3SIAA

Crystal structure of ure3-binding protein, (d127a,n129a) mutant, iodide phased
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
214
structure length
212
Chain Sequence
NFCLWNLQPIQGSWMGAACIYQMPPSVRNTWWFPLLNTIPLDQYTRIYQWFMGVDRDRSGTLEINELMMGQFPGGIRLSPQTALRMMRIFDTDFNGHISFYEFMAMYKFMELAYNLFVMNARARSGTLEPHEILPALQQLGFYINQRTSLLLHRLFAMAFCDLNCWIAICAFAAQTRSAYQMIFMNPYYGPMKPFNPMEFGKFLDVVTSLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords URE3-BP sequence specific DNA binding protein
publication title Crystal structure of URE3-binding protein
rcsb
source organism Entamoeba histolytica
total genus 73
structure length 212
sequence length 214
ec nomenclature
pdb deposition date 2011-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3siaA01
1SKTA 3LK0A 3H4SE 4YI9A 4PDZA 1KQMB 1SR6B 1QLKA 1B4CA 5AANA 1AUIB 1YUSA 1K96A 1OMDA 4ETOA 1CLMA 3CR4X 1XA5A 3SIAA 3FWCA 5HLVA 2OTGC 1UP5A 2KAVA 1IJ5A 1LA3A 1QS7A 4PE4A 4OKHA 4QJ3B 2L5XB 1S6JA 2HQWA 5ER4X 2COLB 3JVTC 1CB1A 1LVCD 2GGZA 1TNXA 1IGVA 2L4HA 3VRPA 5HKZA 3O78A 1SL9A 1KFXS 1EG4A 2JULA 2AUCA 3OHMB 2PVBA 2L4IA 1DJXA 4WQ3A 1CFCA 1K95A 2MLFC 2PASA 4CIDA 1SY9A 2CNPA 4MRYA 1ZFSA 3EVVA 1L7ZA 1QIVA 2L0PA 1F55A 3I5GC 5AXIA 1CM4A 1UHHA 4P2YB 1DJYA 3O4YA 1GGZA 1YVLA 3ZNIA 3RM1A 1L2OB 1XFZO 3D0YB 4UPGA 4WQ2A 1M45A 1CFDA 1N65A 3DVJA 2JOJA 1DF0B 3WHTB 2I18A 1KK7Z 3O2PA 1CM1A 3OX5A 2KGRA 2MRDA 1G8IA 2HQ8A 1QVIZ 2L98A 2O5GA 3LLEA 4IL1A 3TDUA 3SG2A 4CFRA 1EL4A 3KF9A 1NWDA 1C7WA 1OE9B 3NSKA 2BCXA 1XVJA 2BCBA 2KI4B 4NDDA 1V1GA 1BMOA 1H8BA 3KO0A 4YGDB 2LMTA 1BR1B 3DVKA 1X02A 3SJSA 2CBLA 4ORBB 5G08A 1TCFA 1PSRA 3NSIA 1RJVA 4I5NB 1KWOB 2KI6D 4YGBB 2EGDA 3CS1A 1S3PA 2JXLA 1YRUB 1Y6WA 2G9BA 1OQPA 3I5FB 1SCMB 1ZUZA 3KPXA 1XFUO 3EVUA 5HKWA 3PM8A 1S6CA 1ALWA 1J7RA 5CPVA 1C07A 1B8LA 1QJTA 1SNLA 2AAOA 1BR4B 1PVAA 5DKNA 1NX1A 1GGWA 4U8DA 4BY5A 4GGFC 4C0LA 5ER5A 1FBVA 1NCYA 2K7DA 2BL0C 1ODBA 1XK4C 2MHHA 3I5HB 1R6PA 1HQVA 2JU0A 2JRFA 3GOFA 1J7QA 1AHRA 2NLNA 4AQIA 2O60A 2KAXA 4MLWA 1K94A 1SL7A 3SG5A 1B7TY 4ZCUA 1QX5B 1A4PA 1S36A 3AAJA 1DVIA 1YVHA 3OB2B 2M1UA 1J7PA 3SIBA 1S6IA 2MLEC 1C7VA 4YBHB 1TNPA 1NX0A 3DVMA 4DRWA 3LK1A 2K8MB 2HF5A 1BOCA 1YRTB 1OSAA 1XFXO 2P6BB 2JTTA 3OB1B 2GV5A 1S26D 5JJGA 3BUNB 2JPTA 1DT7B 1BU3A 1KSMA 1IKUA 1MHOA 1TNWA 2WCBA 2Y1NA 1ALVA 1PK0D 1NP8A 2M97A 1ZOTB 5KSZA 1QLSA 4HRGA 3FS7A 2KYFA 1J7OA 5KU1A 1EJ3A 2BKHB 3EKJA 1IJ6A 3AAKA 3NXAA 4PHKA 2LMVA 2TN4A 3TS5C 4MEWA 3I5IC 4AQJA 2JQ6A 4GNKB 1MQ1A 2F2PA 2H2KA 2ZN9A 2L50A 1N2DA 2QPTA 1OMRA 2JXCA 1IQ5A 3DF0A 5J3XA 2JC2A 1S5GZ 1JBAA 2BCAA 3MSEB 1B47A 1RFJA 1U5IB 5D7FA 5AFPA 2Q91A 3IQOA 2K0JA 1NUBA 3CLNA 3TUYB 1JC2A 2A4JA 1RWYA 2M0RA 3DF0B 1YUUA 1V1FA 2E6WA 1UWOA 1RK9A 2KQ6A 2F8PA 1W7JB 1IH0A 1MR8A 2WCFA 3VRNA 1PRWA 1KK7Y 1ZACA 2GGMA 4P5OE 4A4BA 2OS8C 1QVIY 3E3RA 1BT6A 1XYDA 5AERA 3NSOA 2NCPA 4N5XA 2CTNA 1WRKA 2K7BA 4I5KA 4GUKA 4HSZA 4GGNA 1LKJA 5AEQA 3D0YA 1F4QA 1YUTA 2KFGA 2FOTA 2LVIA 3FIAA 1WDCC 2KFFA 3VGOA 1FF1A 1H4BA 2LHLA 2KNEA 1DF0A 1FW4A 2JT8A 2KBMA 2NXQA 4GAOA 3CZTX 4OV2A 5I8NA 4I5LB 4MZLA 2WOSA 2EHBA 3BUWB 2V53A 1SK6D 4PHMA 3EVRA 1SYMA 2E30A 4MSPA 3JVTB 4C0KA 1DJZA 4MBEA 5IBWA 3OP0A 2PRUA 2ZN8A 2HPSA 3BUOB 4Q04A 1OOJA 1M31A 4OVNF 3BXKA 3BOWA 1XFYO 1RECA 2M49B 3PN7C 1UHNA 4YGEB 1W7IB 3TDZA 1NCZA 2MA2A 2ZNEA 4DCKA 1A29A 1CKKA 3SG3A 2Y1MA 4CFQA 1AVSA 2LCPA 3I5GB 3BOWB 2KI6C 1JWDA 4TNCA 2SCPA 4M2OA 2MBXA 5K89A 1SPYA 3GK1A 2LP2A 1KK8C 2K7CA 2ZRSA 1VRKA 2JT3A 2JNFA 3BYAA 4USLA 2JNXA 4GPLB 4YRUA 3CR5X 3BUXB 1OZOA 1JF2A 3CR2A 4PALA 2LVJA 2JZIA 1MF8B 3LCPC 2KQYA 4ZCVA 1K9PA 1CLBA 1TTXA 4BY4A 1LXFC 1A2XA 2BBMA 4YI8A 3CWGA 3LL8B 3WHUB 1DGVA 1SCVA 1D1OA 3EK8A 4NDBA 3D10A 1XO5A 2JTZA 4F0ZB 2LMUA 2DOQA 5D69A 2PALA 2K2FA 3AKAA 1J1EA 3TZ1A 3CGAA 1QV0A 2M29A 3PSRA 1NCXA 1A75B 5HLOA 1J55A 1DJIA 4R1EA 4M2QA 1NYAA 4GGFA 1TNQA 1FI5A 1F8HA 4CLNA 1AK8A 2K7OA 1K2HA 1G4YR 2LAPA 1CMFA 2ISDA 2LC5A 1NPQA 1YX8A 4QJ4B 2BBNA 2RGIA 1KFUS 1G33A 1KFXL 1SRAA 1CFPA 1BODA 4MN0A 2BE4A 2OPOA 1E8AA 4PCWA 1JF0A 2AMIA 4WRIA 2EC6C 1QASA 1S5GY 3K21A 5TNCA 1PULA 1K9KA 1R2UA 2M1KB 2M9GA 2G2BA 1SL8A 1HT9A 4OR9B 1CFFA 2FJUB 1FPWA 2LM5A 3EK7A 3SG4A 2WCEA 1J1DA 1NIWA 1UURA 3JTDC 4JWQA 2NZ0A 2H61A 5FYXA 1IQ3A 1KQMC 1SR6C 2VRGA 2LUCA 1U5IA 3BQ3A 1KQVA 1S1EA 3SG7A 1FI6A 3BUMB 1JSAA 5CSFA 2BECA 4L9MA 4HRHA 1UHJA 3DVEA 3ZWHA 4M2PA 5CSJA 5JOLA 2WNDA 4MZJA 1M46A 1CTRA 1M63B 1PVBA 2IS9A 4YGCB 1ZMZA 3KHEA 1NSHA 4N1GA 4PE0A 2L51A 1Y0VH 1RTP1 2I7AA 5HYDA 4ORCB 3RLZA 3AKBA 4PE1A 3I5IB 1RROA 3TS5B 4MVFA 1K8UA 5F6TA 1MXEA 2ZNDA 3C1VA 1B8CA 1B9AA 2KFHA 1OZSA 2I2RE 5HKYA 1AJ4A 5I2LA 5KTYA 3ICBA 2LHIA 2LLSA 2OTGB 1Y1UA 1PSBA 1A03A 1L2OC 2ZRTA 3F45A 1EG3A 4HREE 3WNXB 4NQGA 2WORA 5B8IB 4DIRA 5GQQC 1N0YA 2PMYA 4N1FA 3KEVA 5I2OA 1MXLC 4ICBA 2FCDA 2LNKA 2OS8B 1GQMA 1DTLA 2WC8A 2KI4C 2LANA 2MJWB 2JWWA 1KFUL 1PALA 2KHNA 4I5JA 3HCMA 4XYNA 1QX7A 1SBJA 1WDCB 1B8RA 3CTNA 2JT0A 1BF5A 1BG1A 1KWOC 4DS7A 2L2EA 4FQOA 3A8RA 2M7LA 3A4UB 2LP3A 1YR5A 1AJ5A 1M39A 1XFWO 3I5FC 1F71A 1SCMC 1GJYA 4MRXA 4E68A 4MZKA 5CSNA 2KOTA 1NX3A 2KYCA 1EH2A 2HETA 3PATA 4GBAA 1XFVO 1TOPA 2M7NA 2PSRA 2MAZA 2M8UA 2LVVA 1Y1XA 1YTZC 3PN7B 1IWQA 1DJGA 4A4CA 3I5HC 2QACA 4ORAB 1AP4A 1A75A 4YGAA 1EXRA 1DMOA 1JFKA 1WY9A 2CCMA 1K90D 1KSOA 2KAYA 3IQQA 1Y1AA 1TN4A 2ZKMX 1QXPA 2D8NA 5DKRA 1B1GA 1Q80A 5PALA 3QRXA 1KK8B 3PFVA 2KGBC 4CPVA 1DGUA 3PALA 3GK4X 2LV7A 1DJHA 5CSIA 4FTGA 1MWNA 1YX7A 2Q4UA 3WXAA 1XK4A 4PE7A 5I2QA 1JFJA 1YURA 2F3ZA 3EKHA 4PHJA 1K93D 3TDIA 1LINA 3SG6A 2F3YA 3GK2A 3VRQA 1F70A 4OCIA 2KBIA 2Y5IA 2B1UA 4C0JA 2I94A 3OX6A 1QATA 1BJFA 1CDPA 1QX2A 1UHKA 1CNPA 2BL0B 2M3WA 2Y4QA 1CLLA 1UHIA 2CXJA 3IF7A 4DUQA 2FCEA 2LVKA 1TIZA 4NDCA 1LA0A 4JPZB 1OMVA 3HX4A 1JUOA 3O6BA 1QV1A 2BKIB 2CT9A 1CDLA 1SMGA 4GFTA 1IG5A 1KCYA 1F54A 2LUXA 3DD4A 2F2OA 3PLFB 2KSPA 2K2AA 1CMGA 3M0WA 4PHNA 2LLUA 4JQ0D 1MUXA 1NX2A 4AOMA 1DJWA 1IRJA 1WLMA 1WRLA 5BPJA 1BLQA 1QIWA 2KDHA 3NSLA 4XJKA 2ZFDA 2H61C 4D1EA 1TCOB 2R2IA 2NCOA 1CDMA 2EC6B 3EK4A 1B7TZ 2LE9B 3VRRA 2BE6A 3TUYC 1F4OA 4QJ5B 3FWBA 1QTXA 1UUSA 1WLZA 2K61A 1SW8A 4XJKB 1CDNA 5DKQA 2LLTA 1TRFA 3VROA 1K9UA 2F33A 1WRZA 2SASA 3JTDB
chains in the Genus database with same CATH superfamily
1SKTA 2WC6A 3LK0A 1TUJA 3H4SE 4YI9A 4PDZA 1KQMB 1SR6B 1QLKA 1B4CA 5AANA 1AUIB 1YUSA 1K96A 1OMDA 3SS4A 4ETOA 3DYEA 3QMEA 1CLMA 3CR4X 1XA5A 3SIAA 3FWCA 5HLVA 2OTGC 1UP5A 2KAVA 1IJ5A 2QEVA 1LA3A 1QS7A 4PE4A 3BJHA 4OKHA 4QJ3B 2L5XB 1S6JA 2HQWA 5ER4X 2COLB 3JVTC 1OOIX 3B7AA 1LVCD 1CB1A 2GGZA 1TNXA 1OOGA 1IGVA 2L4HA 3VRPA 5HKZA 3O78A 1SL9A 1KFXS 1EG4A 2JULA 2H8VA 3B86A 2AUCA 3OHMB 2PVBA 2L4IA 1DJXA 4WQ3A 3O4XA 1CFCA 1K95A 2MLFC 2PASA 4CIDA 1SY9A 2CNPA 4MRYA 1ZFSA 3EVVA 1L7ZA 2BAPA 1QIVA 2L0PA 3NGVA 3D74A 1Z4HA 1F55A 3I5GC 5AXIA 1CM4A 1UHHA 4P2YB 1DJYA 3O4YA 3D78A 1OOHA 1GGZA 1YVLA 3ZNIA 1TWOA 1L2OB 1XFZO 3CZ1A 3D0YB 3RM1A 4UPGA 4WQ2A 1M45A 1CFDA 1N65A 3DVJA 2JOJA 1DF0B 3WHTB 2I18A 1KK7Z 3O2PA 1CM1A 3OX5A 2KGRA 2MRDA 1G8IA 2HQ8A 1QVIZ 2L98A 2O5GA 3LLEA 4IL1A 3TDUA 2KLDA 3SG2A 4CFRA 1EL4A 3KF9A 1NWDA 1C7WA 1OE9B 3NSKA 2BCXA 1XVJA 2BCBA 2KI4B 4NDDA 1V1GA 1BMOA 1H8BA 3KO0A 4YGDB 2LMTA 1BR1B 3DVKA 1X02A 3SJSA 2CBLA 2QEOA 4ORBB 5G08A 1TCFA 1PSRA 3NSIA 1RJVA 4I5NB 1KWOB 2KI6D 4YGBB 2K60A 3V2LA 2EGDA 3CS1A 1S3PA 2JXLA 1YRUB 1Y6WA 2G9BA 1OQPA 3I5FB 1SCMB 1ZUZA 3KPXA 1XFUO 5HL1A 2P71A 3EVUA 5HKWA 3IVTA 3PM8A 5I94A 2FJYA 1S6CA 1ALWA 1J7RA 5CPVA 1C07A 1B8LA 1QJTA 1SNLA 2AAOA 1BR4B 1PVAA 5DKNA 1DELA 1NX1A 1GGWA 4U8DA 4BY5A 4GGFC 4C0LA 5ER5A 1FBVA 1NCYA 2K7DA 2BL0C 1ODBA 1XK4C 2MHHA 3I5HB 1R6PA 1HQVA 5FI7A 1SSEB 2JU0A 2JRFA 3GOFA 3S0GA 1J7QA 1AHRA 2NLNA 1TUZA 4AQIA 2O60A 2KAXA 4MLWA 1K94A 1SL7A 3SG5A 1B7TY 4ZCUA 1QX5B 1A4PA 1S36A 3AAJA 1DVIA 1YVHA 3OB2B 2M1UA 1J7PA 3SIBA 1S6IA 2MLEC 1C7VA 4YBHB 1TNPA 1NX0A 3DVMA 4DRWA 2JPOA 3LK1A 2K8MB 2HF5A 1BOCA 1YRTB 1OSAA 1XFXO 2P6BB 2JTTA 3OB1B 2GV5A 1S26D 3Q8IA 3FE8A 5JJGA 3BUNB 2JPTA 1DT7B 1C3YA 1BU3A 1KSMA 1IKUA 1MHOA 1TNWA 2WCBA 4JD9A 2P70A 2Y1NA 1ALVA 1PK0D 3CZ0A 1NP8A 1QWVA 2M97A 1ZOTB 5D3OA 5KSZA 1QLSA 2ERBA 2PQLA 3FS7A 4HRGA 3SS5A 2KYFA 1J7OA 5KU1A 1EJ3A 2BKHB 3DZTA 3EKJA 1IJ6A 3AAKA 3NXAA 4PHKA 2LMVA 2TN4A 3TS5C 4MEWA 1DEKA 3I5IC 4AQJA 2WCLA 2JQ6A 3B88A 3NHIA 4GNKB 1MQ1A 2F2PA 3B6XA 3DXLA 2H2KA 2ZN9A 3PM2A 2L50A 1N2DA 2QPTA 1OMRA 2JXCA 1IQ5A 3DF0A 5J3XA 2JC2A 1S5GZ 3OBVA 1JBAA 2BCAA 3MSEB 3D73A 1B47A 1RFJA 1U5IB 3FE6A 5D7FA 5AFPA 2Q91A 3IQOA 2K0JA 1NUBA 3CLNA 3TUYB 1JC2A 2A4JA 1RWYA 2M0RA 3DF0B 1YUUA 1C3ZA 1V1FA 2E6WA 1UWOA 1RK9A 2KQ6A 5DICA 2F8PA 1W7JB 1IH0A 1MR8A 3CABA 2WCFA 3VRNA 1PRWA 1KK7Y 1ZACA 2GGMA 4P5OE 4A4BA 2OS8C 1QVIY 3E3RA 1BT6A 1XYDA 5AERA 3NSOA 2NCPA 4N5XA 2CTNA 1WRKA 2K7BA 4I5KA 4GUKA 4HSZA 4KYNA 3S0EA 4GGNA 1LKJA 2QEBA 5AEQA 3D0YA 1DC1A 1F4QA 1YUTA 2KFGA 2FOTA 2LVIA 3FIAA 1WDCC 2KFFA 3VGOA 1FF1A 1OOFA 2LHLA 1H4BA 3CZ2A 2KNEA 1DF0A 1FW4A 2JT8A 2KBMA 2NXQA 4GAOA 3CZTX 4OV2A 5I8NA 4I5LB 3D77A 4MZLA 2WOSA 2EHBA 3BUWB 2V53A 1SK6D 4PHMA 3EVRA 1SYMA 2E30A 4MSPA 3JVTB 4C0KA 1DJZA 4MBEA 5IBWA 3OP0A 2PRUA 2ZN8A 3NHTA 2HPSA 3BUOB 4Q04A 1OOJA 1M31A 4OVNF 3BXKA 3BOWA 1XFYO 1RECA 2M49B 3PN7C 1UHNA 4YGEB 1W7IB 3TDZA 1NCZA 2MA2A 2ZNEA 4DCKA 1A29A 1CKKA 3SG3A 2Y1MA 4CFQA 3BFBA 1AVSA 2LCPA 3I5GB 3BOWB 2KI6C 1JWDA 4INWA 2SCPA 4M2OA 4TNCA 2MBXA 2KPHA 5K89A 1SPYA 3GK1A 2LP2A 1KK8C 2K7CA 5EL2A 2ZRSA 1VRKA 1XFRA 2JT3A 2JNFA 3BYAA 4USLA 2JNXA 4GPLB 4YRUA 3CR5X 3BUXB 1OZOA 1ORGA 1JF2A 3CR2A 4PALA 2LVJA 2JZIA 3D76A 1MF8B 3LCPC 2KQYA 4ZCVA 1K9PA 1CLBA 1TTXA 4BY4A 1LXFC 1A2XA 3CDNA 2BBMA 4YI8A 3CWGA 3LL8B 3SS3A 1DGVA 1SCVA 3WHUB 1D1OA 3EK8A 4NDBA 3D10A 1XO5A 2JTZA 4F0ZB 2LMUA 2WC5A 1P28A 2DOQA 5D69A 2PALA 2K2FA 3AKAA 1J1EA 3TZ1A 3CGAA 1QV0A 2M29A 3PSRA 3R1OA 1NCXA 1A75B 3OGNA 5HLOA 1J55A 1DJIA 4R1EA 4M2QA 1NYAA 4GGFA 1TNQA 1FI5A 1F8HA 4CLNA 1AK8A 2K7OA 1K2HA 3L4LA 1G4YR 3BFHA 2LAPA 1CMFA 2ISDA 2LC5A 1NPQA 1YX8A 4QJ4B 2L2CA 4OZDA 2BBNA 2RGIA 1KFUS 1G33A 1KFXL 1SRAA 2QDIA 1CFPA 1BODA 4MN0A 2BE4A 2OPOA 1LS8A 1E8AA 3R1VA 4PCWA 1JF0A 2AMIA 4WRIA 2EC6C 1QASA 1S5GY 3K21A 5TNCA 1PULA 1K9KA 1R2UA 2M1KB 2M9GA 2G2BA 1SL8A 3S0BA 1HT9A 4OR9B 1CFFA 2FJUB 1DQEA 1FPWA 2LM5A 3EK7A 3R72A 2WCEA 3SG4A 4JKTA 1J1DA 1NIWA 1UURA 3JTDC 4JWQA 3S0AA 3S0FA 2NZ0A 2H61A 5FYXA 1IQ3A 1KQMC 1SR6C 2VRGA 2LUCA 1U5IA 2WCMA 3BQ3A 1S1EA 1KQVA 4PT1A 3SG7A 1FI6A 3BUMB 1JSAA 5CSFA 2BECA 4L9MA 1OW4A 4HRHA 1UHJA 3DVEA 3ZWHA 4M2PA 5CSJA 5JOLA 2WNDA 4MZJA 1M46A 1CTRA 1M63B 1PVBA 2IS9A 2PYQA 4YGCB 1ZMZA 2WCHA 3KHEA 3EG5B 1NSHA 4N1GA 2QEHA 4PE0A 3UO9A 2L51A 1Y0VH 1RTP1 2I7AA 3RZSA 5HYDA 4ORCB 3RLZA 2KLEA 3AKBA 4PE1A 3I5IB 1RROA 3TS5B 4MVFA 1K8UA 5F6TA 1MXEA 2ZNDA 3C1VA 4F7FA 1B8CA 1B9AA 2KFHA 1OZSA 2I2RE 5HKYA 1AJ4A 1Z2CB 5I2LA 5KTYA 3ICBA 2LHIA 2LLSA 2OTGB 1Y1UA 1PSBA 1A03A 1L2OC 2ZRTA 3F45A 1EG3A 4HREE 3WNXB 2WCJA 4NQGA 2WORA 2BNXA 5B8IB 4DIRA 5GQQC 1N0YA 3N7HA 2PMYA 4N1FA 3KEVA 5I2OA 1MXLC 3BFAA 4ICBA 2FCDA 2LNKA 2OS8B 1GQMA 1DTLA 2WC8A 2KI4C 2LANA 2MJWB 2JWWA 1KFUL 1W9ZA 1PALA 2KHNA 4I5JA 3HCMA 4XYNA 1QX7A 1SBJA 1WDCB 1B8RA 3CTNA 2JT0A 3VB1A 1BF5A 1BG1A 1KWOC 4DS7A 2L2EA 4FQOA 3A8RA 2M7LA 3A4UB 2LP3A 3CYZA 1YR5A 1AJ5A 1M39A 1XFWO 3I5FC 1F71A 1SCMC 1GM0A 1GJYA 4MRXA 4E68A 4MZKA 5CSNA 2KOTA 1NX3A 5FI2A 2KYCA 1EH2A 2HETA 3PATA 4GBAA 1XFVO 1TOPA 2M7NA 2PSRA 2MAZA 1T14A 2M8UA 2LVVA 1Y1XA 1YTZC 3FE9A 1IWQA 1DJGA 3PN7B 4A4CA 3I5HC 2QACA 4ORAB 1AP4A 1A75A 2L5YA 4YGAA 1EXRA 1DMOA 1JFKA 1WY9A 2CCMA 1K90D 1KSOA 2KAYA 3IQQA 1Y1AA 3K1EA 1TN4A 4IJ7A 2ZKMX 1QXPA 2D8NA 5DKRA 1B1GA 1Q80A 5PALA 4INXA 3QRXA 1KK8B 2YGUA 3PFVA 2KGBC 4CPVA 1DGUA 3PALA 3GK4X 3B87A 2LV7A 1DJHA 5CSIA 4FTGA 1MWNA 1YX7A 2Q4UA 3WXAA 1XK4A 4PE7A 5I2QA 1JFJA 1IIOA 1YURA 2F3ZA 3EKHA 4PHJA 1K93D 3TDIA 1LINA 3SG6A 2F3YA 3GK2A 3VRQA 1F70A 4OCIA 2KBIA 2Y5IA 2B1UA 4C0JA 2I94A 3OX6A 1QATA 1BJFA 1CDPA 1QX2A 1UHKA 1CNPA 2BL0B 2GTEA 2M3WA 2Y4QA 3R1PA 3S0DA 1CLLA 1UHIA 2CXJA 3IF7A 4DUQA 2FCEA 2LVKA 1TIZA 4FQTA 1LA0A 2WCKA 4NDCA 4JPZB 1OMVA 3HX4A 1JUOA 3O6BA 1QV1A 2BKIB 2CT9A 3D75A 1CDLA 1SMGA 4GFTA 1IG5A 3PJIA 1KCYA 1F54A 2LUXA 3DD4A 2F2OA 3PLFB 3L47A 2KSPA 2K2AA 5FI6A 1CMGA 3M0WA 4PHNA 2LLUA 4JQ0D 1MUXA 1NX2A 4AOMA 1DJWA 1IRJA 1WLMA 1WRLA 5BPJA 1BLQA 1QIWA 2KDHA 3NSLA 4XJKA 2ZFDA 2H61C 4D1EA 1TCOB 2R2IA 2NCOA 1CDMA 2EC6B 3EK4A 1B7TZ 2LE9B 3VRRA 2BE6A 3TUYC 1F4OA 3L4AA 3FWBA 4QJ5B 1QTXA 1UUSA 1WLZA 2K61A 3DY9A 1SW8A 4XJKB 1CDNA 5DKQA 2LLTA 1TRFA 3VROA 1K9UA 2F33A 1WRZA 2SASA 3UNWA 3JTDB
chains in the Genus database with same CATH topology
1SKTA 3LK0A 3H4SE 4YI9A 4PDZA 1KQMB 1SR6B 1QLKA 1B4CA 5AANA 1AUIB 1YUSA 1K96A 1OMDA 4ETOA 1CLMA 3CR4X 1XA5A 3SIAA 3FWCA 5HLVA 2OTGC 1UP5A 2KAVA 1IJ5A 1LA3A 1QS7A 4PE4A 4OKHA 4QJ3B 2L5XB 1S6JA 2HQWA 5ER4X 2COLB 3JVTC 1CB1A 1LVCD 2GGZA 1TNXA 1IGVA 2L4HA 3VRPA 5HKZA 3O78A 1SL9A 1KFXS 1EG4A 2JULA 2AUCA 3OHMB 2PVBA 2L4IA 1DJXA 4WQ3A 1CFCA 1K95A 2MLFC 2PASA 4CIDA 1SY9A 2CNPA 4MRYA 1ZFSA 3EVVA 1L7ZA 1QIVA 2L0PA 1F55A 3I5GC 5AXIA 1CM4A 1UHHA 4P2YB 1DJYA 3O4YA 1GGZA 1YVLA 3ZNIA 3RM1A 1L2OB 1XFZO 3D0YB 4UPGA 4WQ2A 1M45A 1CFDA 1N65A 3DVJA 2JOJA 1DF0B 3WHTB 2I18A 1KK7Z 3O2PA 1CM1A 3OX5A 2KGRA 2MRDA 1G8IA 2HQ8A 1QVIZ 2L98A 2O5GA 3LLEA 4IL1A 3TDUA 3SG2A 4CFRA 1EL4A 3KF9A 1NWDA 1C7WA 1OE9B 3NSKA 2BCXA 1XVJA 2BCBA 2KI4B 4NDDA 1V1GA 1BMOA 1H8BA 3KO0A 4YGDB 2LMTA 1BR1B 3DVKA 1X02A 3SJSA 2CBLA 4ORBB 5G08A 1TCFA 1PSRA 3NSIA 1RJVA 4I5NB 1KWOB 2KI6D 4YGBB 2EGDA 3CS1A 1S3PA 2JXLA 1YRUB 1Y6WA 2G9BA 1OQPA 3I5FB 1SCMB 1ZUZA 3KPXA 1XFUO 3EVUA 5HKWA 3PM8A 1S6CA 1ALWA 1J7RA 5CPVA 1C07A 1B8LA 1QJTA 1SNLA 2AAOA 1BR4B 1PVAA 5DKNA 1NX1A 1GGWA 4U8DA 4BY5A 4GGFC 4C0LA 5ER5A 1FBVA 1NCYA 2K7DA 2BL0C 1ODBA 1XK4C 2MHHA 3I5HB 1R6PA 1HQVA 2JU0A 2JRFA 3GOFA 1J7QA 1AHRA 2NLNA 4AQIA 2O60A 2KAXA 4MLWA 1K94A 1SL7A 3SG5A 1B7TY 4ZCUA 1QX5B 1A4PA 1S36A 3AAJA 1DVIA 1YVHA 3OB2B 2M1UA 1J7PA 3SIBA 1S6IA 2MLEC 1C7VA 4YBHB 1TNPA 1NX0A 3DVMA 4DRWA 3LK1A 2K8MB 2HF5A 1BOCA 1YRTB 1OSAA 1XFXO 2P6BB 2JTTA 3OB1B 2GV5A 1S26D 5JJGA 3BUNB 2JPTA 1DT7B 1BU3A 1KSMA 1IKUA 1MHOA 1TNWA 2WCBA 2Y1NA 1ALVA 1PK0D 1NP8A 2M97A 1ZOTB 5KSZA 1QLSA 4HRGA 3FS7A 2KYFA 1J7OA 5KU1A 1EJ3A 2BKHB 3EKJA 1IJ6A 3AAKA 3NXAA 4PHKA 2LMVA 2TN4A 3TS5C 4MEWA 3I5IC 4AQJA 2JQ6A 4GNKB 1MQ1A 2F2PA 2H2KA 2ZN9A 2L50A 1N2DA 2QPTA 1OMRA 2JXCA 1IQ5A 3DF0A 5J3XA 2JC2A 1S5GZ 1JBAA 2BCAA 3MSEB 1B47A 1RFJA 1U5IB 5D7FA 5AFPA 2Q91A 3IQOA 2K0JA 1NUBA 3CLNA 3TUYB 1JC2A 2A4JA 1RWYA 2M0RA 3DF0B 1YUUA 1V1FA 2E6WA 1UWOA 1RK9A 2KQ6A 2F8PA 1W7JB 1IH0A 1MR8A 2WCFA 3VRNA 1PRWA 1KK7Y 1ZACA 2GGMA 4P5OE 4A4BA 2OS8C 1QVIY 3E3RA 1BT6A 1XYDA 5AERA 3NSOA 2NCPA 4N5XA 2CTNA 1WRKA 2K7BA 4I5KA 4GUKA 4HSZA 4GGNA 1LKJA 5AEQA 3D0YA 1F4QA 1YUTA 2KFGA 2FOTA 2LVIA 3FIAA 1WDCC 2KFFA 3VGOA 1FF1A 1H4BA 2LHLA 2KNEA 1DF0A 1FW4A 2JT8A 2KBMA 2NXQA 4GAOA 3CZTX 4OV2A 5I8NA 4I5LB 4MZLA 2WOSA 2EHBA 3BUWB 2V53A 1SK6D 4PHMA 3EVRA 1SYMA 2E30A 4MSPA 3JVTB 4C0KA 1DJZA 4MBEA 5IBWA 3OP0A 2PRUA 2ZN8A 2HPSA 3BUOB 4Q04A 1OOJA 1M31A 4OVNF 3BXKA 3BOWA 1XFYO 1RECA 2M49B 3PN7C 1UHNA 4YGEB 1W7IB 3TDZA 1NCZA 2MA2A 2ZNEA 4DCKA 1A29A 1CKKA 3SG3A 2Y1MA 4CFQA 1AVSA 2LCPA 3I5GB 3BOWB 2KI6C 1JWDA 4TNCA 2SCPA 4M2OA 2MBXA 5K89A 1SPYA 3GK1A 2LP2A 1KK8C 2K7CA 2ZRSA 1VRKA 2JT3A 2JNFA 3BYAA 4USLA 2JNXA 4GPLB 4YRUA 3CR5X 3BUXB 1OZOA 1JF2A 3CR2A 4PALA 2LVJA 2JZIA 1MF8B 3LCPC 2KQYA 4ZCVA 1K9PA 1CLBA 1TTXA 4BY4A 1LXFC 1A2XA 2BBMA 4YI8A 3CWGA 3LL8B 3WHUB 1DGVA 1SCVA 1D1OA 3EK8A 4NDBA 3D10A 1XO5A 2JTZA 4F0ZB 2LMUA 2DOQA 5D69A 2PALA 2K2FA 3AKAA 1J1EA 3TZ1A 3CGAA 1QV0A 2M29A 3PSRA 1NCXA 1A75B 5HLOA 1J55A 1DJIA 4R1EA 4M2QA 1NYAA 4GGFA 1TNQA 1FI5A 1F8HA 4CLNA 1AK8A 2K7OA 1K2HA 1G4YR 2LAPA 1CMFA 2ISDA 2LC5A 1NPQA 1YX8A 4QJ4B 2BBNA 2RGIA 1KFUS 1G33A 1KFXL 1SRAA 1CFPA 1BODA 4MN0A 2BE4A 2OPOA 1E8AA 4PCWA 1JF0A 2AMIA 4WRIA 2EC6C 1QASA 1S5GY 3K21A 5TNCA 1PULA 1K9KA 1R2UA 2M1KB 2M9GA 2G2BA 1SL8A 1HT9A 4OR9B 1CFFA 2FJUB 1FPWA 2LM5A 3EK7A 3SG4A 2WCEA 1J1DA 1NIWA 1UURA 3JTDC 4JWQA 2NZ0A 2H61A 5FYXA 1IQ3A 1KQMC 1SR6C 2VRGA 2LUCA 1U5IA 3BQ3A 1KQVA 1S1EA 3SG7A 1FI6A 3BUMB 1JSAA 5CSFA 2BECA 4L9MA 4HRHA 1UHJA 3DVEA 3ZWHA 4M2PA 5CSJA 5JOLA 2WNDA 4MZJA 1M46A 1CTRA 1M63B 1PVBA 2IS9A 4YGCB 1ZMZA 3KHEA 1NSHA 4N1GA 4PE0A 2L51A 1Y0VH 1RTP1 2I7AA 5HYDA 4ORCB 3RLZA 3AKBA 4PE1A 3I5IB 1RROA 3TS5B 4MVFA 1K8UA 5F6TA 1MXEA 2ZNDA 3C1VA 1B8CA 1B9AA 2KFHA 1OZSA 2I2RE 5HKYA 1AJ4A 5I2LA 5KTYA 3ICBA 2LHIA 2LLSA 2OTGB 1Y1UA 1PSBA 1A03A 1L2OC 2ZRTA 3F45A 1EG3A 4HREE 3WNXB 4NQGA 2WORA 5B8IB 4DIRA 5GQQC 1N0YA 2PMYA 4N1FA 3KEVA 5I2OA 1MXLC 4ICBA 2FCDA 2LNKA 2OS8B 1GQMA 1DTLA 2WC8A 2KI4C 2LANA 2MJWB 2JWWA 1KFUL 1PALA 2KHNA 4I5JA 3HCMA 4XYNA 1QX7A 1SBJA 1WDCB 1B8RA 3CTNA 2JT0A 1BF5A 1BG1A 1KWOC 4DS7A 2L2EA 4FQOA 3A8RA 2M7LA 3A4UB 2LP3A 1YR5A 1AJ5A 1M39A 1XFWO 3I5FC 1F71A 1SCMC 1GJYA 4MRXA 4E68A 4MZKA 5CSNA 2KOTA 1NX3A 2KYCA 1EH2A 2HETA 3PATA 4GBAA 1XFVO 1TOPA 2M7NA 2PSRA 2MAZA 2M8UA 2LVVA 1Y1XA 1YTZC 3PN7B 1IWQA 1DJGA 4A4CA 3I5HC 2QACA 4ORAB 1AP4A 1A75A 4YGAA 1EXRA 1DMOA 1JFKA 1WY9A 2CCMA 1K90D 1KSOA 2KAYA 3IQQA 1Y1AA 1TN4A 2ZKMX 1QXPA 2D8NA 5DKRA 1B1GA 1Q80A 5PALA 3QRXA 1KK8B 3PFVA 2KGBC 4CPVA 1DGUA 3PALA 3GK4X 2LV7A 1DJHA 5CSIA 4FTGA 1MWNA 1YX7A 2Q4UA 3WXAA 1XK4A 4PE7A 5I2QA 1JFJA 1YURA 2F3ZA 3EKHA 4PHJA 1K93D 3TDIA 1LINA 3SG6A 2F3YA 3GK2A 3VRQA 1F70A 4OCIA 2KBIA 2Y5IA 2B1UA 4C0JA 2I94A 3OX6A 1QATA 1BJFA 1CDPA 1QX2A 1UHKA 1CNPA 2BL0B 2M3WA 2Y4QA 1CLLA 1UHIA 2CXJA 3IF7A 4DUQA 2FCEA 2LVKA 1TIZA 4NDCA 1LA0A 4JPZB 1OMVA 3HX4A 1JUOA 3O6BA 1QV1A 2BKIB 2CT9A 1CDLA 1SMGA 4GFTA 1IG5A 1KCYA 1F54A 2LUXA 3DD4A 2F2OA 3PLFB 2KSPA 2K2AA 1CMGA 3M0WA 4PHNA 2LLUA 4JQ0D 1MUXA 1NX2A 4AOMA 1DJWA 1IRJA 1WLMA 1WRLA 5BPJA 1BLQA 1QIWA 2KDHA 3NSLA 4XJKA 2ZFDA 2H61C 4D1EA 1TCOB 2R2IA 2NCOA 1CDMA 2EC6B 3EK4A 1B7TZ 2LE9B 3VRRA 2BE6A 3TUYC 1F4OA 4QJ5B 3FWBA 1QTXA 1UUSA 1WLZA 2K61A 1SW8A 4XJKB 1CDNA 5DKQA 2LLTA 1TRFA 3VROA 1K9UA 2F33A 1WRZA 2SASA 3JTDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SKT A;  3LK0 A;  3H4S E;  4YI9 A;  4PDZ A;  1KQM B;  1SR6 B;  1QLK A;  1B4C A;  5AAN A;  1AUI B;  1YUS A;  1K96 A;  1OMD A;  4ETO A;  1CLM A;  3CR4 X;  1XA5 A;  3SIA A;  3FWC A;  5HLV A;  2OTG C;  1UP5 A;  2KAV A;  1IJ5 A;  1LA3 A;  1QS7 A;  4PE4 A;  4OKH A;  4QJ3 B;  2L5X B;  1S6J A;  2HQW A;  5ER4 X;  2COL B;  3JVT C;  1CB1 A;  1LVC D;  2GGZ A;  1TNX A;  1IGV A;  2L4H A;  3VRP A;  5HKZ A;  3O78 A;  1SL9 A;  1KFX S;  1EG4 A;  2JUL A;  2AUC A;  3OHM B;  2PVB A;  2L4I A;  1DJX A;  4WQ3 A;  1CFC A;  1K95 A;  2MLF C;  2PAS A;  4CID A;  1SY9 A;  2CNP A;  4MRY A;  1ZFS A;  3EVV A;  1L7Z A;  1QIV A;  2L0P A;  1F55 A;  3I5G C;  5AXI A;  1CM4 A;  1UHH A;  4P2Y B;  1DJY A;  3O4Y A;  1GGZ A;  1YVL A;  3ZNI A;  3RM1 A;  1L2O B;  1XFZ O;  3D0Y B;  4UPG A;  4WQ2 A;  1M45 A;  1CFD A;  1N65 A;  3DVJ A;  2JOJ A;  1DF0 B;  3WHT B;  2I18 A;  1KK7 Z;  3O2P A;  1CM1 A;  3OX5 A;  2KGR A;  2MRD A;  1G8I A;  2HQ8 A;  1QVI Z;  2L98 A;  2O5G A;  3LLE A;  4IL1 A;  3TDU A;  3SG2 A;  4CFR A;  1EL4 A;  3KF9 A;  1NWD A;  1C7W A;  1OE9 B;  3NSK A;  2BCX A;  1XVJ A;  2BCB A;  2KI4 B;  4NDD A;  1V1G A;  1BMO A;  1H8B A;  3KO0 A;  4YGD B;  2LMT A;  1BR1 B;  3DVK A;  1X02 A;  3SJS A;  2CBL A;  4ORB B;  5G08 A;  1TCF A;  1PSR A;  3NSI A;  1RJV A;  4I5N B;  1KWO B;  2KI6 D;  4YGB B;  2EGD A;  3CS1 A;  1S3P A;  2JXL A;  1YRU B;  1Y6W A;  2G9B A;  1OQP A;  3I5F B;  1SCM B;  1ZUZ A;  3KPX A;  1XFU O;  3EVU A;  5HKW A;  3PM8 A;  1S6C A;  1ALW A;  1J7R A;  5CPV A;  1C07 A;  1B8L A;  1QJT A;  1SNL A;  2AAO A;  1BR4 B;  1PVA A;  5DKN A;  1NX1 A;  1GGW A;  4U8D A;  4BY5 A;  4GGF C;  4C0L A;  5ER5 A;  1FBV A;  1NCY A;  2K7D A;  2BL0 C;  1ODB A;  1XK4 C;  2MHH A;  3I5H B;  1R6P A;  1HQV A;  2JU0 A;  2JRF A;  3GOF A;  1J7Q A;  1AHR A;  2NLN A;  4AQI A;  2O60 A;  2KAX A;  4MLW A;  1K94 A;  1SL7 A;  3SG5 A;  1B7T Y;  4ZCU A;  1QX5 B;  1A4P A;  1S36 A;  3AAJ A;  1DVI A;  1YVH A;  3OB2 B;  2M1U A;  1J7P A;  3SIB A;  1S6I A;  2MLE C;  1C7V A;  4YBH B;  1TNP A;  1NX0 A;  3DVM A;  4DRW A;  3LK1 A;  2K8M B;  2HF5 A;  1BOC A;  1YRT B;  1OSA A;  1XFX O;  2P6B B;  2JTT A;  3OB1 B;  2GV5 A;  1S26 D;  5JJG A;  3BUN B;  2JPT A;  1DT7 B;  1BU3 A;  1KSM A;  1IKU A;  1MHO A;  1TNW A;  2WCB A;  2Y1N A;  1ALV A;  1PK0 D;  1NP8 A;  2M97 A;  1ZOT B;  5KSZ A;  1QLS A;  4HRG A;  3FS7 A;  2KYF A;  1J7O A;  5KU1 A;  1EJ3 A;  2BKH B;  3EKJ A;  1IJ6 A;  3AAK A;  3NXA A;  4PHK A;  2LMV A;  2TN4 A;  3TS5 C;  4MEW A;  3I5I C;  4AQJ A;  2JQ6 A;  4GNK B;  1MQ1 A;  2F2P A;  2H2K A;  2ZN9 A;  2L50 A;  1N2D A;  2QPT A;  1OMR A;  2JXC A;  1IQ5 A;  3DF0 A;  5J3X A;  2JC2 A;  1S5G Z;  1JBA A;  2BCA A;  3MSE B;  1B47 A;  1RFJ A;  1U5I B;  5D7F A;  5AFP A;  2Q91 A;  3IQO A;  2K0J A;  1NUB A;  3CLN A;  3TUY B;  1JC2 A;  2A4J A;  1RWY A;  2M0R A;  3DF0 B;  1YUU A;  1V1F A;  2E6W A;  1UWO A;  1RK9 A;  2KQ6 A;  2F8P A;  1W7J B;  1IH0 A;  1MR8 A;  2WCF A;  3VRN A;  1PRW A;  1KK7 Y;  1ZAC A;  2GGM A;  4P5O E;  4A4B A;  2OS8 C;  1QVI Y;  3E3R A;  1BT6 A;  1XYD A;  5AER A;  3NSO A;  2NCP A;  4N5X A;  2CTN A;  1WRK A;  2K7B A;  4I5K A;  4GUK A;  4HSZ A;  4GGN A;  1LKJ A;  5AEQ A;  3D0Y A;  1F4Q A;  1YUT A;  2KFG A;  2FOT A;  2LVI A;  3FIA A;  1WDC C;  2KFF A;  3VGO A;  1FF1 A;  1H4B A;  2LHL A;  2KNE A;  1DF0 A;  1FW4 A;  2JT8 A;  2KBM A;  2NXQ A;  4GAO A;  3CZT X;  4OV2 A;  5I8N A;  4I5L B;  4MZL A;  2WOS A;  2EHB A;  3BUW B;  2V53 A;  1SK6 D;  4PHM A;  3EVR A;  1SYM A;  2E30 A;  4MSP A;  3JVT B;  4C0K A;  1DJZ A;  4MBE A;  5IBW A;  3OP0 A;  2PRU A;  2ZN8 A;  2HPS A;  3BUO B;  4Q04 A;  1OOJ A;  1M31 A;  4OVN F;  3BXK A;  3BOW A;  1XFY O;  1REC A;  2M49 B;  3PN7 C;  1UHN A;  4YGE B;  1W7I B;  3TDZ A;  1NCZ A;  2MA2 A;  2ZNE A;  4DCK A;  1A29 A;  1CKK A;  3SG3 A;  2Y1M A;  4CFQ A;  1AVS A;  2LCP A;  3I5G B;  3BOW B;  2KI6 C;  1JWD A;  4TNC A;  2SCP A;  4M2O A;  2MBX A;  5K89 A;  1SPY A;  3GK1 A;  2LP2 A;  1KK8 C;  2K7C A;  2ZRS A;  1VRK A;  2JT3 A;  2JNF A;  3BYA A;  4USL A;  2JNX A;  4GPL B;  4YRU A;  3CR5 X;  3BUX B;  1OZO A;  1JF2 A;  3CR2 A;  4PAL A;  2LVJ A;  2JZI A;  1MF8 B;  3LCP C;  2KQY A;  4ZCV A;  1K9P A;  1CLB A;  1TTX A;  4BY4 A;  1LXF C;  1A2X A;  2BBM A;  4YI8 A;  3CWG A;  3LL8 B;  3WHU B;  1DGV A;  1SCV A;  1D1O A;  3EK8 A;  4NDB A;  3D10 A;  1XO5 A;  2JTZ A;  4F0Z B;  2LMU A;  2DOQ A;  5D69 A;  2PAL A;  2K2F A;  3AKA A;  1J1E A;  3TZ1 A;  3CGA A;  1QV0 A;  2M29 A;  3PSR A;  1NCX A;  1A75 B;  5HLO A;  1J55 A;  1DJI A;  4R1E A;  4M2Q A;  1NYA A;  4GGF A;  1TNQ A;  1FI5 A;  1F8H A;  4CLN A;  1AK8 A;  2K7O A;  1K2H A;  1G4Y R;  2LAP A;  1CMF A;  2ISD A;  2LC5 A;  1NPQ A;  1YX8 A;  4QJ4 B;  2BBN A;  2RGI A;  1KFU S;  1G33 A;  1KFX L;  1SRA A;  1CFP A;  1BOD A;  4MN0 A;  2BE4 A;  2OPO A;  1E8A A;  4PCW A;  1JF0 A;  2AMI A;  4WRI A;  2EC6 C;  1QAS A;  1S5G Y;  3K21 A;  5TNC A;  1PUL A;  1K9K A;  1R2U A;  2M1K B;  2M9G A;  2G2B A;  1SL8 A;  1HT9 A;  4OR9 B;  1CFF A;  2FJU B;  1FPW A;  2LM5 A;  3EK7 A;  3SG4 A;  2WCE A;  1J1D A;  1NIW A;  1UUR A;  3JTD C;  4JWQ A;  2NZ0 A;  2H61 A;  5FYX A;  1IQ3 A;  1KQM C;  1SR6 C;  2VRG A;  2LUC A;  1U5I A;  3BQ3 A;  1KQV A;  1S1E A;  3SG7 A;  1FI6 A;  3BUM B;  1JSA A;  5CSF A;  2BEC A;  4L9M A;  4HRH A;  1UHJ A;  3DVE A;  3ZWH A;  4M2P A;  5CSJ A;  5JOL A;  2WND A;  4MZJ A;  1M46 A;  1CTR A;  1M63 B;  1PVB A;  2IS9 A;  4YGC B;  1ZMZ A;  3KHE A;  1NSH A;  4N1G A;  4PE0 A;  2L51 A;  1Y0V H;  1RTP 1;  2I7A A;  5HYD A;  4ORC B;  3RLZ A;  3AKB A;  4PE1 A;  3I5I B;  1RRO A;  3TS5 B;  4MVF A;  1K8U A;  5F6T A;  1MXE A;  2ZND A;  3C1V A;  1B8C A;  1B9A A;  2KFH A;  1OZS A;  2I2R E;  5HKY A;  1AJ4 A;  5I2L A;  5KTY A;  3ICB A;  2LHI A;  2LLS A;  2OTG B;  1Y1U A;  1PSB A;  1A03 A;  1L2O C;  2ZRT A;  3F45 A;  1EG3 A;  4HRE E;  3WNX B;  4NQG A;  2WOR A;  5B8I B;  4DIR A;  5GQQ C;  1N0Y A;  2PMY A;  4N1F A;  3KEV A;  5I2O A;  1MXL C;  4ICB A;  2FCD A;  2LNK A;  2OS8 B;  1GQM A;  1DTL A;  2WC8 A;  2KI4 C;  2LAN A;  2MJW B;  2JWW A;  1KFU L;  1PAL A;  2KHN A;  4I5J A;  3HCM A;  4XYN A;  1QX7 A;  1SBJ A;  1WDC B;  1B8R A;  3CTN A;  2JT0 A;  1BF5 A;  1BG1 A;  1KWO C;  4DS7 A;  2L2E A;  4FQO A;  3A8R A;  2M7L A;  3A4U B;  2LP3 A;  1YR5 A;  1AJ5 A;  1M39 A;  1XFW O;  3I5F C;  1F71 A;  1SCM C;  1GJY A;  4MRX A;  4E68 A;  4MZK A;  5CSN A;  2KOT A;  1NX3 A;  2KYC A;  1EH2 A;  2HET A;  3PAT A;  4GBA A;  1XFV O;  1TOP A;  2M7N A;  2PSR A;  2MAZ A;  2M8U A;  2LVV A;  1Y1X A;  1YTZ C;  3PN7 B;  1IWQ A;  1DJG A;  4A4C A;  3I5H C;  2QAC A;  4ORA B;  1AP4 A;  1A75 A;  4YGA A;  1EXR A;  1DMO A;  1JFK A;  1WY9 A;  2CCM A;  1K90 D;  1KSO A;  2KAY A;  3IQQ A;  1Y1A A;  1TN4 A;  2ZKM X;  1QXP A;  2D8N A;  5DKR A;  1B1G A;  1Q80 A;  5PAL A;  3QRX A;  1KK8 B;  3PFV A;  2KGB C;  4CPV A;  1DGU A;  3PAL A;  3GK4 X;  2LV7 A;  1DJH A;  5CSI A;  4FTG A;  1MWN A;  1YX7 A;  2Q4U A;  3WXA A;  1XK4 A;  4PE7 A;  5I2Q A;  1JFJ A;  1YUR A;  2F3Z A;  3EKH A;  4PHJ A;  1K93 D;  3TDI A;  1LIN A;  3SG6 A;  2F3Y A;  3GK2 A;  3VRQ A;  1F70 A;  4OCI A;  2KBI A;  2Y5I A;  2B1U A;  4C0J A;  2I94 A;  3OX6 A;  1QAT A;  1BJF A;  1CDP A;  1QX2 A;  1UHK A;  1CNP A;  2BL0 B;  2M3W A;  2Y4Q A;  1CLL A;  1UHI A;  2CXJ A;  3IF7 A;  4DUQ A;  2FCE A;  2LVK A;  1TIZ A;  4NDC A;  1LA0 A;  4JPZ B;  1OMV A;  3HX4 A;  1JUO A;  3O6B A;  1QV1 A;  2BKI B;  2CT9 A;  1CDL A;  1SMG A;  4GFT A;  1IG5 A;  1KCY A;  1F54 A;  2LUX A;  3DD4 A;  2F2O A;  3PLF B;  2KSP A;  2K2A A;  1CMG A;  3M0W A;  4PHN A;  2LLU A;  4JQ0 D;  1MUX A;  1NX2 A;  4AOM A;  1DJW A;  1IRJ A;  1WLM A;  1WRL A;  5BPJ A;  1BLQ A;  1QIW A;  2KDH A;  3NSL A;  4XJK A;  2ZFD A;  2H61 C;  4D1E A;  1TCO B;  2R2I A;  2NCO A;  1CDM A;  2EC6 B;  3EK4 A;  1B7T Z;  2LE9 B;  3VRR A;  2BE6 A;  3TUY C;  1F4O A;  4QJ5 B;  3FWB A;  1QTX A;  1UUS A;  1WLZ A;  2K61 A;  1SW8 A;  4XJK B;  1CDN A;  5DKQ A;  2LLT A;  1TRF A;  3VRO A;  1K9U A;  2F33 A;  1WRZ A;  2SAS A;  3JTD B; 
#chains in the Genus database with same CATH topology
 1SKT A;  2WC6 A;  3LK0 A;  1TUJ A;  3H4S E;  4YI9 A;  4PDZ A;  1KQM B;  1SR6 B;  1QLK A;  1B4C A;  5AAN A;  1AUI B;  1YUS A;  1K96 A;  1OMD A;  3SS4 A;  4ETO A;  3DYE A;  3QME A;  1CLM A;  3CR4 X;  1XA5 A;  3SIA A;  3FWC A;  5HLV A;  2OTG C;  1UP5 A;  2KAV A;  1IJ5 A;  2QEV A;  1LA3 A;  1QS7 A;  4PE4 A;  3BJH A;  4OKH A;  4QJ3 B;  2L5X B;  1S6J A;  2HQW A;  5ER4 X;  2COL B;  3JVT C;  1OOI X;  3B7A A;  1LVC D;  1CB1 A;  2GGZ A;  1TNX A;  1OOG A;  1IGV A;  2L4H A;  3VRP A;  5HKZ A;  3O78 A;  1SL9 A;  1KFX S;  1EG4 A;  2JUL A;  2H8V A;  3B86 A;  2AUC A;  3OHM B;  2PVB A;  2L4I A;  1DJX A;  4WQ3 A;  3O4X A;  1CFC A;  1K95 A;  2MLF C;  2PAS A;  4CID A;  1SY9 A;  2CNP A;  4MRY A;  1ZFS A;  3EVV A;  1L7Z A;  2BAP A;  1QIV A;  2L0P A;  3NGV A;  3D74 A;  1Z4H A;  1F55 A;  3I5G C;  5AXI A;  1CM4 A;  1UHH A;  4P2Y B;  1DJY A;  3O4Y A;  3D78 A;  1OOH A;  1GGZ A;  1YVL A;  3ZNI A;  1TWO A;  1L2O B;  1XFZ O;  3CZ1 A;  3D0Y B;  3RM1 A;  4UPG A;  4WQ2 A;  1M45 A;  1CFD A;  1N65 A;  3DVJ A;  2JOJ A;  1DF0 B;  3WHT B;  2I18 A;  1KK7 Z;  3O2P A;  1CM1 A;  3OX5 A;  2KGR A;  2MRD A;  1G8I A;  2HQ8 A;  1QVI Z;  2L98 A;  2O5G A;  3LLE A;  4IL1 A;  3TDU A;  2KLD A;  3SG2 A;  4CFR A;  1EL4 A;  3KF9 A;  1NWD A;  1C7W A;  1OE9 B;  3NSK A;  2BCX A;  1XVJ A;  2BCB A;  2KI4 B;  4NDD A;  1V1G A;  1BMO A;  1H8B A;  3KO0 A;  4YGD B;  2LMT A;  1BR1 B;  3DVK A;  1X02 A;  3SJS A;  2CBL A;  2QEO A;  4ORB B;  5G08 A;  1TCF A;  1PSR A;  3NSI A;  1RJV A;  4I5N B;  1KWO B;  2KI6 D;  4YGB B;  2K60 A;  3V2L A;  2EGD A;  3CS1 A;  1S3P A;  2JXL A;  1YRU B;  1Y6W A;  2G9B A;  1OQP A;  3I5F B;  1SCM B;  1ZUZ A;  3KPX A;  1XFU O;  5HL1 A;  2P71 A;  3EVU A;  5HKW A;  3IVT A;  3PM8 A;  5I94 A;  2FJY A;  1S6C A;  1ALW A;  1J7R A;  5CPV A;  1C07 A;  1B8L A;  1QJT A;  1SNL A;  2AAO A;  1BR4 B;  1PVA A;  5DKN A;  1DEL A;  1NX1 A;  1GGW A;  4U8D A;  4BY5 A;  4GGF C;  4C0L A;  5ER5 A;  1FBV A;  1NCY A;  2K7D A;  2BL0 C;  1ODB A;  1XK4 C;  2MHH A;  3I5H B;  1R6P A;  1HQV A;  5FI7 A;  1SSE B;  2JU0 A;  2JRF A;  3GOF A;  3S0G A;  1J7Q A;  1AHR A;  2NLN A;  1TUZ A;  4AQI A;  2O60 A;  2KAX A;  4MLW A;  1K94 A;  1SL7 A;  3SG5 A;  1B7T Y;  4ZCU A;  1QX5 B;  1A4P A;  1S36 A;  3AAJ A;  1DVI A;  1YVH A;  3OB2 B;  2M1U A;  1J7P A;  3SIB A;  1S6I A;  2MLE C;  1C7V A;  4YBH B;  1TNP A;  1NX0 A;  3DVM A;  4DRW A;  2JPO A;  3LK1 A;  2K8M B;  2HF5 A;  1BOC A;  1YRT B;  1OSA A;  1XFX O;  2P6B B;  2JTT A;  3OB1 B;  2GV5 A;  1S26 D;  3Q8I A;  3FE8 A;  5JJG A;  3BUN B;  2JPT A;  1DT7 B;  1C3Y A;  1BU3 A;  1KSM A;  1IKU A;  1MHO A;  1TNW A;  2WCB A;  4JD9 A;  2P70 A;  2Y1N A;  1ALV A;  1PK0 D;  3CZ0 A;  1NP8 A;  1QWV A;  2M97 A;  1ZOT B;  5D3O A;  5KSZ A;  1QLS A;  2ERB A;  2PQL A;  3FS7 A;  4HRG A;  3SS5 A;  2KYF A;  1J7O A;  5KU1 A;  1EJ3 A;  2BKH B;  3DZT A;  3EKJ A;  1IJ6 A;  3AAK A;  3NXA A;  4PHK A;  2LMV A;  2TN4 A;  3TS5 C;  4MEW A;  1DEK A;  3I5I C;  4AQJ A;  2WCL A;  2JQ6 A;  3B88 A;  3NHI A;  4GNK B;  1MQ1 A;  2F2P A;  3B6X A;  3DXL A;  2H2K A;  2ZN9 A;  3PM2 A;  2L50 A;  1N2D A;  2QPT A;  1OMR A;  2JXC A;  1IQ5 A;  3DF0 A;  5J3X A;  2JC2 A;  1S5G Z;  3OBV A;  1JBA A;  2BCA A;  3MSE B;  3D73 A;  1B47 A;  1RFJ A;  1U5I B;  3FE6 A;  5D7F A;  5AFP A;  2Q91 A;  3IQO A;  2K0J A;  1NUB A;  3CLN A;  3TUY B;  1JC2 A;  2A4J A;  1RWY A;  2M0R A;  3DF0 B;  1YUU A;  1C3Z A;  1V1F A;  2E6W A;  1UWO A;  1RK9 A;  2KQ6 A;  5DIC A;  2F8P A;  1W7J B;  1IH0 A;  1MR8 A;  3CAB A;  2WCF A;  3VRN A;  1PRW A;  1KK7 Y;  1ZAC A;  2GGM A;  4P5O E;  4A4B A;  2OS8 C;  1QVI Y;  3E3R A;  1BT6 A;  1XYD A;  5AER A;  3NSO A;  2NCP A;  4N5X A;  2CTN A;  1WRK A;  2K7B A;  4I5K A;  4GUK A;  4HSZ A;  4KYN A;  3S0E A;  4GGN A;  1LKJ A;  2QEB A;  5AEQ A;  3D0Y A;  1DC1 A;  1F4Q A;  1YUT A;  2KFG A;  2FOT A;  2LVI A;  3FIA A;  1WDC C;  2KFF A;  3VGO A;  1FF1 A;  1OOF A;  2LHL A;  1H4B A;  3CZ2 A;  2KNE A;  1DF0 A;  1FW4 A;  2JT8 A;  2KBM A;  2NXQ A;  4GAO A;  3CZT X;  4OV2 A;  5I8N A;  4I5L B;  3D77 A;  4MZL A;  2WOS A;  2EHB A;  3BUW B;  2V53 A;  1SK6 D;  4PHM A;  3EVR A;  1SYM A;  2E30 A;  4MSP A;  3JVT B;  4C0K A;  1DJZ A;  4MBE A;  5IBW A;  3OP0 A;  2PRU A;  2ZN8 A;  3NHT A;  2HPS A;  3BUO B;  4Q04 A;  1OOJ A;  1M31 A;  4OVN F;  3BXK A;  3BOW A;  1XFY O;  1REC A;  2M49 B;  3PN7 C;  1UHN A;  4YGE B;  1W7I B;  3TDZ A;  1NCZ A;  2MA2 A;  2ZNE A;  4DCK A;  1A29 A;  1CKK A;  3SG3 A;  2Y1M A;  4CFQ A;  3BFB A;  1AVS A;  2LCP A;  3I5G B;  3BOW B;  2KI6 C;  1JWD A;  4INW A;  2SCP A;  4M2O A;  4TNC A;  2MBX A;  2KPH A;  5K89 A;  1SPY A;  3GK1 A;  2LP2 A;  1KK8 C;  2K7C A;  5EL2 A;  2ZRS A;  1VRK A;  1XFR A;  2JT3 A;  2JNF A;  3BYA A;  4USL A;  2JNX A;  4GPL B;  4YRU A;  3CR5 X;  3BUX B;  1OZO A;  1ORG A;  1JF2 A;  3CR2 A;  4PAL A;  2LVJ A;  2JZI A;  3D76 A;  1MF8 B;  3LCP C;  2KQY A;  4ZCV A;  1K9P A;  1CLB A;  1TTX A;  4BY4 A;  1LXF C;  1A2X A;  3CDN A;  2BBM A;  4YI8 A;  3CWG A;  3LL8 B;  3SS3 A;  1DGV A;  1SCV A;  3WHU B;  1D1O A;  3EK8 A;  4NDB A;  3D10 A;  1XO5 A;  2JTZ A;  4F0Z B;  2LMU A;  2WC5 A;  1P28 A;  2DOQ A;  5D69 A;  2PAL A;  2K2F A;  3AKA A;  1J1E A;  3TZ1 A;  3CGA A;  1QV0 A;  2M29 A;  3PSR A;  3R1O A;  1NCX A;  1A75 B;  3OGN A;  5HLO A;  1J55 A;  1DJI A;  4R1E A;  4M2Q A;  1NYA A;  4GGF A;  1TNQ A;  1FI5 A;  1F8H A;  4CLN A;  1AK8 A;  2K7O A;  1K2H A;  3L4L A;  1G4Y R;  3BFH A;  2LAP A;  1CMF A;  2ISD A;  2LC5 A;  1NPQ A;  1YX8 A;  4QJ4 B;  2L2C A;  4OZD A;  2BBN A;  2RGI A;  1KFU S;  1G33 A;  1KFX L;  1SRA A;  2QDI A;  1CFP A;  1BOD A;  4MN0 A;  2BE4 A;  2OPO A;  1LS8 A;  1E8A A;  3R1V A;  4PCW A;  1JF0 A;  2AMI A;  4WRI A;  2EC6 C;  1QAS A;  1S5G Y;  3K21 A;  5TNC A;  1PUL A;  1K9K A;  1R2U A;  2M1K B;  2M9G A;  2G2B A;  1SL8 A;  3S0B A;  1HT9 A;  4OR9 B;  1CFF A;  2FJU B;  1DQE A;  1FPW A;  2LM5 A;  3EK7 A;  3R72 A;  2WCE A;  3SG4 A;  4JKT A;  1J1D A;  1NIW A;  1UUR A;  3JTD C;  4JWQ A;  3S0A A;  3S0F A;  2NZ0 A;  2H61 A;  5FYX A;  1IQ3 A;  1KQM C;  1SR6 C;  2VRG A;  2LUC A;  1U5I A;  2WCM A;  3BQ3 A;  1S1E A;  1KQV A;  4PT1 A;  3SG7 A;  1FI6 A;  3BUM B;  1JSA A;  5CSF A;  2BEC A;  4L9M A;  1OW4 A;  4HRH A;  1UHJ A;  3DVE A;  3ZWH A;  4M2P A;  5CSJ A;  5JOL A;  2WND A;  4MZJ A;  1M46 A;  1CTR A;  1M63 B;  1PVB A;  2IS9 A;  2PYQ A;  4YGC B;  1ZMZ A;  2WCH A;  3KHE A;  3EG5 B;  1NSH A;  4N1G A;  2QEH A;  4PE0 A;  3UO9 A;  2L51 A;  1Y0V H;  1RTP 1;  2I7A A;  3RZS A;  5HYD A;  4ORC B;  3RLZ A;  2KLE A;  3AKB A;  4PE1 A;  3I5I B;  1RRO A;  3TS5 B;  4MVF A;  1K8U A;  5F6T A;  1MXE A;  2ZND A;  3C1V A;  4F7F A;  1B8C A;  1B9A A;  2KFH A;  1OZS A;  2I2R E;  5HKY A;  1AJ4 A;  1Z2C B;  5I2L A;  5KTY A;  3ICB A;  2LHI A;  2LLS A;  2OTG B;  1Y1U A;  1PSB A;  1A03 A;  1L2O C;  2ZRT A;  3F45 A;  1EG3 A;  4HRE E;  3WNX B;  2WCJ A;  4NQG A;  2WOR A;  2BNX A;  5B8I B;  4DIR A;  5GQQ C;  1N0Y A;  3N7H A;  2PMY A;  4N1F A;  3KEV A;  5I2O A;  1MXL C;  3BFA A;  4ICB A;  2FCD A;  2LNK A;  2OS8 B;  1GQM A;  1DTL A;  2WC8 A;  2KI4 C;  2LAN A;  2MJW B;  2JWW A;  1KFU L;  1W9Z A;  1PAL A;  2KHN A;  4I5J A;  3HCM A;  4XYN A;  1QX7 A;  1SBJ A;  1WDC B;  1B8R A;  3CTN A;  2JT0 A;  3VB1 A;  1BF5 A;  1BG1 A;  1KWO C;  4DS7 A;  2L2E A;  4FQO A;  3A8R A;  2M7L A;  3A4U B;  2LP3 A;  3CYZ A;  1YR5 A;  1AJ5 A;  1M39 A;  1XFW O;  3I5F C;  1F71 A;  1SCM C;  1GM0 A;  1GJY A;  4MRX A;  4E68 A;  4MZK A;  5CSN A;  2KOT A;  1NX3 A;  5FI2 A;  2KYC A;  1EH2 A;  2HET A;  3PAT A;  4GBA A;  1XFV O;  1TOP A;  2M7N A;  2PSR A;  2MAZ A;  1T14 A;  2M8U A;  2LVV A;  1Y1X A;  1YTZ C;  3FE9 A;  1IWQ A;  1DJG A;  3PN7 B;  4A4C A;  3I5H C;  2QAC A;  4ORA B;  1AP4 A;  1A75 A;  2L5Y A;  4YGA A;  1EXR A;  1DMO A;  1JFK A;  1WY9 A;  2CCM A;  1K90 D;  1KSO A;  2KAY A;  3IQQ A;  1Y1A A;  3K1E A;  1TN4 A;  4IJ7 A;  2ZKM X;  1QXP A;  2D8N A;  5DKR A;  1B1G A;  1Q80 A;  5PAL A;  4INX A;  3QRX A;  1KK8 B;  2YGU A;  3PFV A;  2KGB C;  4CPV A;  1DGU A;  3PAL A;  3GK4 X;  3B87 A;  2LV7 A;  1DJH A;  5CSI A;  4FTG A;  1MWN A;  1YX7 A;  2Q4U A;  3WXA A;  1XK4 A;  4PE7 A;  5I2Q A;  1JFJ A;  1IIO A;  1YUR A;  2F3Z A;  3EKH A;  4PHJ A;  1K93 D;  3TDI A;  1LIN A;  3SG6 A;  2F3Y A;  3GK2 A;  3VRQ A;  1F70 A;  4OCI A;  2KBI A;  2Y5I A;  2B1U A;  4C0J A;  2I94 A;  3OX6 A;  1QAT A;  1BJF A;  1CDP A;  1QX2 A;  1UHK A;  1CNP A;  2BL0 B;  2GTE A;  2M3W A;  2Y4Q A;  3R1P A;  3S0D A;  1CLL A;  1UHI A;  2CXJ A;  3IF7 A;  4DUQ A;  2FCE A;  2LVK A;  1TIZ A;  4FQT A;  1LA0 A;  2WCK A;  4NDC A;  4JPZ B;  1OMV A;  3HX4 A;  1JUO A;  3O6B A;  1QV1 A;  2BKI B;  2CT9 A;  3D75 A;  1CDL A;  1SMG A;  4GFT A;  1IG5 A;  3PJI A;  1KCY A;  1F54 A;  2LUX A;  3DD4 A;  2F2O A;  3PLF B;  3L47 A;  2KSP A;  2K2A A;  5FI6 A;  1CMG A;  3M0W A;  4PHN A;  2LLU A;  4JQ0 D;  1MUX A;  1NX2 A;  4AOM A;  1DJW A;  1IRJ A;  1WLM A;  1WRL A;  5BPJ A;  1BLQ A;  1QIW A;  2KDH A;  3NSL A;  4XJK A;  2ZFD A;  2H61 C;  4D1E A;  1TCO B;  2R2I A;  2NCO A;  1CDM A;  2EC6 B;  3EK4 A;  1B7T Z;  2LE9 B;  3VRR A;  2BE6 A;  3TUY C;  1F4O A;  3L4A A;  3FWB A;  4QJ5 B;  1QTX A;  1UUS A;  1WLZ A;  2K61 A;  3DY9 A;  1SW8 A;  4XJK B;  1CDN A;  5DKQ A;  2LLT A;  1TRF A;  3VRO A;  1K9U A;  2F33 A;  1WRZ A;  2SAS A;  3UNW A;  3JTD B; 
#chains in the Genus database with same CATH homology
 1SKT A;  3LK0 A;  3H4S E;  4YI9 A;  4PDZ A;  1KQM B;  1SR6 B;  1QLK A;  1B4C A;  5AAN A;  1AUI B;  1YUS A;  1K96 A;  1OMD A;  4ETO A;  1CLM A;  3CR4 X;  1XA5 A;  3SIA A;  3FWC A;  5HLV A;  2OTG C;  1UP5 A;  2KAV A;  1IJ5 A;  1LA3 A;  1QS7 A;  4PE4 A;  4OKH A;  4QJ3 B;  2L5X B;  1S6J A;  2HQW A;  5ER4 X;  2COL B;  3JVT C;  1CB1 A;  1LVC D;  2GGZ A;  1TNX A;  1IGV A;  2L4H A;  3VRP A;  5HKZ A;  3O78 A;  1SL9 A;  1KFX S;  1EG4 A;  2JUL A;  2AUC A;  3OHM B;  2PVB A;  2L4I A;  1DJX A;  4WQ3 A;  1CFC A;  1K95 A;  2MLF C;  2PAS A;  4CID A;  1SY9 A;  2CNP A;  4MRY A;  1ZFS A;  3EVV A;  1L7Z A;  1QIV A;  2L0P A;  1F55 A;  3I5G C;  5AXI A;  1CM4 A;  1UHH A;  4P2Y B;  1DJY A;  3O4Y A;  1GGZ A;  1YVL A;  3ZNI A;  3RM1 A;  1L2O B;  1XFZ O;  3D0Y B;  4UPG A;  4WQ2 A;  1M45 A;  1CFD A;  1N65 A;  3DVJ A;  2JOJ A;  1DF0 B;  3WHT B;  2I18 A;  1KK7 Z;  3O2P A;  1CM1 A;  3OX5 A;  2KGR A;  2MRD A;  1G8I A;  2HQ8 A;  1QVI Z;  2L98 A;  2O5G A;  3LLE A;  4IL1 A;  3TDU A;  3SG2 A;  4CFR A;  1EL4 A;  3KF9 A;  1NWD A;  1C7W A;  1OE9 B;  3NSK A;  2BCX A;  1XVJ A;  2BCB A;  2KI4 B;  4NDD A;  1V1G A;  1BMO A;  1H8B A;  3KO0 A;  4YGD B;  2LMT A;  1BR1 B;  3DVK A;  1X02 A;  3SJS A;  2CBL A;  4ORB B;  5G08 A;  1TCF A;  1PSR A;  3NSI A;  1RJV A;  4I5N B;  1KWO B;  2KI6 D;  4YGB B;  2EGD A;  3CS1 A;  1S3P A;  2JXL A;  1YRU B;  1Y6W A;  2G9B A;  1OQP A;  3I5F B;  1SCM B;  1ZUZ A;  3KPX A;  1XFU O;  3EVU A;  5HKW A;  3PM8 A;  1S6C A;  1ALW A;  1J7R A;  5CPV A;  1C07 A;  1B8L A;  1QJT A;  1SNL A;  2AAO A;  1BR4 B;  1PVA A;  5DKN A;  1NX1 A;  1GGW A;  4U8D A;  4BY5 A;  4GGF C;  4C0L A;  5ER5 A;  1FBV A;  1NCY A;  2K7D A;  2BL0 C;  1ODB A;  1XK4 C;  2MHH A;  3I5H B;  1R6P A;  1HQV A;  2JU0 A;  2JRF A;  3GOF A;  1J7Q A;  1AHR A;  2NLN A;  4AQI A;  2O60 A;  2KAX A;  4MLW A;  1K94 A;  1SL7 A;  3SG5 A;  1B7T Y;  4ZCU A;  1QX5 B;  1A4P A;  1S36 A;  3AAJ A;  1DVI A;  1YVH A;  3OB2 B;  2M1U A;  1J7P A;  3SIB A;  1S6I A;  2MLE C;  1C7V A;  4YBH B;  1TNP A;  1NX0 A;  3DVM A;  4DRW A;  3LK1 A;  2K8M B;  2HF5 A;  1BOC A;  1YRT B;  1OSA A;  1XFX O;  2P6B B;  2JTT A;  3OB1 B;  2GV5 A;  1S26 D;  5JJG A;  3BUN B;  2JPT A;  1DT7 B;  1BU3 A;  1KSM A;  1IKU A;  1MHO A;  1TNW A;  2WCB A;  2Y1N A;  1ALV A;  1PK0 D;  1NP8 A;  2M97 A;  1ZOT B;  5KSZ A;  1QLS A;  4HRG A;  3FS7 A;  2KYF A;  1J7O A;  5KU1 A;  1EJ3 A;  2BKH B;  3EKJ A;  1IJ6 A;  3AAK A;  3NXA A;  4PHK A;  2LMV A;  2TN4 A;  3TS5 C;  4MEW A;  3I5I C;  4AQJ A;  2JQ6 A;  4GNK B;  1MQ1 A;  2F2P A;  2H2K A;  2ZN9 A;  2L50 A;  1N2D A;  2QPT A;  1OMR A;  2JXC A;  1IQ5 A;  3DF0 A;  5J3X A;  2JC2 A;  1S5G Z;  1JBA A;  2BCA A;  3MSE B;  1B47 A;  1RFJ A;  1U5I B;  5D7F A;  5AFP A;  2Q91 A;  3IQO A;  2K0J A;  1NUB A;  3CLN A;  3TUY B;  1JC2 A;  2A4J A;  1RWY A;  2M0R A;  3DF0 B;  1YUU A;  1V1F A;  2E6W A;  1UWO A;  1RK9 A;  2KQ6 A;  2F8P A;  1W7J B;  1IH0 A;  1MR8 A;  2WCF A;  3VRN A;  1PRW A;  1KK7 Y;  1ZAC A;  2GGM A;  4P5O E;  4A4B A;  2OS8 C;  1QVI Y;  3E3R A;  1BT6 A;  1XYD A;  5AER A;  3NSO A;  2NCP A;  4N5X A;  2CTN A;  1WRK A;  2K7B A;  4I5K A;  4GUK A;  4HSZ A;  4GGN A;  1LKJ A;  5AEQ A;  3D0Y A;  1F4Q A;  1YUT A;  2KFG A;  2FOT A;  2LVI A;  3FIA A;  1WDC C;  2KFF A;  3VGO A;  1FF1 A;  1H4B A;  2LHL A;  2KNE A;  1DF0 A;  1FW4 A;  2JT8 A;  2KBM A;  2NXQ A;  4GAO A;  3CZT X;  4OV2 A;  5I8N A;  4I5L B;  4MZL A;  2WOS A;  2EHB A;  3BUW B;  2V53 A;  1SK6 D;  4PHM A;  3EVR A;  1SYM A;  2E30 A;  4MSP A;  3JVT B;  4C0K A;  1DJZ A;  4MBE A;  5IBW A;  3OP0 A;  2PRU A;  2ZN8 A;  2HPS A;  3BUO B;  4Q04 A;  1OOJ A;  1M31 A;  4OVN F;  3BXK A;  3BOW A;  1XFY O;  1REC A;  2M49 B;  3PN7 C;  1UHN A;  4YGE B;  1W7I B;  3TDZ A;  1NCZ A;  2MA2 A;  2ZNE A;  4DCK A;  1A29 A;  1CKK A;  3SG3 A;  2Y1M A;  4CFQ A;  1AVS A;  2LCP A;  3I5G B;  3BOW B;  2KI6 C;  1JWD A;  4TNC A;  2SCP A;  4M2O A;  2MBX A;  5K89 A;  1SPY A;  3GK1 A;  2LP2 A;  1KK8 C;  2K7C A;  2ZRS A;  1VRK A;  2JT3 A;  2JNF A;  3BYA A;  4USL A;  2JNX A;  4GPL B;  4YRU A;  3CR5 X;  3BUX B;  1OZO A;  1JF2 A;  3CR2 A;  4PAL A;  2LVJ A;  2JZI A;  1MF8 B;  3LCP C;  2KQY A;  4ZCV A;  1K9P A;  1CLB A;  1TTX A;  4BY4 A;  1LXF C;  1A2X A;  2BBM A;  4YI8 A;  3CWG A;  3LL8 B;  3WHU B;  1DGV A;  1SCV A;  1D1O A;  3EK8 A;  4NDB A;  3D10 A;  1XO5 A;  2JTZ A;  4F0Z B;  2LMU A;  2DOQ A;  5D69 A;  2PAL A;  2K2F A;  3AKA A;  1J1E A;  3TZ1 A;  3CGA A;  1QV0 A;  2M29 A;  3PSR A;  1NCX A;  1A75 B;  5HLO A;  1J55 A;  1DJI A;  4R1E A;  4M2Q A;  1NYA A;  4GGF A;  1TNQ A;  1FI5 A;  1F8H A;  4CLN A;  1AK8 A;  2K7O A;  1K2H A;  1G4Y R;  2LAP A;  1CMF A;  2ISD A;  2LC5 A;  1NPQ A;  1YX8 A;  4QJ4 B;  2BBN A;  2RGI A;  1KFU S;  1G33 A;  1KFX L;  1SRA A;  1CFP A;  1BOD A;  4MN0 A;  2BE4 A;  2OPO A;  1E8A A;  4PCW A;  1JF0 A;  2AMI A;  4WRI A;  2EC6 C;  1QAS A;  1S5G Y;  3K21 A;  5TNC A;  1PUL A;  1K9K A;  1R2U A;  2M1K B;  2M9G A;  2G2B A;  1SL8 A;  1HT9 A;  4OR9 B;  1CFF A;  2FJU B;  1FPW A;  2LM5 A;  3EK7 A;  3SG4 A;  2WCE A;  1J1D A;  1NIW A;  1UUR A;  3JTD C;  4JWQ A;  2NZ0 A;  2H61 A;  5FYX A;  1IQ3 A;  1KQM C;  1SR6 C;  2VRG A;  2LUC A;  1U5I A;  3BQ3 A;  1KQV A;  1S1E A;  3SG7 A;  1FI6 A;  3BUM B;  1JSA A;  5CSF A;  2BEC A;  4L9M A;  4HRH A;  1UHJ A;  3DVE A;  3ZWH A;  4M2P A;  5CSJ A;  5JOL A;  2WND A;  4MZJ A;  1M46 A;  1CTR A;  1M63 B;  1PVB A;  2IS9 A;  4YGC B;  1ZMZ A;  3KHE A;  1NSH A;  4N1G A;  4PE0 A;  2L51 A;  1Y0V H;  1RTP 1;  2I7A A;  5HYD A;  4ORC B;  3RLZ A;  3AKB A;  4PE1 A;  3I5I B;  1RRO A;  3TS5 B;  4MVF A;  1K8U A;  5F6T A;  1MXE A;  2ZND A;  3C1V A;  1B8C A;  1B9A A;  2KFH A;  1OZS A;  2I2R E;  5HKY A;  1AJ4 A;  5I2L A;  5KTY A;  3ICB A;  2LHI A;  2LLS A;  2OTG B;  1Y1U A;  1PSB A;  1A03 A;  1L2O C;  2ZRT A;  3F45 A;  1EG3 A;  4HRE E;  3WNX B;  4NQG A;  2WOR A;  5B8I B;  4DIR A;  5GQQ C;  1N0Y A;  2PMY A;  4N1F A;  3KEV A;  5I2O A;  1MXL C;  4ICB A;  2FCD A;  2LNK A;  2OS8 B;  1GQM A;  1DTL A;  2WC8 A;  2KI4 C;  2LAN A;  2MJW B;  2JWW A;  1KFU L;  1PAL A;  2KHN A;  4I5J A;  3HCM A;  4XYN A;  1QX7 A;  1SBJ A;  1WDC B;  1B8R A;  3CTN A;  2JT0 A;  1BF5 A;  1BG1 A;  1KWO C;  4DS7 A;  2L2E A;  4FQO A;  3A8R A;  2M7L A;  3A4U B;  2LP3 A;  1YR5 A;  1AJ5 A;  1M39 A;  1XFW O;  3I5F C;  1F71 A;  1SCM C;  1GJY A;  4MRX A;  4E68 A;  4MZK A;  5CSN A;  2KOT A;  1NX3 A;  2KYC A;  1EH2 A;  2HET A;  3PAT A;  4GBA A;  1XFV O;  1TOP A;  2M7N A;  2PSR A;  2MAZ A;  2M8U A;  2LVV A;  1Y1X A;  1YTZ C;  3PN7 B;  1IWQ A;  1DJG A;  4A4C A;  3I5H C;  2QAC A;  4ORA B;  1AP4 A;  1A75 A;  4YGA A;  1EXR A;  1DMO A;  1JFK A;  1WY9 A;  2CCM A;  1K90 D;  1KSO A;  2KAY A;  3IQQ A;  1Y1A A;  1TN4 A;  2ZKM X;  1QXP A;  2D8N A;  5DKR A;  1B1G A;  1Q80 A;  5PAL A;  3QRX A;  1KK8 B;  3PFV A;  2KGB C;  4CPV A;  1DGU A;  3PAL A;  3GK4 X;  2LV7 A;  1DJH A;  5CSI A;  4FTG A;  1MWN A;  1YX7 A;  2Q4U A;  3WXA A;  1XK4 A;  4PE7 A;  5I2Q A;  1JFJ A;  1YUR A;  2F3Z A;  3EKH A;  4PHJ A;  1K93 D;  3TDI A;  1LIN A;  3SG6 A;  2F3Y A;  3GK2 A;  3VRQ A;  1F70 A;  4OCI A;  2KBI A;  2Y5I A;  2B1U A;  4C0J A;  2I94 A;  3OX6 A;  1QAT A;  1BJF A;  1CDP A;  1QX2 A;  1UHK A;  1CNP A;  2BL0 B;  2M3W A;  2Y4Q A;  1CLL A;  1UHI A;  2CXJ A;  3IF7 A;  4DUQ A;  2FCE A;  2LVK A;  1TIZ A;  4NDC A;  1LA0 A;  4JPZ B;  1OMV A;  3HX4 A;  1JUO A;  3O6B A;  1QV1 A;  2BKI B;  2CT9 A;  1CDL A;  1SMG A;  4GFT A;  1IG5 A;  1KCY A;  1F54 A;  2LUX A;  3DD4 A;  2F2O A;  3PLF B;  2KSP A;  2K2A A;  1CMG A;  3M0W A;  4PHN A;  2LLU A;  4JQ0 D;  1MUX A;  1NX2 A;  4AOM A;  1DJW A;  1IRJ A;  1WLM A;  1WRL A;  5BPJ A;  1BLQ A;  1QIW A;  2KDH A;  3NSL A;  4XJK A;  2ZFD A;  2H61 C;  4D1E A;  1TCO B;  2R2I A;  2NCO A;  1CDM A;  2EC6 B;  3EK4 A;  1B7T Z;  2LE9 B;  3VRR A;  2BE6 A;  3TUY C;  1F4O A;  4QJ5 B;  3FWB A;  1QTX A;  1UUS A;  1WLZ A;  2K61 A;  1SW8 A;  4XJK B;  1CDN A;  5DKQ A;  2LLT A;  1TRF A;  3VRO A;  1K9U A;  2F33 A;  1WRZ A;  2SAS A;  3JTD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...