3D77A

Crystal structure of a pheromone binding protein mutant d35n, from apis mellifera, soaked at ph 4.0
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
116
structure length
116
Chain Sequence
WVPPEVFDLVAEDKARCMSEHGTTQAQIDDVNKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Queen bee pheromone binding protein pH-induced domain swapping favors pheromone release
pubmed doi rcsb
source organism Apis mellifera
molecule tags Pheromone binding protein
molecule keywords Pheromone-binding protein ASP1
total genus 45
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3d77A00
3CZ2A 2H8VA 3CZ0A 2WC5A 5EL2A 1C3ZA 3FE8A 3DY9A 3B86A 3B87A 3S0FA 2QEBA 2WCMA 2QEHA 3S0EA 1OOIX 3BFBA 3B7AA 3DXLA 2P71A 3DZTA 3R72A 1DQEA 2JPOA 3L47A 3V2LA 3NGVA 1OOFA 1TWOA 3L4LA 3BFHA 4INXA 3K1EA 2P70A 4OZDA 4FQTA 3D76A 3S0DA 2L2CA 3RZSA 1T14A 4PT1A 2WCKA 3D75A 3D78A 2WC6A 1OOHA 3FE9A 4JD9A 3NHIA 3NHTA 1P28A 1OW4A 3S0AA 3D73A 3FE6A 3S0GA 3B88A 3CYZA 2PQLA 2WCHA 1ORGA 2QEOA 3D77A 3N7HA 2QEVA 3D74A 3BFAA 3PJIA 1GM0A 3R1OA 3CABA 1OOGA 2KPHA 2QDIA 2ERBA 5DICA 1TUJA 2WCLA 3OGNA 1QWVA 3DYEA 3S0BA 2FJYA 3BJHA 4INWA 3L4AA 1LS8A 3R1PA 2WCJA 1XFRA 3QMEA 3R1VA 3VB1A 3CZ1A 3Q8IA 3CDNA 2GTEA 1C3YA 4F7FA 3B6XA
chains in the Genus database with same CATH superfamily
3CZ2A 2LE9B 1DF0A 2K0JA 4HREE 1GQMA 2FOTA 5JOLA 4IJ7A 1AVSA 2LLUA 2WC5A 3KF9A 1L7ZA 2F3ZA 4A4CA 1WDCC 5PALA 4UPGA 5KTYA 3FIAA 3LCPC 2L51A 1R6PA 1M31A 1X02A 4CFRA 4YGDB 1CLBA 3EVRA 4AOMA 1CNPA 1SL7A 5HKZA 2BAPA 1BR1B 1LINA 3O78A 4GPLB 2NCOA 4PCWA 4WQ3A 4TNCA 3DVKA 3WHUB 3HX4A 1SY9A 2JXLA 2KNEA 4NDBA 4MLWA 4Q04A 1UHJA 1XO5A 2QPTA 3RLZA 2LCPA 3PATA 4YGBB 3DZTA 1B47A 1UP5A 4NDCA 1PRWA 2KDHA 2KAXA 4YI8A 2MA2A 4HSZA 5KSZA 1LA0A 3KO0A 3NGVA 1TWOA 2K8MB 3BFHA 1EXRA 1K8UA 3NSOA 1ZOTB 1WLMA 2BKIB 1K93D 4N1FA 2ZNEA 2KYFA 1EG4A 3H4SE 3JTDC 3D76A 3EVVA 1YTZC 5CPVA 2KAVA 2CNPA 4MSPA 3FS7A 4PT1A 1SK6D 2WCKA 1G4YR 2CTNA 1TCOB 2HETA 1SR6B 3DF0A 1A29A 3OX5A 3ZNIA 3SG4A 2KLEA 3DVMA 2BE4A 3NHTA 4ETOA 1IQ3A 1OSAA 1YUSA 3F45A 1OW4A 2I18A 2K2FA 3OP0A 3PN7C 5CSJA 4GAOA 3I5FC 3EK7A 1ALVA 2O60A 4WRIA 3AAKA 4YBHB 2LVJA 3I5HC 2K61A 5AXIA 3ZWHA 1KK8B 1PVAA 2JULA 4QJ3B 4DRWA 1S5GY 1Y1UA 4PHJA 1FI5A 1CLLA 1QIVA 2MRDA 3LLEA 5DKRA 1S3PA 1JBAA 1IKUA 1PULA 3SG6A 2LVIA 2LUCA 3PFVA 2LMTA 3SS5A 1OOGA 1QTXA 1D1OA 1OZSA 1TNPA 1H8BA 2KI6D 1IIOA 1TNQA 2WCEA 4D1EA 5K89A 2M9GA 1GJYA 4XJKA 1M45A 1KK7Z 2OTGC 3VGOA 1JF0A 3GOFA 4PE7A 3OB2B 2ERBA 2LLTA 2AAOA 3NSIA 1MF8B 1NUBA 3CS1A 4R1EA 1ZACA 2FCEA 1KWOC 2LP2A 4JKTA 1ODBA 2EGDA 2K60A 3L4AA 1FPWA 1CMFA 2ISDA 1XFWO 1XFXO 1M46A 3R1PA 3RM1A 4BY4A 2Q91A 1BLQA 3QMEA 3NXAA 1KFUS 3CGAA 1TTXA 4XYNA 4PE0A 3UO9A 5DKNA 2KLDA 1E8AA 1G8IA 1QLKA 2BCBA 2GGZA 2P6BB 3CZ0A 2ZRSA 3DF0B 1BG1A 1QATA 1F71A 3TUYB 3FE8A 2M49B 2JT3A 5HKYA 1DGUA 1Q80A 1V1GA 1WY9A 1YX7A 1Z4HA 3B86A 3NSLA 4BY5A 1UUSA 5I94A 4USLA 3LL8B 1DJGA 1EL4A 2PASA 2KYCA 2WCMA 1QJTA 1CDPA 1SL8A 5HYDA 2FCDA 3IQQA 3SIAA 1CFPA 1TUZA 2NXQA 2WOSA 2KQYA 2PALA 2LV7A 4PHNA 1XK4C 1Y6WA 3WXAA 1F70A 4YI9A 5I2OA 2JT0A 3GK4X 2D8NA 3SS3A 5AERA 1QV1A 2SASA 2JT8A 3B7AA 1BU3A 4F0ZB 3EKHA 1QX5B 2I94A 1B8LA 4PE1A 2Y4QA 3WHTB 1SYMA 1WRZA 1TNWA 2P71A 3C1VA 3O4YA 1QX7A 4ORBB 4QJ5B 2JTTA 1DJIA 2JPOA 1N65A 1NX0A 2BCAA 4YGAA 3L47A 4ZCVA 2FJUB 2Y1MA 2JQ6A 3I5GB 3K21A 4I5LB 3KEVA 2YGUA 3EK8A 2LC5A 1OQPA 2JXCA 4U8DA 4GFTA 2P70A 1KCYA 3IQOA 5AFPA 1CFDA 1B7TY 2PRUA 1IJ6A 4OZDA 3AAJA 4PALA 4FQTA 2L0PA 4GGFA 2KFFA 1CB1A 2G2BA 1YR5A 1XA5A 1SW8A 1B8RA 1HT9A 3SG5A 5D3OA 1NIWA 1CMGA 3D78A 4E68A 2KGBC 1J7RA 2V53A 1DEKA 2LANA 4CFQA 3BOWB 1BODA 2CT9A 1J7QA 2HF5A 4N1GA 4JPZB 2Q4UA 3LK0A 5ER4X 1JC2A 1S6IA 1XFZO 3KPXA 2LLSA 5F6TA 2AUCA 5G08A 4OR9B 3VRNA 1JWDA 1TRFA 2BL0B 2WC8A 3CYZA 1QV0A 1F4OA 4MRYA 4DUQA 2L5YA 3CR5X 4OV2A 1ZFSA 1BMOA 3AKBA 3D77A 3IVTA 1TCFA 2LHIA 1F4QA 3OB1B 3BQ3A 1J1EA 2RGIA 3CTNA 1YX8A 2LVKA 1MQ1A 2KFGA 2NLNA 1DJHA 3BFAA 1F55A 1XFVO 1SR6C 1IGVA 4MZJA 1NCYA 2OTGB 5KU1A 1IQ5A 1FI6A 2MHHA 2M1UA 1W7JB 1FBVA 4DS7A 2B1UA 3PSRA 5FYXA 2E30A 4XJKB 1UHIA 2WCLA 2BBNA 1CDLA 1QWVA 3S0BA 1KWOB 2JZIA 2FJYA 2PMYA 2SCPA 3BJHA 4OKHA 1TIZA 4INWA 1JFKA 1BOCA 2BL0C 2GGMA 4M2QA 1IG5A 1Y1AA 2F2PA 2K7BA 1M63B 3A8RA 2K2AA 4ORCB 4HRHA 5I2QA 3AKAA 1NSHA 1WLZA 1SCMB 2LUXA 1IRJA 1RK9A 1SRAA 3BUOB 2IS9A 1AK8A 2LHLA 3BUMB 3CDNA 1JSAA 2GTEA 2K7DA 1CLMA 1C3YA 1PSBA 3KHEA 1NPQA 2H8VA 2QACA 4GGNA 3SG3A 1YURA 1DELA 3GK1A 3D0YB 5I2LA 1S26D 2JWWA 3BOWA 1C3ZA 1RFJA 2WORA 5EL2A 2MLFC 1LA3A 1KK8C 1UHKA 2BCXA 3EK4A 1B8CA 2KI4C 5FI6A 1U5IA 2JTZA 5FI2A 1B9AA 1SPYA 2M7LA 1QASA 1XK4A 2QEBA 1K90D 2Y5IA 3FWBA 3I5IC 1QVIZ 2Y1NA 1K2HA 4HRGA 2NZ0A 2M0RA 1BR4B 2CBLA 2QEHA 3GK2A 1KSOA 3QRXA 1YVHA 5AANA 1RECA 2JNFA 1KFXL 2MJWB 1MHOA 1MXLC 1QVIY 1OOIX 2CCMA 2DOQA 2ZN9A 5CSNA 3BFBA 5D7FA 4FTGA 3SS4A 1KQMC 1NX2A 1W7IB 3EKJA 3DXLA 4AQIA 1KQVA 1YRUB 1CM4A 3TDUA 1YRTB 1JUOA 1FF1A 3FWCA 3IF7A 1RWYA 2JOJA 1NX1A 2WCBA 2O5GA 1BJFA 1DJYA 1UWOA 1DGVA 2LMUA 5CSFA 1QS7A 1UURA 2BE6A 4INXA 3K1EA 1DC1A 4OCIA 1MWNA 2KAYA 1R2UA 5FI7A 1DVIA 2KI4B 2MLEC 3RZSA 2M8UA 3TS5C 1J7PA 1T14A 3PM2A 2H61A 4GUKA 2KGRA 5ER5A 1NYAA 1RJVA 1Y1XA 4YRUA 1OOHA 3BUNB 1A75A 2R2IA 3FE9A 3SG7A 1XFYO 3O6BA 4YGCB 4JD9A 3DD4A 3NHIA 3LK1A 1P28A 2KI6C 3TUYC 3S0AA 1RTP1 1SMGA 5HLVA 1SCMC 2EHBA 1NWDA 2L2EA 3I5GC 1CM1A 3FE6A 5AEQA 2WNDA 2CXJA 3D0YA 3NSKA 1CFCA 1ORGA 4ICBA 1NCZA 1VRKA 4NQGA 2BKHB 2QEOA 1AP4A 1K96A 1S6CA 5DKQA 3N7HA 2LVVA 2L4IA 2QEVA 5BPJA 5HLOA 1MXEA 1DJZA 4C0LA 1BF5A 1K95A 2LM5A 1DF0B 1ZUZA 2LMVA 1GM0A 1PK0D 3R1OA 3CABA 1L2OC 2F33A 4I5JA 2KPHA 2QDIA 4KYNA 3TS5B 3I5HB 1FW4A 2ZRTA 5I8NA 2ZN8A 3D10A 2L98A 2OPOA 2A4JA 4L9MA 4AQJA 3TDZA 1TUJA 1J1DA 3BUXB 1S5GZ 3OGNA 1EG3A 4MZKA 1ZMZA 2WCFA 4A4BA 1OOJA 2OS8B 1YVLA 1LVCD 1TN4A 1EH2A 3CR2A 1KFXS 1LS8A 1TNXA 1W9ZA 5B8IB 1CDMA 2L4HA 3PM8A 4GGFC 1AHRA 1SL9A 1BT6A 1C7WA 4QJ4B 2WCJA 4I5KA 1XFRA 1A4PA 1DJWA 1KK7Y 3TZ1A 1C07A 2KHNA 1N0YA 1UHHA 2EC6B 2KQ6A 3BXKA 4C0KA 2H61C 1V1FA 1QX2A 3Q8IA 3SG2A 1PVBA 1PSRA 3B6XA 4WQ2A 2F3YA 2K7OA 4YGEB 1K9PA 2BBMA 2JNXA 4DCKA 5JJGA 4CIDA 1S1EA 1DT7B 1YUUA 1U5IB 1SKTA 1TOPA 1F8HA 3DY9A 2KBIA 1QLSA 1WDCB 1CFFA 3B87A 5IBWA 2HPSA 1OMVA 2LNKA 3I5IB 4PE4A 3TDIA 2BECA 3O4XA 4PHKA 3S0FA 3VRPA 1QIWA 3M0WA 4ORAB 1HQVA 1IJ5A 1LKJA 2OS8C 1JF2A 1OZOA 3OHMB 1MUXA 3PLFB 3BUWB 1IWQA 3S0EA 1RROA 1N2DA 1B7TZ 1CTRA 1XFUO 1YUTA 4M2OA 1AUIB 2HQ8A 3CWGA 3O2PA 3PN7B 3JVTC 1A2XA 1ALWA 3JVTB 1DJXA 2M7NA 1EJ3A 1AJ4A 4MRXA 3R72A 5TNCA 1S36A 3WNXB 1DQEA 4I5NB 1XVJA 2AMIA 1Y0VH 2MAZA 1XYDA 2MBXA 1CKKA 1UHNA 3PALA 3V2LA 1GGZA 1AJ5A 1OOFA 2KFHA 2PYQA 4JWQA 2COLB 1SNLA 3L4LA 4PHMA 1NX3A 4FQOA 2ZKMX 3A4UB 1K9UA 2JU0A 1M39A 4M2PA 1IH0A 2TN4A 1KSMA 3S0DA 2L2CA 2M1KB 1F54A 4GNKB 4P5OE 3D75A 2WC6A 2KSPA 3CZTX 1G33A 2VRGA 3JTDB 2G9BA 3VRQA 2ZFDA 3EG5B 2I7AA 3HCMA 1C7VA 4IL1A 4CLNA 2JC2A 1K9KA 1A75B 4N5XA 3ICBA 3D73A 2ZNDA 1WRKA 2PSRA 1SBJA 2JRFA 3CLNA 4C0JA 2LP3A 3DVJA 3B88A 3S0GA 1PALA 2PQLA 2WCHA 1SSEB 1SCVA 3SIBA 1NP8A 1J55A 3EVUA 2M3WA 2LAPA 3UNWA 3VRRA 4CPVA 4P2YB 1KFUL 3D74A 3E3RA 1A03A 2E6WA 4ZCUA 1MR8A 1B4CA 2BNXA 2KOTA 2JPTA 2K7CA 4MVFA 3OBVA 3PJIA 5CSIA 1CDNA 2M29A 1H4BA 3MSEB 1B1GA 1WRLA 1QXPA 2I2RE 4OVNF 1JFJA 1J7OA 1KQMB 2F8PA 1LXFC 2L50A 3BYAA 2KBMA 5DICA 1OMRA 2F2OA 5GQQC 4DIRA 5HKWA 5HL1A 3DYEA 5D69A 1DMOA 2PVBA 1DTLA 2EC6C 4MBEA 3SJSA 1S6JA 2M97A 1OE9B 3DVEA 4JQ0D 2HQWA 4MEWA 1OMDA 2NCPA 4PDZA 3VROA 1K94A 3OX6A 4MZLA 3CR4X 4NDDA 2H2KA 3I5FB 2L5XB 3R1VA 1L2OB 3VB1A 1Z2CB 3CZ1A 2GV5A 1NCXA 4GBAA 1GGWA 5J3XA 4F7FA 4MN0A
chains in the Genus database with same CATH topology
3CZ2A 2H8VA 3CZ0A 2WC5A 5EL2A 1C3ZA 3FE8A 3DY9A 3B86A 3B87A 3S0FA 2QEBA 2WCMA 2QEHA 3S0EA 1OOIX 3BFBA 3B7AA 3DXLA 2P71A 3DZTA 3R72A 1DQEA 2JPOA 3L47A 3V2LA 3NGVA 1OOFA 1TWOA 3L4LA 3BFHA 4INXA 3K1EA 2P70A 4OZDA 4FQTA 3D76A 3S0DA 2L2CA 3RZSA 1T14A 4PT1A 2WCKA 3D75A 3D78A 2WC6A 1OOHA 3FE9A 4JD9A 3NHIA 3NHTA 1P28A 1OW4A 3S0AA 3D73A 3FE6A 3S0GA 3B88A 3CYZA 2PQLA 2WCHA 1ORGA 2QEOA 3D77A 3N7HA 2QEVA 3D74A 3BFAA 3PJIA 1GM0A 3R1OA 3CABA 1OOGA 2KPHA 2QDIA 2ERBA 5DICA 1TUJA 2WCLA 3OGNA 1QWVA 3DYEA 3S0BA 2FJYA 3BJHA 4INWA 3L4AA 1LS8A 3R1PA 2WCJA 1XFRA 3QMEA 3R1VA 3VB1A 3CZ1A 3Q8IA 3CDNA 2GTEA 1C3YA 4F7FA 3B6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CZ2 A;  2H8V A;  3CZ0 A;  2WC5 A;  5EL2 A;  1C3Z A;  3FE8 A;  3DY9 A;  3B86 A;  3B87 A;  3S0F A;  2QEB A;  2WCM A;  2QEH A;  3S0E A;  1OOI X;  3BFB A;  3B7A A;  3DXL A;  2P71 A;  3DZT A;  3R72 A;  1DQE A;  2JPO A;  3L47 A;  3V2L A;  3NGV A;  1OOF A;  1TWO A;  3L4L A;  3BFH A;  4INX A;  3K1E A;  2P70 A;  4OZD A;  4FQT A;  3D76 A;  3S0D A;  2L2C A;  3RZS A;  1T14 A;  4PT1 A;  2WCK A;  3D75 A;  3D78 A;  2WC6 A;  1OOH A;  3FE9 A;  4JD9 A;  3NHI A;  3NHT A;  1P28 A;  1OW4 A;  3S0A A;  3D73 A;  3FE6 A;  3S0G A;  3B88 A;  3CYZ A;  2PQL A;  2WCH A;  1ORG A;  2QEO A;  3D77 A;  3N7H A;  2QEV A;  3D74 A;  3BFA A;  3PJI A;  1GM0 A;  3R1O A;  3CAB A;  1OOG A;  2KPH A;  2QDI A;  2ERB A;  5DIC A;  1TUJ A;  2WCL A;  3OGN A;  1QWV A;  3DYE A;  3S0B A;  2FJY A;  3BJH A;  4INW A;  3L4A A;  1LS8 A;  3R1P A;  2WCJ A;  1XFR A;  3QME A;  3R1V A;  3VB1 A;  3CZ1 A;  3Q8I A;  3CDN A;  2GTE A;  1C3Y A;  4F7F A;  3B6X A; 
#chains in the Genus database with same CATH topology
 3CZ2 A;  2LE9 B;  1DF0 A;  2K0J A;  4HRE E;  1GQM A;  2FOT A;  5JOL A;  4IJ7 A;  1AVS A;  2LLU A;  2WC5 A;  3KF9 A;  1L7Z A;  2F3Z A;  4A4C A;  1WDC C;  5PAL A;  4UPG A;  5KTY A;  3FIA A;  3LCP C;  2L51 A;  1R6P A;  1M31 A;  1X02 A;  4CFR A;  4YGD B;  1CLB A;  3EVR A;  4AOM A;  1CNP A;  1SL7 A;  5HKZ A;  2BAP A;  1BR1 B;  1LIN A;  3O78 A;  4GPL B;  2NCO A;  4PCW A;  4WQ3 A;  4TNC A;  3DVK A;  3WHU B;  3HX4 A;  1SY9 A;  2JXL A;  2KNE A;  4NDB A;  4MLW A;  4Q04 A;  1UHJ A;  1XO5 A;  2QPT A;  3RLZ A;  2LCP A;  3PAT A;  4YGB B;  3DZT A;  1B47 A;  1UP5 A;  4NDC A;  1PRW A;  2KDH A;  2KAX A;  4YI8 A;  2MA2 A;  4HSZ A;  5KSZ A;  1LA0 A;  3KO0 A;  3NGV A;  1TWO A;  2K8M B;  3BFH A;  1EXR A;  1K8U A;  3NSO A;  1ZOT B;  1WLM A;  2BKI B;  1K93 D;  4N1F A;  2ZNE A;  2KYF A;  1EG4 A;  3H4S E;  3JTD C;  3D76 A;  3EVV A;  1YTZ C;  5CPV A;  2KAV A;  2CNP A;  4MSP A;  3FS7 A;  4PT1 A;  1SK6 D;  2WCK A;  1G4Y R;  2CTN A;  1TCO B;  2HET A;  1SR6 B;  3DF0 A;  1A29 A;  3OX5 A;  3ZNI A;  3SG4 A;  2KLE A;  3DVM A;  2BE4 A;  3NHT A;  4ETO A;  1IQ3 A;  1OSA A;  1YUS A;  3F45 A;  1OW4 A;  2I18 A;  2K2F A;  3OP0 A;  3PN7 C;  5CSJ A;  4GAO A;  3I5F C;  3EK7 A;  1ALV A;  2O60 A;  4WRI A;  3AAK A;  4YBH B;  2LVJ A;  3I5H C;  2K61 A;  5AXI A;  3ZWH A;  1KK8 B;  1PVA A;  2JUL A;  4QJ3 B;  4DRW A;  1S5G Y;  1Y1U A;  4PHJ A;  1FI5 A;  1CLL A;  1QIV A;  2MRD A;  3LLE A;  5DKR A;  1S3P A;  1JBA A;  1IKU A;  1PUL A;  3SG6 A;  2LVI A;  2LUC A;  3PFV A;  2LMT A;  3SS5 A;  1OOG A;  1QTX A;  1D1O A;  1OZS A;  1TNP A;  1H8B A;  2KI6 D;  1IIO A;  1TNQ A;  2WCE A;  4D1E A;  5K89 A;  2M9G A;  1GJY A;  4XJK A;  1M45 A;  1KK7 Z;  2OTG C;  3VGO A;  1JF0 A;  3GOF A;  4PE7 A;  3OB2 B;  2ERB A;  2LLT A;  2AAO A;  3NSI A;  1MF8 B;  1NUB A;  3CS1 A;  4R1E A;  1ZAC A;  2FCE A;  1KWO C;  2LP2 A;  4JKT A;  1ODB A;  2EGD A;  2K60 A;  3L4A A;  1FPW A;  1CMF A;  2ISD A;  1XFW O;  1XFX O;  1M46 A;  3R1P A;  3RM1 A;  4BY4 A;  2Q91 A;  1BLQ A;  3QME A;  3NXA A;  1KFU S;  3CGA A;  1TTX A;  4XYN A;  4PE0 A;  3UO9 A;  5DKN A;  2KLD A;  1E8A A;  1G8I A;  1QLK A;  2BCB A;  2GGZ A;  2P6B B;  3CZ0 A;  2ZRS A;  3DF0 B;  1BG1 A;  1QAT A;  1F71 A;  3TUY B;  3FE8 A;  2M49 B;  2JT3 A;  5HKY A;  1DGU A;  1Q80 A;  1V1G A;  1WY9 A;  1YX7 A;  1Z4H A;  3B86 A;  3NSL A;  4BY5 A;  1UUS A;  5I94 A;  4USL A;  3LL8 B;  1DJG A;  1EL4 A;  2PAS A;  2KYC A;  2WCM A;  1QJT A;  1CDP A;  1SL8 A;  5HYD A;  2FCD A;  3IQQ A;  3SIA A;  1CFP A;  1TUZ A;  2NXQ A;  2WOS A;  2KQY A;  2PAL A;  2LV7 A;  4PHN A;  1XK4 C;  1Y6W A;  3WXA A;  1F70 A;  4YI9 A;  5I2O A;  2JT0 A;  3GK4 X;  2D8N A;  3SS3 A;  5AER A;  1QV1 A;  2SAS A;  2JT8 A;  3B7A A;  1BU3 A;  4F0Z B;  3EKH A;  1QX5 B;  2I94 A;  1B8L A;  4PE1 A;  2Y4Q A;  3WHT B;  1SYM A;  1WRZ A;  1TNW A;  2P71 A;  3C1V A;  3O4Y A;  1QX7 A;  4ORB B;  4QJ5 B;  2JTT A;  1DJI A;  2JPO A;  1N65 A;  1NX0 A;  2BCA A;  4YGA A;  3L47 A;  4ZCV A;  2FJU B;  2Y1M A;  2JQ6 A;  3I5G B;  3K21 A;  4I5L B;  3KEV A;  2YGU A;  3EK8 A;  2LC5 A;  1OQP A;  2JXC A;  4U8D A;  4GFT A;  2P70 A;  1KCY A;  3IQO A;  5AFP A;  1CFD A;  1B7T Y;  2PRU A;  1IJ6 A;  4OZD A;  3AAJ A;  4PAL A;  4FQT A;  2L0P A;  4GGF A;  2KFF A;  1CB1 A;  2G2B A;  1YR5 A;  1XA5 A;  1SW8 A;  1B8R A;  1HT9 A;  3SG5 A;  5D3O A;  1NIW A;  1CMG A;  3D78 A;  4E68 A;  2KGB C;  1J7R A;  2V53 A;  1DEK A;  2LAN A;  4CFQ A;  3BOW B;  1BOD A;  2CT9 A;  1J7Q A;  2HF5 A;  4N1G A;  4JPZ B;  2Q4U A;  3LK0 A;  5ER4 X;  1JC2 A;  1S6I A;  1XFZ O;  3KPX A;  2LLS A;  5F6T A;  2AUC A;  5G08 A;  4OR9 B;  3VRN A;  1JWD A;  1TRF A;  2BL0 B;  2WC8 A;  3CYZ A;  1QV0 A;  1F4O A;  4MRY A;  4DUQ A;  2L5Y A;  3CR5 X;  4OV2 A;  1ZFS A;  1BMO A;  3AKB A;  3D77 A;  3IVT A;  1TCF A;  2LHI A;  1F4Q A;  3OB1 B;  3BQ3 A;  1J1E A;  2RGI A;  3CTN A;  1YX8 A;  2LVK A;  1MQ1 A;  2KFG A;  2NLN A;  1DJH A;  3BFA A;  1F55 A;  1XFV O;  1SR6 C;  1IGV A;  4MZJ A;  1NCY A;  2OTG B;  5KU1 A;  1IQ5 A;  1FI6 A;  2MHH A;  2M1U A;  1W7J B;  1FBV A;  4DS7 A;  2B1U A;  3PSR A;  5FYX A;  2E30 A;  4XJK B;  1UHI A;  2WCL A;  2BBN A;  1CDL A;  1QWV A;  3S0B A;  1KWO B;  2JZI A;  2FJY A;  2PMY A;  2SCP A;  3BJH A;  4OKH A;  1TIZ A;  4INW A;  1JFK A;  1BOC A;  2BL0 C;  2GGM A;  4M2Q A;  1IG5 A;  1Y1A A;  2F2P A;  2K7B A;  1M63 B;  3A8R A;  2K2A A;  4ORC B;  4HRH A;  5I2Q A;  3AKA A;  1NSH A;  1WLZ A;  1SCM B;  2LUX A;  1IRJ A;  1RK9 A;  1SRA A;  3BUO B;  2IS9 A;  1AK8 A;  2LHL A;  3BUM B;  3CDN A;  1JSA A;  2GTE A;  2K7D A;  1CLM A;  1C3Y A;  1PSB A;  3KHE A;  1NPQ A;  2H8V A;  2QAC A;  4GGN A;  3SG3 A;  1YUR A;  1DEL A;  3GK1 A;  3D0Y B;  5I2L A;  1S26 D;  2JWW A;  3BOW A;  1C3Z A;  1RFJ A;  2WOR A;  5EL2 A;  2MLF C;  1LA3 A;  1KK8 C;  1UHK A;  2BCX A;  3EK4 A;  1B8C A;  2KI4 C;  5FI6 A;  1U5I A;  2JTZ A;  5FI2 A;  1B9A A;  1SPY A;  2M7L A;  1QAS A;  1XK4 A;  2QEB A;  1K90 D;  2Y5I A;  3FWB A;  3I5I C;  1QVI Z;  2Y1N A;  1K2H A;  4HRG A;  2NZ0 A;  2M0R A;  1BR4 B;  2CBL A;  2QEH A;  3GK2 A;  1KSO A;  3QRX A;  1YVH A;  5AAN A;  1REC A;  2JNF A;  1KFX L;  2MJW B;  1MHO A;  1MXL C;  1QVI Y;  1OOI X;  2CCM A;  2DOQ A;  2ZN9 A;  5CSN A;  3BFB A;  5D7F A;  4FTG A;  3SS4 A;  1KQM C;  1NX2 A;  1W7I B;  3EKJ A;  3DXL A;  4AQI A;  1KQV A;  1YRU B;  1CM4 A;  3TDU A;  1YRT B;  1JUO A;  1FF1 A;  3FWC A;  3IF7 A;  1RWY A;  2JOJ A;  1NX1 A;  2WCB A;  2O5G A;  1BJF A;  1DJY A;  1UWO A;  1DGV A;  2LMU A;  5CSF A;  1QS7 A;  1UUR A;  2BE6 A;  4INX A;  3K1E A;  1DC1 A;  4OCI A;  1MWN A;  2KAY A;  1R2U A;  5FI7 A;  1DVI A;  2KI4 B;  2MLE C;  3RZS A;  2M8U A;  3TS5 C;  1J7P A;  1T14 A;  3PM2 A;  2H61 A;  4GUK A;  2KGR A;  5ER5 A;  1NYA A;  1RJV A;  1Y1X A;  4YRU A;  1OOH A;  3BUN B;  1A75 A;  2R2I A;  3FE9 A;  3SG7 A;  1XFY O;  3O6B A;  4YGC B;  4JD9 A;  3DD4 A;  3NHI A;  3LK1 A;  1P28 A;  2KI6 C;  3TUY C;  3S0A A;  1RTP 1;  1SMG A;  5HLV A;  1SCM C;  2EHB A;  1NWD A;  2L2E A;  3I5G C;  1CM1 A;  3FE6 A;  5AEQ A;  2WND A;  2CXJ A;  3D0Y A;  3NSK A;  1CFC A;  1ORG A;  4ICB A;  1NCZ A;  1VRK A;  4NQG A;  2BKH B;  2QEO A;  1AP4 A;  1K96 A;  1S6C A;  5DKQ A;  3N7H A;  2LVV A;  2L4I A;  2QEV A;  5BPJ A;  5HLO A;  1MXE A;  1DJZ A;  4C0L A;  1BF5 A;  1K95 A;  2LM5 A;  1DF0 B;  1ZUZ A;  2LMV A;  1GM0 A;  1PK0 D;  3R1O A;  3CAB A;  1L2O C;  2F33 A;  4I5J A;  2KPH A;  2QDI A;  4KYN A;  3TS5 B;  3I5H B;  1FW4 A;  2ZRT A;  5I8N A;  2ZN8 A;  3D10 A;  2L98 A;  2OPO A;  2A4J A;  4L9M A;  4AQJ A;  3TDZ A;  1TUJ A;  1J1D A;  3BUX B;  1S5G Z;  3OGN A;  1EG3 A;  4MZK A;  1ZMZ A;  2WCF A;  4A4B A;  1OOJ A;  2OS8 B;  1YVL A;  1LVC D;  1TN4 A;  1EH2 A;  3CR2 A;  1KFX S;  1LS8 A;  1TNX A;  1W9Z A;  5B8I B;  1CDM A;  2L4H A;  3PM8 A;  4GGF C;  1AHR A;  1SL9 A;  1BT6 A;  1C7W A;  4QJ4 B;  2WCJ A;  4I5K A;  1XFR A;  1A4P A;  1DJW A;  1KK7 Y;  3TZ1 A;  1C07 A;  2KHN A;  1N0Y A;  1UHH A;  2EC6 B;  2KQ6 A;  3BXK A;  4C0K A;  2H61 C;  1V1F A;  1QX2 A;  3Q8I A;  3SG2 A;  1PVB A;  1PSR A;  3B6X A;  4WQ2 A;  2F3Y A;  2K7O A;  4YGE B;  1K9P A;  2BBM A;  2JNX A;  4DCK A;  5JJG A;  4CID A;  1S1E A;  1DT7 B;  1YUU A;  1U5I B;  1SKT A;  1TOP A;  1F8H A;  3DY9 A;  2KBI A;  1QLS A;  1WDC B;  1CFF A;  3B87 A;  5IBW A;  2HPS A;  1OMV A;  2LNK A;  3I5I B;  4PE4 A;  3TDI A;  2BEC A;  3O4X A;  4PHK A;  3S0F A;  3VRP A;  1QIW A;  3M0W A;  4ORA B;  1HQV A;  1IJ5 A;  1LKJ A;  2OS8 C;  1JF2 A;  1OZO A;  3OHM B;  1MUX A;  3PLF B;  3BUW B;  1IWQ A;  3S0E A;  1RRO A;  1N2D A;  1B7T Z;  1CTR A;  1XFU O;  1YUT A;  4M2O A;  1AUI B;  2HQ8 A;  3CWG A;  3O2P A;  3PN7 B;  3JVT C;  1A2X A;  1ALW A;  3JVT B;  1DJX A;  2M7N A;  1EJ3 A;  1AJ4 A;  4MRX A;  3R72 A;  5TNC A;  1S36 A;  3WNX B;  1DQE A;  4I5N B;  1XVJ A;  2AMI A;  1Y0V H;  2MAZ A;  1XYD A;  2MBX A;  1CKK A;  1UHN A;  3PAL A;  3V2L A;  1GGZ A;  1AJ5 A;  1OOF A;  2KFH A;  2PYQ A;  4JWQ A;  2COL B;  1SNL A;  3L4L A;  4PHM A;  1NX3 A;  4FQO A;  2ZKM X;  3A4U B;  1K9U A;  2JU0 A;  1M39 A;  4M2P A;  1IH0 A;  2TN4 A;  1KSM A;  3S0D A;  2L2C A;  2M1K B;  1F54 A;  4GNK B;  4P5O E;  3D75 A;  2WC6 A;  2KSP A;  3CZT X;  1G33 A;  2VRG A;  3JTD B;  2G9B A;  3VRQ A;  2ZFD A;  3EG5 B;  2I7A A;  3HCM A;  1C7V A;  4IL1 A;  4CLN A;  2JC2 A;  1K9K A;  1A75 B;  4N5X A;  3ICB A;  3D73 A;  2ZND A;  1WRK A;  2PSR A;  1SBJ A;  2JRF A;  3CLN A;  4C0J A;  2LP3 A;  3DVJ A;  3B88 A;  3S0G A;  1PAL A;  2PQL A;  2WCH A;  1SSE B;  1SCV A;  3SIB A;  1NP8 A;  1J55 A;  3EVU A;  2M3W A;  2LAP A;  3UNW A;  3VRR A;  4CPV A;  4P2Y B;  1KFU L;  3D74 A;  3E3R A;  1A03 A;  2E6W A;  4ZCU A;  1MR8 A;  1B4C A;  2BNX A;  2KOT A;  2JPT A;  2K7C A;  4MVF A;  3OBV A;  3PJI A;  5CSI A;  1CDN A;  2M29 A;  1H4B A;  3MSE B;  1B1G A;  1WRL A;  1QXP A;  2I2R E;  4OVN F;  1JFJ A;  1J7O A;  1KQM B;  2F8P A;  1LXF C;  2L50 A;  3BYA A;  2KBM A;  5DIC A;  1OMR A;  2F2O A;  5GQQ C;  4DIR A;  5HKW A;  5HL1 A;  3DYE A;  5D69 A;  1DMO A;  2PVB A;  1DTL A;  2EC6 C;  4MBE A;  3SJS A;  1S6J A;  2M97 A;  1OE9 B;  3DVE A;  4JQ0 D;  2HQW A;  4MEW A;  1OMD A;  2NCP A;  4PDZ A;  3VRO A;  1K94 A;  3OX6 A;  4MZL A;  3CR4 X;  4NDD A;  2H2K A;  3I5F B;  2L5X B;  3R1V A;  1L2O B;  3VB1 A;  1Z2C B;  3CZ1 A;  2GV5 A;  1NCX A;  4GBA A;  1GGW A;  5J3X A;  4F7F A;  4MN0 A; 
#chains in the Genus database with same CATH homology
 3CZ2 A;  2H8V A;  3CZ0 A;  2WC5 A;  5EL2 A;  1C3Z A;  3FE8 A;  3DY9 A;  3B86 A;  3B87 A;  3S0F A;  2QEB A;  2WCM A;  2QEH A;  3S0E A;  1OOI X;  3BFB A;  3B7A A;  3DXL A;  2P71 A;  3DZT A;  3R72 A;  1DQE A;  2JPO A;  3L47 A;  3V2L A;  3NGV A;  1OOF A;  1TWO A;  3L4L A;  3BFH A;  4INX A;  3K1E A;  2P70 A;  4OZD A;  4FQT A;  3D76 A;  3S0D A;  2L2C A;  3RZS A;  1T14 A;  4PT1 A;  2WCK A;  3D75 A;  3D78 A;  2WC6 A;  1OOH A;  3FE9 A;  4JD9 A;  3NHI A;  3NHT A;  1P28 A;  1OW4 A;  3S0A A;  3D73 A;  3FE6 A;  3S0G A;  3B88 A;  3CYZ A;  2PQL A;  2WCH A;  1ORG A;  2QEO A;  3D77 A;  3N7H A;  2QEV A;  3D74 A;  3BFA A;  3PJI A;  1GM0 A;  3R1O A;  3CAB A;  1OOG A;  2KPH A;  2QDI A;  2ERB A;  5DIC A;  1TUJ A;  2WCL A;  3OGN A;  1QWV A;  3DYE A;  3S0B A;  2FJY A;  3BJH A;  4INW A;  3L4A A;  1LS8 A;  3R1P A;  2WCJ A;  1XFR A;  3QME A;  3R1V A;  3VB1 A;  3CZ1 A;  3Q8I A;  3CDN A;  2GTE A;  1C3Y A;  4F7F A;  3B6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...