3SIAA

Crystal structure of ure3-binding protein, (d127a,n129a) mutant, iodide phased
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
214
structure length
212
Chain Sequence
b'NFCLWNLQPIQGSWMGAACIYQMPPSVRNTWWFPLLNTIPLDQYTRIYQWFMGVDRDRSGTLEINELMMGQFPGGIRLSPQTALRMMRIFDTDFNGHISFYEFMAMYKFMELAYNLFVMNARARSGTLEPHEILPALQQLGFYINQRTSLLLHRLFAMAFCDLNCWIAICAFAAQTRSAYQMIFMNPYYGPMKPFNPMEFGKFLDVVTSLLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URE3-BP sequence specific DNA binding protein
publication title Crystal structure of URE3-binding protein
rcsb
source organism Entamoeba histolytica
molecule tags Dna binding protein
total genus 73
structure length 212
sequence length 214
ec nomenclature
pdb deposition date 2011-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3siaA01
1DJHA 4HSZA 1E8AA 4OVNF 1D1OA 1AJ4A 3BQ3A 4HRGA 2Q91A 1BLQA 3PLFB 1EG3A 1WDCB 3BXKA 3GOFA 1JWDA 3SG4A 2KQYA 2LLSA 2MJWB 3OP0A 3K21A 2COLB 1NWDA 1S1EA 4P2YB 2DOQA 2LP2A 1K95A 2LLTA 4N1FA 1GJYA 3PN7B 5AANA 1YURA 1MUXA 3BUOB 1IWQA 1LINA 1UHKA 3PSRA 1M39A 2JNFA 3LK0A 3F45A 2HQ8A 2JNXA 1NCZA 1Q80A 2L4HA 1DJZA 4CIDA 1BJFA 1ALVA 1SMGA 4GAOA 3WNXB 1AUIB 5KSZA 4OR9B 4WRIA 3KF9A 1CM1A 4C0LA 2LVKA 4GFTA 2HETA 2PALA 2FJUB 1QJTA 1ZFSA 4WQ2A 3EK7A 1K93D 5AERA 1YUSA 2G2BA 1PSRA 4GPLB 2KI4B 3EKHA 1BR1B 1AHRA 2BE4A 2D8NA 1B8CA 3ZWHA 2CT9A 1MXEA 2Y4QA 4AOMA 1B7TY 3EVVA 3WHUB 4QJ5B 2L51A 2BBNA 2H61A 1XVJA 2WOSA 3DVMA 1IRJA 1IJ5A 2I94A 1RTP1 3KO0A 1F70A 1KQVA 2KGRA 1A2XA 2F8PA 1RFJA 1SR6B 2PASA 3BUXB 2LM5A 1YX7A 1CKKA 1OE9B 2KI6D 1S5GZ 3IQOA 2CXJA 3GK2A 1LA0A 2AMIA 3WXAA 1AP4A 1FW4A 2LMUA 1QS7A 1NX0A 4HRHA 4MZJA 3SIBA 4MSPA 2FCEA 2ZNEA 1PK0D 2F2OA 3KHEA 2E30A 4FTGA 3VRNA 1DJGA 4OKHA 1K94A 4C0KA 1SYMA 3QRXA 2M1KB 3OX5A 2Y1MA 3SG2A 2KBMA 1MWNA 1LKJA 1LXFC 3O2PA 2IS9A 1S6CA 2RGIA 3GK1A 4DUQA 1TNQA 1L2OC 3LCPC 2KFHA 1MQ1A 2K7OA 1FF1A 1FI5A 3I5IB 4I5LB 1YRTB 2BCBA 2F3YA 1CDPA 1JBAA 3BUMB 3JTDC 5GQQC 2CBLA 4PHJA 2SASA 1VRKA 1KFUL 1XK4C 1DMOA 4YI9A 1F8HA 1CMFA 2EC6B 1CMGA 3CR2A 2LVJA 2K7BA 3A4UB 3I5HC 1F71A 1RROA 1L7ZA 3I5FC 1GQMA 5ER4X 5HLOA 2M1UA 2M9GA 4N5XA 1CB1A 1WLZA 1XFUO 2KYCA 1DGUA 1KK8C 4NQGA 1EXRA 3KPXA 1CDLA 1QXPA 3TDUA 1YUTA 1QIVA 1JFKA 2KYFA 2V53A 4ETOA 2JULA 1HQVA 4YGDB 3DVJA 5DKNA 4CFQA 1W7IB 1BR4B 1CFDA 5PALA 2L4IA 1KK7Y 1MR8A 1OQPA 2PMYA 2OTGB 2QACA 3DVKA 1QLKA 4ICBA 1ZACA 1DJYA 5I2QA 1FBVA 1J7OA 1MF8B 2WNDA 3BUNB 1A03A 1G4YR 1C7WA 4HREE 3TS5C 3OB2B 1QLSA 3O4YA 1NX3A 4YI8A 2SCPA 1H4BA 2O60A 5BPJA 1KSMA 2BBMA 1N65A 3NSIA 1NUBA 1CLMA 1YVLA 2JT8A 2PRUA 1A4PA 1CFCA 1H8BA 2L98A 2NCOA 2WCBA 2CTNA 5AEQA 2L5XB 2E6WA 1CFPA 1G33A 1YVHA 2JTTA 4PHNA 1QX7A 3M0WA 4ORAB 2KSPA 1NPQA 3VRQA 4YGEB 1UURA 1K2HA 3JVTC 1JFJA 5I2OA 4WQ3A 1QX5B 2OS8B 1IG5A 2KFFA 3LLEA 2Y1NA 2LLUA 4BY4A 2I18A 4BY5A 2K0JA 1DVIA 1S26D 1S3PA 2M3WA 1DTLA 5F6TA 4PE7A 3VRRA 1SL7A 1DT7B 1QASA 4CLNA 1WRLA 3SG5A 2LAPA 4I5NB 5HKZA 4ZCUA 2QPTA 2ZN9A 2M7NA 3WHTB 4YRUA 1Y1UA 1SK6D 2LUXA 2KAVA 1BMOA 1RECA 1NP8A 5K89A 1AK8A 1NCXA 1C7VA 1WDCC 2MLEC 1XFYO 3CS1A 1KQMC 1TIZA 2LE9B 1MHOA 1QX2A 4M2OA 2BCAA 1B8LA 1SL8A 1QVIZ 3SJSA 1SCMB 1OMDA 1UHIA 4MN0A 1B9AA 4GUKA 3CTNA 4GGNA 2JQ6A 5J3XA 3IQQA 1IQ5A 1LVCD 2L50A 1WY9A 2LP3A 5JOLA 4MVFA 2Q4UA 1TNXA 2NZ0A 3D0YB 4XJKB 5HLVA 5CSFA 1BU3A 1B1GA 1JF0A 2A4JA 4I5KA 2JC2A 2AAOA 1W7JB 1DJWA 4IL1A 1CNPA 2GGZA 1S5GY 4R1EA 1JF2A 2KI4C 4DS7A 3FS7A 1OMRA 1RK9A 5FYXA 2KDHA 2JRFA 2M49B 1SPYA 1YUUA 2NCPA 2FOTA 4PHKA 2ZNDA 2AUCA 2PVBA 1ZUZA 1UHHA 1BODA 1J1DA 5CSJA 1EJ3A 1KFUS 2ZKMX 4I5JA 1AVSA 3PALA 5AFPA 3OHMB 1NCYA 5CPVA 1SRAA 5HKWA 1SR6C 1M46A 4MLWA 4NDBA 1BG1A 1WLMA 1J7PA 4PDZA 3KEVA 1TOPA 1DJIA 1B4CA 3D0YA 3H4SE 4XJKA 2OPOA 2KQ6A 2LUCA 2M29A 3BOWA 1YR5A 4GNKB 1AJ5A 1N0YA 2KGBC 2HPSA 4Q04A 5TNCA 1V1GA 2EGDA 2JWWA 4M2QA 2I2RE 2TN4A 3CWGA 2M7LA 4MRYA 5HYDA 2K2AA 1NIWA 2BL0B 2O5GA 3FIAA 2MAZA 3TDIA 1J1EA 1KSOA 3HX4A 2F2PA 4MRXA 2M97A 2KBIA 3I5IC 5I8NA 1OZSA 1M45A 3TUYC 3DF0B 4N1GA 1QTXA 2R2IA 1SW8A 1OMVA 3DVEA 2MHHA 1XFVO 2CCMA 1KWOB 3FWBA 3LK1A 5HKYA 3EVUA 4MZKA 2K61A 4PE0A 4GGFC 1TNPA 1K9KA 5JJGA 3TS5B 1IH0A 1EG4A 3SIAA 2LMVA 3NSOA 4MEWA 3ICBA 1Y1XA 3GK4X 2LANA 4PE4A 2KAYA 1CFFA 1GGWA 2KI6C 1MXLC 4UPGA 1K8UA 2BE6A 3BUWB 1Y6WA 2JTZA 3NSLA 3NXAA 2MLFC 1QIWA 1J7RA 3SG7A 3DF0A 4MZLA 2BCXA 2OTGC 1M63B 1CDNA 3O78A 5IBWA 2KAXA 3I5GC 4DIRA 2K2FA 3DD4A 1V1FA 3EKJA 2JT0A 3CR5X 4TNCA 1LA3A 2LHLA 1RWYA 3C1VA 5D7FA 3IF7A 1XYDA 4JWQA 4NDCA 2Y5IA 1DJXA 3EVRA 1TRFA 1R2UA 1OOJA 1S36A 2EHBA 3LL8B 1DF0B 4U8DA 1EH2A 1CDMA 1FI6A 2MA2A 3RLZA 5CSNA 1QV1A 2JXCA 2JOJA 2LC5A 2ZN8A 1BF5A 2MBXA 5ER5A 1XA5A 2JXLA 1U5IA 1M31A 1KFXL 4P5OE 1NSHA 4ORBB 1F55A 5I2LA 1CLLA 2OS8C 2K7DA 1S6JA 4CPVA 3VROA 1SCVA 4JPZB 2I7AA 1KQMB 1OZOA 1PULA 2F3ZA 2H2KA 1PALA 3EK8A 5AXIA 4CFRA 2H61C 3PN7C 2KOTA 4E68A 1Y1AA 1JSAA 1DF0A 1K90D 4PHMA 1IQ3A 1TCFA 1XFXO 1QVIY 2ZRSA 1SNLA 4YBHB 3CR4X 4ZCVA 2KFGA 3MSEB 1SBJA 4PE1A 2HQWA 4M2PA 2LNKA 4DCKA 2M0RA 1HT9A 2GV5A 2M8UA 1X02A 4C0JA 1NX1A 1QATA 4USLA 2F33A 3BOWB 1QV0A 1IKUA 2WC8A 1UHNA 4XYNA 1SY9A 2K7CA 1GGZA 1B7TZ 1UP5A 5DKQA 2K8MB 1SCMC 1A29A 2KNEA 1YTZC 2WCFA 1ALWA 1PVBA 3VGOA 1CLBA 1KCYA 1YRUB 5KU1A 4F0ZB 1TCOB 2ZRTA 4ORCB 1R6PA 3AKAA 3HCMA 2WORA 5DKRA 1NX2A 5KTYA 1SKTA 1C07A 4QJ3B 2ZFDA 1K9PA 3SG3A 1L2OB 1YX8A 1BOCA 4JQ0D 3AAJA 4YGAA 1UHJA 1UUSA 2KHNA 3JTDB 2VRGA 1B8RA 2HF5A 3AAKA 3VRPA 5G08A 1F4OA 2JZIA 1TTXA 3FWCA 3CZTX 4NDDA 1NYAA 4YGBB 1G8IA 3I5HB 1IGVA 3O6BA 3BYAA 3I5FB 1JUOA 1UWOA 4FQOA 4GBAA 3CGAA 1KK8B 3TZ1A 2B1UA 3CLNA 1A75B 4PCWA 1PSBA 3SG6A 2LVVA 1ZOTB 3TUYB 1ODBA 3NSKA 1B47A 1CM4A 4DRWA 4QJ4B 1JC2A 1K96A 2P6BB 5CSIA 2EC6C 2NXQA 1TNWA 2JPTA 3D10A 5D69A 4A4CA 1F54A 4MBEA 2LMTA 3AKBA 1S6IA 1K9UA 1XK4A 4A4BA 1BT6A 2BL0C 2JU0A 1SL9A 2CNPA 2NLNA 2BECA 4PALA 4OCIA 3TDZA 1OSAA 2PSRA 3PFVA 1DGVA 1RJVA 1KK7Z 1A75A 4L9MA 3ZNIA 4YGCB 1U5IB 1KWOC 2LHIA 2LCPA 1PVAA 3A8RA 3I5GB 1F4QA 2BKIB 3JVTB 1CTRA 2BKHB 1PRWA 5B8IB 1XFWO 2ISDA 1XFZO 4GGFA 4AQJA 1EL4A 1FPWA 3RM1A 1WRZA 1WRKA 2WCEA 2FCDA 3E3RA 3OX6A 2L0PA 2LV7A 1KFXS 2GGMA 3OB1B 2LVIA 1IJ6A 4D1EA 2G9BA 1J55A 1TN4A 3PATA 1J7QA 1ZMZA 1XO5A 2L2EA 1Y0VH 1N2DA 3EK4A 4OV2A 4AQIA 3PM8A 2MRDA 2JT3A
chains in the Genus database with same CATH superfamily
1DJHA 4HSZA 1E8AA 4OVNF 1D1OA 3K1EA 1AJ4A 3BQ3A 4HRGA 3S0EA 2Q91A 1BLQA 3PLFB 1EG3A 1WDCB 3BXKA 3GOFA 1JWDA 3SG4A 2WCMA 2KQYA 2LLSA 2MJWB 3OP0A 3K21A 1DC1A 2COLB 1NWDA 1S1EA 4P2YB 2DOQA 2LP2A 3O4XA 2QEOA 3SS3A 1K95A 2LLTA 4N1FA 1GJYA 2PQLA 3PN7B 1YURA 5AANA 1MUXA 3BUOB 1IWQA 1LINA 5D3OA 1UHKA 3PSRA 1M39A 2JNFA 1XFRA 3LK0A 3F45A 3R1PA 2HQ8A 2JNXA 1NCZA 1Q80A 2L4HA 1DJZA 4CIDA 1BJFA 1ALVA 1SMGA 4GAOA 3WNXB 1AUIB 5KSZA 4OR9B 4WRIA 3KF9A 3DXLA 1C3YA 1CM1A 4C0LA 2LVKA 4GFTA 2HETA 2PALA 2FJUB 1QJTA 1ZFSA 5I94A 4WQ2A 3EK7A 1K93D 5AERA 1YUSA 2G2BA 3PJIA 1PSRA 4GPLB 2KI4B 3EKHA 1BR1B 1AHRA 2BE4A 2D8NA 1B8CA 3ZWHA 2CT9A 1MXEA 2Y4QA 3EG5B 1B7TY 3EVVA 4KYNA 3WHUB 2L51A 4AOMA 2BBNA 2H61A 1XVJA 2WOSA 3DVMA 1IRJA 1TUJA 1IJ5A 2I94A 1RTP1 3KO0A 1F70A 1KQVA 2KGRA 3BFBA 1A2XA 2F8PA 1RFJA 1SR6B 2PASA 3BUXB 2LM5A 1QWVA 1YX7A 2WCHA 1CKKA 1OE9B 2KI6D 1S5GZ 3IQOA 3VRRA 2CXJA 3GK2A 1LA0A 2AMIA 2QEBA 3CZ1A 1FW4A 3WXAA 2LMUA 1QS7A 1NX0A 4HRHA 4MZJA 3SIBA 2KPHA 4MSPA 2FCEA 2ZNEA 1DELA 1PK0D 2F2OA 3KHEA 2E30A 4FTGA 3VRNA 1DJGA 3L47A 4OKHA 2BNXA 2P71A 1K94A 4C0KA 1SYMA 3QRXA 2M1KB 3OX5A 2Y1MA 3SG2A 2KBMA 1MWNA 1LKJA 1LXFC 2JPOA 2IS9A 3O2PA 1S6CA 2RGIA 3GK1A 4DUQA 1TNQA 1L2OC 4FQTA 3LCPC 2KFHA 1MQ1A 2K7OA 1FF1A 1FI5A 3I5IB 4I5LB 1YRTB 2BCBA 2F3YA 1CDPA 1JBAA 3BUMB 3JTDC 5GQQC 3V2LA 2CBLA 4PHJA 2SASA 1VRKA 1KFUL 1XK4C 1DMOA 4YI9A 1F8HA 1CMFA 2EC6B 1CMGA 3CR2A 2LVJA 2K7BA 3A4UB 3D73A 3I5HC 1F71A 3QMEA 1RROA 1L7ZA 3I5FC 1GQMA 5ER4X 5HLOA 2M1UA 2M9GA 4N5XA 1CB1A 1WLZA 1XFUO 2KYCA 1DGUA 1KK8C 4NQGA 1EXRA 3KPXA 5HL1A 1CDLA 1QXPA 3TDUA 1YUTA 1QIVA 1JFKA 2YGUA 2H8VA 2KYFA 2V53A 4ETOA 2JULA 1HQVA 3R72A 4YGDB 3S0AA 3DVJA 5DKNA 4CFQA 1W7IB 1BR4B 3S0GA 1CFDA 5PALA 2L4IA 1KK7Y 1MR8A 1OQPA 2PMYA 2OTGB 2QACA 3BJHA 1QLKA 3DVKA 4ICBA 1ZACA 1DJYA 5I2QA 1FBVA 1J7OA 1MF8B 3PM2A 2WNDA 3BUNB 3S0BA 1G4YR 1C7WA 4HREE 3TS5C 3D74A 3OB2B 1QLSA 3O4YA 1NX3A 5FI6A 4YI8A 2SCPA 1H4BA 2O60A 5BPJA 1KSMA 2BBMA 1N65A 3NSIA 1NUBA 1CLMA 1YVLA 2JT8A 2PRUA 1SSEB 1A4PA 1CFCA 1H8BA 2L98A 2NCOA 2WCBA 2CTNA 5AEQA 3Q8IA 2L5XB 2E6WA 1CFPA 1G33A 1YVHA 2JTTA 2P70A 1QX7A 3M0WA 1OOHA 2KSPA 3D75A 4ORAB 4PHNA 1NPQA 3VRQA 4YGEB 1UURA 1K2HA 3JVTC 1T14A 1JFJA 5I2OA 4WQ3A 1QX5B 3NHIA 2OS8B 1IG5A 2KFFA 3LLEA 2Y1NA 2LLUA 4BY4A 2I18A 3B6XA 4BY5A 5EL2A 2K0JA 1DVIA 1S26D 1S3PA 2KLEA 1DTLA 2M3WA 2WCLA 4PE7A 1SL7A 5F6TA 1QASA 3CYZA 4CLNA 1DT7B 1WRLA 3SG5A 1OOFA 1TUZA 2LAPA 4I5NB 3OGNA 5HKZA 4ZCUA 2QPTA 2ZN9A 2M7NA 3WHTB 4YRUA 1Y1UA 1SK6D 2LUXA 2KAVA 1BMOA 1RECA 1NP8A 3NGVA 5K89A 1AK8A 1NCXA 1C7VA 1WDCC 2MLEC 1XFYO 1Z2CB 3CS1A 1KQMC 1TIZA 2LE9B 2QEVA 1MHOA 1QX2A 4M2OA 2BCAA 1B8LA 1SL8A 1QVIZ 3SJSA 4INWA 1SCMB 1OMDA 1UHIA 4MN0A 1B9AA 3FE9A 4GUKA 3CTNA 4GGNA 2JQ6A 3D77A 5J3XA 3IQQA 3N7HA 1IQ5A 1LVCD 2L50A 1WY9A 2LP3A 5DICA 3UNWA 5JOLA 4MVFA 2Q4UA 1TNXA 2NZ0A 3D0YB 4XJKB 5HLVA 5CSFA 4JKTA 1BU3A 3S0FA 1B1GA 1JF0A 2A4JA 4I5KA 2JC2A 2AAOA 1W7JB 1DJWA 4IL1A 1CNPA 2GGZA 2K60A 1S5GY 4R1EA 1JF2A 2KI4C 4DS7A 3FS7A 1OMRA 1RK9A 5FYXA 2KDHA 2JRFA 2M49B 1SPYA 1YUUA 2NCPA 2BAPA 2FOTA 4PHKA 2ZNDA 2AUCA 2PVBA 1ZUZA 1UHHA 1BODA 1J1DA 5CSJA 1EJ3A 1KFUS 2ZKMX 3DZTA 1AVSA 3PALA 4I5JA 3SS4A 5AFPA 3OHMB 1NCYA 5CPVA 1SRAA 5HKWA 1SR6C 1M46A 4MLWA 4NDBA 1BG1A 1WLMA 3D76A 1J7PA 4PDZA 1P28A 3KEVA 1TOPA 1DJIA 1B4CA 3D0YA 3H4SE 4XJKA 2OPOA 2KQ6A 3B86A 2LUCA 2M29A 3BOWA 1YR5A 2WC5A 4GNKB 1AJ5A 1N0YA 2KGBC 2HPSA 4Q04A 5TNCA 1V1GA 2EGDA 2JWWA 4M2QA 2I2RE 2TN4A 3CWGA 2M7LA 4MRYA 5HYDA 2K2AA 1NIWA 2BL0B 2O5GA 3FIAA 2MAZA 1AP4A 3TDIA 3B87A 1J1EA 1KSOA 3FE6A 3HX4A 2F2PA 4MRXA 2M97A 2KBIA 3I5IC 2GTEA 1OZSA 1M45A 5I8NA 3TUYC 3SS5A 3DF0B 4N1GA 1QTXA 4QJ5B 2R2IA 1SW8A 1OMVA 3DVEA 2MHHA 1XFVO 2CCMA 1KWOB 3FWBA 3LK1A 5HKYA 3EVUA 4MZKA 2K61A 4PE0A 4GGFC 1TNPA 1K9KA 5JJGA 3TS5B 1IH0A 1EG4A 3SIAA 2LMVA 1LS8A 2ERBA 2L2CA 3NSOA 3ICBA 1Y1XA 3GK4X 4MEWA 2LANA 4PE4A 2KAYA 1CFFA 1GGWA 2KI6C 1MXLC 4UPGA 1K8UA 2BE6A 3BUWB 1Y6WA 2JTZA 3NSLA 3NXAA 2MLFC 1A03A 1QIWA 1J7RA 3SG7A 3DF0A 4MZLA 2BCXA 3VB1A 4INXA 1DQEA 2OTGC 1M63B 3CZ0A 1CDNA 3FE8A 3O78A 5IBWA 2KAXA 3I5GC 4DIRA 2K2FA 3DD4A 1V1FA 3EKJA 2JT0A 3CR5X 4TNCA 2QDIA 1LA3A 2LHLA 1RWYA 3C1VA 5D7FA 1OOIX 3IF7A 1XYDA 4JWQA 4NDCA 4PT1A 2Y5IA 1DJXA 3EVRA 1TRFA 2KLDA 1R2UA 1OOJA 1S36A 2EHBA 1TWOA 3LL8B 1DF0B 4U8DA 1EH2A 1CDMA 1FI6A 1C3ZA 2MA2A 3RLZA 5CSNA 1QV1A 2JXCA 3B88A 2JOJA 2LC5A 2PYQA 2ZN8A 1BF5A 2MBXA 5ER5A 1XA5A 2JXLA 1U5IA 1M31A 1KFXL 4P5OE 1NSHA 4ORBB 1F55A 5I2LA 1CLLA 3DYEA 2OS8C 3R1VA 2K7DA 1S6JA 4CPVA 3VROA 1SCVA 2L5YA 4JPZB 2I7AA 1KQMB 1OZOA 1PULA 2F3ZA 2H2KA 1PALA 3EK8A 5AXIA 4CFRA 2H61C 3PN7C 2KOTA 4E68A 1Y1AA 1JSAA 1DF0A 1K90D 4PHMA 1IQ3A 1TCFA 1XFXO 1QVIY 2ZRSA 1SNLA 4YBHB 3CR4X 3OBVA 4ZCVA 2KFGA 3MSEB 1SBJA 4PE1A 3DY9A 2HQWA 4M2PA 2LNKA 3S0DA 4DCKA 2M0RA 1HT9A 2GV5A 2M8UA 1X02A 4C0JA 3IVTA 1NX1A 1QATA 4USLA 2F33A 3BOWB 1QV0A 1IKUA 2WC8A 1UHNA 4XYNA 1SY9A 2K7CA 3B7AA 1GGZA 5FI7A 1B7TZ 1UP5A 5DKQA 2K8MB 3D78A 1SCMC 1A29A 2KNEA 1YTZC 2WCFA 1ALWA 1PVBA 3VGOA 1CLBA 1KCYA 1YRUB 5KU1A 4F0ZB 1TCOB 2ZRTA 4ORCB 2WCKA 1R6PA 1Z4HA 3AKAA 3HCMA 2WORA 5DKRA 1NX2A 5KTYA 1SKTA 1C07A 3UO9A 4QJ3B 2ZFDA 1K9PA 3SG3A 1YX8A 1L2OB 1BOCA 1OW4A 4JQ0D 3AAJA 4YGAA 1UHJA 1UUSA 1ORGA 2KHNA 3JTDB 2VRGA 3CABA 1B8RA 3RZSA 2HF5A 3AAKA 3VRPA 5G08A 1DEKA 1F4OA 2JZIA 1TTXA 3FWCA 3CZTX 4NDDA 1NYAA 4YGBB 1G8IA 3I5HB 1IGVA 3O6BA 3BYAA 3I5FB 1JUOA 1UWOA 4FQOA 4GBAA 3NHTA 3CGAA 1KK8B 3TZ1A 2B1UA 3CLNA 3L4LA 4IJ7A 1A75B 3BFHA 4PCWA 1PSBA 3BFAA 3SG6A 2LVVA 1ZOTB 3TUYB 2WC6A 1ODBA 3NSKA 1B47A 1CM4A 4JD9A 4DRWA 4QJ4B 1JC2A 1K96A 2P6BB 5CSIA 1OOGA 2EC6C 2NXQA 1TNWA 2JPTA 2QEHA 3D10A 5D69A 4A4CA 4MBEA 1F54A 1GM0A 2LMTA 3AKBA 1S6IA 1K9UA 1XK4A 4A4BA 1BT6A 2WCJA 2BL0C 2JU0A 1SL9A 2CNPA 2NLNA 2BECA 4PALA 4OCIA 3TDZA 1OSAA 2PSRA 3PFVA 1DGVA 2FJYA 1RJVA 1KK7Z 1A75A 4L9MA 3ZNIA 4YGCB 1U5IB 1KWOC 2LHIA 2LCPA 1PVAA 3A8RA 3I5GB 1F4QA 2BKIB 1IIOA 3L4AA 3JVTB 1CTRA 4OV2A 2BKHB 3CDNA 1PRWA 5B8IB 1XFWO 2ISDA 1XFZO 4F7FA 4GGFA 4AQJA 1EL4A 1FPWA 3RM1A 1WRZA 1WRKA 2WCEA 5FI2A 2FCDA 3E3RA 3OX6A 2L0PA 2LV7A 1KFXS 2GGMA 3OB1B 4OZDA 2LVIA 3R1OA 1IJ6A 4D1EA 2G9BA 1J55A 1TN4A 1W9ZA 3PATA 1J7QA 1ZMZA 1XO5A 2L2EA 1Y0VH 1N2DA 3EK4A 3CZ2A 4AQIA 3PM8A 2MRDA 2JT3A
chains in the Genus database with same CATH topology
1DJHA 4HSZA 1E8AA 4OVNF 1D1OA 1AJ4A 3BQ3A 4HRGA 2Q91A 1BLQA 3PLFB 1EG3A 1WDCB 3BXKA 3GOFA 1JWDA 3SG4A 2KQYA 2LLSA 2MJWB 3OP0A 3K21A 2COLB 1NWDA 1S1EA 4P2YB 2DOQA 2LP2A 1K95A 2LLTA 4N1FA 1GJYA 3PN7B 5AANA 1YURA 1MUXA 3BUOB 1IWQA 1LINA 1UHKA 3PSRA 1M39A 2JNFA 3LK0A 3F45A 2HQ8A 2JNXA 1NCZA 1Q80A 2L4HA 1DJZA 4CIDA 1BJFA 1ALVA 1SMGA 4GAOA 3WNXB 1AUIB 5KSZA 4OR9B 4WRIA 3KF9A 1CM1A 4C0LA 2LVKA 4GFTA 2HETA 2PALA 2FJUB 1QJTA 1ZFSA 4WQ2A 3EK7A 1K93D 5AERA 1YUSA 2G2BA 1PSRA 4GPLB 2KI4B 3EKHA 1BR1B 1AHRA 2BE4A 2D8NA 1B8CA 3ZWHA 2CT9A 1MXEA 2Y4QA 4AOMA 1B7TY 3EVVA 3WHUB 4QJ5B 2L51A 2BBNA 2H61A 1XVJA 2WOSA 3DVMA 1IRJA 1IJ5A 2I94A 1RTP1 3KO0A 1F70A 1KQVA 2KGRA 1A2XA 2F8PA 1RFJA 1SR6B 2PASA 3BUXB 2LM5A 1YX7A 1CKKA 1OE9B 2KI6D 1S5GZ 3IQOA 2CXJA 3GK2A 1LA0A 2AMIA 3WXAA 1AP4A 1FW4A 2LMUA 1QS7A 1NX0A 4HRHA 4MZJA 3SIBA 4MSPA 2FCEA 2ZNEA 1PK0D 2F2OA 3KHEA 2E30A 4FTGA 3VRNA 1DJGA 4OKHA 1K94A 4C0KA 1SYMA 3QRXA 2M1KB 3OX5A 2Y1MA 3SG2A 2KBMA 1MWNA 1LKJA 1LXFC 3O2PA 2IS9A 1S6CA 2RGIA 3GK1A 4DUQA 1TNQA 1L2OC 3LCPC 2KFHA 1MQ1A 2K7OA 1FF1A 1FI5A 3I5IB 4I5LB 1YRTB 2BCBA 2F3YA 1CDPA 1JBAA 3BUMB 3JTDC 5GQQC 2CBLA 4PHJA 2SASA 1VRKA 1KFUL 1XK4C 1DMOA 4YI9A 1F8HA 1CMFA 2EC6B 1CMGA 3CR2A 2LVJA 2K7BA 3A4UB 3I5HC 1F71A 1RROA 1L7ZA 3I5FC 1GQMA 5ER4X 5HLOA 2M1UA 2M9GA 4N5XA 1CB1A 1WLZA 1XFUO 2KYCA 1DGUA 1KK8C 4NQGA 1EXRA 3KPXA 1CDLA 1QXPA 3TDUA 1YUTA 1QIVA 1JFKA 2KYFA 2V53A 4ETOA 2JULA 1HQVA 4YGDB 3DVJA 5DKNA 4CFQA 1W7IB 1BR4B 1CFDA 5PALA 2L4IA 1KK7Y 1MR8A 1OQPA 2PMYA 2OTGB 2QACA 3DVKA 1QLKA 4ICBA 1ZACA 1DJYA 5I2QA 1FBVA 1J7OA 1MF8B 2WNDA 3BUNB 1A03A 1G4YR 1C7WA 4HREE 3TS5C 3OB2B 1QLSA 3O4YA 1NX3A 4YI8A 2SCPA 1H4BA 2O60A 5BPJA 1KSMA 2BBMA 1N65A 3NSIA 1NUBA 1CLMA 1YVLA 2JT8A 2PRUA 1A4PA 1CFCA 1H8BA 2L98A 2NCOA 2WCBA 2CTNA 5AEQA 2L5XB 2E6WA 1CFPA 1G33A 1YVHA 2JTTA 4PHNA 1QX7A 3M0WA 4ORAB 2KSPA 1NPQA 3VRQA 4YGEB 1UURA 1K2HA 3JVTC 1JFJA 5I2OA 4WQ3A 1QX5B 2OS8B 1IG5A 2KFFA 3LLEA 2Y1NA 2LLUA 4BY4A 2I18A 4BY5A 2K0JA 1DVIA 1S26D 1S3PA 2M3WA 1DTLA 5F6TA 4PE7A 3VRRA 1SL7A 1DT7B 1QASA 4CLNA 1WRLA 3SG5A 2LAPA 4I5NB 5HKZA 4ZCUA 2QPTA 2ZN9A 2M7NA 3WHTB 4YRUA 1Y1UA 1SK6D 2LUXA 2KAVA 1BMOA 1RECA 1NP8A 5K89A 1AK8A 1NCXA 1C7VA 1WDCC 2MLEC 1XFYO 3CS1A 1KQMC 1TIZA 2LE9B 1MHOA 1QX2A 4M2OA 2BCAA 1B8LA 1SL8A 1QVIZ 3SJSA 1SCMB 1OMDA 1UHIA 4MN0A 1B9AA 4GUKA 3CTNA 4GGNA 2JQ6A 5J3XA 3IQQA 1IQ5A 1LVCD 2L50A 1WY9A 2LP3A 5JOLA 4MVFA 2Q4UA 1TNXA 2NZ0A 3D0YB 4XJKB 5HLVA 5CSFA 1BU3A 1B1GA 1JF0A 2A4JA 4I5KA 2JC2A 2AAOA 1W7JB 1DJWA 4IL1A 1CNPA 2GGZA 1S5GY 4R1EA 1JF2A 2KI4C 4DS7A 3FS7A 1OMRA 1RK9A 5FYXA 2KDHA 2JRFA 2M49B 1SPYA 1YUUA 2NCPA 2FOTA 4PHKA 2ZNDA 2AUCA 2PVBA 1ZUZA 1UHHA 1BODA 1J1DA 5CSJA 1EJ3A 1KFUS 2ZKMX 4I5JA 1AVSA 3PALA 5AFPA 3OHMB 1NCYA 5CPVA 1SRAA 5HKWA 1SR6C 1M46A 4MLWA 4NDBA 1BG1A 1WLMA 1J7PA 4PDZA 3KEVA 1TOPA 1DJIA 1B4CA 3D0YA 3H4SE 4XJKA 2OPOA 2KQ6A 2LUCA 2M29A 3BOWA 1YR5A 4GNKB 1AJ5A 1N0YA 2KGBC 2HPSA 4Q04A 5TNCA 1V1GA 2EGDA 2JWWA 4M2QA 2I2RE 2TN4A 3CWGA 2M7LA 4MRYA 5HYDA 2K2AA 1NIWA 2BL0B 2O5GA 3FIAA 2MAZA 3TDIA 1J1EA 1KSOA 3HX4A 2F2PA 4MRXA 2M97A 2KBIA 3I5IC 5I8NA 1OZSA 1M45A 3TUYC 3DF0B 4N1GA 1QTXA 2R2IA 1SW8A 1OMVA 3DVEA 2MHHA 1XFVO 2CCMA 1KWOB 3FWBA 3LK1A 5HKYA 3EVUA 4MZKA 2K61A 4PE0A 4GGFC 1TNPA 1K9KA 5JJGA 3TS5B 1IH0A 1EG4A 3SIAA 2LMVA 3NSOA 4MEWA 3ICBA 1Y1XA 3GK4X 2LANA 4PE4A 2KAYA 1CFFA 1GGWA 2KI6C 1MXLC 4UPGA 1K8UA 2BE6A 3BUWB 1Y6WA 2JTZA 3NSLA 3NXAA 2MLFC 1QIWA 1J7RA 3SG7A 3DF0A 4MZLA 2BCXA 2OTGC 1M63B 1CDNA 3O78A 5IBWA 2KAXA 3I5GC 4DIRA 2K2FA 3DD4A 1V1FA 3EKJA 2JT0A 3CR5X 4TNCA 1LA3A 2LHLA 1RWYA 3C1VA 5D7FA 3IF7A 1XYDA 4JWQA 4NDCA 2Y5IA 1DJXA 3EVRA 1TRFA 1R2UA 1OOJA 1S36A 2EHBA 3LL8B 1DF0B 4U8DA 1EH2A 1CDMA 1FI6A 2MA2A 3RLZA 5CSNA 1QV1A 2JXCA 2JOJA 2LC5A 2ZN8A 1BF5A 2MBXA 5ER5A 1XA5A 2JXLA 1U5IA 1M31A 1KFXL 4P5OE 1NSHA 4ORBB 1F55A 5I2LA 1CLLA 2OS8C 2K7DA 1S6JA 4CPVA 3VROA 1SCVA 4JPZB 2I7AA 1KQMB 1OZOA 1PULA 2F3ZA 2H2KA 1PALA 3EK8A 5AXIA 4CFRA 2H61C 3PN7C 2KOTA 4E68A 1Y1AA 1JSAA 1DF0A 1K90D 4PHMA 1IQ3A 1TCFA 1XFXO 1QVIY 2ZRSA 1SNLA 4YBHB 3CR4X 4ZCVA 2KFGA 3MSEB 1SBJA 4PE1A 2HQWA 4M2PA 2LNKA 4DCKA 2M0RA 1HT9A 2GV5A 2M8UA 1X02A 4C0JA 1NX1A 1QATA 4USLA 2F33A 3BOWB 1QV0A 1IKUA 2WC8A 1UHNA 4XYNA 1SY9A 2K7CA 1GGZA 1B7TZ 1UP5A 5DKQA 2K8MB 1SCMC 1A29A 2KNEA 1YTZC 2WCFA 1ALWA 1PVBA 3VGOA 1CLBA 1KCYA 1YRUB 5KU1A 4F0ZB 1TCOB 2ZRTA 4ORCB 1R6PA 3AKAA 3HCMA 2WORA 5DKRA 1NX2A 5KTYA 1SKTA 1C07A 4QJ3B 2ZFDA 1K9PA 3SG3A 1L2OB 1YX8A 1BOCA 4JQ0D 3AAJA 4YGAA 1UHJA 1UUSA 2KHNA 3JTDB 2VRGA 1B8RA 2HF5A 3AAKA 3VRPA 5G08A 1F4OA 2JZIA 1TTXA 3FWCA 3CZTX 4NDDA 1NYAA 4YGBB 1G8IA 3I5HB 1IGVA 3O6BA 3BYAA 3I5FB 1JUOA 1UWOA 4FQOA 4GBAA 3CGAA 1KK8B 3TZ1A 2B1UA 3CLNA 1A75B 4PCWA 1PSBA 3SG6A 2LVVA 1ZOTB 3TUYB 1ODBA 3NSKA 1B47A 1CM4A 4DRWA 4QJ4B 1JC2A 1K96A 2P6BB 5CSIA 2EC6C 2NXQA 1TNWA 2JPTA 3D10A 5D69A 4A4CA 1F54A 4MBEA 2LMTA 3AKBA 1S6IA 1K9UA 1XK4A 4A4BA 1BT6A 2BL0C 2JU0A 1SL9A 2CNPA 2NLNA 2BECA 4PALA 4OCIA 3TDZA 1OSAA 2PSRA 3PFVA 1DGVA 1RJVA 1KK7Z 1A75A 4L9MA 3ZNIA 4YGCB 1U5IB 1KWOC 2LHIA 2LCPA 1PVAA 3A8RA 3I5GB 1F4QA 2BKIB 3JVTB 1CTRA 2BKHB 1PRWA 5B8IB 1XFWO 2ISDA 1XFZO 4GGFA 4AQJA 1EL4A 1FPWA 3RM1A 1WRZA 1WRKA 2WCEA 2FCDA 3E3RA 3OX6A 2L0PA 2LV7A 1KFXS 2GGMA 3OB1B 2LVIA 1IJ6A 4D1EA 2G9BA 1J55A 1TN4A 3PATA 1J7QA 1ZMZA 1XO5A 2L2EA 1Y0VH 1N2DA 3EK4A 4OV2A 4AQIA 3PM8A 2MRDA 2JT3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DJH A;  4HSZ A;  1E8A A;  4OVN F;  1D1O A;  1AJ4 A;  3BQ3 A;  4HRG A;  2Q91 A;  1BLQ A;  3PLF B;  1EG3 A;  1WDC B;  3BXK A;  3GOF A;  1JWD A;  3SG4 A;  2KQY A;  2LLS A;  2MJW B;  3OP0 A;  3K21 A;  2COL B;  1NWD A;  1S1E A;  4P2Y B;  2DOQ A;  2LP2 A;  1K95 A;  2LLT A;  4N1F A;  1GJY A;  3PN7 B;  5AAN A;  1YUR A;  1MUX A;  3BUO B;  1IWQ A;  1LIN A;  1UHK A;  3PSR A;  1M39 A;  2JNF A;  3LK0 A;  3F45 A;  2HQ8 A;  2JNX A;  1NCZ A;  1Q80 A;  2L4H A;  1DJZ A;  4CID A;  1BJF A;  1ALV A;  1SMG A;  4GAO A;  3WNX B;  1AUI B;  5KSZ A;  4OR9 B;  4WRI A;  3KF9 A;  1CM1 A;  4C0L A;  2LVK A;  4GFT A;  2HET A;  2PAL A;  2FJU B;  1QJT A;  1ZFS A;  4WQ2 A;  3EK7 A;  1K93 D;  5AER A;  1YUS A;  2G2B A;  1PSR A;  4GPL B;  2KI4 B;  3EKH A;  1BR1 B;  1AHR A;  2BE4 A;  2D8N A;  1B8C A;  3ZWH A;  2CT9 A;  1MXE A;  2Y4Q A;  4AOM A;  1B7T Y;  3EVV A;  3WHU B;  4QJ5 B;  2L51 A;  2BBN A;  2H61 A;  1XVJ A;  2WOS A;  3DVM A;  1IRJ A;  1IJ5 A;  2I94 A;  1RTP 1;  3KO0 A;  1F70 A;  1KQV A;  2KGR A;  1A2X A;  2F8P A;  1RFJ A;  1SR6 B;  2PAS A;  3BUX B;  2LM5 A;  1YX7 A;  1CKK A;  1OE9 B;  2KI6 D;  1S5G Z;  3IQO A;  2CXJ A;  3GK2 A;  1LA0 A;  2AMI A;  3WXA A;  1AP4 A;  1FW4 A;  2LMU A;  1QS7 A;  1NX0 A;  4HRH A;  4MZJ A;  3SIB A;  4MSP A;  2FCE A;  2ZNE A;  1PK0 D;  2F2O A;  3KHE A;  2E30 A;  4FTG A;  3VRN A;  1DJG A;  4OKH A;  1K94 A;  4C0K A;  1SYM A;  3QRX A;  2M1K B;  3OX5 A;  2Y1M A;  3SG2 A;  2KBM A;  1MWN A;  1LKJ A;  1LXF C;  3O2P A;  2IS9 A;  1S6C A;  2RGI A;  3GK1 A;  4DUQ A;  1TNQ A;  1L2O C;  3LCP C;  2KFH A;  1MQ1 A;  2K7O A;  1FF1 A;  1FI5 A;  3I5I B;  4I5L B;  1YRT B;  2BCB A;  2F3Y A;  1CDP A;  1JBA A;  3BUM B;  3JTD C;  5GQQ C;  2CBL A;  4PHJ A;  2SAS A;  1VRK A;  1KFU L;  1XK4 C;  1DMO A;  4YI9 A;  1F8H A;  1CMF A;  2EC6 B;  1CMG A;  3CR2 A;  2LVJ A;  2K7B A;  3A4U B;  3I5H C;  1F71 A;  1RRO A;  1L7Z A;  3I5F C;  1GQM A;  5ER4 X;  5HLO A;  2M1U A;  2M9G A;  4N5X A;  1CB1 A;  1WLZ A;  1XFU O;  2KYC A;  1DGU A;  1KK8 C;  4NQG A;  1EXR A;  3KPX A;  1CDL A;  1QXP A;  3TDU A;  1YUT A;  1QIV A;  1JFK A;  2KYF A;  2V53 A;  4ETO A;  2JUL A;  1HQV A;  4YGD B;  3DVJ A;  5DKN A;  4CFQ A;  1W7I B;  1BR4 B;  1CFD A;  5PAL A;  2L4I A;  1KK7 Y;  1MR8 A;  1OQP A;  2PMY A;  2OTG B;  2QAC A;  3DVK A;  1QLK A;  4ICB A;  1ZAC A;  1DJY A;  5I2Q A;  1FBV A;  1J7O A;  1MF8 B;  2WND A;  3BUN B;  1A03 A;  1G4Y R;  1C7W A;  4HRE E;  3TS5 C;  3OB2 B;  1QLS A;  3O4Y A;  1NX3 A;  4YI8 A;  2SCP A;  1H4B A;  2O60 A;  5BPJ A;  1KSM A;  2BBM A;  1N65 A;  3NSI A;  1NUB A;  1CLM A;  1YVL A;  2JT8 A;  2PRU A;  1A4P A;  1CFC A;  1H8B A;  2L98 A;  2NCO A;  2WCB A;  2CTN A;  5AEQ A;  2L5X B;  2E6W A;  1CFP A;  1G33 A;  1YVH A;  2JTT A;  4PHN A;  1QX7 A;  3M0W A;  4ORA B;  2KSP A;  1NPQ A;  3VRQ A;  4YGE B;  1UUR A;  1K2H A;  3JVT C;  1JFJ A;  5I2O A;  4WQ3 A;  1QX5 B;  2OS8 B;  1IG5 A;  2KFF A;  3LLE A;  2Y1N A;  2LLU A;  4BY4 A;  2I18 A;  4BY5 A;  2K0J A;  1DVI A;  1S26 D;  1S3P A;  2M3W A;  1DTL A;  5F6T A;  4PE7 A;  3VRR A;  1SL7 A;  1DT7 B;  1QAS A;  4CLN A;  1WRL A;  3SG5 A;  2LAP A;  4I5N B;  5HKZ A;  4ZCU A;  2QPT A;  2ZN9 A;  2M7N A;  3WHT B;  4YRU A;  1Y1U A;  1SK6 D;  2LUX A;  2KAV A;  1BMO A;  1REC A;  1NP8 A;  5K89 A;  1AK8 A;  1NCX A;  1C7V A;  1WDC C;  2MLE C;  1XFY O;  3CS1 A;  1KQM C;  1TIZ A;  2LE9 B;  1MHO A;  1QX2 A;  4M2O A;  2BCA A;  1B8L A;  1SL8 A;  1QVI Z;  3SJS A;  1SCM B;  1OMD A;  1UHI A;  4MN0 A;  1B9A A;  4GUK A;  3CTN A;  4GGN A;  2JQ6 A;  5J3X A;  3IQQ A;  1IQ5 A;  1LVC D;  2L50 A;  1WY9 A;  2LP3 A;  5JOL A;  4MVF A;  2Q4U A;  1TNX A;  2NZ0 A;  3D0Y B;  4XJK B;  5HLV A;  5CSF A;  1BU3 A;  1B1G A;  1JF0 A;  2A4J A;  4I5K A;  2JC2 A;  2AAO A;  1W7J B;  1DJW A;  4IL1 A;  1CNP A;  2GGZ A;  1S5G Y;  4R1E A;  1JF2 A;  2KI4 C;  4DS7 A;  3FS7 A;  1OMR A;  1RK9 A;  5FYX A;  2KDH A;  2JRF A;  2M49 B;  1SPY A;  1YUU A;  2NCP A;  2FOT A;  4PHK A;  2ZND A;  2AUC A;  2PVB A;  1ZUZ A;  1UHH A;  1BOD A;  1J1D A;  5CSJ A;  1EJ3 A;  1KFU S;  2ZKM X;  4I5J A;  1AVS A;  3PAL A;  5AFP A;  3OHM B;  1NCY A;  5CPV A;  1SRA A;  5HKW A;  1SR6 C;  1M46 A;  4MLW A;  4NDB A;  1BG1 A;  1WLM A;  1J7P A;  4PDZ A;  3KEV A;  1TOP A;  1DJI A;  1B4C A;  3D0Y A;  3H4S E;  4XJK A;  2OPO A;  2KQ6 A;  2LUC A;  2M29 A;  3BOW A;  1YR5 A;  4GNK B;  1AJ5 A;  1N0Y A;  2KGB C;  2HPS A;  4Q04 A;  5TNC A;  1V1G A;  2EGD A;  2JWW A;  4M2Q A;  2I2R E;  2TN4 A;  3CWG A;  2M7L A;  4MRY A;  5HYD A;  2K2A A;  1NIW A;  2BL0 B;  2O5G A;  3FIA A;  2MAZ A;  3TDI A;  1J1E A;  1KSO A;  3HX4 A;  2F2P A;  4MRX A;  2M97 A;  2KBI A;  3I5I C;  5I8N A;  1OZS A;  1M45 A;  3TUY C;  3DF0 B;  4N1G A;  1QTX A;  2R2I A;  1SW8 A;  1OMV A;  3DVE A;  2MHH A;  1XFV O;  2CCM A;  1KWO B;  3FWB A;  3LK1 A;  5HKY A;  3EVU A;  4MZK A;  2K61 A;  4PE0 A;  4GGF C;  1TNP A;  1K9K A;  5JJG A;  3TS5 B;  1IH0 A;  1EG4 A;  3SIA A;  2LMV A;  3NSO A;  4MEW A;  3ICB A;  1Y1X A;  3GK4 X;  2LAN A;  4PE4 A;  2KAY A;  1CFF A;  1GGW A;  2KI6 C;  1MXL C;  4UPG A;  1K8U A;  2BE6 A;  3BUW B;  1Y6W A;  2JTZ A;  3NSL A;  3NXA A;  2MLF C;  1QIW A;  1J7R A;  3SG7 A;  3DF0 A;  4MZL A;  2BCX A;  2OTG C;  1M63 B;  1CDN A;  3O78 A;  5IBW A;  2KAX A;  3I5G C;  4DIR A;  2K2F A;  3DD4 A;  1V1F A;  3EKJ A;  2JT0 A;  3CR5 X;  4TNC A;  1LA3 A;  2LHL A;  1RWY A;  3C1V A;  5D7F A;  3IF7 A;  1XYD A;  4JWQ A;  4NDC A;  2Y5I A;  1DJX A;  3EVR A;  1TRF A;  1R2U A;  1OOJ A;  1S36 A;  2EHB A;  3LL8 B;  1DF0 B;  4U8D A;  1EH2 A;  1CDM A;  1FI6 A;  2MA2 A;  3RLZ A;  5CSN A;  1QV1 A;  2JXC A;  2JOJ A;  2LC5 A;  2ZN8 A;  1BF5 A;  2MBX A;  5ER5 A;  1XA5 A;  2JXL A;  1U5I A;  1M31 A;  1KFX L;  4P5O E;  1NSH A;  4ORB B;  1F55 A;  5I2L A;  1CLL A;  2OS8 C;  2K7D A;  1S6J A;  4CPV A;  3VRO A;  1SCV A;  4JPZ B;  2I7A A;  1KQM B;  1OZO A;  1PUL A;  2F3Z A;  2H2K A;  1PAL A;  3EK8 A;  5AXI A;  4CFR A;  2H61 C;  3PN7 C;  2KOT A;  4E68 A;  1Y1A A;  1JSA A;  1DF0 A;  1K90 D;  4PHM A;  1IQ3 A;  1TCF A;  1XFX O;  1QVI Y;  2ZRS A;  1SNL A;  4YBH B;  3CR4 X;  4ZCV A;  2KFG A;  3MSE B;  1SBJ A;  4PE1 A;  2HQW A;  4M2P A;  2LNK A;  4DCK A;  2M0R A;  1HT9 A;  2GV5 A;  2M8U A;  1X02 A;  4C0J A;  1NX1 A;  1QAT A;  4USL A;  2F33 A;  3BOW B;  1QV0 A;  1IKU A;  2WC8 A;  1UHN A;  4XYN A;  1SY9 A;  2K7C A;  1GGZ A;  1B7T Z;  1UP5 A;  5DKQ A;  2K8M B;  1SCM C;  1A29 A;  2KNE A;  1YTZ C;  2WCF A;  1ALW A;  1PVB A;  3VGO A;  1CLB A;  1KCY A;  1YRU B;  5KU1 A;  4F0Z B;  1TCO B;  2ZRT A;  4ORC B;  1R6P A;  3AKA A;  3HCM A;  2WOR A;  5DKR A;  1NX2 A;  5KTY A;  1SKT A;  1C07 A;  4QJ3 B;  2ZFD A;  1K9P A;  3SG3 A;  1L2O B;  1YX8 A;  1BOC A;  4JQ0 D;  3AAJ A;  4YGA A;  1UHJ A;  1UUS A;  2KHN A;  3JTD B;  2VRG A;  1B8R A;  2HF5 A;  3AAK A;  3VRP A;  5G08 A;  1F4O A;  2JZI A;  1TTX A;  3FWC A;  3CZT X;  4NDD A;  1NYA A;  4YGB B;  1G8I A;  3I5H B;  1IGV A;  3O6B A;  3BYA A;  3I5F B;  1JUO A;  1UWO A;  4FQO A;  4GBA A;  3CGA A;  1KK8 B;  3TZ1 A;  2B1U A;  3CLN A;  1A75 B;  4PCW A;  1PSB A;  3SG6 A;  2LVV A;  1ZOT B;  3TUY B;  1ODB A;  3NSK A;  1B47 A;  1CM4 A;  4DRW A;  4QJ4 B;  1JC2 A;  1K96 A;  2P6B B;  5CSI A;  2EC6 C;  2NXQ A;  1TNW A;  2JPT A;  3D10 A;  5D69 A;  4A4C A;  1F54 A;  4MBE A;  2LMT A;  3AKB A;  1S6I A;  1K9U A;  1XK4 A;  4A4B A;  1BT6 A;  2BL0 C;  2JU0 A;  1SL9 A;  2CNP A;  2NLN A;  2BEC A;  4PAL A;  4OCI A;  3TDZ A;  1OSA A;  2PSR A;  3PFV A;  1DGV A;  1RJV A;  1KK7 Z;  1A75 A;  4L9M A;  3ZNI A;  4YGC B;  1U5I B;  1KWO C;  2LHI A;  2LCP A;  1PVA A;  3A8R A;  3I5G B;  1F4Q A;  2BKI B;  3JVT B;  1CTR A;  2BKH B;  1PRW A;  5B8I B;  1XFW O;  2ISD A;  1XFZ O;  4GGF A;  4AQJ A;  1EL4 A;  1FPW A;  3RM1 A;  1WRZ A;  1WRK A;  2WCE A;  2FCD A;  3E3R A;  3OX6 A;  2L0P A;  2LV7 A;  1KFX S;  2GGM A;  3OB1 B;  2LVI A;  1IJ6 A;  4D1E A;  2G9B A;  1J55 A;  1TN4 A;  3PAT A;  1J7Q A;  1ZMZ A;  1XO5 A;  2L2E A;  1Y0V H;  1N2D A;  3EK4 A;  4OV2 A;  4AQI A;  3PM8 A;  2MRD A;  2JT3 A; 
#chains in the Genus database with same CATH topology
 1DJH A;  4HSZ A;  1E8A A;  4OVN F;  1D1O A;  3K1E A;  1AJ4 A;  3BQ3 A;  4HRG A;  3S0E A;  2Q91 A;  1BLQ A;  3PLF B;  1EG3 A;  1WDC B;  3BXK A;  3GOF A;  1JWD A;  3SG4 A;  2WCM A;  2KQY A;  2LLS A;  2MJW B;  3OP0 A;  3K21 A;  1DC1 A;  2COL B;  1NWD A;  1S1E A;  4P2Y B;  2DOQ A;  2LP2 A;  3O4X A;  2QEO A;  3SS3 A;  1K95 A;  2LLT A;  4N1F A;  1GJY A;  2PQL A;  3PN7 B;  1YUR A;  5AAN A;  1MUX A;  3BUO B;  1IWQ A;  1LIN A;  5D3O A;  1UHK A;  3PSR A;  1M39 A;  2JNF A;  1XFR A;  3LK0 A;  3F45 A;  3R1P A;  2HQ8 A;  2JNX A;  1NCZ A;  1Q80 A;  2L4H A;  1DJZ A;  4CID A;  1BJF A;  1ALV A;  1SMG A;  4GAO A;  3WNX B;  1AUI B;  5KSZ A;  4OR9 B;  4WRI A;  3KF9 A;  3DXL A;  1C3Y A;  1CM1 A;  4C0L A;  2LVK A;  4GFT A;  2HET A;  2PAL A;  2FJU B;  1QJT A;  1ZFS A;  5I94 A;  4WQ2 A;  3EK7 A;  1K93 D;  5AER A;  1YUS A;  2G2B A;  3PJI A;  1PSR A;  4GPL B;  2KI4 B;  3EKH A;  1BR1 B;  1AHR A;  2BE4 A;  2D8N A;  1B8C A;  3ZWH A;  2CT9 A;  1MXE A;  2Y4Q A;  3EG5 B;  1B7T Y;  3EVV A;  4KYN A;  3WHU B;  2L51 A;  4AOM A;  2BBN A;  2H61 A;  1XVJ A;  2WOS A;  3DVM A;  1IRJ A;  1TUJ A;  1IJ5 A;  2I94 A;  1RTP 1;  3KO0 A;  1F70 A;  1KQV A;  2KGR A;  3BFB A;  1A2X A;  2F8P A;  1RFJ A;  1SR6 B;  2PAS A;  3BUX B;  2LM5 A;  1QWV A;  1YX7 A;  2WCH A;  1CKK A;  1OE9 B;  2KI6 D;  1S5G Z;  3IQO A;  3VRR A;  2CXJ A;  3GK2 A;  1LA0 A;  2AMI A;  2QEB A;  3CZ1 A;  1FW4 A;  3WXA A;  2LMU A;  1QS7 A;  1NX0 A;  4HRH A;  4MZJ A;  3SIB A;  2KPH A;  4MSP A;  2FCE A;  2ZNE A;  1DEL A;  1PK0 D;  2F2O A;  3KHE A;  2E30 A;  4FTG A;  3VRN A;  1DJG A;  3L47 A;  4OKH A;  2BNX A;  2P71 A;  1K94 A;  4C0K A;  1SYM A;  3QRX A;  2M1K B;  3OX5 A;  2Y1M A;  3SG2 A;  2KBM A;  1MWN A;  1LKJ A;  1LXF C;  2JPO A;  2IS9 A;  3O2P A;  1S6C A;  2RGI A;  3GK1 A;  4DUQ A;  1TNQ A;  1L2O C;  4FQT A;  3LCP C;  2KFH A;  1MQ1 A;  2K7O A;  1FF1 A;  1FI5 A;  3I5I B;  4I5L B;  1YRT B;  2BCB A;  2F3Y A;  1CDP A;  1JBA A;  3BUM B;  3JTD C;  5GQQ C;  3V2L A;  2CBL A;  4PHJ A;  2SAS A;  1VRK A;  1KFU L;  1XK4 C;  1DMO A;  4YI9 A;  1F8H A;  1CMF A;  2EC6 B;  1CMG A;  3CR2 A;  2LVJ A;  2K7B A;  3A4U B;  3D73 A;  3I5H C;  1F71 A;  3QME A;  1RRO A;  1L7Z A;  3I5F C;  1GQM A;  5ER4 X;  5HLO A;  2M1U A;  2M9G A;  4N5X A;  1CB1 A;  1WLZ A;  1XFU O;  2KYC A;  1DGU A;  1KK8 C;  4NQG A;  1EXR A;  3KPX A;  5HL1 A;  1CDL A;  1QXP A;  3TDU A;  1YUT A;  1QIV A;  1JFK A;  2YGU A;  2H8V A;  2KYF A;  2V53 A;  4ETO A;  2JUL A;  1HQV A;  3R72 A;  4YGD B;  3S0A A;  3DVJ A;  5DKN A;  4CFQ A;  1W7I B;  1BR4 B;  3S0G A;  1CFD A;  5PAL A;  2L4I A;  1KK7 Y;  1MR8 A;  1OQP A;  2PMY A;  2OTG B;  2QAC A;  3BJH A;  1QLK A;  3DVK A;  4ICB A;  1ZAC A;  1DJY A;  5I2Q A;  1FBV A;  1J7O A;  1MF8 B;  3PM2 A;  2WND A;  3BUN B;  3S0B A;  1G4Y R;  1C7W A;  4HRE E;  3TS5 C;  3D74 A;  3OB2 B;  1QLS A;  3O4Y A;  1NX3 A;  5FI6 A;  4YI8 A;  2SCP A;  1H4B A;  2O60 A;  5BPJ A;  1KSM A;  2BBM A;  1N65 A;  3NSI A;  1NUB A;  1CLM A;  1YVL A;  2JT8 A;  2PRU A;  1SSE B;  1A4P A;  1CFC A;  1H8B A;  2L98 A;  2NCO A;  2WCB A;  2CTN A;  5AEQ A;  3Q8I A;  2L5X B;  2E6W A;  1CFP A;  1G33 A;  1YVH A;  2JTT A;  2P70 A;  1QX7 A;  3M0W A;  1OOH A;  2KSP A;  3D75 A;  4ORA B;  4PHN A;  1NPQ A;  3VRQ A;  4YGE B;  1UUR A;  1K2H A;  3JVT C;  1T14 A;  1JFJ A;  5I2O A;  4WQ3 A;  1QX5 B;  3NHI A;  2OS8 B;  1IG5 A;  2KFF A;  3LLE A;  2Y1N A;  2LLU A;  4BY4 A;  2I18 A;  3B6X A;  4BY5 A;  5EL2 A;  2K0J A;  1DVI A;  1S26 D;  1S3P A;  2KLE A;  1DTL A;  2M3W A;  2WCL A;  4PE7 A;  1SL7 A;  5F6T A;  1QAS A;  3CYZ A;  4CLN A;  1DT7 B;  1WRL A;  3SG5 A;  1OOF A;  1TUZ A;  2LAP A;  4I5N B;  3OGN A;  5HKZ A;  4ZCU A;  2QPT A;  2ZN9 A;  2M7N A;  3WHT B;  4YRU A;  1Y1U A;  1SK6 D;  2LUX A;  2KAV A;  1BMO A;  1REC A;  1NP8 A;  3NGV A;  5K89 A;  1AK8 A;  1NCX A;  1C7V A;  1WDC C;  2MLE C;  1XFY O;  1Z2C B;  3CS1 A;  1KQM C;  1TIZ A;  2LE9 B;  2QEV A;  1MHO A;  1QX2 A;  4M2O A;  2BCA A;  1B8L A;  1SL8 A;  1QVI Z;  3SJS A;  4INW A;  1SCM B;  1OMD A;  1UHI A;  4MN0 A;  1B9A A;  3FE9 A;  4GUK A;  3CTN A;  4GGN A;  2JQ6 A;  3D77 A;  5J3X A;  3IQQ A;  3N7H A;  1IQ5 A;  1LVC D;  2L50 A;  1WY9 A;  2LP3 A;  5DIC A;  3UNW A;  5JOL A;  4MVF A;  2Q4U A;  1TNX A;  2NZ0 A;  3D0Y B;  4XJK B;  5HLV A;  5CSF A;  4JKT A;  1BU3 A;  3S0F A;  1B1G A;  1JF0 A;  2A4J A;  4I5K A;  2JC2 A;  2AAO A;  1W7J B;  1DJW A;  4IL1 A;  1CNP A;  2GGZ A;  2K60 A;  1S5G Y;  4R1E A;  1JF2 A;  2KI4 C;  4DS7 A;  3FS7 A;  1OMR A;  1RK9 A;  5FYX A;  2KDH A;  2JRF A;  2M49 B;  1SPY A;  1YUU A;  2NCP A;  2BAP A;  2FOT A;  4PHK A;  2ZND A;  2AUC A;  2PVB A;  1ZUZ A;  1UHH A;  1BOD A;  1J1D A;  5CSJ A;  1EJ3 A;  1KFU S;  2ZKM X;  3DZT A;  1AVS A;  3PAL A;  4I5J A;  3SS4 A;  5AFP A;  3OHM B;  1NCY A;  5CPV A;  1SRA A;  5HKW A;  1SR6 C;  1M46 A;  4MLW A;  4NDB A;  1BG1 A;  1WLM A;  3D76 A;  1J7P A;  4PDZ A;  1P28 A;  3KEV A;  1TOP A;  1DJI A;  1B4C A;  3D0Y A;  3H4S E;  4XJK A;  2OPO A;  2KQ6 A;  3B86 A;  2LUC A;  2M29 A;  3BOW A;  1YR5 A;  2WC5 A;  4GNK B;  1AJ5 A;  1N0Y A;  2KGB C;  2HPS A;  4Q04 A;  5TNC A;  1V1G A;  2EGD A;  2JWW A;  4M2Q A;  2I2R E;  2TN4 A;  3CWG A;  2M7L A;  4MRY A;  5HYD A;  2K2A A;  1NIW A;  2BL0 B;  2O5G A;  3FIA A;  2MAZ A;  1AP4 A;  3TDI A;  3B87 A;  1J1E A;  1KSO A;  3FE6 A;  3HX4 A;  2F2P A;  4MRX A;  2M97 A;  2KBI A;  3I5I C;  2GTE A;  1OZS A;  1M45 A;  5I8N A;  3TUY C;  3SS5 A;  3DF0 B;  4N1G A;  1QTX A;  4QJ5 B;  2R2I A;  1SW8 A;  1OMV A;  3DVE A;  2MHH A;  1XFV O;  2CCM A;  1KWO B;  3FWB A;  3LK1 A;  5HKY A;  3EVU A;  4MZK A;  2K61 A;  4PE0 A;  4GGF C;  1TNP A;  1K9K A;  5JJG A;  3TS5 B;  1IH0 A;  1EG4 A;  3SIA A;  2LMV A;  1LS8 A;  2ERB A;  2L2C A;  3NSO A;  3ICB A;  1Y1X A;  3GK4 X;  4MEW A;  2LAN A;  4PE4 A;  2KAY A;  1CFF A;  1GGW A;  2KI6 C;  1MXL C;  4UPG A;  1K8U A;  2BE6 A;  3BUW B;  1Y6W A;  2JTZ A;  3NSL A;  3NXA A;  2MLF C;  1A03 A;  1QIW A;  1J7R A;  3SG7 A;  3DF0 A;  4MZL A;  2BCX A;  3VB1 A;  4INX A;  1DQE A;  2OTG C;  1M63 B;  3CZ0 A;  1CDN A;  3FE8 A;  3O78 A;  5IBW A;  2KAX A;  3I5G C;  4DIR A;  2K2F A;  3DD4 A;  1V1F A;  3EKJ A;  2JT0 A;  3CR5 X;  4TNC A;  2QDI A;  1LA3 A;  2LHL A;  1RWY A;  3C1V A;  5D7F A;  1OOI X;  3IF7 A;  1XYD A;  4JWQ A;  4NDC A;  4PT1 A;  2Y5I A;  1DJX A;  3EVR A;  1TRF A;  2KLD A;  1R2U A;  1OOJ A;  1S36 A;  2EHB A;  1TWO A;  3LL8 B;  1DF0 B;  4U8D A;  1EH2 A;  1CDM A;  1FI6 A;  1C3Z A;  2MA2 A;  3RLZ A;  5CSN A;  1QV1 A;  2JXC A;  3B88 A;  2JOJ A;  2LC5 A;  2PYQ A;  2ZN8 A;  1BF5 A;  2MBX A;  5ER5 A;  1XA5 A;  2JXL A;  1U5I A;  1M31 A;  1KFX L;  4P5O E;  1NSH A;  4ORB B;  1F55 A;  5I2L A;  1CLL A;  3DYE A;  2OS8 C;  3R1V A;  2K7D A;  1S6J A;  4CPV A;  3VRO A;  1SCV A;  2L5Y A;  4JPZ B;  2I7A A;  1KQM B;  1OZO A;  1PUL A;  2F3Z A;  2H2K A;  1PAL A;  3EK8 A;  5AXI A;  4CFR A;  2H61 C;  3PN7 C;  2KOT A;  4E68 A;  1Y1A A;  1JSA A;  1DF0 A;  1K90 D;  4PHM A;  1IQ3 A;  1TCF A;  1XFX O;  1QVI Y;  2ZRS A;  1SNL A;  4YBH B;  3CR4 X;  3OBV A;  4ZCV A;  2KFG A;  3MSE B;  1SBJ A;  4PE1 A;  3DY9 A;  2HQW A;  4M2P A;  2LNK A;  3S0D A;  4DCK A;  2M0R A;  1HT9 A;  2GV5 A;  2M8U A;  1X02 A;  4C0J A;  3IVT A;  1NX1 A;  1QAT A;  4USL A;  2F33 A;  3BOW B;  1QV0 A;  1IKU A;  2WC8 A;  1UHN A;  4XYN A;  1SY9 A;  2K7C A;  3B7A A;  1GGZ A;  5FI7 A;  1B7T Z;  1UP5 A;  5DKQ A;  2K8M B;  3D78 A;  1SCM C;  1A29 A;  2KNE A;  1YTZ C;  2WCF A;  1ALW A;  1PVB A;  3VGO A;  1CLB A;  1KCY A;  1YRU B;  5KU1 A;  4F0Z B;  1TCO B;  2ZRT A;  4ORC B;  2WCK A;  1R6P A;  1Z4H A;  3AKA A;  3HCM A;  2WOR A;  5DKR A;  1NX2 A;  5KTY A;  1SKT A;  1C07 A;  3UO9 A;  4QJ3 B;  2ZFD A;  1K9P A;  3SG3 A;  1YX8 A;  1L2O B;  1BOC A;  1OW4 A;  4JQ0 D;  3AAJ A;  4YGA A;  1UHJ A;  1UUS A;  1ORG A;  2KHN A;  3JTD B;  2VRG A;  3CAB A;  1B8R A;  3RZS A;  2HF5 A;  3AAK A;  3VRP A;  5G08 A;  1DEK A;  1F4O A;  2JZI A;  1TTX A;  3FWC A;  3CZT X;  4NDD A;  1NYA A;  4YGB B;  1G8I A;  3I5H B;  1IGV A;  3O6B A;  3BYA A;  3I5F B;  1JUO A;  1UWO A;  4FQO A;  4GBA A;  3NHT A;  3CGA A;  1KK8 B;  3TZ1 A;  2B1U A;  3CLN A;  3L4L A;  4IJ7 A;  1A75 B;  3BFH A;  4PCW A;  1PSB A;  3BFA A;  3SG6 A;  2LVV A;  1ZOT B;  3TUY B;  2WC6 A;  1ODB A;  3NSK A;  1B47 A;  1CM4 A;  4JD9 A;  4DRW A;  4QJ4 B;  1JC2 A;  1K96 A;  2P6B B;  5CSI A;  1OOG A;  2EC6 C;  2NXQ A;  1TNW A;  2JPT A;  2QEH A;  3D10 A;  5D69 A;  4A4C A;  4MBE A;  1F54 A;  1GM0 A;  2LMT A;  3AKB A;  1S6I A;  1K9U A;  1XK4 A;  4A4B A;  1BT6 A;  2WCJ A;  2BL0 C;  2JU0 A;  1SL9 A;  2CNP A;  2NLN A;  2BEC A;  4PAL A;  4OCI A;  3TDZ A;  1OSA A;  2PSR A;  3PFV A;  1DGV A;  2FJY A;  1RJV A;  1KK7 Z;  1A75 A;  4L9M A;  3ZNI A;  4YGC B;  1U5I B;  1KWO C;  2LHI A;  2LCP A;  1PVA A;  3A8R A;  3I5G B;  1F4Q A;  2BKI B;  1IIO A;  3L4A A;  3JVT B;  1CTR A;  4OV2 A;  2BKH B;  3CDN A;  1PRW A;  5B8I B;  1XFW O;  2ISD A;  1XFZ O;  4F7F A;  4GGF A;  4AQJ A;  1EL4 A;  1FPW A;  3RM1 A;  1WRZ A;  1WRK A;  2WCE A;  5FI2 A;  2FCD A;  3E3R A;  3OX6 A;  2L0P A;  2LV7 A;  1KFX S;  2GGM A;  3OB1 B;  4OZD A;  2LVI A;  3R1O A;  1IJ6 A;  4D1E A;  2G9B A;  1J55 A;  1TN4 A;  1W9Z A;  3PAT A;  1J7Q A;  1ZMZ A;  1XO5 A;  2L2E A;  1Y0V H;  1N2D A;  3EK4 A;  3CZ2 A;  4AQI A;  3PM8 A;  2MRD A;  2JT3 A; 
#chains in the Genus database with same CATH homology
 1DJH A;  4HSZ A;  1E8A A;  4OVN F;  1D1O A;  1AJ4 A;  3BQ3 A;  4HRG A;  2Q91 A;  1BLQ A;  3PLF B;  1EG3 A;  1WDC B;  3BXK A;  3GOF A;  1JWD A;  3SG4 A;  2KQY A;  2LLS A;  2MJW B;  3OP0 A;  3K21 A;  2COL B;  1NWD A;  1S1E A;  4P2Y B;  2DOQ A;  2LP2 A;  1K95 A;  2LLT A;  4N1F A;  1GJY A;  3PN7 B;  5AAN A;  1YUR A;  1MUX A;  3BUO B;  1IWQ A;  1LIN A;  1UHK A;  3PSR A;  1M39 A;  2JNF A;  3LK0 A;  3F45 A;  2HQ8 A;  2JNX A;  1NCZ A;  1Q80 A;  2L4H A;  1DJZ A;  4CID A;  1BJF A;  1ALV A;  1SMG A;  4GAO A;  3WNX B;  1AUI B;  5KSZ A;  4OR9 B;  4WRI A;  3KF9 A;  1CM1 A;  4C0L A;  2LVK A;  4GFT A;  2HET A;  2PAL A;  2FJU B;  1QJT A;  1ZFS A;  4WQ2 A;  3EK7 A;  1K93 D;  5AER A;  1YUS A;  2G2B A;  1PSR A;  4GPL B;  2KI4 B;  3EKH A;  1BR1 B;  1AHR A;  2BE4 A;  2D8N A;  1B8C A;  3ZWH A;  2CT9 A;  1MXE A;  2Y4Q A;  4AOM A;  1B7T Y;  3EVV A;  3WHU B;  4QJ5 B;  2L51 A;  2BBN A;  2H61 A;  1XVJ A;  2WOS A;  3DVM A;  1IRJ A;  1IJ5 A;  2I94 A;  1RTP 1;  3KO0 A;  1F70 A;  1KQV A;  2KGR A;  1A2X A;  2F8P A;  1RFJ A;  1SR6 B;  2PAS A;  3BUX B;  2LM5 A;  1YX7 A;  1CKK A;  1OE9 B;  2KI6 D;  1S5G Z;  3IQO A;  2CXJ A;  3GK2 A;  1LA0 A;  2AMI A;  3WXA A;  1AP4 A;  1FW4 A;  2LMU A;  1QS7 A;  1NX0 A;  4HRH A;  4MZJ A;  3SIB A;  4MSP A;  2FCE A;  2ZNE A;  1PK0 D;  2F2O A;  3KHE A;  2E30 A;  4FTG A;  3VRN A;  1DJG A;  4OKH A;  1K94 A;  4C0K A;  1SYM A;  3QRX A;  2M1K B;  3OX5 A;  2Y1M A;  3SG2 A;  2KBM A;  1MWN A;  1LKJ A;  1LXF C;  3O2P A;  2IS9 A;  1S6C A;  2RGI A;  3GK1 A;  4DUQ A;  1TNQ A;  1L2O C;  3LCP C;  2KFH A;  1MQ1 A;  2K7O A;  1FF1 A;  1FI5 A;  3I5I B;  4I5L B;  1YRT B;  2BCB A;  2F3Y A;  1CDP A;  1JBA A;  3BUM B;  3JTD C;  5GQQ C;  2CBL A;  4PHJ A;  2SAS A;  1VRK A;  1KFU L;  1XK4 C;  1DMO A;  4YI9 A;  1F8H A;  1CMF A;  2EC6 B;  1CMG A;  3CR2 A;  2LVJ A;  2K7B A;  3A4U B;  3I5H C;  1F71 A;  1RRO A;  1L7Z A;  3I5F C;  1GQM A;  5ER4 X;  5HLO A;  2M1U A;  2M9G A;  4N5X A;  1CB1 A;  1WLZ A;  1XFU O;  2KYC A;  1DGU A;  1KK8 C;  4NQG A;  1EXR A;  3KPX A;  1CDL A;  1QXP A;  3TDU A;  1YUT A;  1QIV A;  1JFK A;  2KYF A;  2V53 A;  4ETO A;  2JUL A;  1HQV A;  4YGD B;  3DVJ A;  5DKN A;  4CFQ A;  1W7I B;  1BR4 B;  1CFD A;  5PAL A;  2L4I A;  1KK7 Y;  1MR8 A;  1OQP A;  2PMY A;  2OTG B;  2QAC A;  3DVK A;  1QLK A;  4ICB A;  1ZAC A;  1DJY A;  5I2Q A;  1FBV A;  1J7O A;  1MF8 B;  2WND A;  3BUN B;  1A03 A;  1G4Y R;  1C7W A;  4HRE E;  3TS5 C;  3OB2 B;  1QLS A;  3O4Y A;  1NX3 A;  4YI8 A;  2SCP A;  1H4B A;  2O60 A;  5BPJ A;  1KSM A;  2BBM A;  1N65 A;  3NSI A;  1NUB A;  1CLM A;  1YVL A;  2JT8 A;  2PRU A;  1A4P A;  1CFC A;  1H8B A;  2L98 A;  2NCO A;  2WCB A;  2CTN A;  5AEQ A;  2L5X B;  2E6W A;  1CFP A;  1G33 A;  1YVH A;  2JTT A;  4PHN A;  1QX7 A;  3M0W A;  4ORA B;  2KSP A;  1NPQ A;  3VRQ A;  4YGE B;  1UUR A;  1K2H A;  3JVT C;  1JFJ A;  5I2O A;  4WQ3 A;  1QX5 B;  2OS8 B;  1IG5 A;  2KFF A;  3LLE A;  2Y1N A;  2LLU A;  4BY4 A;  2I18 A;  4BY5 A;  2K0J A;  1DVI A;  1S26 D;  1S3P A;  2M3W A;  1DTL A;  5F6T A;  4PE7 A;  3VRR A;  1SL7 A;  1DT7 B;  1QAS A;  4CLN A;  1WRL A;  3SG5 A;  2LAP A;  4I5N B;  5HKZ A;  4ZCU A;  2QPT A;  2ZN9 A;  2M7N A;  3WHT B;  4YRU A;  1Y1U A;  1SK6 D;  2LUX A;  2KAV A;  1BMO A;  1REC A;  1NP8 A;  5K89 A;  1AK8 A;  1NCX A;  1C7V A;  1WDC C;  2MLE C;  1XFY O;  3CS1 A;  1KQM C;  1TIZ A;  2LE9 B;  1MHO A;  1QX2 A;  4M2O A;  2BCA A;  1B8L A;  1SL8 A;  1QVI Z;  3SJS A;  1SCM B;  1OMD A;  1UHI A;  4MN0 A;  1B9A A;  4GUK A;  3CTN A;  4GGN A;  2JQ6 A;  5J3X A;  3IQQ A;  1IQ5 A;  1LVC D;  2L50 A;  1WY9 A;  2LP3 A;  5JOL A;  4MVF A;  2Q4U A;  1TNX A;  2NZ0 A;  3D0Y B;  4XJK B;  5HLV A;  5CSF A;  1BU3 A;  1B1G A;  1JF0 A;  2A4J A;  4I5K A;  2JC2 A;  2AAO A;  1W7J B;  1DJW A;  4IL1 A;  1CNP A;  2GGZ A;  1S5G Y;  4R1E A;  1JF2 A;  2KI4 C;  4DS7 A;  3FS7 A;  1OMR A;  1RK9 A;  5FYX A;  2KDH A;  2JRF A;  2M49 B;  1SPY A;  1YUU A;  2NCP A;  2FOT A;  4PHK A;  2ZND A;  2AUC A;  2PVB A;  1ZUZ A;  1UHH A;  1BOD A;  1J1D A;  5CSJ A;  1EJ3 A;  1KFU S;  2ZKM X;  4I5J A;  1AVS A;  3PAL A;  5AFP A;  3OHM B;  1NCY A;  5CPV A;  1SRA A;  5HKW A;  1SR6 C;  1M46 A;  4MLW A;  4NDB A;  1BG1 A;  1WLM A;  1J7P A;  4PDZ A;  3KEV A;  1TOP A;  1DJI A;  1B4C A;  3D0Y A;  3H4S E;  4XJK A;  2OPO A;  2KQ6 A;  2LUC A;  2M29 A;  3BOW A;  1YR5 A;  4GNK B;  1AJ5 A;  1N0Y A;  2KGB C;  2HPS A;  4Q04 A;  5TNC A;  1V1G A;  2EGD A;  2JWW A;  4M2Q A;  2I2R E;  2TN4 A;  3CWG A;  2M7L A;  4MRY A;  5HYD A;  2K2A A;  1NIW A;  2BL0 B;  2O5G A;  3FIA A;  2MAZ A;  3TDI A;  1J1E A;  1KSO A;  3HX4 A;  2F2P A;  4MRX A;  2M97 A;  2KBI A;  3I5I C;  5I8N A;  1OZS A;  1M45 A;  3TUY C;  3DF0 B;  4N1G A;  1QTX A;  2R2I A;  1SW8 A;  1OMV A;  3DVE A;  2MHH A;  1XFV O;  2CCM A;  1KWO B;  3FWB A;  3LK1 A;  5HKY A;  3EVU A;  4MZK A;  2K61 A;  4PE0 A;  4GGF C;  1TNP A;  1K9K A;  5JJG A;  3TS5 B;  1IH0 A;  1EG4 A;  3SIA A;  2LMV A;  3NSO A;  4MEW A;  3ICB A;  1Y1X A;  3GK4 X;  2LAN A;  4PE4 A;  2KAY A;  1CFF A;  1GGW A;  2KI6 C;  1MXL C;  4UPG A;  1K8U A;  2BE6 A;  3BUW B;  1Y6W A;  2JTZ A;  3NSL A;  3NXA A;  2MLF C;  1QIW A;  1J7R A;  3SG7 A;  3DF0 A;  4MZL A;  2BCX A;  2OTG C;  1M63 B;  1CDN A;  3O78 A;  5IBW A;  2KAX A;  3I5G C;  4DIR A;  2K2F A;  3DD4 A;  1V1F A;  3EKJ A;  2JT0 A;  3CR5 X;  4TNC A;  1LA3 A;  2LHL A;  1RWY A;  3C1V A;  5D7F A;  3IF7 A;  1XYD A;  4JWQ A;  4NDC A;  2Y5I A;  1DJX A;  3EVR A;  1TRF A;  1R2U A;  1OOJ A;  1S36 A;  2EHB A;  3LL8 B;  1DF0 B;  4U8D A;  1EH2 A;  1CDM A;  1FI6 A;  2MA2 A;  3RLZ A;  5CSN A;  1QV1 A;  2JXC A;  2JOJ A;  2LC5 A;  2ZN8 A;  1BF5 A;  2MBX A;  5ER5 A;  1XA5 A;  2JXL A;  1U5I A;  1M31 A;  1KFX L;  4P5O E;  1NSH A;  4ORB B;  1F55 A;  5I2L A;  1CLL A;  2OS8 C;  2K7D A;  1S6J A;  4CPV A;  3VRO A;  1SCV A;  4JPZ B;  2I7A A;  1KQM B;  1OZO A;  1PUL A;  2F3Z A;  2H2K A;  1PAL A;  3EK8 A;  5AXI A;  4CFR A;  2H61 C;  3PN7 C;  2KOT A;  4E68 A;  1Y1A A;  1JSA A;  1DF0 A;  1K90 D;  4PHM A;  1IQ3 A;  1TCF A;  1XFX O;  1QVI Y;  2ZRS A;  1SNL A;  4YBH B;  3CR4 X;  4ZCV A;  2KFG A;  3MSE B;  1SBJ A;  4PE1 A;  2HQW A;  4M2P A;  2LNK A;  4DCK A;  2M0R A;  1HT9 A;  2GV5 A;  2M8U A;  1X02 A;  4C0J A;  1NX1 A;  1QAT A;  4USL A;  2F33 A;  3BOW B;  1QV0 A;  1IKU A;  2WC8 A;  1UHN A;  4XYN A;  1SY9 A;  2K7C A;  1GGZ A;  1B7T Z;  1UP5 A;  5DKQ A;  2K8M B;  1SCM C;  1A29 A;  2KNE A;  1YTZ C;  2WCF A;  1ALW A;  1PVB A;  3VGO A;  1CLB A;  1KCY A;  1YRU B;  5KU1 A;  4F0Z B;  1TCO B;  2ZRT A;  4ORC B;  1R6P A;  3AKA A;  3HCM A;  2WOR A;  5DKR A;  1NX2 A;  5KTY A;  1SKT A;  1C07 A;  4QJ3 B;  2ZFD A;  1K9P A;  3SG3 A;  1L2O B;  1YX8 A;  1BOC A;  4JQ0 D;  3AAJ A;  4YGA A;  1UHJ A;  1UUS A;  2KHN A;  3JTD B;  2VRG A;  1B8R A;  2HF5 A;  3AAK A;  3VRP A;  5G08 A;  1F4O A;  2JZI A;  1TTX A;  3FWC A;  3CZT X;  4NDD A;  1NYA A;  4YGB B;  1G8I A;  3I5H B;  1IGV A;  3O6B A;  3BYA A;  3I5F B;  1JUO A;  1UWO A;  4FQO A;  4GBA A;  3CGA A;  1KK8 B;  3TZ1 A;  2B1U A;  3CLN A;  1A75 B;  4PCW A;  1PSB A;  3SG6 A;  2LVV A;  1ZOT B;  3TUY B;  1ODB A;  3NSK A;  1B47 A;  1CM4 A;  4DRW A;  4QJ4 B;  1JC2 A;  1K96 A;  2P6B B;  5CSI A;  2EC6 C;  2NXQ A;  1TNW A;  2JPT A;  3D10 A;  5D69 A;  4A4C A;  1F54 A;  4MBE A;  2LMT A;  3AKB A;  1S6I A;  1K9U A;  1XK4 A;  4A4B A;  1BT6 A;  2BL0 C;  2JU0 A;  1SL9 A;  2CNP A;  2NLN A;  2BEC A;  4PAL A;  4OCI A;  3TDZ A;  1OSA A;  2PSR A;  3PFV A;  1DGV A;  1RJV A;  1KK7 Z;  1A75 A;  4L9M A;  3ZNI A;  4YGC B;  1U5I B;  1KWO C;  2LHI A;  2LCP A;  1PVA A;  3A8R A;  3I5G B;  1F4Q A;  2BKI B;  3JVT B;  1CTR A;  2BKH B;  1PRW A;  5B8I B;  1XFW O;  2ISD A;  1XFZ O;  4GGF A;  4AQJ A;  1EL4 A;  1FPW A;  3RM1 A;  1WRZ A;  1WRK A;  2WCE A;  2FCD A;  3E3R A;  3OX6 A;  2L0P A;  2LV7 A;  1KFX S;  2GGM A;  3OB1 B;  2LVI A;  1IJ6 A;  4D1E A;  2G9B A;  1J55 A;  1TN4 A;  3PAT A;  1J7Q A;  1ZMZ A;  1XO5 A;  2L2E A;  1Y0V H;  1N2D A;  3EK4 A;  4OV2 A;  4AQI A;  3PM8 A;  2MRD A;  2JT3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...