE4A 1IJ5A 2BCAA 1N65A 2LE9B 2JXLA 3Q8IA 1WLMA 4MRXA 2LVKA 4I5LB 5CSNA 1Y0VH 2I2RE 3OBVA 2I94A 4QJ5B 1V1GA 1JFKA 2M8UA 3O4XA 1QX7A 3PALA 4GGNA 3CZ2A 1DJHA 5D3OA 1F55A 3TDIA 3ZNIA 2KLDA 4OV2A 2JT0A 2L2CA 2LVIA 1BF5A 3AKBA 2KBIA 3O4YA 3HX4A 1XFYO 4PCWA 3BOWB 3DVEA 2M29A 1WRKA 2E30A 3SS4A 1WY9A 1Y1AA 1J1EA 1NWDA 1DELA 4PT1A 1AP4A 2L5XB 2WCKA 1DQEA 1NYAA 1YVHA 3FWBA 5DKQA 3I5HC 1EH2A 1N0YA 2LCPA 2I18A 1RTP1 1KFXL 2NXQA 1K93D 1B1GA 4DRWA 3SG7A 3SG3A 1CMGA 4FQOA 1IWQA 4ZCVA 1LA3A 1YUTA 5K89A 2Y4QA 3BUNB 2P71A 1XFUO 1FBVA 2KQ6A 4L9MA 4ORAB 2KFGA 5FI7A 4CFQA 4D1EA 1SR6C 1LINA 1NCZA 1CTRA 1DMOA 1F54A 1TNXA 1RK9A 5AEQA 1EG4A 2NCPA 1EXRA 1MXEA 3AAJA 1U5IB 2M97A 1BOCA 2M49B 1AHRA 3SS3A 4F0ZB 3O2PA 2I7AA 1UUSA 2L50A 1IJ6A 1LVCD 1SL8A 1S5GY 2KHNA 2BAPA 5AANA 1KQMC 1PSRA 1AUIB 1MWNA 1FW4A 3L47A 3VB1A 1IRJA 2BNXA 3LL8B 1SBJA 2COLB
chains in the Genus database with same CATH topology
2JULA 3EKJA 4MLWA 4XJKB 1UHNA 1LKJA 2TN4A 3BXKA 5HLOA 2LNKA 4U8DA 2JPTA 1RECA 1G8IA 4N1GA 1FI6A 3EK8A 3WHTB 2PALA 1R6PA 3A4UB 5I2OA 1TTXA 2QPTA 3IQQA 1IG5A 4NDCA 2F3ZA 3K21A 2BBNA 4PE0A 2HQWA 4DUQA 5TNCA 5ER4X 2K8MB 3VROA 1BR1B 3A8RA 2KSPA 1CDMA 1S5GZ 3BQ3A 2L0PA 3DD4A 5KU1A 2P6BB 1F4OA 3CWGA 2G9BA 3NSKA 1TCFA 4PHNA 5CSJA 4YBHB 3VGOA 1LA0A 2WCFA 1K9UA 2KOTA 2LC5A 1ZOTB 4AQIA 1K96A 1B8CA 1B7TY 2LANA 1QS7A 1R2UA 1JBAA 5CSIA 3RM1A 4HSZA 2LLUA 2VRGA 3OX6A 3PM8A 2O5GA 5HLVA 1OQPA 3CZTX 3OHMB 3LLEA 2KYCA 1J7PA 3GOFA 4PDZA 2G2BA 3SG6A 4CFRA 2LMVA 1PALA 2PMYA 2K7BA 3JTDB 2GV5A 2LUCA 2MLFC 1QXPA 1XVJA 1A4PA 3KEVA 1JF0A 5BPJA 1MHOA 2PVBA 2KFHA 1SL9A 1SNLA 1UHHA 1V1FA 2MRDA 3BUXB 5CPVA 5DKNA 1J7QA 1CFDA 2Y5IA 1OMRA 1C07A 1B7TZ 2JOJA 2JNFA 2EC6B 1X02A 3GK1A 4N5XA 4NQGA 1G4YR 2KDHA 2WCEA 1GGZA 3TDUA 5ER5A 1SK6D 3BYAA 2K7OA 3H4SE 1KSOA 2SCPA 3ICBA 3LK1A 4GPLB 2LHIA 1IKUA 2LP3A 3SJSA 4HREE 1BG1A 3EK4A 3BUOB 4GGFA 3CR5X 4C0JA 4YGBB 2K0JA 4WRIA 2BCXA 1DGUA 4ORCB 3TS5B 1XFWO 1KFUS 2ZN8A 3I5IB 2ZNEA 3D0YA 3CR4X 2WC8A 5HYDA 1IGVA 1S3PA 2L98A 2M0RA 1SYMA 1D1OA 3SIAA 4MZJA 2M3WA 1PRWA 3TDZA 1L7ZA 1W7IB 2BL0B 3DVKA 3PN7B 1CLLA 5KTYA 3CLNA 1TN4A 4BY5A 2WNDA 1G33A 1DT7B 1KCYA 3JTDC 1EG3A 2KI6C 2SASA 1GJYA 2KNEA 2BECA 4PE7A 5HKZA 1PVAA 3JVTB 2FJUB 1K9PA 1DJYA 1SW8A 1CKKA 3EK7A 1VRKA 4MRYA 3WXAA 1WLZA 4PHJA 1OMDA 2JNXA 2CTNA 3AAKA 1W7JB 2EC6C 4A4BA 5IBWA 4Q04A 2OPOA 1XYDA 4GAOA 2ZRTA 4YGAA 1OMVA 1CFCA 1CFFA 1CLMA 1KK8B 1UP5A 1NX2A 4CIDA 1RJVA 2KBMA 3OB1B 2KAVA 1SPYA 4M2OA 1F70A 3C1VA 1A75A 3KO0A 3IQOA 1OZOA 3TUYB 4A4CA 2LM5A 3WNXB 1KK7Y 2WCBA 4QJ4B 3TS5C 1WRLA 1MF8B 1PSBA 1CDPA 2KGRA 3I5IC 1OZSA 3BUWB 1Y1UA 4AOMA 2MLEC 3CS1A 2OS8B 1CB1A 2CCMA 2FCEA 2KAYA 2JU0A 2EHBA 1BR4B 2AAOA 2HETA 5J3XA 1S36A 5HKWA 3PN7C 1CDLA 2JC2A 1OE9B 5F6TA 1M31A 1NSHA 3KPXA 1DJXA 1JFJA 1S6CA 1CM1A 4DS7A 1BODA 4MN0A 2F3YA 2KFFA 3JVTC 4MBEA 2Y1MA 4CLNA 5G08A 4DCKA 1KK7Z 3O6BA 2JT8A 3MSEB 4XYNA 3SG2A 1TRFA 1B8RA 5D7FA 3BUMB 1HQVA 1J7RA 1M45A 1J1DA 3QRXA 4MZKA 2BBMA 1UHIA 5HKYA 2HF5A 2LUXA 1SCVA 3PSRA 1A2XA 1PVBA 1BU3A 1ALVA 2F2PA 3LK0A 2ZRSA 1KK8C 1OOJA 2NZ0A 3D0YB 1QV0A 2B1UA 3NXAA 4TNCA 1QIVA 4WQ3A 1NX0A 3NSLA 3DVJA 3WHUB 2CBLA 4M2QA 2WOSA 2JQ6A 3DF0B 3TUYC 1QLSA 3EVRA 2F2OA 3CTNA 4ZCUA 2KQYA 1J7OA 2JTZA 4MZLA 4UPGA 1NUBA 2JT3A 2OS8C 3VRPA 2LP2A 3HCMA 1CMFA 2R2IA 1K95A 1UHKA 1DF0A 2H61A 1DVIA 1NCXA 4JPZB 5I2QA 2D8NA 5KSZA 4YRUA 2QACA 4C0LA 2LHLA 4OVNF 1KFUL 1BJFA 1TNPA 4ORBB 2KYFA 2M9GA 2ZFDA 2K7DA 2MAZA 1DGVA 4R1EA 1DJZA 2FOTA 1XK4A 2WORA 5B8IB 1Y1XA 4OR9B 1MQ1A 2AMIA 3KHEA 1A03A 2K7CA 1SL7A 4MVFA 1FI5A 2M1UA 2HQ8A 1IQ5A 5I2LA 1QATA 1A75B 4GGFC 4MEWA 4YGEB 4I5JA 2K61A 2BE6A 1HT9A 1MUXA 4C0KA 2JRFA 1MR8A 4I5NB 1LXFC 1YVLA 1KQVA 2ZKMX 5CSFA 1EL4A 2L51A 1ZMZA 2BCBA 2GGZA 1XFVO 1S1EA 1FPWA 4MSPA 3FIAA 2K2AA 4JQ0D 1XFZO 1WRZA 4NDBA 1CLBA 1CNPA 1BMOA 1TIZA 1TNQA 1H8BA 1NIWA 1K94A 3I5GB 1H4BA 3DF0A 2LMUA 1AJ4A 3PFVA 3KF9A 3I5FB 1S6IA 4HRHA 2O60A 1AJ5A 1Q80A 3NSOA 1EJ3A 1WDCB 2OTGB 1JWDA 3D10A 2K2FA 1PULA 4PE1A 4YI9A 2LVJA 3FWCA 4PHMA 5D69A 3F45A 5GQQC 1KQMB 1ZFSA 1ALWA 2LMTA 3ZWHA 1C7WA 1QLKA 2LLTA 1SMGA 3EKHA 1C7VA 1JUOA 1K90D 4N1FA 4YGCB 1FF1A 1XA5A 3SIBA 4I5KA 2BKIB 2GGMA 3LCPC 3EVUA 1AK8A 2EGDA 1SKTA 1XO5A 3GK4X 4OCIA 2F8PA 1YR5A 5I8NA 1JC2A 2PASA 2JXCA 1RROA 1JF2A 2L2EA 1B9AA 1F4QA 4P2YB 1PK0D 1QTXA 3OX5A 3E3RA 1SCMB 1IH0A 1DF0B 1NX3A 4FTGA 4M2PA 1K2HA 3I5GC 1KWOB 2Q91A 4AQJA 3VRRA 4BY4A 2BL0C 2LAPA 1CM4A 1YX7A 1DTLA 2KGBC 5AXIA 2Y1NA 1IQ3A 3I5FC 1YUSA 2Q4UA 1N2DA 2L4IA 1WDCC 2OTGC 4CPVA 3VRNA 4OKHA 2CNPA 1K8UA 1DJWA 1YUUA 3O78A 3AKAA 1YTZC 1KSMA 1M39A 1NP8A 2L4HA 4HRGA 3TZ1A 5AFPA 1L2OB 2JWWA 3VRQA 2LVVA 1B47A 4GNKB 1KFXS 1YX8A 1NCYA 2F33A 1QASA 1TOPA 2CXJA 5FYXA 1UWOA 4QJ3B 1YRUB 1QX2A 1QJTA 2E6WA 1K9KA 1GGWA 1F8HA 1YRTB 3OB2B 2PRUA 2ZNDA 5AERA 1TCOB 1NPQA 1F71A 1RFJA 1YURA 2M1KB 4E68A 3BOWA 5JOLA 2KI4B 2KI6D 2MBXA 1QX5B 1S26D 2RGIA 1B8LA 1QIWA 2FCDA 1CDNA 4P5OE 1ZUZA 2ISDA 2KAXA 1BT6A 1SCMC 4NDDA 2H61C 1SY9A 4PALA 2BKHB 1E8AA 1JSAA 1A29A 1KWOC 1TNWA 2MJWB 3CGAA 1S6JA 2CT9A 2M7NA 4PHKA 1DJIA 2LV7A 2LLSA 1XK4C 2AUCA 2JZIA 4WQ2A 4ETOA 3EVVA 3M0WA 4YI8A 1ODBA 1Y6WA 3RLZA 5JJGA 1QVIY 1OSAA 1DJGA 2JTTA 1J55A 3NSIA 4DIRA 1U5IA 2PSRA 3GK2A 3SG5A 2NLNA 2HPSA 1BLQA 1L2OC 2IS9A 3DVMA 1XFXO 1UURA 3CR2A 1CFPA 5PALA 1NX1A 2ZN9A 1M63B 4IL1A 1MXLC 2MHHA 1SRAA 1AVSA 4GBAA 4ICBA 3FS7A 1RWYA 2MA2A 1UHJA 1GQMA 4XJKA 3PATA 2DOQA 3OP0A 3I5HB 2M7LA 4USLA 1ZACA 2A4JA 2H2KA 2KI4C 1QVIZ 2NCOA 1QV1A 2BE4A 1B4CA 4JWQA 4YGDB 3PLFB 4GFTA 3SG4A 3IF7A 4GUKA 2V53A 1SR6B 1M46A 5DKRA 4PE4A 1IJ5A 2BCAA 1N65A 2LE9B 2JXLA 1WLMA 4MRXA 2LVKA 4I5LB 5CSNA 1Y0VH 2I2RE 2I94A 4QJ5B 1V1GA 1JFKA 2M8UA 1QX7A 3PALA 4GGNA 1DJHA 1F55A 3TDIA 3ZNIA 4OV2A 2JT0A 2LVIA 1BF5A 3AKBA 2KBIA 3O4YA 3HX4A 1XFYO 4PCWA 3BOWB 3DVEA 2M29A 1WRKA 2E30A 1WY9A 1Y1AA 1J1EA 1NWDA 1AP4A 2L5XB 5DKQA 1EH2A 1NYAA 1YVHA 3FWBA 3I5HC 1N0YA 2LCPA 2I18A 1RTP1 1KFXL 2NXQA 1K93D 1B1GA 4DRWA 3SG7A 3SG3A 1CMGA 4FQOA 1IWQA 4ZCVA 1LA3A 1YUTA 5K89A 2Y4QA 3BUNB 1XFUO 1FBVA 2KQ6A 4L9MA 4ORAB 2KFGA 4CFQA 4D1EA 1SR6C 1LINA 1NCZA 1CTRA 1DMOA 1F54A 1TNXA 1RK9A 5AEQA 1EG4A 2NCPA 1EXRA 1MXEA 3AAJA 1U5IB 2M97A 1BOCA 2M49B 1AHRA 4F0ZB 3O2PA 2I7AA 1UUSA 2L50A 1IJ6A 1LVCD 1SL8A 1S5GY 2KHNA 5AANA 1KQMC 1PSRA 1AUIB 1MWNA 1FW4A 1IRJA 3LL8B 1SBJA 2COLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JUL A;  3EKJ A;  4MLW A;  4XJK B;  1UHN A;  1LKJ A;  2TN4 A;  3BXK A;  5HLO A;  2LNK A;  4U8D A;  2JPT A;  1REC A;  1G8I A;  4N1G A;  1FI6 A;  3EK8 A;  3WHT B;  2PAL A;  1R6P A;  3A4U B;  5I2O A;  1TTX A;  2QPT A;  3IQQ A;  1IG5 A;  4NDC A;  2F3Z A;  3K21 A;  2BBN A;  4PE0 A;  2HQW A;  4DUQ A;  5TNC A;  5ER4 X;  2K8M B;  3VRO A;  1BR1 B;  3A8R A;  2KSP A;  1CDM A;  1S5G Z;  3BQ3 A;  2L0P A;  3DD4 A;  5KU1 A;  2P6B B;  1F4O A;  3CWG A;  2G9B A;  3NSK A;  1TCF A;  4PHN A;  5CSJ A;  4YBH B;  3VGO A;  1LA0 A;  2WCF A;  1K9U A;  2KOT A;  2LC5 A;  1ZOT B;  4AQI A;  1K96 A;  1B8C A;  1B7T Y;  2LAN A;  1QS7 A;  1R2U A;  1JBA A;  5CSI A;  3RM1 A;  4HSZ A;  2LLU A;  2VRG A;  3OX6 A;  3PM8 A;  2O5G A;  5HLV A;  1OQP A;  3CZT X;  3OHM B;  3LLE A;  2KYC A;  1J7P A;  3GOF A;  4PDZ A;  2G2B A;  3SG6 A;  4CFR A;  2LMV A;  1PAL A;  2PMY A;  2K7B A;  3JTD B;  2GV5 A;  2LUC A;  2MLF C;  1QXP A;  1XVJ A;  1A4P A;  3KEV A;  1JF0 A;  5BPJ A;  1MHO A;  2PVB A;  2KFH A;  1SL9 A;  1SNL A;  1UHH A;  1V1F A;  2MRD A;  3BUX B;  5CPV A;  5DKN A;  1J7Q A;  1CFD A;  2Y5I A;  1OMR A;  1C07 A;  1B7T Z;  2JOJ A;  2JNF A;  2EC6 B;  1X02 A;  3GK1 A;  4N5X A;  4NQG A;  1G4Y R;  2KDH A;  2WCE A;  1GGZ A;  3TDU A;  5ER5 A;  1SK6 D;  3BYA A;  2K7O A;  3H4S E;  1KSO A;  2SCP A;  3ICB A;  3LK1 A;  4GPL B;  2LHI A;  1IKU A;  2LP3 A;  3SJS A;  4HRE E;  1BG1 A;  3EK4 A;  3BUO B;  4GGF A;  3CR5 X;  4C0J A;  4YGB B;  2K0J A;  4WRI A;  2BCX A;  1DGU A;  4ORC B;  3TS5 B;  1XFW O;  1KFU S;  2ZN8 A;  3I5I B;  2ZNE A;  3D0Y A;  3CR4 X;  2WC8 A;  5HYD A;  1IGV A;  1S3P A;  2L98 A;  2M0R A;  1SYM A;  1D1O A;  3SIA A;  4MZJ A;  2M3W A;  1PRW A;  3TDZ A;  1L7Z A;  1W7I B;  2BL0 B;  3DVK A;  3PN7 B;  1CLL A;  5KTY A;  3CLN A;  1TN4 A;  4BY5 A;  2WND A;  1G33 A;  1DT7 B;  1KCY A;  3JTD C;  1EG3 A;  2KI6 C;  2SAS A;  1GJY A;  2KNE A;  2BEC A;  4PE7 A;  5HKZ A;  1PVA A;  3JVT B;  2FJU B;  1K9P A;  1DJY A;  1SW8 A;  1CKK A;  3EK7 A;  1VRK A;  4MRY A;  3WXA A;  1WLZ A;  4PHJ A;  1OMD A;  2JNX A;  2CTN A;  3AAK A;  1W7J B;  2EC6 C;  4A4B A;  5IBW A;  4Q04 A;  2OPO A;  1XYD A;  4GAO A;  2ZRT A;  4YGA A;  1OMV A;  1CFC A;  1CFF A;  1CLM A;  1KK8 B;  1UP5 A;  1NX2 A;  4CID A;  1RJV A;  2KBM A;  3OB1 B;  2KAV A;  1SPY A;  4M2O A;  1F70 A;  3C1V A;  1A75 A;  3KO0 A;  3IQO A;  1OZO A;  3TUY B;  4A4C A;  2LM5 A;  3WNX B;  1KK7 Y;  2WCB A;  4QJ4 B;  3TS5 C;  1WRL A;  1MF8 B;  1PSB A;  1CDP A;  2KGR A;  3I5I C;  1OZS A;  3BUW B;  1Y1U A;  4AOM A;  2MLE C;  3CS1 A;  2OS8 B;  1CB1 A;  2CCM A;  2FCE A;  2KAY A;  2JU0 A;  2EHB A;  1BR4 B;  2AAO A;  2HET A;  5J3X A;  1S36 A;  5HKW A;  3PN7 C;  1CDL A;  2JC2 A;  1OE9 B;  5F6T A;  1M31 A;  1NSH A;  3KPX A;  1DJX A;  1JFJ A;  1S6C A;  1CM1 A;  4DS7 A;  1BOD A;  4MN0 A;  2F3Y A;  2KFF A;  3JVT C;  4MBE A;  2Y1M A;  4CLN A;  5G08 A;  4DCK A;  1KK7 Z;  3O6B A;  2JT8 A;  3MSE B;  4XYN A;  3SG2 A;  1TRF A;  1B8R A;  5D7F A;  3BUM B;  1HQV A;  1J7R A;  1M45 A;  1J1D A;  3QRX A;  4MZK A;  2BBM A;  1UHI A;  5HKY A;  2HF5 A;  2LUX A;  1SCV A;  3PSR A;  1A2X A;  1PVB A;  1BU3 A;  1ALV A;  2F2P A;  3LK0 A;  2ZRS A;  1KK8 C;  1OOJ A;  2NZ0 A;  3D0Y B;  1QV0 A;  2B1U A;  3NXA A;  4TNC A;  1QIV A;  4WQ3 A;  1NX0 A;  3NSL A;  3DVJ A;  3WHU B;  2CBL A;  4M2Q A;  2WOS A;  2JQ6 A;  3DF0 B;  3TUY C;  1QLS A;  3EVR A;  2F2O A;  3CTN A;  4ZCU A;  2KQY A;  1J7O A;  2JTZ A;  4MZL A;  4UPG A;  1NUB A;  2JT3 A;  2OS8 C;  3VRP A;  2LP2 A;  3HCM A;  1CMF A;  2R2I A;  1K95 A;  1UHK A;  1DF0 A;  2H61 A;  1DVI A;  1NCX A;  4JPZ B;  5I2Q A;  2D8N A;  5KSZ A;  4YRU A;  2QAC A;  4C0L A;  2LHL A;  4OVN F;  1KFU L;  1BJF A;  1TNP A;  4ORB B;  2KYF A;  2M9G A;  2ZFD A;  2K7D A;  2MAZ A;  1DGV A;  4R1E A;  1DJZ A;  2FOT A;  1XK4 A;  2WOR A;  5B8I B;  1Y1X A;  4OR9 B;  1MQ1 A;  2AMI A;  3KHE A;  1A03 A;  2K7C A;  1SL7 A;  4MVF A;  1FI5 A;  2M1U A;  2HQ8 A;  1IQ5 A;  5I2L A;  1QAT A;  1A75 B;  4GGF C;  4MEW A;  4YGE B;  4I5J A;  2K61 A;  2BE6 A;  1HT9 A;  1MUX A;  4C0K A;  2JRF A;  1MR8 A;  4I5N B;  1LXF C;  1YVL A;  1KQV A;  2ZKM X;  5CSF A;  1EL4 A;  2L51 A;  1ZMZ A;  2BCB A;  2GGZ A;  1XFV O;  1S1E A;  1FPW A;  4MSP A;  3FIA A;  2K2A A;  4JQ0 D;  1XFZ O;  1WRZ A;  4NDB A;  1CLB A;  1CNP A;  1BMO A;  1TIZ A;  1TNQ A;  1H8B A;  1NIW A;  1K94 A;  3I5G B;  1H4B A;  3DF0 A;  2LMU A;  1AJ4 A;  3PFV A;  3KF9 A;  3I5F B;  1S6I A;  4HRH A;  2O60 A;  1AJ5 A;  1Q80 A;  3NSO A;  1EJ3 A;  1WDC B;  2OTG B;  1JWD A;  3D10 A;  2K2F A;  1PUL A;  4PE1 A;  4YI9 A;  2LVJ A;  3FWC A;  4PHM A;  5D69 A;  3F45 A;  5GQQ C;  1KQM B;  1ZFS A;  1ALW A;  2LMT A;  3ZWH A;  1C7W A;  1QLK A;  2LLT A;  1SMG A;  3EKH A;  1C7V A;  1JUO A;  1K90 D;  4N1F A;  4YGC B;  1FF1 A;  1XA5 A;  3SIB A;  4I5K A;  2BKI B;  2GGM A;  3LCP C;  3EVU A;  1AK8 A;  2EGD A;  1SKT A;  1XO5 A;  3GK4 X;  4OCI A;  2F8P A;  1YR5 A;  5I8N A;  1JC2 A;  2PAS A;  2JXC A;  1RRO A;  1JF2 A;  2L2E A;  1B9A A;  1F4Q A;  4P2Y B;  1PK0 D;  1QTX A;  3OX5 A;  3E3R A;  1SCM B;  1IH0 A;  1DF0 B;  1NX3 A;  4FTG A;  4M2P A;  1K2H A;  3I5G C;  1KWO B;  2Q91 A;  4AQJ A;  3VRR A;  4BY4 A;  2BL0 C;  2LAP A;  1CM4 A;  1YX7 A;  1DTL A;  2KGB C;  5AXI A;  2Y1N A;  1IQ3 A;  3I5F C;  1YUS A;  2Q4U A;  1N2D A;  2L4I A;  1WDC C;  2OTG C;  4CPV A;  3VRN A;  4OKH A;  2CNP A;  1K8U A;  1DJW A;  1YUU A;  3O78 A;  3AKA A;  1YTZ C;  1KSM A;  1M39 A;  1NP8 A;  2L4H A;  4HRG A;  3TZ1 A;  5AFP A;  1L2O B;  2JWW A;  3VRQ A;  2LVV A;  1B47 A;  4GNK B;  1KFX S;  1YX8 A;  1NCY A;  2F33 A;  1QAS A;  1TOP A;  2CXJ A;  5FYX A;  1UWO A;  4QJ3 B;  1YRU B;  1QX2 A;  1QJT A;  2E6W A;  1K9K A;  1GGW A;  1F8H A;  1YRT B;  3OB2 B;  2PRU A;  2ZND A;  5AER A;  1TCO B;  1NPQ A;  1F71 A;  1RFJ A;  1YUR A;  2M1K B;  4E68 A;  3BOW A;  5JOL A;  2KI4 B;  2KI6 D;  2MBX A;  1QX5 B;  1S26 D;  2RGI A;  1B8L A;  1QIW A;  2FCD A;  1CDN A;  4P5O E;  1ZUZ A;  2ISD A;  2KAX A;  1BT6 A;  1SCM C;  4NDD A;  2H61 C;  1SY9 A;  4PAL A;  2BKH B;  1E8A A;  1JSA A;  1A29 A;  1KWO C;  1TNW A;  2MJW B;  3CGA A;  1S6J A;  2CT9 A;  2M7N A;  4PHK A;  1DJI A;  2LV7 A;  2LLS A;  1XK4 C;  2AUC A;  2JZI A;  4WQ2 A;  4ETO A;  3EVV A;  3M0W A;  4YI8 A;  1ODB A;  1Y6W A;  3RLZ A;  5JJG A;  1QVI Y;  1OSA A;  1DJG A;  2JTT A;  1J55 A;  3NSI A;  4DIR A;  1U5I A;  2PSR A;  3GK2 A;  3SG5 A;  2NLN A;  2HPS A;  1BLQ A;  1L2O C;  2IS9 A;  3DVM A;  1XFX O;  1UUR A;  3CR2 A;  1CFP A;  5PAL A;  1NX1 A;  2ZN9 A;  1M63 B;  4IL1 A;  1MXL C;  2MHH A;  1SRA A;  1AVS A;  4GBA A;  4ICB A;  3FS7 A;  1RWY A;  2MA2 A;  1UHJ A;  1GQM A;  4XJK A;  3PAT A;  2DOQ A;  3OP0 A;  3I5H B;  2M7L A;  4USL A;  1ZAC A;  2A4J A;  2H2K A;  2KI4 C;  1QVI Z;  2NCO A;  1QV1 A;  2BE4 A;  1B4C A;  4JWQ A;  4YGD B;  3PLF B;  4GFT A;  3SG4 A;  3IF7 A;  4GUK A;  2V53 A;  1SR6 B;  1M46 A;  5DKR A;  4PE4 A;  1IJ5 A;  2BCA A;  1N65 A;  2LE9 B;  2JXL A;  1WLM A;  4MRX A;  2LVK A;  4I5L B;  5CSN A;  1Y0V H;  2I2R E;  2I94 A;  4QJ5 B;  1V1G A;  1JFK A;  2M8U A;  1QX7 A;  3PAL A;  4GGN A;  1DJH A;  1F55 A;  3TDI A;  3ZNI A;  4OV2 A;  2JT0 A;  2LVI A;  1BF5 A;  3AKB A;  2KBI A;  3O4Y A;  3HX4 A;  1XFY O;  4PCW A;  3BOW B;  3DVE A;  2M29 A;  1WRK A;  2E30 A;  1WY9 A;  1Y1A A;  1J1E A;  1NWD A;  1AP4 A;  2L5X B;  5DKQ A;  1EH2 A;  1NYA A;  1YVH A;  3FWB A;  3I5H C;  1N0Y A;  2LCP A;  2I18 A;  1RTP 1;  1KFX L;  2NXQ A;  1K93 D;  1B1G A;  4DRW A;  3SG7 A;  3SG3 A;  1CMG A;  4FQO A;  1IWQ A;  4ZCV A;  1LA3 A;  1YUT A;  5K89 A;  2Y4Q A;  3BUN B;  1XFU O;  1FBV A;  2KQ6 A;  4L9M A;  4ORA B;  2KFG A;  4CFQ A;  4D1E A;  1SR6 C;  1LIN A;  1NCZ A;  1CTR A;  1DMO A;  1F54 A;  1TNX A;  1RK9 A;  5AEQ A;  1EG4 A;  2NCP A;  1EXR A;  1MXE A;  3AAJ A;  1U5I B;  2M97 A;  1BOC A;  2M49 B;  1AHR A;  4F0Z B;  3O2P A;  2I7A A;  1UUS A;  2L50 A;  1IJ6 A;  1LVC D;  1SL8 A;  1S5G Y;  2KHN A;  5AAN A;  1KQM C;  1PSR A;  1AUI B;  1MWN A;  1FW4 A;  1IRJ A;  3LL8 B;  1SBJ A;  2COL B; 
#chains in the Genus database with same CATH topology
 2JUL A;  3EKJ A;  4MLW A;  4XJK B;  1UHN A;  1LKJ A;  2TN4 A;  3BXK A;  5HLO A;  2LNK A;  4U8D A;  2JPT A;  1REC A;  1G8I A;  4N1G A;  1FI6 A;  3N7H A;  3EK8 A;  3WHT B;  2PAL A;  1R6P A;  3A4U B;  5I2O A;  1TTX A;  2QPT A;  3IQQ A;  1IG5 A;  4NDC A;  2F3Z A;  3K21 A;  2BBN A;  4PE0 A;  2HQW A;  4DUQ A;  2KPH A;  5TNC A;  5ER4 X;  2K8M B;  3VRO A;  1BR1 B;  3A8R A;  3B7A A;  2KSP A;  1CDM A;  1S5G Z;  3BQ3 A;  2L0P A;  3DD4 A;  5KU1 A;  2P6B B;  1F4O A;  3CWG A;  2G9B A;  3NSK A;  1TCF A;  4PHN A;  5CSJ A;  2QDI A;  4YBH B;  3VGO A;  1LA0 A;  2WCF A;  1K9U A;  2KOT A;  2LC5 A;  1ZOT B;  4AQI A;  1K96 A;  1B8C A;  1B7T Y;  2LAN A;  1QS7 A;  1R2U A;  1JBA A;  5CSI A;  3RM1 A;  4HSZ A;  2LLU A;  2VRG A;  3OX6 A;  3PM8 A;  1DEK A;  2O5G A;  5HLV A;  3BFB A;  1OQP A;  3CZT X;  3OHM B;  3LLE A;  2KYC A;  2ERB A;  1J7P A;  3GOF A;  3B87 A;  2G2B A;  4PDZ A;  3SG6 A;  4CFR A;  3S0A A;  2LMV A;  4INW A;  1PAL A;  3OGN A;  2PMY A;  2K7B A;  3JTD B;  3R1O A;  2GV5 A;  2LUC A;  2MLF C;  1QXP A;  1XVJ A;  1A4P A;  3KEV A;  1JF0 A;  5BPJ A;  1MHO A;  2PVB A;  2KFH A;  3DY9 A;  1SL9 A;  1SNL A;  1UHH A;  1V1F A;  2MRD A;  3BUX B;  5CPV A;  5DKN A;  1J7Q A;  3EG5 B;  1CFD A;  2Y5I A;  1OMR A;  3SS5 A;  3BFH A;  1C07 A;  1B7T Z;  2JOJ A;  2JNF A;  2EC6 B;  1X02 A;  3GK1 A;  4N5X A;  4NQG A;  1G4Y R;  3V2L A;  1Z4H A;  3QME A;  1TUJ A;  2KDH A;  2WCE A;  1GGZ A;  1XFR A;  3TDU A;  5ER5 A;  1SK6 D;  3BYA A;  2K7O A;  3H4S E;  1KSO A;  2SCP A;  3ICB A;  3LK1 A;  4GPL B;  2LHI A;  1IKU A;  3NGV A;  2LP3 A;  3SJS A;  4HRE E;  4F7F A;  3S0F A;  1BG1 A;  3EK4 A;  3BUO B;  4GGF A;  3CR5 X;  4C0J A;  4YGB B;  3B88 A;  2K0J A;  4WRI A;  2BCX A;  1DGU A;  4ORC B;  3TS5 B;  1XFW O;  1KFU S;  2ZN8 A;  3I5I B;  2ZNE A;  3D0Y A;  3CR4 X;  2WC8 A;  5HYD A;  1IGV A;  1S3P A;  2L98 A;  2M0R A;  1SYM A;  1D1O A;  3SIA A;  4MZJ A;  3IVT A;  2M3W A;  1PRW A;  3TDZ A;  1L7Z A;  1W7I B;  3R1P A;  2BL0 B;  3DVK A;  3PN7 B;  1CLL A;  3S0B A;  5KTY A;  3CLN A;  1TN4 A;  4BY5 A;  2WND A;  1G33 A;  1DT7 B;  1KCY A;  3JTD C;  1EG3 A;  2KI6 C;  1P28 A;  1GJY A;  2KNE A;  2BEC A;  2QEH A;  2SAS A;  2QEB A;  4PE7 A;  5HKZ A;  1PVA A;  3JVT B;  2FJU B;  1K9P A;  1DJY A;  1SW8 A;  3PM2 A;  1CKK A;  3EK7 A;  1VRK A;  3NHI A;  4MRY A;  3WXA A;  1WLZ A;  4PHJ A;  1OMD A;  2JNX A;  2CTN A;  3AAK A;  1W7J B;  2EC6 C;  3D74 A;  3D77 A;  3L4L A;  4A4B A;  5IBW A;  4Q04 A;  2OPO A;  1XYD A;  4GAO A;  2ZRT A;  3S0G A;  4YGA A;  1OMV A;  1CFC A;  1CFF A;  1CLM A;  1KK8 B;  1UP5 A;  1NX2 A;  4CID A;  1RJV A;  2KBM A;  3OB1 B;  2KAV A;  1SPY A;  4M2O A;  1F70 A;  3C1V A;  1A75 A;  2PQL A;  3KO0 A;  3IQO A;  1OZO A;  3TUY B;  4A4C A;  2LM5 A;  3BJH A;  4KYN A;  3WNX B;  1KK7 Y;  3D75 A;  2WCB A;  4QJ4 B;  2JPO A;  3TS5 C;  1WRL A;  1LS8 A;  1MF8 B;  1PSB A;  1CDP A;  2KGR A;  3I5I C;  1GM0 A;  5HL1 A;  1OZS A;  3BUW B;  1Y1U A;  4AOM A;  2MLE C;  3CS1 A;  2OS8 B;  1CB1 A;  2CCM A;  2FCE A;  2KAY A;  2JU0 A;  2EHB A;  1BR4 B;  2AAO A;  2HET A;  5J3X A;  1S36 A;  5HKW A;  3PN7 C;  1CDL A;  2JC2 A;  1OE9 B;  5F6T A;  3FE6 A;  1M31 A;  1NSH A;  3KPX A;  1DJX A;  1TUZ A;  1JFJ A;  1S6C A;  1CM1 A;  4DS7 A;  1BOD A;  4MN0 A;  2F3Y A;  2KFF A;  3JVT C;  4MBE A;  2Y1M A;  4CLN A;  5G08 A;  4DCK A;  1KK7 Z;  3O6B A;  2JT8 A;  3CZ1 A;  3MSE B;  4XYN A;  2WCL A;  3SG2 A;  1TRF A;  1B8R A;  5D7F A;  3BUM B;  1HQV A;  1J7R A;  1M45 A;  1J1D A;  3QRX A;  4MZK A;  2BBM A;  1UHI A;  5HKY A;  2HF5 A;  4JD9 A;  2LUX A;  1SCV A;  3PSR A;  1A2X A;  1PVB A;  1BU3 A;  1ALV A;  2F2P A;  3LK0 A;  2ZRS A;  1KK8 C;  1OOJ A;  3DZT A;  4FQT A;  2NZ0 A;  3D0Y B;  4JKT A;  1QV0 A;  5EL2 A;  2B1U A;  3NXA A;  4TNC A;  1QIV A;  4WQ3 A;  1NX0 A;  3B6X A;  3NSL A;  3DVJ A;  1OOI X;  2CBL A;  4M2Q A;  3WHU B;  2WOS A;  1C3Y A;  2JQ6 A;  3DF0 B;  3TUY C;  1QLS A;  3EVR A;  2F2O A;  3CTN A;  1T14 A;  4ZCU A;  2KQY A;  1J7O A;  2JTZ A;  4MZL A;  4UPG A;  1NUB A;  2JT3 A;  2OS8 C;  3VRP A;  2LP2 A;  3HCM A;  1CMF A;  2R2I A;  1K95 A;  5FI2 A;  1UHK A;  1DF0 A;  2H61 A;  2H8V A;  3FE9 A;  1DVI A;  1NCX A;  4JPZ B;  5I2Q A;  2D8N A;  5KSZ A;  4YRU A;  2QAC A;  4C0L A;  2LHL A;  4OVN F;  1KFU L;  1BJF A;  1TNP A;  4ORB B;  2KYF A;  2M9G A;  2ZFD A;  2K7D A;  2MAZ A;  1DGV A;  4R1E A;  1DJZ A;  2FOT A;  1XK4 A;  2WOR A;  5B8I B;  1Y1X A;  4OR9 B;  1MQ1 A;  2AMI A;  2L5Y A;  3KHE A;  1A03 A;  2K7C A;  1SL7 A;  2WCM A;  4MVF A;  3S0D A;  1FI5 A;  2M1U A;  2HQ8 A;  1IQ5 A;  5I2L A;  1QAT A;  3R72 A;  1A75 B;  4GGF C;  4MEW A;  4YGE B;  4I5J A;  2K61 A;  3CZ0 A;  1HT9 A;  1MUX A;  2BE6 A;  4C0K A;  2JRF A;  1MR8 A;  2PYQ A;  4I5N B;  1LXF C;  1YVL A;  1KQV A;  2ZKM X;  5CSF A;  1EL4 A;  2QEO A;  2L51 A;  1QWV A;  1ZMZ A;  2BCB A;  1XFV O;  1S1E A;  2GGZ A;  3R1V A;  4MSP A;  1FPW A;  3FIA A;  2K2A A;  4JQ0 D;  1XFZ O;  1WRZ A;  4NDB A;  1CLB A;  1CNP A;  1BMO A;  1TIZ A;  1TNQ A;  1H8B A;  1NIW A;  1K94 A;  2WC6 A;  3I5G B;  1SSE B;  2K60 A;  3CYZ A;  3DF0 A;  2LMU A;  1AJ4 A;  3PFV A;  1H4B A;  3FE8 A;  3UNW A;  3KF9 A;  3I5F B;  1S6I A;  4HRH A;  2O60 A;  1AJ5 A;  1Q80 A;  3NSO A;  1EJ3 A;  1WDC B;  2OTG B;  1JWD A;  3D10 A;  2K2F A;  1PUL A;  4PE1 A;  4YI9 A;  3D76 A;  1TWO A;  2LVJ A;  2YGU A;  3FWC A;  4PHM A;  5D69 A;  2FJY A;  3F45 A;  5GQQ C;  1KQM B;  1ZFS A;  1ALW A;  2LMT A;  3DYE A;  3ZWH A;  1C7W A;  4IJ7 A;  1QLK A;  2LLT A;  1SMG A;  2P70 A;  3EKH A;  1C7V A;  1JUO A;  1K90 D;  1DC1 A;  1IIO A;  3S0E A;  4N1F A;  4YGC B;  1FF1 A;  1XA5 A;  3SIB A;  4I5K A;  2BKI B;  2GGM A;  3LCP C;  3EVU A;  3NHT A;  1AK8 A;  2EGD A;  1SKT A;  3CDN A;  1XO5 A;  3GK4 X;  3PJI A;  1W9Z A;  4OCI A;  2F8P A;  1YR5 A;  5I8N A;  1JC2 A;  2PAS A;  2JXC A;  2QEV A;  1RRO A;  1JF2 A;  2L2E A;  3CAB A;  1B9A A;  1F4Q A;  4P2Y B;  1PK0 D;  1QTX A;  3OX5 A;  3E3R A;  1SCM B;  1IH0 A;  1DF0 B;  1NX3 A;  4FTG A;  4M2P A;  1K2H A;  3I5G C;  1KWO B;  4INX A;  2Q91 A;  4AQJ A;  3VRR A;  4BY4 A;  2BL0 C;  2LAP A;  1CM4 A;  1OW4 A;  1DTL A;  1YX7 A;  1Z2C B;  2KGB C;  2Y1N A;  5AXI A;  1IQ3 A;  3I5F C;  1YUS A;  2Q4U A;  1N2D A;  2L4I A;  1WDC C;  2OTG C;  4CPV A;  3VRN A;  3DXL A;  2CNP A;  1K8U A;  4OKH A;  1DJW A;  1YUU A;  3B86 A;  3O78 A;  3AKA A;  1YTZ C;  2WC5 A;  1KSM A;  1M39 A;  1NP8 A;  2L4H A;  4HRG A;  3TZ1 A;  5AFP A;  1L2O B;  2JWW A;  3VRQ A;  2LVV A;  1B47 A;  4GNK B;  1KFX S;  1YX8 A;  1NCY A;  2F33 A;  1QAS A;  1TOP A;  2CXJ A;  5FYX A;  1UWO A;  4QJ3 B;  2WCH A;  1YRU B;  1QX2 A;  1QJT A;  2E6W A;  1K9K A;  1GGW A;  1F8H A;  1YRT B;  3OB2 B;  1OOF A;  2PRU A;  2ZND A;  5AER A;  1TCO B;  1NPQ A;  5DIC A;  1F71 A;  3K1E A;  1RFJ A;  1YUR A;  2M1K B;  4E68 A;  3BOW A;  5JOL A;  2KI4 B;  2KI6 D;  1C3Z A;  1ORG A;  2MBX A;  1QX5 B;  1S26 D;  2RGI A;  1B8L A;  1QIW A;  2FCD A;  1CDN A;  4P5O E;  1ZUZ A;  2ISD A;  2KAX A;  1BT6 A;  1SCM C;  2KLE A;  2H61 C;  4NDD A;  1SY9 A;  4PAL A;  2BKH B;  1E8A A;  3D78 A;  5FI6 A;  1JSA A;  1A29 A;  1KWO C;  1TNW A;  2MJW B;  3CGA A;  1S6J A;  2CT9 A;  2M7N A;  4PHK A;  1DJI A;  3BFA A;  2LV7 A;  3RZS A;  2LLS A;  1XK4 C;  2AUC A;  2JZI A;  4WQ2 A;  4ETO A;  3EVV A;  3M0W A;  3D73 A;  1ODB A;  4YI8 A;  1Y6W A;  3RLZ A;  5JJG A;  1QVI Y;  1OSA A;  1DJG A;  2JTT A;  1J55 A;  3NSI A;  4DIR A;  1OOH A;  1U5I A;  2PSR A;  3GK2 A;  2NLN A;  3SG5 A;  2HPS A;  1BLQ A;  1L2O C;  2IS9 A;  2GTE A;  1XFX O;  3DVM A;  1UUR A;  3CR2 A;  1CFP A;  5PAL A;  1NX1 A;  2ZN9 A;  1M63 B;  4IL1 A;  1MXL C;  2MHH A;  1SRA A;  1AVS A;  4GBA A;  3L4A A;  4ICB A;  3FS7 A;  1RWY A;  2MA2 A;  1UHJ A;  1GQM A;  4XJK A;  3PAT A;  2DOQ A;  3OP0 A;  3I5H B;  2M7L A;  4USL A;  4OZD A;  1ZAC A;  1OOG A;  2A4J A;  3UO9 A;  2H2K A;  2WCJ A;  2KI4 C;  1QVI Z;  2NCO A;  1QV1 A;  2BE4 A;  1B4C A;  4JWQ A;  4YGD B;  5I94 A;  3PLF B;  4GFT A;  3SG4 A;  3IF7 A;  4GUK A;  2V53 A;  1SR6 B;  1M46 A;  5DKR A;  4PE4 A;  1IJ5 A;  2BCA A;  1N65 A;  2LE9 B;  2JXL A;  3Q8I A;  1WLM A;  4MRX A;  2LVK A;  4I5L B;  5CSN A;  1Y0V H;  2I2R E;  3OBV A;  2I94 A;  4QJ5 B;  1V1G A;  1JFK A;  2M8U A;  3O4X A;  1QX7 A;  3PAL A;  4GGN A;  3CZ2 A;  1DJH A;  5D3O A;  1F55 A;  3TDI A;  3ZNI A;  2KLD A;  4OV2 A;  2JT0 A;  2L2C A;  2LVI A;  1BF5 A;  3AKB A;  2KBI A;  3O4Y A;  3HX4 A;  1XFY O;  4PCW A;  3BOW B;  3DVE A;  2M29 A;  1WRK A;  2E30 A;  3SS4 A;  1WY9 A;  1Y1A A;  1J1E A;  1NWD A;  1DEL A;  4PT1 A;  1AP4 A;  2L5X B;  2WCK A;  1DQE A;  1NYA A;  1YVH A;  3FWB A;  5DKQ A;  3I5H C;  1EH2 A;  1N0Y A;  2LCP A;  2I18 A;  1RTP 1;  1KFX L;  2NXQ A;  1K93 D;  1B1G A;  4DRW A;  3SG7 A;  3SG3 A;  1CMG A;  4FQO A;  1IWQ A;  4ZCV A;  1LA3 A;  1YUT A;  5K89 A;  2Y4Q A;  3BUN B;  2P71 A;  1XFU O;  1FBV A;  2KQ6 A;  4L9M A;  4ORA B;  2KFG A;  5FI7 A;  4CFQ A;  4D1E A;  1SR6 C;  1LIN A;  1NCZ A;  1CTR A;  1DMO A;  1F54 A;  1TNX A;  1RK9 A;  5AEQ A;  1EG4 A;  2NCP A;  1EXR A;  1MXE A;  3AAJ A;  1U5I B;  2M97 A;  1BOC A;  2M49 B;  1AHR A;  3SS3 A;  4F0Z B;  3O2P A;  2I7A A;  1UUS A;  2L50 A;  1IJ6 A;  1LVC D;  1SL8 A;  1S5G Y;  2KHN A;  2BAP A;  5AAN A;  1KQM C;  1PSR A;  1AUI B;  1MWN A;  1FW4 A;  3L47 A;  3VB1 A;  1IRJ A;  2BNX A;  3LL8 B;  1SBJ A;  2COL B; 
#chains in the Genus database with same CATH homology
 2JUL A;  3EKJ A;  4MLW A;  4XJK B;  1UHN A;  1LKJ A;  2TN4 A;  3BXK A;  5HLO A;  2LNK A;  4U8D A;  2JPT A;  1REC A;  1G8I A;  4N1G A;  1FI6 A;  3EK8 A;  3WHT B;  2PAL A;  1R6P A;  3A4U B;  5I2O A;  1TTX A;  2QPT A;  3IQQ A;  1IG5 A;  4NDC A;  2F3Z A;  3K21 A;  2BBN A;  4PE0 A;  2HQW A;  4DUQ A;  5TNC A;  5ER4 X;  2K8M B;  3VRO A;  1BR1 B;  3A8R A;  2KSP A;  1CDM A;  1S5G Z;  3BQ3 A;  2L0P A;  3DD4 A;  5KU1 A;  2P6B B;  1F4O A;  3CWG A;  2G9B A;  3NSK A;  1TCF A;  4PHN A;  5CSJ A;  4YBH B;  3VGO A;  1LA0 A;  2WCF A;  1K9U A;  2KOT A;  2LC5 A;  1ZOT B;  4AQI A;  1K96 A;  1B8C A;  1B7T Y;  2LAN A;  1QS7 A;  1R2U A;  1JBA A;  5CSI A;  3RM1 A;  4HSZ A;  2LLU A;  2VRG A;  3OX6 A;  3PM8 A;  2O5G A;  5HLV A;  1OQP A;  3CZT X;  3OHM B;  3LLE A;  2KYC A;  1J7P A;  3GOF A;  4PDZ A;  2G2B A;  3SG6 A;  4CFR A;  2LMV A;  1PAL A;  2PMY A;  2K7B A;  3JTD B;  2GV5 A;  2LUC A;  2MLF C;  1QXP A;  1XVJ A;  1A4P A;  3KEV A;  1JF0 A;  5BPJ A;  1MHO A;  2PVB A;  2KFH A;  1SL9 A;  1SNL A;  1UHH A;  1V1F A;  2MRD A;  3BUX B;  5CPV A;  5DKN A;  1J7Q A;  1CFD A;  2Y5I A;  1OMR A;  1C07 A;  1B7T Z;  2JOJ A;  2JNF A;  2EC6 B;  1X02 A;  3GK1 A;  4N5X A;  4NQG A;  1G4Y R;  2KDH A;  2WCE A;  1GGZ A;  3TDU A;  5ER5 A;  1SK6 D;  3BYA A;  2K7O A;  3H4S E;  1KSO A;  2SCP A;  3ICB A;  3LK1 A;  4GPL B;  2LHI A;  1IKU A;  2LP3 A;  3SJS A;  4HRE E;  1BG1 A;  3EK4 A;  3BUO B;  4GGF A;  3CR5 X;  4C0J A;  4YGB B;  2K0J A;  4WRI A;  2BCX A;  1DGU A;  4ORC B;  3TS5 B;  1XFW O;  1KFU S;  2ZN8 A;  3I5I B;  2ZNE A;  3D0Y A;  3CR4 X;  2WC8 A;  5HYD A;  1IGV A;  1S3P A;  2L98 A;  2M0R A;  1SYM A;  1D1O A;  3SIA A;  4MZJ A;  2M3W A;  1PRW A;  3TDZ A;  1L7Z A;  1W7I B;  2BL0 B;  3DVK A;  3PN7 B;  1CLL A;  5KTY A;  3CLN A;  1TN4 A;  4BY5 A;  2WND A;  1G33 A;  1DT7 B;  1KCY A;  3JTD C;  1EG3 A;  2KI6 C;  2SAS A;  1GJY A;  2KNE A;  2BEC A;  4PE7 A;  5HKZ A;  1PVA A;  3JVT B;  2FJU B;  1K9P A;  1DJY A;  1SW8 A;  1CKK A;  3EK7 A;  1VRK A;  4MRY A;  3WXA A;  1WLZ A;  4PHJ A;  1OMD A;  2JNX A;  2CTN A;  3AAK A;  1W7J B;  2EC6 C;  4A4B A;  5IBW A;  4Q04 A;  2OPO A;  1XYD A;  4GAO A;  2ZRT A;  4YGA A;  1OMV A;  1CFC A;  1CFF A;  1CLM A;  1KK8 B;  1UP5 A;  1NX2 A;  4CID A;  1RJV A;  2KBM A;  3OB1 B;  2KAV A;  1SPY A;  4M2O A;  1F70 A;  3C1V A;  1A75 A;  3KO0 A;  3IQO A;  1OZO A;  3TUY B;  4A4C A;  2LM5 A;  3WNX B;  1KK7 Y;  2WCB A;  4QJ4 B;  3TS5 C;  1WRL A;  1MF8 B;  1PSB A;  1CDP A;  2KGR A;  3I5I C;  1OZS A;  3BUW B;  1Y1U A;  4AOM A;  2MLE C;  3CS1 A;  2OS8 B;  1CB1 A;  2CCM A;  2FCE A;  2KAY A;  2JU0 A;  2EHB A;  1BR4 B;  2AAO A;  2HET A;  5J3X A;  1S36 A;  5HKW A;  3PN7 C;  1CDL A;  2JC2 A;  1OE9 B;  5F6T A;  1M31 A;  1NSH A;  3KPX A;  1DJX A;  1JFJ A;  1S6C A;  1CM1 A;  4DS7 A;  1BOD A;  4MN0 A;  2F3Y A;  2KFF A;  3JVT C;  4MBE A;  2Y1M A;  4CLN A;  5G08 A;  4DCK A;  1KK7 Z;  3O6B A;  2JT8 A;  3MSE B;  4XYN A;  3SG2 A;  1TRF A;  1B8R A;  5D7F A;  3BUM B;  1HQV A;  1J7R A;  1M45 A;  1J1D A;  3QRX A;  4MZK A;  2BBM A;  1UHI A;  5HKY A;  2HF5 A;  2LUX A;  1SCV A;  3PSR A;  1A2X A;  1PVB A;  1BU3 A;  1ALV A;  2F2P A;  3LK0 A;  2ZRS A;  1KK8 C;  1OOJ A;  2NZ0 A;  3D0Y B;  1QV0 A;  2B1U A;  3NXA A;  4TNC A;  1QIV A;  4WQ3 A;  1NX0 A;  3NSL A;  3DVJ A;  3WHU B;  2CBL A;  4M2Q A;  2WOS A;  2JQ6 A;  3DF0 B;  3TUY C;  1QLS A;  3EVR A;  2F2O A;  3CTN A;  4ZCU A;  2KQY A;  1J7O A;  2JTZ A;  4MZL A;  4UPG A;  1NUB A;  2JT3 A;  2OS8 C;  3VRP A;  2LP2 A;  3HCM A;  1CMF A;  2R2I A;  1K95 A;  1UHK A;  1DF0 A;  2H61 A;  1DVI A;  1NCX A;  4JPZ B;  5I2Q A;  2D8N A;  5KSZ A;  4YRU A;  2QAC A;  4C0L A;  2LHL A;  4OVN F;  1KFU L;  1BJF A;  1TNP A;  4ORB B;  2KYF A;  2M9G A;  2ZFD A;  2K7D A;  2MAZ A;  1DGV A;  4R1E A;  1DJZ A;  2FOT A;  1XK4 A;  2WOR A;  5B8I B;  1Y1X A;  4OR9 B;  1MQ1 A;  2AMI A;  3KHE A;  1A03 A;  2K7C A;  1SL7 A;  4MVF A;  1FI5 A;  2M1U A;  2HQ8 A;  1IQ5 A;  5I2L A;  1QAT A;  1A75 B;  4GGF C;  4MEW A;  4YGE B;  4I5J A;  2K61 A;  2BE6 A;  1HT9 A;  1MUX A;  4C0K A;  2JRF A;  1MR8 A;  4I5N B;  1LXF C;  1YVL A;  1KQV A;  2ZKM X;  5CSF A;  1EL4 A;  2L51 A;  1ZMZ A;  2BCB A;  2GGZ A;  1XFV O;  1S1E A;  1FPW A;  4MSP A;  3FIA A;  2K2A A;  4JQ0 D;  1XFZ O;  1WRZ A;  4NDB A;  1CLB A;  1CNP A;  1BMO A;  1TIZ A;  1TNQ A;  1H8B A;  1NIW A;  1K94 A;  3I5G B;  1H4B A;  3DF0 A;  2LMU A;  1AJ4 A;  3PFV A;  3KF9 A;  3I5F B;  1S6I A;  4HRH A;  2O60 A;  1AJ5 A;  1Q80 A;  3NSO A;  1EJ3 A;  1WDC B;  2OTG B;  1JWD A;  3D10 A;  2K2F A;  1PUL A;  4PE1 A;  4YI9 A;  2LVJ A;  3FWC A;  4PHM A;  5D69 A;  3F45 A;  5GQQ C;  1KQM B;  1ZFS A;  1ALW A;  2LMT A;  3ZWH A;  1C7W A;  1QLK A;  2LLT A;  1SMG A;  3EKH A;  1C7V A;  1JUO A;  1K90 D;  4N1F A;  4YGC B;  1FF1 A;  1XA5 A;  3SIB A;  4I5K A;  2BKI B;  2GGM A;  3LCP C;  3EVU A;  1AK8 A;  2EGD A;  1SKT A;  1XO5 A;  3GK4 X;  4OCI A;  2F8P A;  1YR5 A;  5I8N A;  1JC2 A;  2PAS A;  2JXC A;  1RRO A;  1JF2 A;  2L2E A;  1B9A A;  1F4Q A;  4P2Y B;  1PK0 D;  1QTX A;  3OX5 A;  3E3R A;  1SCM B;  1IH0 A;  1DF0 B;  1NX3 A;  4FTG A;  4M2P A;  1K2H A;  3I5G C;  1KWO B;  2Q91 A;  4AQJ A;  3VRR A;  4BY4 A;  2BL0 C;  2LAP A;  1CM4 A;  1YX7 A;  1DTL A;  2KGB C;  5AXI A;  2Y1N A;  1IQ3 A;  3I5F C;  1YUS A;  2Q4U A;  1N2D A;  2L4I A;  1WDC C;  2OTG C;  4CPV A;  3VRN A;  4OKH A;  2CNP A;  1K8U A;  1DJW A;  1YUU A;  3O78 A;  3AKA A;  1YTZ C;  1KSM A;  1M39 A;  1NP8 A;  2L4H A;  4HRG A;  3TZ1 A;  5AFP A;  1L2O B;  2JWW A;  3VRQ A;  2LVV A;  1B47 A;  4GNK B;  1KFX S;  1YX8 A;  1NCY A;  2F33 A;  1QAS A;  1TOP A;  2CXJ A;  5FYX A;  1UWO A;  4QJ3 B;  1YRU B;  1QX2 A;  1QJT A;  2E6W A;  1K9K A;  1GGW A;  1F8H A;  1YRT B;  3OB2 B;  2PRU A;  2ZND A;  5AER A;  1TCO B;  1NPQ A;  1F71 A;  1RFJ A;  1YUR A;  2M1K B;  4E68 A;  3BOW A;  5JOL A;  2KI4 B;  2KI6 D;  2MBX A;  1QX5 B;  1S26 D;  2RGI A;  1B8L A;  1QIW A;  2FCD A;  1CDN A;  4P5O E;  1ZUZ A;  2ISD A;  2KAX A;  1BT6 A;  1SCM C;  4NDD A;  2H61 C;  1SY9 A;  4PAL A;  2BKH B;  1E8A A;  1JSA A;  1A29 A;  1KWO C;  1TNW A;  2MJW B;  3CGA A;  1S6J A;  2CT9 A;  2M7N A;  4PHK A;  1DJI A;  2LV7 A;  2LLS A;  1XK4 C;  2AUC A;  2JZI A;  4WQ2 A;  4ETO A;  3EVV A;  3M0W A;  4YI8 A;  1ODB A;  1Y6W A;  3RLZ A;  5JJG A;  1QVI Y;  1OSA A;  1DJG A;  2JTT A;  1J55 A;  3NSI A;  4DIR A;  1U5I A;  2PSR A;  3GK2 A;  3SG5 A;  2NLN A;  2HPS A;  1BLQ A;  1L2O C;  2IS9 A;  3DVM A;  1XFX O;  1UUR A;  3CR2 A;  1CFP A;  5PAL A;  1NX1 A;  2ZN9 A;  1M63 B;  4IL1 A;  1MXL C;  2MHH A;  1SRA A;  1AVS A;  4GBA A;  4ICB A;  3FS7 A;  1RWY A;  2MA2 A;  1UHJ A;  1GQM A;  4XJK A;  3PAT A;  2DOQ A;  3OP0 A;  3I5H B;  2M7L A;  4USL A;  1ZAC A;  2A4J A;  2H2K A;  2KI4 C;  1QVI Z;  2NCO A;  1QV1 A;  2BE4 A;  1B4C A;  4JWQ A;  4YGD B;  3PLF B;  4GFT A;  3SG4 A;  3IF7 A;  4GUK A;  2V53 A;  1SR6 B;  1M46 A;  5DKR A;  4PE4 A;  1IJ5 A;  2BCA A;  1N65 A;  2LE9 B;  2JXL A;  1WLM A;  4MRX A;  2LVK A;  4I5L B;  5CSN A;  1Y0V H;  2I2R E;  2I94 A;  4QJ5 B;  1V1G A;  1JFK A;  2M8U A;  1QX7 A;  3PAL A;  4GGN A;  1DJH A;  1F55 A;  3TDI A;  3ZNI A;  4OV2 A;  2JT0 A;  2LVI A;  1BF5 A;  3AKB A;  2KBI A;  3O4Y A;  3HX4 A;  1XFY O;  4PCW A;  3BOW B;  3DVE A;  2M29 A;  1WRK A;  2E30 A;  1WY9 A;  1Y1A A;  1J1E A;  1NWD A;  1AP4 A;  2L5X B;  5DKQ A;  1EH2 A;  1NYA A;  1YVH A;  3FWB A;  3I5H C;  1N0Y A;  2LCP A;  2I18 A;  1RTP 1;  1KFX L;  2NXQ A;  1K93 D;  1B1G A;  4DRW A;  3SG7 A;  3SG3 A;  1CMG A;  4FQO A;  1IWQ A;  4ZCV A;  1LA3 A;  1YUT A;  5K89 A;  2Y4Q A;  3BUN B;  1XFU O;  1FBV A;  2KQ6 A;  4L9M A;  4ORA B;  2KFG A;  4CFQ A;  4D1E A;  1SR6 C;  1LIN A;  1NCZ A;  1CTR A;  1DMO A;  1F54 A;  1TNX A;  1RK9 A;  5AEQ A;  1EG4 A;  2NCP A;  1EXR A;  1MXE A;  3AAJ A;  1U5I B;  2M97 A;  1BOC A;  2M49 B;  1AHR A;  4F0Z B;  3O2P A;  2I7A A;  1UUS A;  2L50 A;  1IJ6 A;  1LVC D;  1SL8 A;  1S5G Y;  2KHN A;  5AAN A;  1KQM C;  1PSR A;  1AUI B;  1MWN A;  1FW4 A;  1IRJ A;  3LL8 B;  1SBJ A;  2COL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...