3SIAA

Crystal structure of ure3-binding protein, (d127a,n129a) mutant, iodide phased
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
214
structure length
212
Chain Sequence
NFCLWNLQPIQGSWMGAACIYQMPPSVRNTWWFPLLNTIPLDQYTRIYQWFMGVDRDRSGTLEINELMMGQFPGGIRLSPQTALRMMRIFDTDFNGHISFYEFMAMYKFMELAYNLFVMNARARSGTLEPHEILPALQQLGFYINQRTSLLLHRLFAMAFCDLNCWIAICAFAAQTRSAYQMIFMNPYYGPMKPFNPMEFGKFLDVVTSLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of URE3-binding protein
rcsb
source organism Entamoeba histolytica
molecule tags Dna binding protein
molecule keywords URE3-BP sequence specific DNA binding protein
total genus 73
structure length 212
sequence length 214
ec nomenclature
pdb deposition date 2011-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3siaA01
1BT6A 1MQ1A 3SG4A 4MVFA 1CM1A 5JJGA 2F8PA 1QIWA 2F2PA 1WDCC 1DGVA 2KI4C 2BKIB 2GV5A 1AJ4A 1K2HA 4ORBB 3MSEB 4QJ3B 5IBWA 1XFXO 2WCFA 1GQMA 3TDZA 1S36A 3GK4X 3VRQA 1BMOA 3FWCA 2PRUA 1YVLA 1LINA 1SYMA 2EC6C 1J1DA 1BOCA 2JNFA 4PHMA 2M7NA 4WQ3A 1SBJA 1UURA 1U5IA 1WRKA 2KSPA 2L2EA 2ZRSA 3BQ3A 3AKAA 2LLTA 1U5IB 1WDCB 2K7BA 3PSRA 4CFRA 1UP5A 3CLNA 2BCAA 3BUWB 2K2FA 1V1GA 2SASA 1NX0A 5KU1A 2BECA 1E8AA 2E6WA 1Y1UA 2HQ8A 2JTZA 1L2OB 2K7CA 2EC6B 2LUXA 2WOSA 1B8CA 1N65A 2M29A 1DJYA 1QS7A 2GGZA 3BUMB 3ZWHA 1BG1A 5CSIA 1ZFSA 2FOTA 1B4CA 1K93D 2BBNA 2OTGC 1HT9A 1ZACA 2CXJA 2G9BA 1A2XA 1YURA 4Q04A 1JF0A 2M1UA 1XFYO 1ZMZA 3PALA 3TZ1A 2MLEC 1A03A 1UHHA 2JWWA 1CDPA 2KQYA 3D10A 2LLSA 1BU3A 1KWOC 1K9UA 3CR4X 3TDUA 1OQPA 1EG4A 4DRWA 1YUUA 3I5GC 1PVBA 2LP3A 4NQGA 1NIWA 1QLSA 3PLFB 1RTP1 1YX7A 1S5GZ 1SCMB 3NSKA 2LCPA 1BJFA 4C0KA 4GBAA 1F71A 4I5LB 4YBHB 4FQOA 5KTYA 3DF0A 1IG5A 3I5IB 4OV2A 5CPVA 4OCIA 1BLQA 3GOFA 1N2DA 4M2PA 5K89A 1FI6A 1S6IA 1Y1XA 3DVMA 3WXAA 3OB1B 1L2OC 3NXAA 1OSAA 5HKZA 5AEQA 2LMUA 3GK1A 1S26D 1CMGA 1K8UA 4P5OE 2LLUA 1WLMA 3M0WA 3BOWB 4WQ2A 2E30A 1KCYA 1DF0A 2JRFA 2KAVA 3CS1A 3O2PA 4AQJA 1CFCA 1XYDA 1MWNA 4NDCA 5DKRA 1DF0B 4YI8A 2ZN9A 2O5GA 1PULA 2L4HA 3SG6A 1QVIY 2G2BA 1J7RA 1K90D 1TRFA 4MZJA 2LMVA 3EK7A 3JVTB 3HCMA 1EL4A 2L0PA 3LK1A 1K96A 5DKQA 1F70A 1SL9A 2L98A 3SG3A 3VROA 3JTDB 4L9MA 2HETA 1AHRA 2Y1NA 4PCWA 3VGOA 3PN7B 1NPQA 1NSHA 4HREE 1F4QA 1MUXA 1V1FA 1PSBA 3O4YA 4UPGA 2WORA 1JFJA 2WCEA 4PALA 2BL0C 2M0RA 5JOLA 1ODBA 2BCBA 1J55A 1Q80A 1QATA 5FYXA 1B9AA 1Y6WA 1RFJA 3VRPA 1OE9B 1F55A 3BXKA 1UHNA 3SG7A 1CFDA 3FWBA 3EVVA 2FCEA 3A4UB 4OVNF 2K61A 1F54A 2KBIA 1YX8A 1DMOA 5D7FA 1F4OA 1TTXA 1B1GA 2L4IA 3A8RA 3QRXA 2KAYA 3TUYB 2JU0A 3OX6A 2QPTA 1HQVA 1RROA 2KBMA 2CBLA 4I5NB 5D69A 1TIZA 5AXIA 2LAPA 3EKHA 2JULA 5TNCA 1AVSA 1CKKA 1XK4A 3JTDC 3H4SE 1QXPA 1DTLA 2JT0A 2L51A 4MZKA 2DOQA 1QX5B 1B8RA 1ZOTB 3IQQA 4A4CA 4GGFC 1GGZA 1DJHA 3RM1A 2MLFC 1CFFA 5GQQC 4ZCVA 4DUQA 1EJ3A 4GGNA 2I7AA 1N0YA 1MF8B 3CR5X 1DJXA 3SIAA 1PRWA 1LKJA 3C1VA 2F2OA 1KK8C 2PSRA 4DS7A 4ETOA 1OOJA 1SL7A 1PALA 3NSOA 1RWYA 3CZTX 4C0JA 3CGAA 1NWDA 2H61A 2JT3A 2MHHA 2CCMA 1CTRA 5DKNA 1M63B 2B1UA 2F3YA 4I5JA 3FS7A 4GNKB 2KFFA 3PN7C 4OR9B 4HSZA 1R2UA 3I5FC 2JT8A 1SCMC 2HPSA 4M2OA 2JPTA 4MSPA 4MLWA 2I18A 2LHLA 5BPJA 1YVHA 2BBMA 4YGCB 2KFHA 1KK8B 2KDHA 1M31A 1FI5A 1KSOA 4XJKB 5I2OA 2JXCA 4QJ5B 1QJTA 2JXLA 1JSAA 1S5GY 1YTZC 3ZNIA 1J7QA 2WNDA 1IKUA 1MXLC 2KAXA 3PFVA 1YRUB 2KYFA 3VRNA 1JF2A 1KFUL 3PM8A 1NUBA 2BE6A 1A75A 3CWGA 4MRXA 4PDZA 4DIRA 1R6PA 1CLMA 1L7ZA 2LHIA 1FF1A 2D8NA 1IH0A 4ORAB 5ER4X 3AAKA 3D0YA 2OS8C 4WRIA 1WRLA 1LA0A 1SR6B 2M3WA 1H8BA 4MN0A 1OMRA 2MA2A 3JVTC 1BR1B 1CMFA 1EXRA 3IQOA 1XA5A 1NCXA 3NSLA 2WCBA 2P6BB 3DVJA 1SMGA 2K0JA 3LLEA 1B47A 4PE0A 1GGWA 1KQMB 1TN4A 3BUXB 1G4YR 4R1EA 4HRHA 1DT7B 3I5GB 2BKHB 1AK8A 1KFXL 3FIAA 2OTGB 1KSMA 2F33A 2COLB 2LV7A 3EK4A 3NSIA 5I8NA 1MR8A 2BL0B 2KQ6A 3IF7A 1DJIA 1YUTA 4CPVA 4YGBB 2LMTA 1IWQA 1JWDA 1RJVA 1S3PA 1IJ5A 3HX4A 3GK2A 4JWQA 1PK0D 3CR2A 2KGBC 4C0LA 4D1EA 3KHEA 4ZCUA 2LANA 1YUSA 5HLOA 4CFQA 1SNLA 5CSFA 2LNKA 3TS5B 1UUSA 2M9GA 1NYAA 1CLLA 1CDMA 4NDBA 1IGVA 4A4BA 1WLZA 3DF0B 3OB2B 4XYNA 2CNPA 2VRGA 3SIBA 1W7JB 2TN4A 1A75B 4HRGA 1FW4A 4JQ0D 4MBEA 4F0ZB 1M45A 3AAJA 1C07A 4E68A 1QTXA 1M46A 2K2AA 1DVIA 1PVAA 4N5XA 5HKWA 1G33A 2PALA 2K8MB 4I5KA 2MRDA 4PE1A 1KQVA 2KI6D 5CSJA 5HKYA 1S6JA 2AMIA 2LC5A 1IQ3A 4YGDB 1J7PA 1OMVA 4YGAA 2KHNA 1SK6D 2EGDA 2JC2A 2ZRTA 1QIVA 4ICBA 2M49B 1ZUZA 1K9PA 4TNCA 3ICBA 1KK7Y 1QX2A 2JQ6A 2GGMA 1AJ5A 3D0YB 1SR6C 5AFPA 1KFUS 2L50A 2NCOA 5CSNA 2FJUB 2AUCA 1UHIA 1WRZA 3VRRA 5J3XA 3BYAA 2M7LA 1DGUA 2QACA 1TNXA 5I2LA 1QVIZ 2CTNA 4JPZB 4N1FA 1XFUO 1AUIB 1CNPA 1TNQA 2BE4A 4YGEB 1SCVA 4GGFA 2M1KB 2NCPA 3BUOB 3SG2A 5HLVA 3WNXB 2NLNA 2PMYA 1J1EA 2OS8B 1NX2A 2V53A 1JBAA 4BY4A 2LVIA 1VRKA 3CTNA 1IJ6A 5G08A 1K9KA 3I5IC 4P2YB 4USLA 1XVJA 1SW8A 1BR4B 2F3ZA 2M8UA 2Y4QA 1Y1AA 3E3RA 1GJYA 1CLBA 2ZKMX 2KGRA 3EKJA 1EG3A 3WHUB 1LA3A 2LVKA 4MEWA 5B8IB 1CDNA 1B8LA 3WHTB 3LCPC 1C7WA 3I5HC 2EHBA 1K95A 4N1GA 3KO0A 2KI6C 3TUYC 1JFKA 1NCZA 4GUKA 2HF5A 2JZIA 5KSZA 1FPWA 4YRUA 2SCPA 5ER5A 5PALA 1XFVO 4M2QA 2LVVA 4U8DA 1SL8A 3PATA 2RGIA 1EH2A 5AERA 1A29A 1SPYA 1G8IA 1KWOB 1AP4A 1BF5A 1A4PA 3OHMB 2ZN8A 2OPOA 1CM4A 1LXFC 4NDDA 4ORCB 2JOJA 4XJKA 1RK9A 1B7TZ 2JNXA 3K21A 1JUOA 2H61C 3DD4A 4CIDA 1CDLA 2I94A 2I2RE 1TCFA 4PHNA 3TS5C 1DJWA 1QV0A 1SY9A 2ZNEA 2KI4B 1UHJA 1IQ5A 1K94A 4PHJA 1QLKA 2PVBA 3RLZA 1FBVA 2HQWA 2WC8A 3OX5A 1MXEA 1F8HA 1RECA 3EVRA 1UWOA 4FTGA 4MRYA 1OZSA 1XFZO 2CT9A 2IS9A 3KPXA 2L5XB 2KNEA 3DVKA 5I2QA 4OKHA 4IL1A 2NXQA 2FCDA 1NCYA 1ALWA 1QASA 3O6BA 1DJZA 3LL8B 2MJWB 2KOTA 2KFGA 2ISDA 1S1EA 2K7DA 1B7TY 2O60A 3EVUA 3I5FB 4PE7A 1ALVA 1CB1A 4YI9A 2MBXA 1H4BA 1J7OA 1XK4C 1XO5A 1TNWA 4MZLA 2MAZA 1NX1A 2NZ0A 4GPLB 1C7VA 1XFWO 4PE4A 1Y0VH 3BUNB 3EK8A 1WY9A 2BCXA 2LM5A 2R2IA 1DJGA 3F45A 3SG5A 5AANA 3TDIA 4BY5A 1JC2A 1NX3A 1SRAA 2ZFDA 3BOWA 4AQIA 2M97A 1TOPA 3OP0A 1QX7A 1NP8A 3KEVA 2JTTA 1TCOB 1MHOA 1YRTB 3I5HB 1KQMC 1W7IB 2H2KA 2LP2A 4DCKA 2Q4UA 2Q91A 5F6TA 2KYCA 1CFPA 1OZOA 1PSRA 1KK7Z 1X02A 1SKTA 3O78A 2LE9B 1BODA 2PASA 1QV1A 4AOMA 1S6CA 1UHKA 1LVCD 4QJ4B 1D1OA 2LVJA 2A4JA 2Y1MA 3DVEA 3LK0A 1IRJA 3AKBA 1TNPA 3SJSA 1OMDA 3KF9A 2AAOA 2LUCA 4PHKA 2ZNDA 2K7OA 1M39A 4GAOA 4GFTA 1YR5A 5HYDA 4CLNA 1KFXS 2Y5IA
chains in the Genus database with same CATH superfamily
1BT6A 1MQ1A 3SG4A 3D73A 4MVFA 1CM1A 5JJGA 2F8PA 1QIWA 2F2PA 1WDCC 1DGVA 2KI4C 2BKIB 2GV5A 3BFHA 1AJ4A 1K2HA 2WC6A 4ORBB 3MSEB 4QJ3B 5IBWA 1XFXO 2WCFA 1GQMA 3TDZA 1S36A 3GK4X 3VRQA 1BMOA 3CZ0A 2PRUA 3FWCA 1YVLA 1LINA 1SYMA 2EC6C 1J1DA 2ERBA 1BOCA 2JNFA 4PHMA 2M7NA 3R72A 2P71A 4WQ3A 1SBJA 1Z2CB 1UURA 2QEHA 1U5IA 1WRKA 2KSPA 2L2EA 2ZRSA 3BQ3A 3AKAA 4JKTA 2LLTA 1U5IB 1WDCB 2FJYA 2K7BA 3PSRA 4CFRA 1UP5A 3Q8IA 3CLNA 3R1PA 2BCAA 3BUWB 2K2FA 1V1GA 2SASA 1NX0A 5KU1A 2BECA 1E8AA 2E6WA 1Y1UA 2HQ8A 2JTZA 1L2OB 2K7CA 2EC6B 2LUXA 2WOSA 1B8CA 1N65A 2M29A 1DJYA 1QS7A 2GGZA 3BUMB 3ZWHA 1BG1A 5CSIA 1ZFSA 2FOTA 1B4CA 1K93D 2BBNA 2OTGC 1HT9A 1ZACA 2CXJA 2G9BA 1A2XA 1YURA 4Q04A 1JF0A 2M1UA 1XFYO 1ZMZA 3PALA 3TZ1A 2MLEC 1A03A 1UHHA 2JWWA 1CDPA 2KQYA 3D10A 2LLSA 1BU3A 1KWOC 1K9UA 3CR4X 3TDUA 1OQPA 1EG4A 4DRWA 1YUUA 3I5GC 1PVBA 2LP3A 4NQGA 1NIWA 1QLSA 3PLFB 4F7FA 1RTP1 1YX7A 1S5GZ 3NHIA 1SCMB 3NSKA 2LCPA 1BJFA 4C0KA 3FE9A 4GBAA 1F71A 4I5LB 4YBHB 4FQOA 5KTYA 3DF0A 1IG5A 3I5IB 4OV2A 5CPVA 4OCIA 3SS5A 3GOFA 1N2DA 4M2PA 5K89A 1BLQA 1FI6A 1S6IA 1Y1XA 5EL2A 3DVMA 3WXAA 3OB1B 2PQLA 1L2OC 3NXAA 1OSAA 5HKZA 5AEQA 2LMUA 3GK1A 1S26D 1CMGA 1K8UA 4P5OE 2LLUA 1WLMA 3M0WA 3BOWB 3CZ1A 2E30A 4WQ2A 1KCYA 1DF0A 2JRFA 1OOGA 2KAVA 3CS1A 3O2PA 4AQJA 2L5YA 1XYDA 1MWNA 4NDCA 5DKRA 1CFCA 1GM0A 1DF0B 4YI8A 1C3ZA 2ZN9A 2O5GA 1PULA 2L4HA 3SG6A 1QVIY 2G2BA 1J7RA 1K90D 1TRFA 4MZJA 5I94A 2LMVA 3EK7A 3JVTB 2BNXA 3HCMA 1C3YA 4KYNA 1EL4A 4IJ7A 2L0PA 3LK1A 1K96A 1P28A 5DKQA 1F70A 1SL9A 2L98A 3SG3A 3VROA 3JTDB 2QEBA 3BFAA 4L9MA 2HETA 1AHRA 2Y1NA 4PCWA 3B6XA 3NHTA 3VGOA 3PN7B 2WCHA 2WCMA 3NGVA 1NPQA 1OOHA 1NSHA 4HREE 1F4QA 1MUXA 1OOFA 1TWOA 1PSBA 1V1FA 3O4YA 4UPGA 2WORA 1JFJA 2WCEA 4PALA 2BL0C 2M0RA 5JOLA 1ODBA 2BCBA 1J55A 1Q80A 1QATA 5FYXA 1B9AA 4BY5A 1Y6WA 1RFJA 3VRPA 1OE9B 1F55A 3BXKA 1UHNA 3VB1A 3SG7A 1CFDA 3FWBA 3EVVA 4PT1A 2FCEA 3A4UB 4OVNF 3CYZA 2K61A 1F54A 2KBIA 1YX8A 1DMOA 5D7FA 1F4OA 1TTXA 1B1GA 2L4IA 3A8RA 3QRXA 2KAYA 3TUYB 2JU0A 3OX6A 2QPTA 1HQVA 1RROA 2KBMA 2CBLA 4I5NB 5D69A 1TIZA 2QEOA 5AXIA 2LAPA 3EKHA 2JULA 5TNCA 1AVSA 1CKKA 1XK4A 3JTDC 3H4SE 3V2LA 1QXPA 3CDNA 1DTLA 2JT0A 2L51A 4MZKA 2DOQA 1QX5B 1B8RA 1ZOTB 3IQQA 4A4CA 4GGFC 3FE6A 1GGZA 1DJHA 3RM1A 2MLFC 1CFFA 3B87A 5GQQC 1DEKA 4ZCVA 4DUQA 1EJ3A 4GGNA 2I7AA 1N0YA 1MF8B 3CR5X 1DJXA 3SIAA 1PRWA 1LKJA 3C1VA 2F2OA 1KK8C 3PM2A 2PSRA 4DS7A 4ETOA 1OOJA 1SL7A 1PALA 3NSOA 1RWYA 3CZTX 4C0JA 3CGAA 1NWDA 3IVTA 2H61A 2JT3A 2MHHA 2CCMA 1CTRA 3D78A 5DKNA 1M63B 2B1UA 2F3YA 4I5JA 3FS7A 1DELA 2KFFA 3PN7C 4GNKB 4OR9B 3DY9A 4HSZA 3UO9A 1R2UA 3I5FC 1DQEA 2JT8A 3L4LA 3L4AA 1SCMC 2HPSA 4M2OA 2JPTA 4MSPA 4MLWA 2I18A 2LHLA 5BPJA 1YVHA 2BBMA 4YGCB 2KFHA 1KK8B 1LS8A 2KDHA 1M31A 1FI5A 1KSOA 4XJKB 5I2OA 3S0GA 1XFRA 2WCLA 2JXCA 4QJ5B 1QJTA 2JXLA 1JSAA 1S5GY 1YTZC 3ZNIA 1J7QA 3K1EA 2H8VA 2WNDA 1IKUA 1MXLC 2KAXA 3PFVA 1YRUB 2BAPA 2KYFA 3VRNA 1JF2A 1KFUL 3PM8A 1NUBA 2BE6A 1OW4A 1A75A 3CWGA 4MRXA 4PDZA 4DIRA 1R6PA 3B7AA 1CLMA 1L7ZA 2LHIA 1FF1A 2D8NA 1IH0A 4ORAB 5ER4X 3AAKA 3D0YA 4INWA 2OS8C 4WRIA 1WRLA 1LA0A 1SR6B 2M3WA 3DXLA 1H8BA 4MN0A 1OMRA 1TUJA 2MA2A 3JVTC 1BR1B 1CMFA 1EXRA 3IQOA 1XA5A 1NCXA 3NSLA 2WCBA 2P6BB 3DVJA 1SMGA 2K0JA 2KLEA 3LLEA 4OZDA 1B47A 4PE0A 1GGWA 2QEVA 1KQMB 1TN4A 1TUZA 1G4YR 3BUXB 4R1EA 4HRHA 1DT7B 3OGNA 3I5GB 2BKHB 1AK8A 1KFXL 3FIAA 2OTGB 1KSMA 2F33A 2COLB 2LV7A 3EK4A 3NSIA 5I8NA 1MR8A 2BL0B 2KQ6A 3IF7A 1DJIA 5FI7A 1YUTA 4CPVA 4YGBB 2LMTA 1IWQA 1JWDA 1RJVA 1S3PA 1IJ5A 3HX4A 3GK2A 4JWQA 1PK0D 3CR2A 2KGBC 4C0LA 4D1EA 3KHEA 5DICA 4ZCUA 2LANA 1YUSA 5HLOA 4CFQA 1SNLA 5CSFA 4JD9A 2LNKA 3TS5B 1UUSA 2M9GA 1NYAA 1CLLA 1CDMA 4NDBA 1IGVA 4A4BA 1WLZA 3DF0B 3OB2B 4XYNA 2CNPA 2L2CA 2VRGA 4FQTA 1W7JB 3SIBA 2TN4A 1A75B 4HRGA 1FW4A 4JQ0D 4MBEA 4F0ZB 1M45A 3AAJA 1DC1A 1C07A 4E68A 1QTXA 1T14A 1M46A 2K2AA 1DVIA 1PVAA 4N5XA 5HKWA 1G33A 2PALA 2K8MB 2WCKA 2MRDA 4I5KA 4PE1A 2KI6D 5CSJA 1KQVA 5HKYA 1S6JA 2AMIA 2LC5A 3R1VA 4YGDB 1IQ3A 1OMVA 4YGAA 1J7PA 2KHNA 1SK6D 2EGDA 2JC2A 2ZRTA 1QIVA 4ICBA 2M49B 2P70A 1ZUZA 1K9PA 4TNCA 3ICBA 1KK7Y 1QX2A 2JQ6A 2GGMA 1AJ5A 3D0YB 1SR6C 3CZ2A 5AFPA 1KFUS 2L50A 2NCOA 5CSNA 2FJUB 2AUCA 1UHIA 1WRZA 3VRRA 5J3XA 3BYAA 2M7LA 1DGUA 2QACA 1TNXA 3S0DA 5I2LA 1QVIZ 2CTNA 4JPZB 4N1FA 1XFUO 1AUIB 3QMEA 1CNPA 1TNQA 2BE4A 4YGEB 1SCVA 3B86A 4GGFA 2M1KB 2NCPA 3BUOB 3SG2A 5HLVA 3WNXB 2NLNA 2PMYA 1J1EA 2OS8B 1NX2A 2V53A 5FI2A 1JBAA 4BY4A 2LVIA 1VRKA 3CTNA 1IJ6A 5G08A 1K9KA 3I5IC 4P2YB 3S0FA 4USLA 1XVJA 1SW8A 1BR4B 2F3ZA 2M8UA 2Y4QA 1Y1AA 3E3RA 1GJYA 1CLBA 2ZKMX 2GTEA 2KGRA 3EKJA 1EG3A 3RZSA 3WHUB 1LA3A 3L47A 2LVKA 4MEWA 5B8IB 1CDNA 1B8LA 3WHTB 3OBVA 3LCPC 1C7WA 3I5HC 5D3OA 2EHBA 1K95A 4N1GA 3KO0A 2KI6C 3TUYC 1IIOA 3FE8A 1JFKA 1NCZA 4GUKA 2HF5A 3N7HA 2YGUA 2JZIA 2WCJA 5KSZA 1FPWA 4YRUA 2SCPA 5ER5A 3O4XA 5PALA 1XFVO 4M2QA 2LVVA 3BJHA 4U8DA 1SL8A 3PATA 2RGIA 1EH2A 5AERA 1A29A 1SPYA 1G8IA 1KWOB 1AP4A 1BF5A 1A4PA 3OHMB 3S0EA 2ZN8A 2OPOA 1CM4A 2JPOA 3DYEA 1LXFC 2K60A 4NDDA 4ORCB 2JOJA 4XJKA 1RK9A 1B7TZ 2JNXA 3D77A 3K21A 1JUOA 2H61C 3DD4A 4CIDA 1CDLA 2I94A 2I2RE 1TCFA 4PHNA 3TS5C 1DJWA 1QV0A 1SY9A 2ZNEA 2KLDA 2KI4B 1UHJA 1IQ5A 1K94A 4PHJA 1QLKA 2PVBA 3RLZA 1FBVA 2HQWA 2WC8A 3OX5A 1MXEA 1F8HA 1RECA 3EVRA 1UWOA 4FTGA 1SSEB 4MRYA 1OZSA 1XFZO 2CT9A 3SS3A 3D76A 2IS9A 3KPXA 2L5XB 2KNEA 3DVKA 5I2QA 4OKHA 4IL1A 2NXQA 1NCYA 2FCDA 1ALWA 1QASA 2WC5A 3EG5B 1DJZA 3LL8B 3O6BA 2MJWB 2KOTA 2KFGA 2ISDA 4INXA 1S1EA 3R1OA 2K7DA 1B7TY 2O60A 3EVUA 3I5FB 4PE7A 1ALVA 1CB1A 4YI9A 2MBXA 1H4BA 1J7OA 1XK4C 1XO5A 1TNWA 4MZLA 2MAZA 1NX1A 2NZ0A 4GPLB 1C7VA 1XFWO 4PE4A 1Y0VH 3BUNB 3EK8A 1WY9A 2BCXA 2LM5A 2R2IA 1DJGA 1W9ZA 3B88A 3F45A 5AANA 3SG5A 3TDIA 1JC2A 1NX3A 1SRAA 2ZFDA 1OOIX 3BOWA 4AQIA 2M97A 2PYQA 1TOPA 3OP0A 1QX7A 1NP8A 3KEVA 2JTTA 1TCOB 1MHOA 3S0BA 1YRTB 3I5HB 3PJIA 1KQMC 1W7IB 2H2KA 3S0AA 2LP2A 3DZTA 2Q4UA 4DCKA 2Q91A 5F6TA 2KYCA 1CFPA 1OZOA 2KPHA 1PSRA 1KK7Z 1X02A 1Z4HA 3D74A 1SKTA 3O78A 5FI6A 2LE9B 1BODA 3D75A 1QWVA 1QV1A 2PASA 3BFBA 1S6CA 1UHKA 1LVCD 3SS4A 4AOMA 4QJ4B 2LVJA 2QDIA 1D1OA 2A4JA 2Y1MA 3CABA 3DVEA 3LK0A 1IRJA 3AKBA 1TNPA 3SJSA 1OMDA 3KF9A 2AAOA 2LUCA 4PHKA 3UNWA 1ORGA 2ZNDA 5HL1A 2K7OA 1M39A 4GAOA 4GFTA 1YR5A 5HYDA 4CLNA 1KFXS 2Y5IA
chains in the Genus database with same CATH topology
1BT6A 1MQ1A 3SG4A 4MVFA 1CM1A 5JJGA 2F8PA 1QIWA 2F2PA 1WDCC 1DGVA 2KI4C 2BKIB 2GV5A 1AJ4A 1K2HA 4ORBB 3MSEB 4QJ3B 5IBWA 1XFXO 2WCFA 1GQMA 3TDZA 1S36A 3GK4X 3VRQA 1BMOA 3FWCA 2PRUA 1YVLA 1LINA 1SYMA 2EC6C 1J1DA 1BOCA 2JNFA 4PHMA 2M7NA 4WQ3A 1SBJA 1UURA 1U5IA 1WRKA 2KSPA 2L2EA 2ZRSA 3BQ3A 3AKAA 2LLTA 1U5IB 1WDCB 2K7BA 3PSRA 4CFRA 1UP5A 3CLNA 2BCAA 3BUWB 2K2FA 1V1GA 2SASA 1NX0A 5KU1A 2BECA 1E8AA 2E6WA 1Y1UA 2HQ8A 2JTZA 1L2OB 2K7CA 2EC6B 2LUXA 2WOSA 1B8CA 1N65A 2M29A 1DJYA 1QS7A 2GGZA 3BUMB 3ZWHA 1BG1A 5CSIA 1ZFSA 2FOTA 1B4CA 1K93D 2BBNA 2OTGC 1HT9A 1ZACA 2CXJA 2G9BA 1A2XA 1YURA 4Q04A 1JF0A 2M1UA 1XFYO 1ZMZA 3PALA 3TZ1A 2MLEC 1A03A 1UHHA 2JWWA 1CDPA 2KQYA 3D10A 2LLSA 1BU3A 1KWOC 1K9UA 3CR4X 3TDUA 1OQPA 1EG4A 4DRWA 1YUUA 3I5GC 1PVBA 2LP3A 4NQGA 1NIWA 1QLSA 3PLFB 1RTP1 1YX7A 1S5GZ 1SCMB 3NSKA 2LCPA 1BJFA 4C0KA 4GBAA 1F71A 4I5LB 4YBHB 4FQOA 5KTYA 3DF0A 1IG5A 3I5IB 4OV2A 5CPVA 4OCIA 1BLQA 3GOFA 1N2DA 4M2PA 5K89A 1FI6A 1S6IA 1Y1XA 3DVMA 3WXAA 3OB1B 1L2OC 3NXAA 1OSAA 5HKZA 5AEQA 2LMUA 3GK1A 1S26D 1CMGA 1K8UA 4P5OE 2LLUA 1WLMA 3M0WA 3BOWB 4WQ2A 2E30A 1KCYA 1DF0A 2JRFA 2KAVA 3CS1A 3O2PA 4AQJA 1CFCA 1XYDA 1MWNA 4NDCA 5DKRA 1DF0B 4YI8A 2ZN9A 2O5GA 1PULA 2L4HA 3SG6A 1QVIY 2G2BA 1J7RA 1K90D 1TRFA 4MZJA 2LMVA 3EK7A 3JVTB 3HCMA 1EL4A 2L0PA 3LK1A 1K96A 5DKQA 1F70A 1SL9A 2L98A 3SG3A 3VROA 3JTDB 4L9MA 2HETA 1AHRA 2Y1NA 4PCWA 3VGOA 3PN7B 1NPQA 1NSHA 4HREE 1F4QA 1MUXA 1V1FA 1PSBA 3O4YA 4UPGA 2WORA 1JFJA 2WCEA 4PALA 2BL0C 2M0RA 5JOLA 1ODBA 2BCBA 1J55A 1Q80A 1QATA 5FYXA 1B9AA 1Y6WA 1RFJA 3VRPA 1OE9B 1F55A 3BXKA 1UHNA 3SG7A 1CFDA 3FWBA 3EVVA 2FCEA 3A4UB 4OVNF 2K61A 1F54A 2KBIA 1YX8A 1DMOA 5D7FA 1F4OA 1TTXA 1B1GA 2L4IA 3A8RA 3QRXA 2KAYA 3TUYB 2JU0A 3OX6A 2QPTA 1HQVA 1RROA 2KBMA 2CBLA 4I5NB 5D69A 1TIZA 5AXIA 2LAPA 3EKHA 2JULA 5TNCA 1AVSA 1CKKA 1XK4A 3JTDC 3H4SE 1QXPA 1DTLA 2JT0A 2L51A 4MZKA 2DOQA 1QX5B 1B8RA 1ZOTB 3IQQA 4A4CA 4GGFC 1GGZA 1DJHA 3RM1A 2MLFC 1CFFA 5GQQC 4ZCVA 4DUQA 1EJ3A 4GGNA 2I7AA 1N0YA 1MF8B 3CR5X 1DJXA 3SIAA 1PRWA 1LKJA 3C1VA 2F2OA 1KK8C 2PSRA 4DS7A 4ETOA 1OOJA 1SL7A 1PALA 3NSOA 1RWYA 3CZTX 4C0JA 3CGAA 1NWDA 2H61A 2JT3A 2MHHA 2CCMA 1CTRA 5DKNA 1M63B 2B1UA 2F3YA 4I5JA 3FS7A 4GNKB 2KFFA 3PN7C 4OR9B 4HSZA 1R2UA 3I5FC 2JT8A 1SCMC 2HPSA 4M2OA 2JPTA 4MSPA 4MLWA 2I18A 2LHLA 5BPJA 1YVHA 2BBMA 4YGCB 2KFHA 1KK8B 2KDHA 1M31A 1FI5A 1KSOA 4XJKB 5I2OA 2JXCA 4QJ5B 1QJTA 2JXLA 1JSAA 1S5GY 1YTZC 3ZNIA 1J7QA 2WNDA 1IKUA 1MXLC 2KAXA 3PFVA 1YRUB 2KYFA 3VRNA 1JF2A 1KFUL 3PM8A 1NUBA 2BE6A 1A75A 3CWGA 4MRXA 4PDZA 4DIRA 1R6PA 1CLMA 1L7ZA 2LHIA 1FF1A 2D8NA 1IH0A 4ORAB 5ER4X 3AAKA 3D0YA 2OS8C 4WRIA 1WRLA 1LA0A 1SR6B 2M3WA 1H8BA 4MN0A 1OMRA 2MA2A 3JVTC 1BR1B 1CMFA 1EXRA 3IQOA 1XA5A 1NCXA 3NSLA 2WCBA 2P6BB 3DVJA 1SMGA 2K0JA 3LLEA 1B47A 4PE0A 1GGWA 1KQMB 1TN4A 3BUXB 1G4YR 4R1EA 4HRHA 1DT7B 3I5GB 2BKHB 1AK8A 1KFXL 3FIAA 2OTGB 1KSMA 2F33A 2COLB 2LV7A 3EK4A 3NSIA 5I8NA 1MR8A 2BL0B 2KQ6A 3IF7A 1DJIA 1YUTA 4CPVA 4YGBB 2LMTA 1IWQA 1JWDA 1RJVA 1S3PA 1IJ5A 3HX4A 3GK2A 4JWQA 1PK0D 3CR2A 2KGBC 4C0LA 4D1EA 3KHEA 4ZCUA 2LANA 1YUSA 5HLOA 4CFQA 1SNLA 5CSFA 2LNKA 3TS5B 1UUSA 2M9GA 1NYAA 1CLLA 1CDMA 4NDBA 1IGVA 4A4BA 1WLZA 3DF0B 3OB2B 4XYNA 2CNPA 2VRGA 3SIBA 1W7JB 2TN4A 1A75B 4HRGA 1FW4A 4JQ0D 4MBEA 4F0ZB 1M45A 3AAJA 1C07A 4E68A 1QTXA 1M46A 2K2AA 1DVIA 1PVAA 4N5XA 5HKWA 1G33A 2PALA 2K8MB 4I5KA 2MRDA 4PE1A 1KQVA 2KI6D 5CSJA 5HKYA 1S6JA 2AMIA 2LC5A 1IQ3A 4YGDB 1J7PA 1OMVA 4YGAA 2KHNA 1SK6D 2EGDA 2JC2A 2ZRTA 1QIVA 4ICBA 2M49B 1ZUZA 1K9PA 4TNCA 3ICBA 1KK7Y 1QX2A 2JQ6A 2GGMA 1AJ5A 3D0YB 1SR6C 5AFPA 1KFUS 2L50A 2NCOA 5CSNA 2FJUB 2AUCA 1UHIA 1WRZA 3VRRA 5J3XA 3BYAA 2M7LA 1DGUA 2QACA 1TNXA 5I2LA 1QVIZ 2CTNA 4JPZB 4N1FA 1XFUO 1AUIB 1CNPA 1TNQA 2BE4A 4YGEB 1SCVA 4GGFA 2M1KB 2NCPA 3BUOB 3SG2A 5HLVA 3WNXB 2NLNA 2PMYA 1J1EA 2OS8B 1NX2A 2V53A 1JBAA 4BY4A 2LVIA 1VRKA 3CTNA 1IJ6A 5G08A 1K9KA 3I5IC 4P2YB 4USLA 1XVJA 1SW8A 1BR4B 2F3ZA 2M8UA 2Y4QA 1Y1AA 3E3RA 1GJYA 1CLBA 2ZKMX 2KGRA 3EKJA 1EG3A 3WHUB 1LA3A 2LVKA 4MEWA 5B8IB 1CDNA 1B8LA 3WHTB 3LCPC 1C7WA 3I5HC 2EHBA 1K95A 4N1GA 3KO0A 2KI6C 3TUYC 1JFKA 1NCZA 4GUKA 2HF5A 2JZIA 5KSZA 1FPWA 4YRUA 2SCPA 5ER5A 5PALA 1XFVO 4M2QA 2LVVA 4U8DA 1SL8A 3PATA 2RGIA 1EH2A 5AERA 1A29A 1SPYA 1G8IA 1KWOB 1AP4A 1BF5A 1A4PA 3OHMB 2ZN8A 2OPOA 1CM4A 1LXFC 4NDDA 4ORCB 2JOJA 4XJKA 1RK9A 1B7TZ 2JNXA 3K21A 1JUOA 2H61C 3DD4A 4CIDA 1CDLA 2I94A 2I2RE 1TCFA 4PHNA 3TS5C 1DJWA 1QV0A 1SY9A 2ZNEA 2KI4B 1UHJA 1IQ5A 1K94A 4PHJA 1QLKA 2PVBA 3RLZA 1FBVA 2HQWA 2WC8A 3OX5A 1MXEA 1F8HA 1RECA 3EVRA 1UWOA 4FTGA 4MRYA 1OZSA 1XFZO 2CT9A 2IS9A 3KPXA 2L5XB 2KNEA 3DVKA 5I2QA 4OKHA 4IL1A 2NXQA 2FCDA 1NCYA 1ALWA 1QASA 3O6BA 1DJZA 3LL8B 2MJWB 2KOTA 2KFGA 2ISDA 1S1EA 2K7DA 1B7TY 2O60A 3EVUA 3I5FB 4PE7A 1ALVA 1CB1A 4YI9A 2MBXA 1H4BA 1J7OA 1XK4C 1XO5A 1TNWA 4MZLA 2MAZA 1NX1A 2NZ0A 4GPLB 1C7VA 1XFWO 4PE4A 1Y0VH 3BUNB 3EK8A 1WY9A 2BCXA 2LM5A 2R2IA 1DJGA 3F45A 3SG5A 5AANA 3TDIA 4BY5A 1JC2A 1NX3A 1SRAA 2ZFDA 3BOWA 4AQIA 2M97A 1TOPA 3OP0A 1QX7A 1NP8A 3KEVA 2JTTA 1TCOB 1MHOA 1YRTB 3I5HB 1KQMC 1W7IB 2H2KA 2LP2A 4DCKA 2Q4UA 2Q91A 5F6TA 2KYCA 1CFPA 1OZOA 1PSRA 1KK7Z 1X02A 1SKTA 3O78A 2LE9B 1BODA 2PASA 1QV1A 4AOMA 1S6CA 1UHKA 1LVCD 4QJ4B 1D1OA 2LVJA 2A4JA 2Y1MA 3DVEA 3LK0A 1IRJA 3AKBA 1TNPA 3SJSA 1OMDA 3KF9A 2AAOA 2LUCA 4PHKA 2ZNDA 2K7OA 1M39A 4GAOA 4GFTA 1YR5A 5HYDA 4CLNA 1KFXS 2Y5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BT6 A;  1MQ1 A;  3SG4 A;  4MVF A;  1CM1 A;  5JJG A;  2F8P A;  1QIW A;  2F2P A;  1WDC C;  1DGV A;  2KI4 C;  2BKI B;  2GV5 A;  1AJ4 A;  1K2H A;  4ORB B;  3MSE B;  4QJ3 B;  5IBW A;  1XFX O;  2WCF A;  1GQM A;  3TDZ A;  1S36 A;  3GK4 X;  3VRQ A;  1BMO A;  3FWC A;  2PRU A;  1YVL A;  1LIN A;  1SYM A;  2EC6 C;  1J1D A;  1BOC A;  2JNF A;  4PHM A;  2M7N A;  4WQ3 A;  1SBJ A;  1UUR A;  1U5I A;  1WRK A;  2KSP A;  2L2E A;  2ZRS A;  3BQ3 A;  3AKA A;  2LLT A;  1U5I B;  1WDC B;  2K7B A;  3PSR A;  4CFR A;  1UP5 A;  3CLN A;  2BCA A;  3BUW B;  2K2F A;  1V1G A;  2SAS A;  1NX0 A;  5KU1 A;  2BEC A;  1E8A A;  2E6W A;  1Y1U A;  2HQ8 A;  2JTZ A;  1L2O B;  2K7C A;  2EC6 B;  2LUX A;  2WOS A;  1B8C A;  1N65 A;  2M29 A;  1DJY A;  1QS7 A;  2GGZ A;  3BUM B;  3ZWH A;  1BG1 A;  5CSI A;  1ZFS A;  2FOT A;  1B4C A;  1K93 D;  2BBN A;  2OTG C;  1HT9 A;  1ZAC A;  2CXJ A;  2G9B A;  1A2X A;  1YUR A;  4Q04 A;  1JF0 A;  2M1U A;  1XFY O;  1ZMZ A;  3PAL A;  3TZ1 A;  2MLE C;  1A03 A;  1UHH A;  2JWW A;  1CDP A;  2KQY A;  3D10 A;  2LLS A;  1BU3 A;  1KWO C;  1K9U A;  3CR4 X;  3TDU A;  1OQP A;  1EG4 A;  4DRW A;  1YUU A;  3I5G C;  1PVB A;  2LP3 A;  4NQG A;  1NIW A;  1QLS A;  3PLF B;  1RTP 1;  1YX7 A;  1S5G Z;  1SCM B;  3NSK A;  2LCP A;  1BJF A;  4C0K A;  4GBA A;  1F71 A;  4I5L B;  4YBH B;  4FQO A;  5KTY A;  3DF0 A;  1IG5 A;  3I5I B;  4OV2 A;  5CPV A;  4OCI A;  1BLQ A;  3GOF A;  1N2D A;  4M2P A;  5K89 A;  1FI6 A;  1S6I A;  1Y1X A;  3DVM A;  3WXA A;  3OB1 B;  1L2O C;  3NXA A;  1OSA A;  5HKZ A;  5AEQ A;  2LMU A;  3GK1 A;  1S26 D;  1CMG A;  1K8U A;  4P5O E;  2LLU A;  1WLM A;  3M0W A;  3BOW B;  4WQ2 A;  2E30 A;  1KCY A;  1DF0 A;  2JRF A;  2KAV A;  3CS1 A;  3O2P A;  4AQJ A;  1CFC A;  1XYD A;  1MWN A;  4NDC A;  5DKR A;  1DF0 B;  4YI8 A;  2ZN9 A;  2O5G A;  1PUL A;  2L4H A;  3SG6 A;  1QVI Y;  2G2B A;  1J7R A;  1K90 D;  1TRF A;  4MZJ A;  2LMV A;  3EK7 A;  3JVT B;  3HCM A;  1EL4 A;  2L0P A;  3LK1 A;  1K96 A;  5DKQ A;  1F70 A;  1SL9 A;  2L98 A;  3SG3 A;  3VRO A;  3JTD B;  4L9M A;  2HET A;  1AHR A;  2Y1N A;  4PCW A;  3VGO A;  3PN7 B;  1NPQ A;  1NSH A;  4HRE E;  1F4Q A;  1MUX A;  1V1F A;  1PSB A;  3O4Y A;  4UPG A;  2WOR A;  1JFJ A;  2WCE A;  4PAL A;  2BL0 C;  2M0R A;  5JOL A;  1ODB A;  2BCB A;  1J55 A;  1Q80 A;  1QAT A;  5FYX A;  1B9A A;  1Y6W A;  1RFJ A;  3VRP A;  1OE9 B;  1F55 A;  3BXK A;  1UHN A;  3SG7 A;  1CFD A;  3FWB A;  3EVV A;  2FCE A;  3A4U B;  4OVN F;  2K61 A;  1F54 A;  2KBI A;  1YX8 A;  1DMO A;  5D7F A;  1F4O A;  1TTX A;  1B1G A;  2L4I A;  3A8R A;  3QRX A;  2KAY A;  3TUY B;  2JU0 A;  3OX6 A;  2QPT A;  1HQV A;  1RRO A;  2KBM A;  2CBL A;  4I5N B;  5D69 A;  1TIZ A;  5AXI A;  2LAP A;  3EKH A;  2JUL A;  5TNC A;  1AVS A;  1CKK A;  1XK4 A;  3JTD C;  3H4S E;  1QXP A;  1DTL A;  2JT0 A;  2L51 A;  4MZK A;  2DOQ A;  1QX5 B;  1B8R A;  1ZOT B;  3IQQ A;  4A4C A;  4GGF C;  1GGZ A;  1DJH A;  3RM1 A;  2MLF C;  1CFF A;  5GQQ C;  4ZCV A;  4DUQ A;  1EJ3 A;  4GGN A;  2I7A A;  1N0Y A;  1MF8 B;  3CR5 X;  1DJX A;  3SIA A;  1PRW A;  1LKJ A;  3C1V A;  2F2O A;  1KK8 C;  2PSR A;  4DS7 A;  4ETO A;  1OOJ A;  1SL7 A;  1PAL A;  3NSO A;  1RWY A;  3CZT X;  4C0J A;  3CGA A;  1NWD A;  2H61 A;  2JT3 A;  2MHH A;  2CCM A;  1CTR A;  5DKN A;  1M63 B;  2B1U A;  2F3Y A;  4I5J A;  3FS7 A;  4GNK B;  2KFF A;  3PN7 C;  4OR9 B;  4HSZ A;  1R2U A;  3I5F C;  2JT8 A;  1SCM C;  2HPS A;  4M2O A;  2JPT A;  4MSP A;  4MLW A;  2I18 A;  2LHL A;  5BPJ A;  1YVH A;  2BBM A;  4YGC B;  2KFH A;  1KK8 B;  2KDH A;  1M31 A;  1FI5 A;  1KSO A;  4XJK B;  5I2O A;  2JXC A;  4QJ5 B;  1QJT A;  2JXL A;  1JSA A;  1S5G Y;  1YTZ C;  3ZNI A;  1J7Q A;  2WND A;  1IKU A;  1MXL C;  2KAX A;  3PFV A;  1YRU B;  2KYF A;  3VRN A;  1JF2 A;  1KFU L;  3PM8 A;  1NUB A;  2BE6 A;  1A75 A;  3CWG A;  4MRX A;  4PDZ A;  4DIR A;  1R6P A;  1CLM A;  1L7Z A;  2LHI A;  1FF1 A;  2D8N A;  1IH0 A;  4ORA B;  5ER4 X;  3AAK A;  3D0Y A;  2OS8 C;  4WRI A;  1WRL A;  1LA0 A;  1SR6 B;  2M3W A;  1H8B A;  4MN0 A;  1OMR A;  2MA2 A;  3JVT C;  1BR1 B;  1CMF A;  1EXR A;  3IQO A;  1XA5 A;  1NCX A;  3NSL A;  2WCB A;  2P6B B;  3DVJ A;  1SMG A;  2K0J A;  3LLE A;  1B47 A;  4PE0 A;  1GGW A;  1KQM B;  1TN4 A;  3BUX B;  1G4Y R;  4R1E A;  4HRH A;  1DT7 B;  3I5G B;  2BKH B;  1AK8 A;  1KFX L;  3FIA A;  2OTG B;  1KSM A;  2F33 A;  2COL B;  2LV7 A;  3EK4 A;  3NSI A;  5I8N A;  1MR8 A;  2BL0 B;  2KQ6 A;  3IF7 A;  1DJI A;  1YUT A;  4CPV A;  4YGB B;  2LMT A;  1IWQ A;  1JWD A;  1RJV A;  1S3P A;  1IJ5 A;  3HX4 A;  3GK2 A;  4JWQ A;  1PK0 D;  3CR2 A;  2KGB C;  4C0L A;  4D1E A;  3KHE A;  4ZCU A;  2LAN A;  1YUS A;  5HLO A;  4CFQ A;  1SNL A;  5CSF A;  2LNK A;  3TS5 B;  1UUS A;  2M9G A;  1NYA A;  1CLL A;  1CDM A;  4NDB A;  1IGV A;  4A4B A;  1WLZ A;  3DF0 B;  3OB2 B;  4XYN A;  2CNP A;  2VRG A;  3SIB A;  1W7J B;  2TN4 A;  1A75 B;  4HRG A;  1FW4 A;  4JQ0 D;  4MBE A;  4F0Z B;  1M45 A;  3AAJ A;  1C07 A;  4E68 A;  1QTX A;  1M46 A;  2K2A A;  1DVI A;  1PVA A;  4N5X A;  5HKW A;  1G33 A;  2PAL A;  2K8M B;  4I5K A;  2MRD A;  4PE1 A;  1KQV A;  2KI6 D;  5CSJ A;  5HKY A;  1S6J A;  2AMI A;  2LC5 A;  1IQ3 A;  4YGD B;  1J7P A;  1OMV A;  4YGA A;  2KHN A;  1SK6 D;  2EGD A;  2JC2 A;  2ZRT A;  1QIV A;  4ICB A;  2M49 B;  1ZUZ A;  1K9P A;  4TNC A;  3ICB A;  1KK7 Y;  1QX2 A;  2JQ6 A;  2GGM A;  1AJ5 A;  3D0Y B;  1SR6 C;  5AFP A;  1KFU S;  2L50 A;  2NCO A;  5CSN A;  2FJU B;  2AUC A;  1UHI A;  1WRZ A;  3VRR A;  5J3X A;  3BYA A;  2M7L A;  1DGU A;  2QAC A;  1TNX A;  5I2L A;  1QVI Z;  2CTN A;  4JPZ B;  4N1F A;  1XFU O;  1AUI B;  1CNP A;  1TNQ A;  2BE4 A;  4YGE B;  1SCV A;  4GGF A;  2M1K B;  2NCP A;  3BUO B;  3SG2 A;  5HLV A;  3WNX B;  2NLN A;  2PMY A;  1J1E A;  2OS8 B;  1NX2 A;  2V53 A;  1JBA A;  4BY4 A;  2LVI A;  1VRK A;  3CTN A;  1IJ6 A;  5G08 A;  1K9K A;  3I5I C;  4P2Y B;  4USL A;  1XVJ A;  1SW8 A;  1BR4 B;  2F3Z A;  2M8U A;  2Y4Q A;  1Y1A A;  3E3R A;  1GJY A;  1CLB A;  2ZKM X;  2KGR A;  3EKJ A;  1EG3 A;  3WHU B;  1LA3 A;  2LVK A;  4MEW A;  5B8I B;  1CDN A;  1B8L A;  3WHT B;  3LCP C;  1C7W A;  3I5H C;  2EHB A;  1K95 A;  4N1G A;  3KO0 A;  2KI6 C;  3TUY C;  1JFK A;  1NCZ A;  4GUK A;  2HF5 A;  2JZI A;  5KSZ A;  1FPW A;  4YRU A;  2SCP A;  5ER5 A;  5PAL A;  1XFV O;  4M2Q A;  2LVV A;  4U8D A;  1SL8 A;  3PAT A;  2RGI A;  1EH2 A;  5AER A;  1A29 A;  1SPY A;  1G8I A;  1KWO B;  1AP4 A;  1BF5 A;  1A4P A;  3OHM B;  2ZN8 A;  2OPO A;  1CM4 A;  1LXF C;  4NDD A;  4ORC B;  2JOJ A;  4XJK A;  1RK9 A;  1B7T Z;  2JNX A;  3K21 A;  1JUO A;  2H61 C;  3DD4 A;  4CID A;  1CDL A;  2I94 A;  2I2R E;  1TCF A;  4PHN A;  3TS5 C;  1DJW A;  1QV0 A;  1SY9 A;  2ZNE A;  2KI4 B;  1UHJ A;  1IQ5 A;  1K94 A;  4PHJ A;  1QLK A;  2PVB A;  3RLZ A;  1FBV A;  2HQW A;  2WC8 A;  3OX5 A;  1MXE A;  1F8H A;  1REC A;  3EVR A;  1UWO A;  4FTG A;  4MRY A;  1OZS A;  1XFZ O;  2CT9 A;  2IS9 A;  3KPX A;  2L5X B;  2KNE A;  3DVK A;  5I2Q A;  4OKH A;  4IL1 A;  2NXQ A;  2FCD A;  1NCY A;  1ALW A;  1QAS A;  3O6B A;  1DJZ A;  3LL8 B;  2MJW B;  2KOT A;  2KFG A;  2ISD A;  1S1E A;  2K7D A;  1B7T Y;  2O60 A;  3EVU A;  3I5F B;  4PE7 A;  1ALV A;  1CB1 A;  4YI9 A;  2MBX A;  1H4B A;  1J7O A;  1XK4 C;  1XO5 A;  1TNW A;  4MZL A;  2MAZ A;  1NX1 A;  2NZ0 A;  4GPL B;  1C7V A;  1XFW O;  4PE4 A;  1Y0V H;  3BUN B;  3EK8 A;  1WY9 A;  2BCX A;  2LM5 A;  2R2I A;  1DJG A;  3F45 A;  3SG5 A;  5AAN A;  3TDI A;  4BY5 A;  1JC2 A;  1NX3 A;  1SRA A;  2ZFD A;  3BOW A;  4AQI A;  2M97 A;  1TOP A;  3OP0 A;  1QX7 A;  1NP8 A;  3KEV A;  2JTT A;  1TCO B;  1MHO A;  1YRT B;  3I5H B;  1KQM C;  1W7I B;  2H2K A;  2LP2 A;  4DCK A;  2Q4U A;  2Q91 A;  5F6T A;  2KYC A;  1CFP A;  1OZO A;  1PSR A;  1KK7 Z;  1X02 A;  1SKT A;  3O78 A;  2LE9 B;  1BOD A;  2PAS A;  1QV1 A;  4AOM A;  1S6C A;  1UHK A;  1LVC D;  4QJ4 B;  1D1O A;  2LVJ A;  2A4J A;  2Y1M A;  3DVE A;  3LK0 A;  1IRJ A;  3AKB A;  1TNP A;  3SJS A;  1OMD A;  3KF9 A;  2AAO A;  2LUC A;  4PHK A;  2ZND A;  2K7O A;  1M39 A;  4GAO A;  4GFT A;  1YR5 A;  5HYD A;  4CLN A;  1KFX S;  2Y5I A; 
#chains in the Genus database with same CATH topology
 1BT6 A;  1MQ1 A;  3SG4 A;  3D73 A;  4MVF A;  1CM1 A;  5JJG A;  2F8P A;  1QIW A;  2F2P A;  1WDC C;  1DGV A;  2KI4 C;  2BKI B;  2GV5 A;  3BFH A;  1AJ4 A;  1K2H A;  2WC6 A;  4ORB B;  3MSE B;  4QJ3 B;  5IBW A;  1XFX O;  2WCF A;  1GQM A;  3TDZ A;  1S36 A;  3GK4 X;  3VRQ A;  1BMO A;  3CZ0 A;  2PRU A;  3FWC A;  1YVL A;  1LIN A;  1SYM A;  2EC6 C;  1J1D A;  2ERB A;  1BOC A;  2JNF A;  4PHM A;  2M7N A;  3R72 A;  2P71 A;  4WQ3 A;  1SBJ A;  1Z2C B;  1UUR A;  2QEH A;  1U5I A;  1WRK A;  2KSP A;  2L2E A;  2ZRS A;  3BQ3 A;  3AKA A;  4JKT A;  2LLT A;  1U5I B;  1WDC B;  2FJY A;  2K7B A;  3PSR A;  4CFR A;  1UP5 A;  3Q8I A;  3CLN A;  3R1P A;  2BCA A;  3BUW B;  2K2F A;  1V1G A;  2SAS A;  1NX0 A;  5KU1 A;  2BEC A;  1E8A A;  2E6W A;  1Y1U A;  2HQ8 A;  2JTZ A;  1L2O B;  2K7C A;  2EC6 B;  2LUX A;  2WOS A;  1B8C A;  1N65 A;  2M29 A;  1DJY A;  1QS7 A;  2GGZ A;  3BUM B;  3ZWH A;  1BG1 A;  5CSI A;  1ZFS A;  2FOT A;  1B4C A;  1K93 D;  2BBN A;  2OTG C;  1HT9 A;  1ZAC A;  2CXJ A;  2G9B A;  1A2X A;  1YUR A;  4Q04 A;  1JF0 A;  2M1U A;  1XFY O;  1ZMZ A;  3PAL A;  3TZ1 A;  2MLE C;  1A03 A;  1UHH A;  2JWW A;  1CDP A;  2KQY A;  3D10 A;  2LLS A;  1BU3 A;  1KWO C;  1K9U A;  3CR4 X;  3TDU A;  1OQP A;  1EG4 A;  4DRW A;  1YUU A;  3I5G C;  1PVB A;  2LP3 A;  4NQG A;  1NIW A;  1QLS A;  3PLF B;  4F7F A;  1RTP 1;  1YX7 A;  1S5G Z;  3NHI A;  1SCM B;  3NSK A;  2LCP A;  1BJF A;  4C0K A;  3FE9 A;  4GBA A;  1F71 A;  4I5L B;  4YBH B;  4FQO A;  5KTY A;  3DF0 A;  1IG5 A;  3I5I B;  4OV2 A;  5CPV A;  4OCI A;  3SS5 A;  3GOF A;  1N2D A;  4M2P A;  5K89 A;  1BLQ A;  1FI6 A;  1S6I A;  1Y1X A;  5EL2 A;  3DVM A;  3WXA A;  3OB1 B;  2PQL A;  1L2O C;  3NXA A;  1OSA A;  5HKZ A;  5AEQ A;  2LMU A;  3GK1 A;  1S26 D;  1CMG A;  1K8U A;  4P5O E;  2LLU A;  1WLM A;  3M0W A;  3BOW B;  3CZ1 A;  2E30 A;  4WQ2 A;  1KCY A;  1DF0 A;  2JRF A;  1OOG A;  2KAV A;  3CS1 A;  3O2P A;  4AQJ A;  2L5Y A;  1XYD A;  1MWN A;  4NDC A;  5DKR A;  1CFC A;  1GM0 A;  1DF0 B;  4YI8 A;  1C3Z A;  2ZN9 A;  2O5G A;  1PUL A;  2L4H A;  3SG6 A;  1QVI Y;  2G2B A;  1J7R A;  1K90 D;  1TRF A;  4MZJ A;  5I94 A;  2LMV A;  3EK7 A;  3JVT B;  2BNX A;  3HCM A;  1C3Y A;  4KYN A;  1EL4 A;  4IJ7 A;  2L0P A;  3LK1 A;  1K96 A;  1P28 A;  5DKQ A;  1F70 A;  1SL9 A;  2L98 A;  3SG3 A;  3VRO A;  3JTD B;  2QEB A;  3BFA A;  4L9M A;  2HET A;  1AHR A;  2Y1N A;  4PCW A;  3B6X A;  3NHT A;  3VGO A;  3PN7 B;  2WCH A;  2WCM A;  3NGV A;  1NPQ A;  1OOH A;  1NSH A;  4HRE E;  1F4Q A;  1MUX A;  1OOF A;  1TWO A;  1PSB A;  1V1F A;  3O4Y A;  4UPG A;  2WOR A;  1JFJ A;  2WCE A;  4PAL A;  2BL0 C;  2M0R A;  5JOL A;  1ODB A;  2BCB A;  1J55 A;  1Q80 A;  1QAT A;  5FYX A;  1B9A A;  4BY5 A;  1Y6W A;  1RFJ A;  3VRP A;  1OE9 B;  1F55 A;  3BXK A;  1UHN A;  3VB1 A;  3SG7 A;  1CFD A;  3FWB A;  3EVV A;  4PT1 A;  2FCE A;  3A4U B;  4OVN F;  3CYZ A;  2K61 A;  1F54 A;  2KBI A;  1YX8 A;  1DMO A;  5D7F A;  1F4O A;  1TTX A;  1B1G A;  2L4I A;  3A8R A;  3QRX A;  2KAY A;  3TUY B;  2JU0 A;  3OX6 A;  2QPT A;  1HQV A;  1RRO A;  2KBM A;  2CBL A;  4I5N B;  5D69 A;  1TIZ A;  2QEO A;  5AXI A;  2LAP A;  3EKH A;  2JUL A;  5TNC A;  1AVS A;  1CKK A;  1XK4 A;  3JTD C;  3H4S E;  3V2L A;  1QXP A;  3CDN A;  1DTL A;  2JT0 A;  2L51 A;  4MZK A;  2DOQ A;  1QX5 B;  1B8R A;  1ZOT B;  3IQQ A;  4A4C A;  4GGF C;  3FE6 A;  1GGZ A;  1DJH A;  3RM1 A;  2MLF C;  1CFF A;  3B87 A;  5GQQ C;  1DEK A;  4ZCV A;  4DUQ A;  1EJ3 A;  4GGN A;  2I7A A;  1N0Y A;  1MF8 B;  3CR5 X;  1DJX A;  3SIA A;  1PRW A;  1LKJ A;  3C1V A;  2F2O A;  1KK8 C;  3PM2 A;  2PSR A;  4DS7 A;  4ETO A;  1OOJ A;  1SL7 A;  1PAL A;  3NSO A;  1RWY A;  3CZT X;  4C0J A;  3CGA A;  1NWD A;  3IVT A;  2H61 A;  2JT3 A;  2MHH A;  2CCM A;  1CTR A;  3D78 A;  5DKN A;  1M63 B;  2B1U A;  2F3Y A;  4I5J A;  3FS7 A;  1DEL A;  2KFF A;  3PN7 C;  4GNK B;  4OR9 B;  3DY9 A;  4HSZ A;  3UO9 A;  1R2U A;  3I5F C;  1DQE A;  2JT8 A;  3L4L A;  3L4A A;  1SCM C;  2HPS A;  4M2O A;  2JPT A;  4MSP A;  4MLW A;  2I18 A;  2LHL A;  5BPJ A;  1YVH A;  2BBM A;  4YGC B;  2KFH A;  1KK8 B;  1LS8 A;  2KDH A;  1M31 A;  1FI5 A;  1KSO A;  4XJK B;  5I2O A;  3S0G A;  1XFR A;  2WCL A;  2JXC A;  4QJ5 B;  1QJT A;  2JXL A;  1JSA A;  1S5G Y;  1YTZ C;  3ZNI A;  1J7Q A;  3K1E A;  2H8V A;  2WND A;  1IKU A;  1MXL C;  2KAX A;  3PFV A;  1YRU B;  2BAP A;  2KYF A;  3VRN A;  1JF2 A;  1KFU L;  3PM8 A;  1NUB A;  2BE6 A;  1OW4 A;  1A75 A;  3CWG A;  4MRX A;  4PDZ A;  4DIR A;  1R6P A;  3B7A A;  1CLM A;  1L7Z A;  2LHI A;  1FF1 A;  2D8N A;  1IH0 A;  4ORA B;  5ER4 X;  3AAK A;  3D0Y A;  4INW A;  2OS8 C;  4WRI A;  1WRL A;  1LA0 A;  1SR6 B;  2M3W A;  3DXL A;  1H8B A;  4MN0 A;  1OMR A;  1TUJ A;  2MA2 A;  3JVT C;  1BR1 B;  1CMF A;  1EXR A;  3IQO A;  1XA5 A;  1NCX A;  3NSL A;  2WCB A;  2P6B B;  3DVJ A;  1SMG A;  2K0J A;  2KLE A;  3LLE A;  4OZD A;  1B47 A;  4PE0 A;  1GGW A;  2QEV A;  1KQM B;  1TN4 A;  1TUZ A;  1G4Y R;  3BUX B;  4R1E A;  4HRH A;  1DT7 B;  3OGN A;  3I5G B;  2BKH B;  1AK8 A;  1KFX L;  3FIA A;  2OTG B;  1KSM A;  2F33 A;  2COL B;  2LV7 A;  3EK4 A;  3NSI A;  5I8N A;  1MR8 A;  2BL0 B;  2KQ6 A;  3IF7 A;  1DJI A;  5FI7 A;  1YUT A;  4CPV A;  4YGB B;  2LMT A;  1IWQ A;  1JWD A;  1RJV A;  1S3P A;  1IJ5 A;  3HX4 A;  3GK2 A;  4JWQ A;  1PK0 D;  3CR2 A;  2KGB C;  4C0L A;  4D1E A;  3KHE A;  5DIC A;  4ZCU A;  2LAN A;  1YUS A;  5HLO A;  4CFQ A;  1SNL A;  5CSF A;  4JD9 A;  2LNK A;  3TS5 B;  1UUS A;  2M9G A;  1NYA A;  1CLL A;  1CDM A;  4NDB A;  1IGV A;  4A4B A;  1WLZ A;  3DF0 B;  3OB2 B;  4XYN A;  2CNP A;  2L2C A;  2VRG A;  4FQT A;  1W7J B;  3SIB A;  2TN4 A;  1A75 B;  4HRG A;  1FW4 A;  4JQ0 D;  4MBE A;  4F0Z B;  1M45 A;  3AAJ A;  1DC1 A;  1C07 A;  4E68 A;  1QTX A;  1T14 A;  1M46 A;  2K2A A;  1DVI A;  1PVA A;  4N5X A;  5HKW A;  1G33 A;  2PAL A;  2K8M B;  2WCK A;  2MRD A;  4I5K A;  4PE1 A;  2KI6 D;  5CSJ A;  1KQV A;  5HKY A;  1S6J A;  2AMI A;  2LC5 A;  3R1V A;  4YGD B;  1IQ3 A;  1OMV A;  4YGA A;  1J7P A;  2KHN A;  1SK6 D;  2EGD A;  2JC2 A;  2ZRT A;  1QIV A;  4ICB A;  2M49 B;  2P70 A;  1ZUZ A;  1K9P A;  4TNC A;  3ICB A;  1KK7 Y;  1QX2 A;  2JQ6 A;  2GGM A;  1AJ5 A;  3D0Y B;  1SR6 C;  3CZ2 A;  5AFP A;  1KFU S;  2L50 A;  2NCO A;  5CSN A;  2FJU B;  2AUC A;  1UHI A;  1WRZ A;  3VRR A;  5J3X A;  3BYA A;  2M7L A;  1DGU A;  2QAC A;  1TNX A;  3S0D A;  5I2L A;  1QVI Z;  2CTN A;  4JPZ B;  4N1F A;  1XFU O;  1AUI B;  3QME A;  1CNP A;  1TNQ A;  2BE4 A;  4YGE B;  1SCV A;  3B86 A;  4GGF A;  2M1K B;  2NCP A;  3BUO B;  3SG2 A;  5HLV A;  3WNX B;  2NLN A;  2PMY A;  1J1E A;  2OS8 B;  1NX2 A;  2V53 A;  5FI2 A;  1JBA A;  4BY4 A;  2LVI A;  1VRK A;  3CTN A;  1IJ6 A;  5G08 A;  1K9K A;  3I5I C;  4P2Y B;  3S0F A;  4USL A;  1XVJ A;  1SW8 A;  1BR4 B;  2F3Z A;  2M8U A;  2Y4Q A;  1Y1A A;  3E3R A;  1GJY A;  1CLB A;  2ZKM X;  2GTE A;  2KGR A;  3EKJ A;  1EG3 A;  3RZS A;  3WHU B;  1LA3 A;  3L47 A;  2LVK A;  4MEW A;  5B8I B;  1CDN A;  1B8L A;  3WHT B;  3OBV A;  3LCP C;  1C7W A;  3I5H C;  5D3O A;  2EHB A;  1K95 A;  4N1G A;  3KO0 A;  2KI6 C;  3TUY C;  1IIO A;  3FE8 A;  1JFK A;  1NCZ A;  4GUK A;  2HF5 A;  3N7H A;  2YGU A;  2JZI A;  2WCJ A;  5KSZ A;  1FPW A;  4YRU A;  2SCP A;  5ER5 A;  3O4X A;  5PAL A;  1XFV O;  4M2Q A;  2LVV A;  3BJH A;  4U8D A;  1SL8 A;  3PAT A;  2RGI A;  1EH2 A;  5AER A;  1A29 A;  1SPY A;  1G8I A;  1KWO B;  1AP4 A;  1BF5 A;  1A4P A;  3OHM B;  3S0E A;  2ZN8 A;  2OPO A;  1CM4 A;  2JPO A;  3DYE A;  1LXF C;  2K60 A;  4NDD A;  4ORC B;  2JOJ A;  4XJK A;  1RK9 A;  1B7T Z;  2JNX A;  3D77 A;  3K21 A;  1JUO A;  2H61 C;  3DD4 A;  4CID A;  1CDL A;  2I94 A;  2I2R E;  1TCF A;  4PHN A;  3TS5 C;  1DJW A;  1QV0 A;  1SY9 A;  2ZNE A;  2KLD A;  2KI4 B;  1UHJ A;  1IQ5 A;  1K94 A;  4PHJ A;  1QLK A;  2PVB A;  3RLZ A;  1FBV A;  2HQW A;  2WC8 A;  3OX5 A;  1MXE A;  1F8H A;  1REC A;  3EVR A;  1UWO A;  4FTG A;  1SSE B;  4MRY A;  1OZS A;  1XFZ O;  2CT9 A;  3SS3 A;  3D76 A;  2IS9 A;  3KPX A;  2L5X B;  2KNE A;  3DVK A;  5I2Q A;  4OKH A;  4IL1 A;  2NXQ A;  1NCY A;  2FCD A;  1ALW A;  1QAS A;  2WC5 A;  3EG5 B;  1DJZ A;  3LL8 B;  3O6B A;  2MJW B;  2KOT A;  2KFG A;  2ISD A;  4INX A;  1S1E A;  3R1O A;  2K7D A;  1B7T Y;  2O60 A;  3EVU A;  3I5F B;  4PE7 A;  1ALV A;  1CB1 A;  4YI9 A;  2MBX A;  1H4B A;  1J7O A;  1XK4 C;  1XO5 A;  1TNW A;  4MZL A;  2MAZ A;  1NX1 A;  2NZ0 A;  4GPL B;  1C7V A;  1XFW O;  4PE4 A;  1Y0V H;  3BUN B;  3EK8 A;  1WY9 A;  2BCX A;  2LM5 A;  2R2I A;  1DJG A;  1W9Z A;  3B88 A;  3F45 A;  5AAN A;  3SG5 A;  3TDI A;  1JC2 A;  1NX3 A;  1SRA A;  2ZFD A;  1OOI X;  3BOW A;  4AQI A;  2M97 A;  2PYQ A;  1TOP A;  3OP0 A;  1QX7 A;  1NP8 A;  3KEV A;  2JTT A;  1TCO B;  1MHO A;  3S0B A;  1YRT B;  3I5H B;  3PJI A;  1KQM C;  1W7I B;  2H2K A;  3S0A A;  2LP2 A;  3DZT A;  2Q4U A;  4DCK A;  2Q91 A;  5F6T A;  2KYC A;  1CFP A;  1OZO A;  2KPH A;  1PSR A;  1KK7 Z;  1X02 A;  1Z4H A;  3D74 A;  1SKT A;  3O78 A;  5FI6 A;  2LE9 B;  1BOD A;  3D75 A;  1QWV A;  1QV1 A;  2PAS A;  3BFB A;  1S6C A;  1UHK A;  1LVC D;  3SS4 A;  4AOM A;  4QJ4 B;  2LVJ A;  2QDI A;  1D1O A;  2A4J A;  2Y1M A;  3CAB A;  3DVE A;  3LK0 A;  1IRJ A;  3AKB A;  1TNP A;  3SJS A;  1OMD A;  3KF9 A;  2AAO A;  2LUC A;  4PHK A;  3UNW A;  1ORG A;  2ZND A;  5HL1 A;  2K7O A;  1M39 A;  4GAO A;  4GFT A;  1YR5 A;  5HYD A;  4CLN A;  1KFX S;  2Y5I A; 
#chains in the Genus database with same CATH homology
 1BT6 A;  1MQ1 A;  3SG4 A;  4MVF A;  1CM1 A;  5JJG A;  2F8P A;  1QIW A;  2F2P A;  1WDC C;  1DGV A;  2KI4 C;  2BKI B;  2GV5 A;  1AJ4 A;  1K2H A;  4ORB B;  3MSE B;  4QJ3 B;  5IBW A;  1XFX O;  2WCF A;  1GQM A;  3TDZ A;  1S36 A;  3GK4 X;  3VRQ A;  1BMO A;  3FWC A;  2PRU A;  1YVL A;  1LIN A;  1SYM A;  2EC6 C;  1J1D A;  1BOC A;  2JNF A;  4PHM A;  2M7N A;  4WQ3 A;  1SBJ A;  1UUR A;  1U5I A;  1WRK A;  2KSP A;  2L2E A;  2ZRS A;  3BQ3 A;  3AKA A;  2LLT A;  1U5I B;  1WDC B;  2K7B A;  3PSR A;  4CFR A;  1UP5 A;  3CLN A;  2BCA A;  3BUW B;  2K2F A;  1V1G A;  2SAS A;  1NX0 A;  5KU1 A;  2BEC A;  1E8A A;  2E6W A;  1Y1U A;  2HQ8 A;  2JTZ A;  1L2O B;  2K7C A;  2EC6 B;  2LUX A;  2WOS A;  1B8C A;  1N65 A;  2M29 A;  1DJY A;  1QS7 A;  2GGZ A;  3BUM B;  3ZWH A;  1BG1 A;  5CSI A;  1ZFS A;  2FOT A;  1B4C A;  1K93 D;  2BBN A;  2OTG C;  1HT9 A;  1ZAC A;  2CXJ A;  2G9B A;  1A2X A;  1YUR A;  4Q04 A;  1JF0 A;  2M1U A;  1XFY O;  1ZMZ A;  3PAL A;  3TZ1 A;  2MLE C;  1A03 A;  1UHH A;  2JWW A;  1CDP A;  2KQY A;  3D10 A;  2LLS A;  1BU3 A;  1KWO C;  1K9U A;  3CR4 X;  3TDU A;  1OQP A;  1EG4 A;  4DRW A;  1YUU A;  3I5G C;  1PVB A;  2LP3 A;  4NQG A;  1NIW A;  1QLS A;  3PLF B;  1RTP 1;  1YX7 A;  1S5G Z;  1SCM B;  3NSK A;  2LCP A;  1BJF A;  4C0K A;  4GBA A;  1F71 A;  4I5L B;  4YBH B;  4FQO A;  5KTY A;  3DF0 A;  1IG5 A;  3I5I B;  4OV2 A;  5CPV A;  4OCI A;  1BLQ A;  3GOF A;  1N2D A;  4M2P A;  5K89 A;  1FI6 A;  1S6I A;  1Y1X A;  3DVM A;  3WXA A;  3OB1 B;  1L2O C;  3NXA A;  1OSA A;  5HKZ A;  5AEQ A;  2LMU A;  3GK1 A;  1S26 D;  1CMG A;  1K8U A;  4P5O E;  2LLU A;  1WLM A;  3M0W A;  3BOW B;  4WQ2 A;  2E30 A;  1KCY A;  1DF0 A;  2JRF A;  2KAV A;  3CS1 A;  3O2P A;  4AQJ A;  1CFC A;  1XYD A;  1MWN A;  4NDC A;  5DKR A;  1DF0 B;  4YI8 A;  2ZN9 A;  2O5G A;  1PUL A;  2L4H A;  3SG6 A;  1QVI Y;  2G2B A;  1J7R A;  1K90 D;  1TRF A;  4MZJ A;  2LMV A;  3EK7 A;  3JVT B;  3HCM A;  1EL4 A;  2L0P A;  3LK1 A;  1K96 A;  5DKQ A;  1F70 A;  1SL9 A;  2L98 A;  3SG3 A;  3VRO A;  3JTD B;  4L9M A;  2HET A;  1AHR A;  2Y1N A;  4PCW A;  3VGO A;  3PN7 B;  1NPQ A;  1NSH A;  4HRE E;  1F4Q A;  1MUX A;  1V1F A;  1PSB A;  3O4Y A;  4UPG A;  2WOR A;  1JFJ A;  2WCE A;  4PAL A;  2BL0 C;  2M0R A;  5JOL A;  1ODB A;  2BCB A;  1J55 A;  1Q80 A;  1QAT A;  5FYX A;  1B9A A;  1Y6W A;  1RFJ A;  3VRP A;  1OE9 B;  1F55 A;  3BXK A;  1UHN A;  3SG7 A;  1CFD A;  3FWB A;  3EVV A;  2FCE A;  3A4U B;  4OVN F;  2K61 A;  1F54 A;  2KBI A;  1YX8 A;  1DMO A;  5D7F A;  1F4O A;  1TTX A;  1B1G A;  2L4I A;  3A8R A;  3QRX A;  2KAY A;  3TUY B;  2JU0 A;  3OX6 A;  2QPT A;  1HQV A;  1RRO A;  2KBM A;  2CBL A;  4I5N B;  5D69 A;  1TIZ A;  5AXI A;  2LAP A;  3EKH A;  2JUL A;  5TNC A;  1AVS A;  1CKK A;  1XK4 A;  3JTD C;  3H4S E;  1QXP A;  1DTL A;  2JT0 A;  2L51 A;  4MZK A;  2DOQ A;  1QX5 B;  1B8R A;  1ZOT B;  3IQQ A;  4A4C A;  4GGF C;  1GGZ A;  1DJH A;  3RM1 A;  2MLF C;  1CFF A;  5GQQ C;  4ZCV A;  4DUQ A;  1EJ3 A;  4GGN A;  2I7A A;  1N0Y A;  1MF8 B;  3CR5 X;  1DJX A;  3SIA A;  1PRW A;  1LKJ A;  3C1V A;  2F2O A;  1KK8 C;  2PSR A;  4DS7 A;  4ETO A;  1OOJ A;  1SL7 A;  1PAL A;  3NSO A;  1RWY A;  3CZT X;  4C0J A;  3CGA A;  1NWD A;  2H61 A;  2JT3 A;  2MHH A;  2CCM A;  1CTR A;  5DKN A;  1M63 B;  2B1U A;  2F3Y A;  4I5J A;  3FS7 A;  4GNK B;  2KFF A;  3PN7 C;  4OR9 B;  4HSZ A;  1R2U A;  3I5F C;  2JT8 A;  1SCM C;  2HPS A;  4M2O A;  2JPT A;  4MSP A;  4MLW A;  2I18 A;  2LHL A;  5BPJ A;  1YVH A;  2BBM A;  4YGC B;  2KFH A;  1KK8 B;  2KDH A;  1M31 A;  1FI5 A;  1KSO A;  4XJK B;  5I2O A;  2JXC A;  4QJ5 B;  1QJT A;  2JXL A;  1JSA A;  1S5G Y;  1YTZ C;  3ZNI A;  1J7Q A;  2WND A;  1IKU A;  1MXL C;  2KAX A;  3PFV A;  1YRU B;  2KYF A;  3VRN A;  1JF2 A;  1KFU L;  3PM8 A;  1NUB A;  2BE6 A;  1A75 A;  3CWG A;  4MRX A;  4PDZ A;  4DIR A;  1R6P A;  1CLM A;  1L7Z A;  2LHI A;  1FF1 A;  2D8N A;  1IH0 A;  4ORA B;  5ER4 X;  3AAK A;  3D0Y A;  2OS8 C;  4WRI A;  1WRL A;  1LA0 A;  1SR6 B;  2M3W A;  1H8B A;  4MN0 A;  1OMR A;  2MA2 A;  3JVT C;  1BR1 B;  1CMF A;  1EXR A;  3IQO A;  1XA5 A;  1NCX A;  3NSL A;  2WCB A;  2P6B B;  3DVJ A;  1SMG A;  2K0J A;  3LLE A;  1B47 A;  4PE0 A;  1GGW A;  1KQM B;  1TN4 A;  3BUX B;  1G4Y R;  4R1E A;  4HRH A;  1DT7 B;  3I5G B;  2BKH B;  1AK8 A;  1KFX L;  3FIA A;  2OTG B;  1KSM A;  2F33 A;  2COL B;  2LV7 A;  3EK4 A;  3NSI A;  5I8N A;  1MR8 A;  2BL0 B;  2KQ6 A;  3IF7 A;  1DJI A;  1YUT A;  4CPV A;  4YGB B;  2LMT A;  1IWQ A;  1JWD A;  1RJV A;  1S3P A;  1IJ5 A;  3HX4 A;  3GK2 A;  4JWQ A;  1PK0 D;  3CR2 A;  2KGB C;  4C0L A;  4D1E A;  3KHE A;  4ZCU A;  2LAN A;  1YUS A;  5HLO A;  4CFQ A;  1SNL A;  5CSF A;  2LNK A;  3TS5 B;  1UUS A;  2M9G A;  1NYA A;  1CLL A;  1CDM A;  4NDB A;  1IGV A;  4A4B A;  1WLZ A;  3DF0 B;  3OB2 B;  4XYN A;  2CNP A;  2VRG A;  3SIB A;  1W7J B;  2TN4 A;  1A75 B;  4HRG A;  1FW4 A;  4JQ0 D;  4MBE A;  4F0Z B;  1M45 A;  3AAJ A;  1C07 A;  4E68 A;  1QTX A;  1M46 A;  2K2A A;  1DVI A;  1PVA A;  4N5X A;  5HKW A;  1G33 A;  2PAL A;  2K8M B;  4I5K A;  2MRD A;  4PE1 A;  1KQV A;  2KI6 D;  5CSJ A;  5HKY A;  1S6J A;  2AMI A;  2LC5 A;  1IQ3 A;  4YGD B;  1J7P A;  1OMV A;  4YGA A;  2KHN A;  1SK6 D;  2EGD A;  2JC2 A;  2ZRT A;  1QIV A;  4ICB A;  2M49 B;  1ZUZ A;  1K9P A;  4TNC A;  3ICB A;  1KK7 Y;  1QX2 A;  2JQ6 A;  2GGM A;  1AJ5 A;  3D0Y B;  1SR6 C;  5AFP A;  1KFU S;  2L50 A;  2NCO A;  5CSN A;  2FJU B;  2AUC A;  1UHI A;  1WRZ A;  3VRR A;  5J3X A;  3BYA A;  2M7L A;  1DGU A;  2QAC A;  1TNX A;  5I2L A;  1QVI Z;  2CTN A;  4JPZ B;  4N1F A;  1XFU O;  1AUI B;  1CNP A;  1TNQ A;  2BE4 A;  4YGE B;  1SCV A;  4GGF A;  2M1K B;  2NCP A;  3BUO B;  3SG2 A;  5HLV A;  3WNX B;  2NLN A;  2PMY A;  1J1E A;  2OS8 B;  1NX2 A;  2V53 A;  1JBA A;  4BY4 A;  2LVI A;  1VRK A;  3CTN A;  1IJ6 A;  5G08 A;  1K9K A;  3I5I C;  4P2Y B;  4USL A;  1XVJ A;  1SW8 A;  1BR4 B;  2F3Z A;  2M8U A;  2Y4Q A;  1Y1A A;  3E3R A;  1GJY A;  1CLB A;  2ZKM X;  2KGR A;  3EKJ A;  1EG3 A;  3WHU B;  1LA3 A;  2LVK A;  4MEW A;  5B8I B;  1CDN A;  1B8L A;  3WHT B;  3LCP C;  1C7W A;  3I5H C;  2EHB A;  1K95 A;  4N1G A;  3KO0 A;  2KI6 C;  3TUY C;  1JFK A;  1NCZ A;  4GUK A;  2HF5 A;  2JZI A;  5KSZ A;  1FPW A;  4YRU A;  2SCP A;  5ER5 A;  5PAL A;  1XFV O;  4M2Q A;  2LVV A;  4U8D A;  1SL8 A;  3PAT A;  2RGI A;  1EH2 A;  5AER A;  1A29 A;  1SPY A;  1G8I A;  1KWO B;  1AP4 A;  1BF5 A;  1A4P A;  3OHM B;  2ZN8 A;  2OPO A;  1CM4 A;  1LXF C;  4NDD A;  4ORC B;  2JOJ A;  4XJK A;  1RK9 A;  1B7T Z;  2JNX A;  3K21 A;  1JUO A;  2H61 C;  3DD4 A;  4CID A;  1CDL A;  2I94 A;  2I2R E;  1TCF A;  4PHN A;  3TS5 C;  1DJW A;  1QV0 A;  1SY9 A;  2ZNE A;  2KI4 B;  1UHJ A;  1IQ5 A;  1K94 A;  4PHJ A;  1QLK A;  2PVB A;  3RLZ A;  1FBV A;  2HQW A;  2WC8 A;  3OX5 A;  1MXE A;  1F8H A;  1REC A;  3EVR A;  1UWO A;  4FTG A;  4MRY A;  1OZS A;  1XFZ O;  2CT9 A;  2IS9 A;  3KPX A;  2L5X B;  2KNE A;  3DVK A;  5I2Q A;  4OKH A;  4IL1 A;  2NXQ A;  2FCD A;  1NCY A;  1ALW A;  1QAS A;  3O6B A;  1DJZ A;  3LL8 B;  2MJW B;  2KOT A;  2KFG A;  2ISD A;  1S1E A;  2K7D A;  1B7T Y;  2O60 A;  3EVU A;  3I5F B;  4PE7 A;  1ALV A;  1CB1 A;  4YI9 A;  2MBX A;  1H4B A;  1J7O A;  1XK4 C;  1XO5 A;  1TNW A;  4MZL A;  2MAZ A;  1NX1 A;  2NZ0 A;  4GPL B;  1C7V A;  1XFW O;  4PE4 A;  1Y0V H;  3BUN B;  3EK8 A;  1WY9 A;  2BCX A;  2LM5 A;  2R2I A;  1DJG A;  3F45 A;  3SG5 A;  5AAN A;  3TDI A;  4BY5 A;  1JC2 A;  1NX3 A;  1SRA A;  2ZFD A;  3BOW A;  4AQI A;  2M97 A;  1TOP A;  3OP0 A;  1QX7 A;  1NP8 A;  3KEV A;  2JTT A;  1TCO B;  1MHO A;  1YRT B;  3I5H B;  1KQM C;  1W7I B;  2H2K A;  2LP2 A;  4DCK A;  2Q4U A;  2Q91 A;  5F6T A;  2KYC A;  1CFP A;  1OZO A;  1PSR A;  1KK7 Z;  1X02 A;  1SKT A;  3O78 A;  2LE9 B;  1BOD A;  2PAS A;  1QV1 A;  4AOM A;  1S6C A;  1UHK A;  1LVC D;  4QJ4 B;  1D1O A;  2LVJ A;  2A4J A;  2Y1M A;  3DVE A;  3LK0 A;  1IRJ A;  3AKB A;  1TNP A;  3SJS A;  1OMD A;  3KF9 A;  2AAO A;  2LUC A;  4PHK A;  2ZND A;  2K7O A;  1M39 A;  4GAO A;  4GFT A;  1YR5 A;  5HYD A;  4CLN A;  1KFX S;  2Y5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...