3D77A

Crystal structure of a pheromone binding protein mutant d35n, from apis mellifera, soaked at ph 4.0
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
116
structure length
116
Chain Sequence
b'WVPPEVFDLVAEDKARCMSEHGTTQAQIDDVNKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone-binding protein ASP1
publication title Queen bee pheromone binding protein pH-induced domain swapping favors pheromone release
pubmed doi rcsb
source organism Apis mellifera
molecule tags Pheromone binding protein
total genus 45
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3d77A00
3CABA 2QEBA 1DQEA 1LS8A 2WC6A 3S0GA 3CDNA 4INWA 4JD9A 3B88A 1OOIX 5EL2A 1C3ZA 3Q8IA 1OOFA 3D78A 1OW4A 3D75A 1OOGA 3D74A 2PQLA 3CZ0A 3VB1A 2WC5A 3NHTA 3L4AA 2FJYA 3R72A 3S0FA 2KPHA 3CZ2A 2GTEA 3D77A 3D76A 3DY9A 3S0BA 3D73A 5DICA 1ORGA 2P71A 3S0AA 2JPOA 1TWOA 3B86A 3DYEA 3R1VA 2WCLA 2QEVA 3QMEA 3BFBA 3B6XA 3S0DA 4INXA 3PJIA 3L47A 3DZTA 1C3YA 2ERBA 3B7AA 2WCMA 3CZ1A 1XFRA 1T14A 1QWVA 3V2LA 1GM0A 1TUJA 3NHIA 2QEHA 3FE9A 3R1OA 2L2CA 3L4LA 4FQTA 3CYZA 3BFHA 4OZDA 1P28A 3NGVA 3BFAA 3DXLA 2QDIA 3OGNA 2P70A 2QEOA 3S0EA 2WCHA 2WCJA 4PT1A 3N7HA 1OOHA 3FE8A 2H8VA 3K1EA 3RZSA 3B87A 3BJHA 3FE6A 4F7FA 3R1PA 2WCKA
chains in the Genus database with same CATH superfamily
1K93D 2K0JA 3EK4A 1CDMA 1QATA 1LS8A 2P6BB 4I5LB 2SCPA 1TNQA 5CSJA 2JTTA 4BY4A 2FJUB 5D7FA 2KBIA 2ZN8A 4OR9B 2KNEA 1BLQA 1OOIX 1NIWA 3BQ3A 1C3ZA 2CNPA 3Q8IA 1PSBA 3NSOA 1SPYA 1Y0VH 2MLEC 1MHOA 1IQ5A 2I18A 2L5XB 2BL0C 1JFJA 1KFXS 5K89A 1QVIY 4CFRA 1UHNA 1Z4HA 1V1FA 1NWDA 1K9UA 2LUXA 1J1DA 1MR8A 3CZ0A 1JC2A 2F33A 3OHMB 1S5GZ 2BL0B 2CT9A 3WNXB 1MF8B 2M9GA 1TCOB 2M49B 3S0FA 2AMIA 4GNKB 1PVAA 3CZ2A 1WRLA 3D77A 1JUOA 5CSFA 1SY9A 3BUMB 3S0BA 2LC5A 1YVLA 1DJGA 2LANA 2L50A 2P71A 3TUYC 1K2HA 4YI8A 4C0JA 2ZRSA 1S5GY 1NCYA 1N65A 3CZTX 3VGOA 2LMTA 1OSAA 3QMEA 4WRIA 3AKAA 3CS1A 1CLBA 2CXJA 2K7BA 3CR5X 1BR4B 4INXA 3SG2A 3TDIA 1WLZA 3LK0A 3WXAA 1PVBA 1YUUA 1TRFA 1Y6WA 4KYNA 3EK7A 1Y1UA 4MRXA 1Y1AA 1ZFSA 2L0PA 1R6PA 1SYMA 1F4QA 1KQMC 2E30A 2WCFA 3B7AA 5FYXA 4PALA 1BODA 1BOCA 1MQ1A 1QX7A 1T14A 1FI6A 1UHHA 1LXFC 1KQMB 1S6IA 1TUZA 1Z2CB 1WDCC 5J3XA 1G8IA 1DF0B 1H8BA 1QXPA 1GM0A 1RWYA 4A4BA 3NHIA 2JNXA 2OTGC 2QEHA 4MEWA 3VRRA 1C07A 2BCBA 4FTGA 1CKKA 4OCIA 1MXLC 4FQTA 4MZLA 1BG1A 1WDCB 2ZKMX 1U5IB 1CNPA 3PM8A 3VRQA 1AK8A 2K2FA 1EH2A 3JTDC 3DXLA 2KI4B 1EL4A 5AXIA 2LLSA 4ZCVA 2QDIA 3LL8B 4NQGA 1KWOB 3PATA 1YURA 2PRUA 3PN7C 3WHTB 3JTDB 4PE0A 4PHMA 2KI6C 1BJFA 1B1GA 2F3YA 2K2AA 3BYAA 1B8RA 2AUCA 1BU3A 3PM2A 1WRZA 1B7TZ 3FE8A 4GFTA 1KCYA 3O4XA 3CTNA 1FBVA 4PHNA 1J55A 1ZUZA 3TDUA 2TN4A 1OZSA 1YX7A 1GGWA 2HQ8A 2BKHB 3NSIA 2KDHA 2MLFC 5I2LA 3EVUA 1GQMA 1V1GA 4DCKA 1KFUS 3ZNIA 2KOTA 1ZACA 3PSRA 1DTLA 4NDDA 1KFUL 5DKRA 2WCKA 3KF9A 3EKHA 1DJYA 1XFWO 2M8UA 1B8LA 1DQEA 4NDBA 2LVIA 3NSKA 2JNFA 3OB2B 3D0YB 5JOLA 3CR4X 3BUOB 5CPVA 1JFKA 2KYFA 1B7TY 1OZOA 1IJ5A 4C0KA 1SCVA 3D10A 5FI2A 2PSRA 1YR5A 1GJYA 2MJWB 3EG5B 3TZ1A 2MA2A 1A75A 4AQJA 3BUXB 1K9KA 2JTZA 2HF5A 1IIOA 2OPOA 1SL9A 1OOGA 1D1OA 1LKJA 3SIAA 4MZKA 4P2YB 1F4OA 4GGFA 2MAZA 2LMUA 4CLNA 2LLTA 2LNKA 3NHTA 1WRKA 1CLMA 4A4CA 1DJWA 1HT9A 4WQ2A 2I2RE 4AQIA 2BECA 2PASA 3IQQA 5IBWA 2GTEA 2WC8A 3D76A 3LK1A 5KTYA 2F3ZA 4Q04A 3D73A 2WOSA 2KHNA 1K8UA 1QTXA 1KK7Y 1UWOA 2JPOA 4HRHA 4NDCA 3SIBA 3B86A 1XYDA 3I5IC 1DT7B 3IQOA 3R1VA 4USLA 1MWNA 1RFJA 1QV0A 2H61C 2NLNA 3AAJA 2QACA 3OB1B 1FI5A 4M2OA 1KFXL 1IWQA 3OX5A 2LLUA 1RTP1 3FIAA 3L47A 3I5IB 1DVIA 2L5YA 2NCPA 1QASA 5AANA 3VRPA 3DVKA 1QLSA 1EXRA 2ERBA 2G2BA 1S6CA 3AAKA 3SJSA 1Y1XA 1TCFA 2G9BA 1K95A 4R1EA 2KAVA 1J7RA 1E8AA 1TN4A 2HQWA 3BOWA 1KQVA 1KK8C 3CZ1A 4HREE 2L51A 5CSIA 1XFYO 1IJ6A 2F2PA 4YBHB 2JWWA 3SS4A 2KLEA 3EVVA 4PHJA 1W7JB 2WNDA 1YRUB 2BKIB 1XK4C 5CSNA 3H4SE 1KK8B 1J1EA 2F8PA 1CTRA 1K90D 1SRAA 3IF7A 1OQPA 3R1OA 4QJ5B 3CYZA 1IH0A 4OZDA 2M1KB 4YI9A 3EVRA 1SW8A 1YUSA 2JZIA 5KSZA 5AFPA 1LVCD 3PALA 3VRNA 2BBMA 1YRTB 1CFDA 2AAOA 1S36A 1S3PA 2LVVA 1X02A 1NCZA 3E3RA 3FWCA 2QEOA 3O6BA 1IQ3A 3O78A 1SK6D 2PVBA 2I94A 1S26D 1G4YR 5B8IB 2WCEA 2KGBC 4XJKB 3N7HA 5I94A 1CFFA 2YGUA 4JPZB 3BUWB 2L4HA 1AVSA 1UP5A 2L2EA 5I2QA 2KI4C 2M7LA 3AKBA 2KGRA 5FI7A 3B87A 2KQ6A 1DMOA 3DF0A 2JRFA 2KFFA 4N5XA 1KWOC 3NXAA 1CDLA 2OS8C 2F2OA 2COLB 1R2UA 2BAPA 3CABA 2QEBA 1DJZA 1QJTA 4MSPA 2B1UA 2WC6A 1BMOA 1TTXA 2Y1NA 3IVTA 1WY9A 2OS8B 1IRJA 4IJ7A 1CMFA 4INWA 1LA0A 3SS5A 5DKNA 1F8HA 1SSEB 1RK9A 1L2OC 2FCDA 1SCMC 1NX2A 1B4CA 3K21A 5EL2A 1DJXA 3SG5A 1G33A 5HYDA 3HX4A 1AUIB 2SASA 3D78A 1TNXA 1PALA 3NSLA 4DUQA 3CR2A 1SKTA 1XFXO 1L2OB 1OW4A 1SCMB 1XO5A 1KSMA 4YGAA 1N2DA 1NX0A 3WHUB 1LINA 1XVJA 4P5OE 1TIZA 2ZNDA 1M46A 2WC5A 4GBAA 1NYAA 1GGZA 1NPQA 3DVJA 2KLDA 3L4AA 4YGCB 4CFQA 1AHRA 1YVHA 2FJYA 2ISDA 1XFZO 3R72A 4GGNA 2JOJA 3UNWA 4I5NB 1JSAA 2JXCA 3CWGA 2R2IA 3I5FB 2LP3A 1TOPA 1OMDA 5PALA 1JF0A 3LLEA 2KI6D 3DY9A 1CFPA 3ZWHA 2NZ0A 3TUYB 2H2KA 3BXKA 2A4JA 4IL1A 4OV2A 2NXQA 1N0YA 3KO0A 4N1GA 1CDPA 2Y5IA 2PALA 3S0AA 2PYQA 1ZMZA 1A29A 1XK4A 2CTNA 1DEKA 2WCLA 5HKZA 1DJIA 2BBNA 4JKTA 5D69A 1J7QA 3B6XA 3S0DA 5BPJA 1NUBA 1MXEA 1QLKA 3PJIA 2EHBA 2ZRTA 1OE9B 3UO9A 3LCPC 5HLVA 1SMGA 2GGMA 2KAYA 1C3YA 3GK4X 4MBEA 3M0WA 3A4UB 1NCXA 2JPTA 2DOQA 3GK1A 4U8DA 2LAPA 3OP0A 5TNCA 2KAXA 2K7CA 4YGEB 5I2OA 1DF0A 1UUSA 1CFCA 1QWVA 1CM1A 3V2LA 2M1UA 2Y1MA 1DJHA 4ORBB 5D3OA 4ZCUA 1C7VA 1U5IA 2M29A 5I8NA 1TNWA 3L4LA 1FW4A 4ICBA 2K7DA 1RJVA 1SL8A 5F6TA 1FPWA 4DRWA 3BFHA 2LVKA 4WQ3A 3SG3A 1K96A 1S1EA 2M3WA 2PMYA 3BFAA 3DF0B 2WCBA 3FWBA 1IKUA 1LA3A 1NP8A 1UHIA 1YUTA 2JULA 1M31A 1IGVA 1XFUO 1XFVO 3F45A 3FS7A 4GPLB 1EG3A 4PE4A 1OOJA 1BR1B 4N1FA 2EC6C 2EGDA 2WCHA 1AP4A 4PT1A 1ALWA 2O5GA 3DD4A 4BY5A 3EKJA 2GGZA 1PRWA 2FCEA 2JU0A 2LVJA 1NX3A 2EC6B 1M45A 3CGAA 2Q4UA 3PLFB 3RZSA 3CLNA 3QRXA 1NX1A 1B47A 1F55A 1JF2A 3A8RA 3FE6A 4F7FA 1ODBA 3R1PA 5G08A 5FI6A 3HCMA 2D8NA 4XYNA 3D0YA 1PULA 1YX8A 4JQ0D 3S0GA 2KBMA 1DC1A 2JT8A 2KSPA 3CDNA 2ZFDA 4JD9A 4QJ3B 4ETOA 1JBAA 1FF1A 5GQQC 3SG4A 3B88A 2V53A 4ORAB 1B8CA 1W7IB 1HQVA 1J7PA 1SR6C 1F54A 1OOFA 2KFHA 4HRGA 4JWQA 2LUCA 2RGIA 1DELA 2E6WA 3I5GC 1DGVA 2L98A 1QIWA 3VROA 3D75A 2GV5A 1DGUA 1K94A 1PK0D 1W9ZA 2JQ6A 4GGFC 1A75B 3TS5C 3D74A 4OVNF 2PQLA 1SR6B 4L9MA 2JT3A 1UURA 2LHIA 4PCWA 4YGDB 3SS3A 3VB1A 3KHEA 1SL7A 3I5GB 1RECA 1B9AA 1ZOTB 5ER4X 4FQOA 5HLOA 2WORA 3TS5B 4I5KA 2BE4A 1QIVA 2JT0A 2QPTA 3DVMA 1BT6A 3GOFA 2KPHA 1NSHA 1VRKA 2L4IA 2BCAA 3RM1A 2I7AA 2IS9A 2VRGA 2LP2A 4D1EA 3JVTC 2JC2A 2K7OA 4OKHA 1QX5B 1SBJA 3KEVA 2LV7A 5HKWA 5DICA 1ORGA 1Q80A 2MBXA 1TWOA 3O4YA 3DYEA 1AJ5A 1OMVA 2BNXA 2O60A 2QEVA 3JVTB 5HL1A 2LM5A 1A4PA 3OX6A 3BFBA 1QV1A 2K8MB 2H61A 2Y4QA 4UPGA 2OTGB 1CMGA 2JXLA 1J7OA 3DZTA 3I5FC 2K60A 1IG5A 2KYCA 4YRUA 3GK2A 3MSEB 3TDZA 4PE1A 3SG7A 2WCMA 1K9PA 1EJ3A 4MVFA 1ALVA 2ZNEA 2BE6A 1XFRA 3BOWB 3C1VA 1CB1A 2CCMA 3DVEA 5DKQA 3PN7B 1PSRA 1CLLA 3O2PA 4ORCB 5AERA 4M2PA 1EG4A 5HKYA 1YTZC 1A2XA 1TUJA 3FE9A 2LHLA 4QJ4B 1L7ZA 1CDNA 2L2CA 1OMRA 4M2QA 4CIDA 5JJGA 1F70A 1JWDA 3I5HC 2MRDA 4I5JA 1H4BA 3OBVA 1P28A 4MRYA 1M39A 2ZN9A 3NGVA 4PDZA 4GAOA 4HSZA 1TNPA 1C7WA 2HETA 2LMVA 4TNCA 1BF5A 3I5HB 3EK8A 1XA5A 2KQYA 1QX2A 3OGNA 4PE7A 2P70A 5ER5A 2M0RA 1MUXA 5AEQA 4MN0A 4MLWA 3S0EA 2WCJA 2KFGA 4XJKA 1A03A 1KSOA 1M63B 4PHKA 4DS7A 4E68A 1UHJA 2Q91A 4DIRA 2FOTA 2NCOA 2CBLA 2LCPA 1AJ4A 1OOHA 3KPXA 4F0ZB 5KU1A 4AOMA 2M7NA 3BUNB 2H8VA 3K1EA 3PFVA 3ICBA 1KK7Z 2K61A 2BCXA 1QS7A 4CPVA 3SG6A 1RROA 1CM4A 1F71A 2HPSA 3BJHA 3RLZA 2LE9B 4C0LA 1S6JA 2M97A 2MHHA 4MZJA 1QVIZ 4GUKA 1WLMA 1UHKA 4YGBB 1SNLA
chains in the Genus database with same CATH topology
3CABA 2QEBA 1DQEA 1LS8A 2WC6A 3S0GA 3CDNA 4INWA 4JD9A 3B88A 1OOIX 5EL2A 1C3ZA 3Q8IA 1OOFA 3D78A 1OW4A 3D75A 1OOGA 3D74A 2PQLA 3CZ0A 3VB1A 2WC5A 3NHTA 3L4AA 2FJYA 3R72A 3S0FA 2KPHA 3CZ2A 2GTEA 3D77A 3D76A 3DY9A 3S0BA 3D73A 5DICA 1ORGA 2P71A 3S0AA 2JPOA 1TWOA 3B86A 3DYEA 3R1VA 2WCLA 2QEVA 3QMEA 3BFBA 3B6XA 3S0DA 4INXA 3PJIA 3L47A 3DZTA 1C3YA 2ERBA 3B7AA 2WCMA 3CZ1A 1XFRA 1T14A 1QWVA 3V2LA 1GM0A 1TUJA 3NHIA 2QEHA 3FE9A 3R1OA 2L2CA 3L4LA 4FQTA 3CYZA 3BFHA 4OZDA 1P28A 3NGVA 3BFAA 3DXLA 2QDIA 3OGNA 2P70A 2QEOA 3S0EA 2WCHA 2WCJA 4PT1A 3N7HA 1OOHA 3FE8A 2H8VA 3K1EA 3RZSA 3B87A 3BJHA 3FE6A 4F7FA 3R1PA 2WCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CAB A;  2QEB A;  1DQE A;  1LS8 A;  2WC6 A;  3S0G A;  3CDN A;  4INW A;  4JD9 A;  3B88 A;  1OOI X;  5EL2 A;  1C3Z A;  3Q8I A;  1OOF A;  3D78 A;  1OW4 A;  3D75 A;  1OOG A;  3D74 A;  2PQL A;  3CZ0 A;  3VB1 A;  2WC5 A;  3NHT A;  3L4A A;  2FJY A;  3R72 A;  3S0F A;  2KPH A;  3CZ2 A;  2GTE A;  3D77 A;  3D76 A;  3DY9 A;  3S0B A;  3D73 A;  5DIC A;  1ORG A;  2P71 A;  3S0A A;  2JPO A;  1TWO A;  3B86 A;  3DYE A;  3R1V A;  2WCL A;  2QEV A;  3QME A;  3BFB A;  3B6X A;  3S0D A;  4INX A;  3PJI A;  3L47 A;  3DZT A;  1C3Y A;  2ERB A;  3B7A A;  2WCM A;  3CZ1 A;  1XFR A;  1T14 A;  1QWV A;  3V2L A;  1GM0 A;  1TUJ A;  3NHI A;  2QEH A;  3FE9 A;  3R1O A;  2L2C A;  3L4L A;  4FQT A;  3CYZ A;  3BFH A;  4OZD A;  1P28 A;  3NGV A;  3BFA A;  3DXL A;  2QDI A;  3OGN A;  2P70 A;  2QEO A;  3S0E A;  2WCH A;  2WCJ A;  4PT1 A;  3N7H A;  1OOH A;  3FE8 A;  2H8V A;  3K1E A;  3RZS A;  3B87 A;  3BJH A;  3FE6 A;  4F7F A;  3R1P A;  2WCK A; 
#chains in the Genus database with same CATH topology
 1K93 D;  2K0J A;  3EK4 A;  1CDM A;  1QAT A;  1LS8 A;  2P6B B;  4I5L B;  2SCP A;  1TNQ A;  5CSJ A;  2JTT A;  4BY4 A;  2FJU B;  5D7F A;  2KBI A;  2ZN8 A;  4OR9 B;  2KNE A;  1BLQ A;  1OOI X;  1NIW A;  3BQ3 A;  1C3Z A;  2CNP A;  3Q8I A;  1PSB A;  3NSO A;  1SPY A;  1Y0V H;  2MLE C;  1MHO A;  1IQ5 A;  2I18 A;  2L5X B;  2BL0 C;  1JFJ A;  1KFX S;  5K89 A;  1QVI Y;  4CFR A;  1UHN A;  1Z4H A;  1V1F A;  1NWD A;  1K9U A;  2LUX A;  1J1D A;  1MR8 A;  3CZ0 A;  1JC2 A;  2F33 A;  3OHM B;  1S5G Z;  2BL0 B;  2CT9 A;  3WNX B;  1MF8 B;  2M9G A;  1TCO B;  2M49 B;  3S0F A;  2AMI A;  4GNK B;  1PVA A;  3CZ2 A;  1WRL A;  3D77 A;  1JUO A;  5CSF A;  1SY9 A;  3BUM B;  3S0B A;  2LC5 A;  1YVL A;  1DJG A;  2LAN A;  2L50 A;  2P71 A;  3TUY C;  1K2H A;  4YI8 A;  4C0J A;  2ZRS A;  1S5G Y;  1NCY A;  1N65 A;  3CZT X;  3VGO A;  2LMT A;  1OSA A;  3QME A;  4WRI A;  3AKA A;  3CS1 A;  1CLB A;  2CXJ A;  2K7B A;  3CR5 X;  1BR4 B;  4INX A;  3SG2 A;  3TDI A;  1WLZ A;  3LK0 A;  3WXA A;  1PVB A;  1YUU A;  1TRF A;  1Y6W A;  4KYN A;  3EK7 A;  1Y1U A;  4MRX A;  1Y1A A;  1ZFS A;  2L0P A;  1R6P A;  1SYM A;  1F4Q A;  1KQM C;  2E30 A;  2WCF A;  3B7A A;  5FYX A;  4PAL A;  1BOD A;  1BOC A;  1MQ1 A;  1QX7 A;  1T14 A;  1FI6 A;  1UHH A;  1LXF C;  1KQM B;  1S6I A;  1TUZ A;  1Z2C B;  1WDC C;  5J3X A;  1G8I A;  1DF0 B;  1H8B A;  1QXP A;  1GM0 A;  1RWY A;  4A4B A;  3NHI A;  2JNX A;  2OTG C;  2QEH A;  4MEW A;  3VRR A;  1C07 A;  2BCB A;  4FTG A;  1CKK A;  4OCI A;  1MXL C;  4FQT A;  4MZL A;  1BG1 A;  1WDC B;  2ZKM X;  1U5I B;  1CNP A;  3PM8 A;  3VRQ A;  1AK8 A;  2K2F A;  1EH2 A;  3JTD C;  3DXL A;  2KI4 B;  1EL4 A;  5AXI A;  2LLS A;  4ZCV A;  2QDI A;  3LL8 B;  4NQG A;  1KWO B;  3PAT A;  1YUR A;  2PRU A;  3PN7 C;  3WHT B;  3JTD B;  4PE0 A;  4PHM A;  2KI6 C;  1BJF A;  1B1G A;  2F3Y A;  2K2A A;  3BYA A;  1B8R A;  2AUC A;  1BU3 A;  3PM2 A;  1WRZ A;  1B7T Z;  3FE8 A;  4GFT A;  1KCY A;  3O4X A;  3CTN A;  1FBV A;  4PHN A;  1J55 A;  1ZUZ A;  3TDU A;  2TN4 A;  1OZS A;  1YX7 A;  1GGW A;  2HQ8 A;  2BKH B;  3NSI A;  2KDH A;  2MLF C;  5I2L A;  3EVU A;  1GQM A;  1V1G A;  4DCK A;  1KFU S;  3ZNI A;  2KOT A;  1ZAC A;  3PSR A;  1DTL A;  4NDD A;  1KFU L;  5DKR A;  2WCK A;  3KF9 A;  3EKH A;  1DJY A;  1XFW O;  2M8U A;  1B8L A;  1DQE A;  4NDB A;  2LVI A;  3NSK A;  2JNF A;  3OB2 B;  3D0Y B;  5JOL A;  3CR4 X;  3BUO B;  5CPV A;  1JFK A;  2KYF A;  1B7T Y;  1OZO A;  1IJ5 A;  4C0K A;  1SCV A;  3D10 A;  5FI2 A;  2PSR A;  1YR5 A;  1GJY A;  2MJW B;  3EG5 B;  3TZ1 A;  2MA2 A;  1A75 A;  4AQJ A;  3BUX B;  1K9K A;  2JTZ A;  2HF5 A;  1IIO A;  2OPO A;  1SL9 A;  1OOG A;  1D1O A;  1LKJ A;  3SIA A;  4MZK A;  4P2Y B;  1F4O A;  4GGF A;  2MAZ A;  2LMU A;  4CLN A;  2LLT A;  2LNK A;  3NHT A;  1WRK A;  1CLM A;  4A4C A;  1DJW A;  1HT9 A;  4WQ2 A;  2I2R E;  4AQI A;  2BEC A;  2PAS A;  3IQQ A;  5IBW A;  2GTE A;  2WC8 A;  3D76 A;  3LK1 A;  5KTY A;  2F3Z A;  4Q04 A;  3D73 A;  2WOS A;  2KHN A;  1K8U A;  1QTX A;  1KK7 Y;  1UWO A;  2JPO A;  4HRH A;  4NDC A;  3SIB A;  3B86 A;  1XYD A;  3I5I C;  1DT7 B;  3IQO A;  3R1V A;  4USL A;  1MWN A;  1RFJ A;  1QV0 A;  2H61 C;  2NLN A;  3AAJ A;  2QAC A;  3OB1 B;  1FI5 A;  4M2O A;  1KFX L;  1IWQ A;  3OX5 A;  2LLU A;  1RTP 1;  3FIA A;  3L47 A;  3I5I B;  1DVI A;  2L5Y A;  2NCP A;  1QAS A;  5AAN A;  3VRP A;  3DVK A;  1QLS A;  1EXR A;  2ERB A;  2G2B A;  1S6C A;  3AAK A;  3SJS A;  1Y1X A;  1TCF A;  2G9B A;  1K95 A;  4R1E A;  2KAV A;  1J7R A;  1E8A A;  1TN4 A;  2HQW A;  3BOW A;  1KQV A;  1KK8 C;  3CZ1 A;  4HRE E;  2L51 A;  5CSI A;  1XFY O;  1IJ6 A;  2F2P A;  4YBH B;  2JWW A;  3SS4 A;  2KLE A;  3EVV A;  4PHJ A;  1W7J B;  2WND A;  1YRU B;  2BKI B;  1XK4 C;  5CSN A;  3H4S E;  1KK8 B;  1J1E A;  2F8P A;  1CTR A;  1K90 D;  1SRA A;  3IF7 A;  1OQP A;  3R1O A;  4QJ5 B;  3CYZ A;  1IH0 A;  4OZD A;  2M1K B;  4YI9 A;  3EVR A;  1SW8 A;  1YUS A;  2JZI A;  5KSZ A;  5AFP A;  1LVC D;  3PAL A;  3VRN A;  2BBM A;  1YRT B;  1CFD A;  2AAO A;  1S36 A;  1S3P A;  2LVV A;  1X02 A;  1NCZ A;  3E3R A;  3FWC A;  2QEO A;  3O6B A;  1IQ3 A;  3O78 A;  1SK6 D;  2PVB A;  2I94 A;  1S26 D;  1G4Y R;  5B8I B;  2WCE A;  2KGB C;  4XJK B;  3N7H A;  5I94 A;  1CFF A;  2YGU A;  4JPZ B;  3BUW B;  2L4H A;  1AVS A;  1UP5 A;  2L2E A;  5I2Q A;  2KI4 C;  2M7L A;  3AKB A;  2KGR A;  5FI7 A;  3B87 A;  2KQ6 A;  1DMO A;  3DF0 A;  2JRF A;  2KFF A;  4N5X A;  1KWO C;  3NXA A;  1CDL A;  2OS8 C;  2F2O A;  2COL B;  1R2U A;  2BAP A;  3CAB A;  2QEB A;  1DJZ A;  1QJT A;  4MSP A;  2B1U A;  2WC6 A;  1BMO A;  1TTX A;  2Y1N A;  3IVT A;  1WY9 A;  2OS8 B;  1IRJ A;  4IJ7 A;  1CMF A;  4INW A;  1LA0 A;  3SS5 A;  5DKN A;  1F8H A;  1SSE B;  1RK9 A;  1L2O C;  2FCD A;  1SCM C;  1NX2 A;  1B4C A;  3K21 A;  5EL2 A;  1DJX A;  3SG5 A;  1G33 A;  5HYD A;  3HX4 A;  1AUI B;  2SAS A;  3D78 A;  1TNX A;  1PAL A;  3NSL A;  4DUQ A;  3CR2 A;  1SKT A;  1XFX O;  1L2O B;  1OW4 A;  1SCM B;  1XO5 A;  1KSM A;  4YGA A;  1N2D A;  1NX0 A;  3WHU B;  1LIN A;  1XVJ A;  4P5O E;  1TIZ A;  2ZND A;  1M46 A;  2WC5 A;  4GBA A;  1NYA A;  1GGZ A;  1NPQ A;  3DVJ A;  2KLD A;  3L4A A;  4YGC B;  4CFQ A;  1AHR A;  1YVH A;  2FJY A;  2ISD A;  1XFZ O;  3R72 A;  4GGN A;  2JOJ A;  3UNW A;  4I5N B;  1JSA A;  2JXC A;  3CWG A;  2R2I A;  3I5F B;  2LP3 A;  1TOP A;  1OMD A;  5PAL A;  1JF0 A;  3LLE A;  2KI6 D;  3DY9 A;  1CFP A;  3ZWH A;  2NZ0 A;  3TUY B;  2H2K A;  3BXK A;  2A4J A;  4IL1 A;  4OV2 A;  2NXQ A;  1N0Y A;  3KO0 A;  4N1G A;  1CDP A;  2Y5I A;  2PAL A;  3S0A A;  2PYQ A;  1ZMZ A;  1A29 A;  1XK4 A;  2CTN A;  1DEK A;  2WCL A;  5HKZ A;  1DJI A;  2BBN A;  4JKT A;  5D69 A;  1J7Q A;  3B6X A;  3S0D A;  5BPJ A;  1NUB A;  1MXE A;  1QLK A;  3PJI A;  2EHB A;  2ZRT A;  1OE9 B;  3UO9 A;  3LCP C;  5HLV A;  1SMG A;  2GGM A;  2KAY A;  1C3Y A;  3GK4 X;  4MBE A;  3M0W A;  3A4U B;  1NCX A;  2JPT A;  2DOQ A;  3GK1 A;  4U8D A;  2LAP A;  3OP0 A;  5TNC A;  2KAX A;  2K7C A;  4YGE B;  5I2O A;  1DF0 A;  1UUS A;  1CFC A;  1QWV A;  1CM1 A;  3V2L A;  2M1U A;  2Y1M A;  1DJH A;  4ORB B;  5D3O A;  4ZCU A;  1C7V A;  1U5I A;  2M29 A;  5I8N A;  1TNW A;  3L4L A;  1FW4 A;  4ICB A;  2K7D A;  1RJV A;  1SL8 A;  5F6T A;  1FPW A;  4DRW A;  3BFH A;  2LVK A;  4WQ3 A;  3SG3 A;  1K96 A;  1S1E A;  2M3W A;  2PMY A;  3BFA A;  3DF0 B;  2WCB A;  3FWB A;  1IKU A;  1LA3 A;  1NP8 A;  1UHI A;  1YUT A;  2JUL A;  1M31 A;  1IGV A;  1XFU O;  1XFV O;  3F45 A;  3FS7 A;  4GPL B;  1EG3 A;  4PE4 A;  1OOJ A;  1BR1 B;  4N1F A;  2EC6 C;  2EGD A;  2WCH A;  1AP4 A;  4PT1 A;  1ALW A;  2O5G A;  3DD4 A;  4BY5 A;  3EKJ A;  2GGZ A;  1PRW A;  2FCE A;  2JU0 A;  2LVJ A;  1NX3 A;  2EC6 B;  1M45 A;  3CGA A;  2Q4U A;  3PLF B;  3RZS A;  3CLN A;  3QRX A;  1NX1 A;  1B47 A;  1F55 A;  1JF2 A;  3A8R A;  3FE6 A;  4F7F A;  1ODB A;  3R1P A;  5G08 A;  5FI6 A;  3HCM A;  2D8N A;  4XYN A;  3D0Y A;  1PUL A;  1YX8 A;  4JQ0 D;  3S0G A;  2KBM A;  1DC1 A;  2JT8 A;  2KSP A;  3CDN A;  2ZFD A;  4JD9 A;  4QJ3 B;  4ETO A;  1JBA A;  1FF1 A;  5GQQ C;  3SG4 A;  3B88 A;  2V53 A;  4ORA B;  1B8C A;  1W7I B;  1HQV A;  1J7P A;  1SR6 C;  1F54 A;  1OOF A;  2KFH A;  4HRG A;  4JWQ A;  2LUC A;  2RGI A;  1DEL A;  2E6W A;  3I5G C;  1DGV A;  2L98 A;  1QIW A;  3VRO A;  3D75 A;  2GV5 A;  1DGU A;  1K94 A;  1PK0 D;  1W9Z A;  2JQ6 A;  4GGF C;  1A75 B;  3TS5 C;  3D74 A;  4OVN F;  2PQL A;  1SR6 B;  4L9M A;  2JT3 A;  1UUR A;  2LHI A;  4PCW A;  4YGD B;  3SS3 A;  3VB1 A;  3KHE A;  1SL7 A;  3I5G B;  1REC A;  1B9A A;  1ZOT B;  5ER4 X;  4FQO A;  5HLO A;  2WOR A;  3TS5 B;  4I5K A;  2BE4 A;  1QIV A;  2JT0 A;  2QPT A;  3DVM A;  1BT6 A;  3GOF A;  2KPH A;  1NSH A;  1VRK A;  2L4I A;  2BCA A;  3RM1 A;  2I7A A;  2IS9 A;  2VRG A;  2LP2 A;  4D1E A;  3JVT C;  2JC2 A;  2K7O A;  4OKH A;  1QX5 B;  1SBJ A;  3KEV A;  2LV7 A;  5HKW A;  5DIC A;  1ORG A;  1Q80 A;  2MBX A;  1TWO A;  3O4Y A;  3DYE A;  1AJ5 A;  1OMV A;  2BNX A;  2O60 A;  2QEV A;  3JVT B;  5HL1 A;  2LM5 A;  1A4P A;  3OX6 A;  3BFB A;  1QV1 A;  2K8M B;  2H61 A;  2Y4Q A;  4UPG A;  2OTG B;  1CMG A;  2JXL A;  1J7O A;  3DZT A;  3I5F C;  2K60 A;  1IG5 A;  2KYC A;  4YRU A;  3GK2 A;  3MSE B;  3TDZ A;  4PE1 A;  3SG7 A;  2WCM A;  1K9P A;  1EJ3 A;  4MVF A;  1ALV A;  2ZNE A;  2BE6 A;  1XFR A;  3BOW B;  3C1V A;  1CB1 A;  2CCM A;  3DVE A;  5DKQ A;  3PN7 B;  1PSR A;  1CLL A;  3O2P A;  4ORC B;  5AER A;  4M2P A;  1EG4 A;  5HKY A;  1YTZ C;  1A2X A;  1TUJ A;  3FE9 A;  2LHL A;  4QJ4 B;  1L7Z A;  1CDN A;  2L2C A;  1OMR A;  4M2Q A;  4CID A;  5JJG A;  1F70 A;  1JWD A;  3I5H C;  2MRD A;  4I5J A;  1H4B A;  3OBV A;  1P28 A;  4MRY A;  1M39 A;  2ZN9 A;  3NGV A;  4PDZ A;  4GAO A;  4HSZ A;  1TNP A;  1C7W A;  2HET A;  2LMV A;  4TNC A;  1BF5 A;  3I5H B;  3EK8 A;  1XA5 A;  2KQY A;  1QX2 A;  3OGN A;  4PE7 A;  2P70 A;  5ER5 A;  2M0R A;  1MUX A;  5AEQ A;  4MN0 A;  4MLW A;  3S0E A;  2WCJ A;  2KFG A;  4XJK A;  1A03 A;  1KSO A;  1M63 B;  4PHK A;  4DS7 A;  4E68 A;  1UHJ A;  2Q91 A;  4DIR A;  2FOT A;  2NCO A;  2CBL A;  2LCP A;  1AJ4 A;  1OOH A;  3KPX A;  4F0Z B;  5KU1 A;  4AOM A;  2M7N A;  3BUN B;  2H8V A;  3K1E A;  3PFV A;  3ICB A;  1KK7 Z;  2K61 A;  2BCX A;  1QS7 A;  4CPV A;  3SG6 A;  1RRO A;  1CM4 A;  1F71 A;  2HPS A;  3BJH A;  3RLZ A;  2LE9 B;  4C0L A;  1S6J A;  2M97 A;  2MHH A;  4MZJ A;  1QVI Z;  4GUK A;  1WLM A;  1UHK A;  4YGB B;  1SNL A; 
#chains in the Genus database with same CATH homology
 3CAB A;  2QEB A;  1DQE A;  1LS8 A;  2WC6 A;  3S0G A;  3CDN A;  4INW A;  4JD9 A;  3B88 A;  1OOI X;  5EL2 A;  1C3Z A;  3Q8I A;  1OOF A;  3D78 A;  1OW4 A;  3D75 A;  1OOG A;  3D74 A;  2PQL A;  3CZ0 A;  3VB1 A;  2WC5 A;  3NHT A;  3L4A A;  2FJY A;  3R72 A;  3S0F A;  2KPH A;  3CZ2 A;  2GTE A;  3D77 A;  3D76 A;  3DY9 A;  3S0B A;  3D73 A;  5DIC A;  1ORG A;  2P71 A;  3S0A A;  2JPO A;  1TWO A;  3B86 A;  3DYE A;  3R1V A;  2WCL A;  2QEV A;  3QME A;  3BFB A;  3B6X A;  3S0D A;  4INX A;  3PJI A;  3L47 A;  3DZT A;  1C3Y A;  2ERB A;  3B7A A;  2WCM A;  3CZ1 A;  1XFR A;  1T14 A;  1QWV A;  3V2L A;  1GM0 A;  1TUJ A;  3NHI A;  2QEH A;  3FE9 A;  3R1O A;  2L2C A;  3L4L A;  4FQT A;  3CYZ A;  3BFH A;  4OZD A;  1P28 A;  3NGV A;  3BFA A;  3DXL A;  2QDI A;  3OGN A;  2P70 A;  2QEO A;  3S0E A;  2WCH A;  2WCJ A;  4PT1 A;  3N7H A;  1OOH A;  3FE8 A;  2H8V A;  3K1E A;  3RZS A;  3B87 A;  3BJH A;  3FE6 A;  4F7F A;  3R1P A;  2WCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...