3D77A

Crystal structure of a pheromone binding protein mutant d35n, from apis mellifera, soaked at ph 4.0
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
116
structure length
116
Chain Sequence
WVPPEVFDLVAEDKARCMSEHGTTQAQIDDVNKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Pheromone binding protein
molecule keywords Pheromone-binding protein ASP1
publication title Queen bee pheromone binding protein pH-induced domain swapping favors pheromone release
pubmed doi rcsb
source organism Apis mellifera
total genus 45
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3d77A00
2QDIA 2P70A 3DY9A 3DYEA 3BFHA 3B7AA 2H8VA 2WCJA 1OOGA 3CABA 2WC6A 5DICA 4OZDA 2FJYA 3R1PA 3Q8IA 2WCMA 3DXLA 3D76A 3D78A 3NGVA 4FQTA 3L4LA 2P71A 1OOHA 3B6XA 1ORGA 3L4AA 4PT1A 1OOIX 2QEBA 3DZTA 1OW4A 2QEHA 3CZ2A 3BFAA 4INWA 3VB1A 4F7FA 3N7HA 1XFRA 3S0GA 3RZSA 1T14A 3CYZA 5EL2A 1C3ZA 3B88A 3R1OA 3FE9A 3D75A 3S0BA 2WCLA 3S0FA 3D77A 3CZ0A 1DQEA 1P28A 2GTEA 3S0EA 3V2LA 1C3YA 2QEVA 3B87A 3BJHA 4JD9A 3L47A 3D74A 3PJIA 3R72A 3D73A 3B86A 3NHTA 2PQLA 1TUJA 2KPHA 1GM0A 2WCKA 1QWVA 3BFBA 3FE8A 2QEOA 4INXA 2JPOA 1LS8A 2WC5A 3R1VA 1TWOA 3S0DA 3K1EA 2WCHA 3NHIA 2ERBA 2L2CA 3S0AA 1OOFA 3CDNA 3QMEA 3OGNA 3FE6A 3CZ1A
chains in the Genus database with same CATH superfamily
4AOMA 2M49B 2F3ZA 1UHJA 4YI8A 1YRUB 4I5LB 4YGEB 4WQ2A 3TZ1A 3NSOA 1BMOA 1QIWA 3DYEA 1KSOA 2WC8A 4MVFA 4ORBB 3BOWB 2H8VA 1MHOA 2FOTA 4XYNA 1VRKA 1FI5A 1IIOA 4PHJA 5DICA 2K2FA 1BG1A 4OZDA 1OE9B 3KEVA 2VRGA 3A4UB 1L7ZA 2F3YA 1K93D 1QX5B 2Y4QA 3F45A 2M1UA 3D78A 1SL8A 3O78A 3NGVA 5AEQA 3L4LA 1AJ5A 4PHMA 2WCEA 3LK0A 2KFHA 5IBWA 2BKHB 2JT0A 3DVKA 1YUSA 1S6JA 1DEKA 1UURA 1UHHA 1F4OA 1IH0A 1JFJA 1OQPA 1W7IB 1PVBA 1SCVA 2RGIA 1ORGA 4JWQA 1IQ3A 3UNWA 4GPLB 2ZNDA 3DD4A 3CGAA 4PT1A 1OOIX 1M39A 4ZCUA 2AMIA 2PSRA 4MZLA 3PM8A 1BJFA 4U8DA 3TS5B 3UO9A 1NCXA 1QLKA 3BFAA 3CZ2A 4FQOA 4ORCB 2LANA 1OZSA 3S0GA 1XFVO 3BOWA 3FS7A 1CMFA 3ZWHA 3O4XA 3DVJA 1CTRA 1S5GZ 2BBMA 4MLWA 4GGFC 4YGBB 3SS4A 3FE9A 3S0BA 1S3PA 4NQGA 2A4JA 5HYDA 4BY4A 3OB1B 3NSKA 2L5XB 3CR4X 1B8CA 3D77A 3VRRA 1P28A 2H61C 5I2OA 1EXRA 2WNDA 3V2LA 2JXLA 2SASA 1ZACA 1S5GY 1QV1A 1JWDA 3D74A 1SRAA 2YGUA 3R72A 4GGFA 4D1EA 3FWCA 2ZN8A 1ODBA 4N5XA 5F6TA 4ICBA 5JJGA 1TUJA 1DJWA 2F2OA 3PSRA 4N1GA 4OVNF 2MLEC 2G9BA 2H61A 2CBLA 4DS7A 1JBAA 1MR8A 3OP0A 2BCBA 1UUSA 2ISDA 4HRGA 2MRDA 5CSIA 1QWVA 1RFJA 2JTZA 1JC2A 3FE8A 2NLNA 1F55A 1MWNA 2QEOA 2QPTA 4INXA 2OTGB 2BCXA 1NPQA 4TNCA 3R1VA 1QTXA 3EK7A 5I94A 1TWOA 1OOJA 1QX7A 1DC1A 2K8MB 4BY5A 3S0DA 1LXFC 2KAXA 2KGBC 1KK7Z 2EHBA 4MSPA 3SIBA 1YUUA 1UWOA 5HKYA 1CFFA 1XFZO 4XJKB 4YGAA 3SG2A 3JTDB 1TTXA 1QX2A 3CLNA 2JNXA 2KNEA 4MZKA 1C07A 5J3XA 3QMEA 2EGDA 1B8LA 2TN4A 3BXKA 3KO0A 1WRZA 5HKZA 2Y1MA 3OBVA 1NUBA 2LC5A 2WCFA 4PE4A 1MXEA 1NCZA 4HREE 3DY9A 1BT6A 3CWGA 1K2HA 2Y1NA 3I5IB 4I5KA 4YI9A 4WQ3A 3SG5A 1QVIY 4HRHA 3JTDC 2FJYA 1LA0A 3R1PA 1EG3A 1W7JB 2KBIA 5DKRA 2NXQA 2WCMA 3DXLA 5CPVA 1G33A 1LKJA 2PALA 1KCYA 3WHTB 1SK6D 5I2QA 1W9ZA 2ZNEA 2FCEA 2KI4B 4R1EA 2KYFA 1HT9A 2BECA 1ZOTB 3NXAA 2JNFA 2LMTA 3CS1A 3I5IC 2ZRTA 1A03A 4XJKA 1OZOA 2LM5A 5HL1A 2PYQA 1TCOB 3ICBA 1SR6B 3FIAA 2L50A 3L4AA 4YGDB 4OCIA 1XA5A 1AJ4A 1DVIA 2IS9A 1TNWA 2HETA 3DZTA 1PK0D 1QS7A 1RK9A 1G8IA 2K7OA 5GQQC 3D10A 5D7FA 1CB1A 2F33A 2L98A 2V53A 2KI4C 4MBEA 4OR9B 3VB1A 3CR5X 1PULA 2JOJA 4L9MA 4IL1A 1CM4A 1JFKA 1XFRA 2KQ6A 2M97A 1N65A 1T14A 2ZKMX 5I2LA 1YRTB 3KF9A 1FW4A 4YBHB 1C3ZA 3SG6A 3B88A 1CLBA 2Y5IA 1TUZA 1SYMA 3BYAA 4I5JA 1DJYA 2L5YA 4P2YB 2LV7A 2M0RA 4DIRA 1SPYA 1SR6C 4JQ0D 2LMUA 3E3RA 1J7PA 2M9GA 1FF1A 2NCPA 5AERA 1LVCD 1U5IB 1YX8A 2D8NA 2LUCA 1J55A 3JVTC 4PCWA 5B8IB 3RM1A 4PE0A 2LVKA 1M46A 2QEVA 4FTGA 1B9AA 1SL9A 2JXCA 1UHNA 2CXJA 3BJHA 1KK8B 3BUMB 4GAOA 4GUKA 4JD9A 2KLEA 2I7AA 2ZN9A 1YURA 3IQOA 1TNXA 3VROA 5K89A 5KTYA 3D73A 3B86A 2I2RE 3MSEB 1KQMB 5D69A 1XFWO 1SSEB 1DJIA 4ETOA 4I5NB 1XK4C 1BU3A 1QLSA 3I5FB 3TUYC 1F70A 3GOFA 3QRXA 1PALA 2WCKA 1YX7A 4A4BA 4ZCVA 2K2AA 5ER5A 1CKKA 4QJ5B 2LVJA 1K95A 3PATA 5CSFA 1RTP1 3BUOB 3BQ3A 4YRUA 1KFXS 3BUNB 1OSAA 2LCPA 3BUWB 1KK8C 2GGZA 1Y1XA 4PALA 2M7LA 2KI6C 2KSPA 2JRFA 1A4PA 1EL4A 1RROA 2WC5A 2DOQA 2L2EA 1NX1A 2KYCA 2Q4UA 1IG5A 1KFXL 1KQMC 4PHNA 1B8RA 1DJZA 3EKJA 1XK4A 2L4HA 1DF0B 1M31A 1BLQA 3I5FC 4WRIA 5JOLA 1U5IA 4DCKA 1PSBA 1PSRA 2L2CA 5G08A 1B47A 1CDNA 3FWBA 1NIWA 3CDNA 1R6PA 3FE6A 1XO5A 3CZ1A 1D1OA 1KWOC 2BNXA 2BBNA 1F8HA 4MRXA 1UP5A 2QDIA 2KDHA 1CDPA 4MN0A 2EC6B 1K94A 2M29A 3BFHA 1J1EA 3B7AA 2NZ0A 1S26D 3OX6A 1FI6A 1B7TZ 1TNPA 2WCJA 3CABA 3K21A 3OB2B 1F71A 2WC6A 1DJGA 3PALA 3DF0B 3PFVA 3SJSA 1YVHA 2MBXA 1V1FA 2BL0C 1A29A 3Q8IA 4ORAB 3DVEA 1EH2A 4YGCB 3D76A 1XFYO 1XVJA 1Y1UA 2FJUB 2LE9B 3GK4X 1CM1A 4KYNA 1IQ5A 5PALA 3KPXA 2H2KA 4C0KA 4C0JA 1BR1B 2KHNA 2PASA 1TIZA 2EC6C 2HQ8A 3I5HB 5I8NA 1ZFSA 1K96A 1OOHA 1DF0A 1YTZC 2PRUA 2K0JA 3B6XA 1AHRA 1Y6WA 2KFGA 1WLMA 3PLFB 1FBVA 3SG4A 3CR2A 1KK7Y 1NX2A 3IVTA 2I94A 1SY9A 1HQVA 1MF8B 1DGVA 1QV0A 2MHHA 1QATA 2KFFA 2PVBA 5KU1A 1LINA 4CPVA 4CLNA 4INWA 4UPGA 3AAJA 3VRPA 3N7HA 3I5HC 5FI2A 3GK1A 1AK8A 1JSAA 1BOCA 1RECA 1CDMA 1X02A 5EL2A 2JULA 5ER4X 2HQWA 3DF0A 2P6BB 1MXLC 3LK1A 1NWDA 1SMGA 1WDCB 4IJ7A 5DKNA 1CFPA 2LLTA 2MJWB 4E68A 2AUCA 1YUTA 2LAPA 3ZNIA 1NYAA 1TCFA 1GQMA 1DJHA 1DQEA 2GTEA 2MAZA 3S0EA 1KQVA 2LVIA 1S6CA 1C3YA 1DELA 3B87A 2M1KB 3D0YB 3WNXB 1QJTA 1ALVA 1OMDA 1NP8A 1NSHA 1WRLA 2CTNA 3IQQA 2JZIA 3L47A 1CNPA 1EJ3A 3PJIA 1N0YA 1S36A 4MRYA 1WY9A 2JQ6A 1M63B 3C1VA 1AUIB 1OMRA 3JVTB 4AQIA 3SS5A 1G4YR 1WDCC 5CSJA 3NHTA 1PRWA 2PQLA 4MZJA 3HCMA 1XYDA 2KPHA 1C7VA 1GM0A 1F4QA 1J7OA 4CIDA 1S1EA 2G2BA 2WCBA 1DTLA 4CFRA 2LLUA 3BFBA 2GGMA 1CLLA 3PN7B 2JT8A 3NSLA 3OHMB 3TUYB 2LP2A 4PE1A 3O6BA 2JPOA 3SS3A 1LS8A 2Q91A 2WOSA 3TDUA 1QASA 3LCPC 1Z2CB 2E6WA 2HPSA 2ZFDA 3AKBA 3LLEA 3O2PA 3PM2A 3K1EA 2WCHA 2PMYA 2LVVA 1NX3A 5KSZA 3AKAA 1YVLA 1MQ1A 2LUXA 2NCOA 3VRNA 1JF0A 2ERBA 1J7QA 3VGOA 2F8PA 3EG5B 3D0YA 3PN7C 1A2XA 1OOFA 3OGNA 4M2PA 1Y1AA 2M3WA 4GNKB 1TRFA 1IJ6A 1ALWA 3EVRA 2ZRSA 2P70A 1AVSA 4M2OA 1K9PA 1AP4A 4HSZA 1WLZA 3SG7A 4NDCA 5D3OA 2I18A 1IWQA 2BE4A 1KWOB 1OOGA 1SNLA 4JPZB 5HKWA 2KLDA 3EKHA 4PDZA 1CFCA 4NDDA 1K8UA 1B4CA 3NSIA 1NCYA 5FI6A 3RZSA 1QIVA 3KHEA 1IKUA 4FQTA 4CFQA 1H8BA 3EVVA 3EK8A 3TDZA 1MUXA 2BL0B 2MA2A 5FI7A 2LMVA 4N1FA 3M0WA 2COLB 2P71A 1SCMB 2JTTA 2JPTA 2E30A 1EG4A 3A8RA 2KAYA 2MLFC 2BAPA 4P5OE 1UHIA 3TS5C 2LLSA 5TNCA 1A75B 2L51A 1V1GA 2OS8B 3SIAA 4USLA 4GBAA 3BUXB 2QEBA 3CTNA 4GFTA 2M8UA 1OW4A 1SKTA 1IJ5A 1IRJA 1PVAA 2JC2A 2QEHA 2K60A 1YR5A 4DRWA 4F7FA 1OMVA 3GK2A 2QACA 1SCMC 4PHKA 1KSMA 3I5GB 3IF7A 1WRKA 3CYZA 3AAKA 5DKQA 2K7BA 2CNPA 3R1OA 4NDBA 5HLVA 1ZMZA 3D75A 5CSNA 2K7DA 1B7TY 2WCLA 1N2DA 1H4BA 1Y0VH 2OS8C 3S0FA 1J7RA 2LP3A 1BF5A 2L4IA 3O4YA 3SG3A 2BCAA 1R2UA 2BKIB 2LHIA 1LA3A 3CZ0A 4JKTA 2K7CA 1CLMA 2AAOA 5HLOA 1L2OB 2KQYA 1Q80A 1B1GA 1TN4A 4Q04A 1DJXA 2JU0A 2CCMA 4OKHA 1SBJA 3I5GC 2HF5A 2LNKA 4MEWA 5AXIA 3HX4A 2SCPA 3VRQA 2LHLA 1A75A 2BE6A 3OX5A 4GGNA 3TDIA 3EK4A 1DMOA 2CT9A 1K90D 1ZUZA 1QVIZ 2F2PA 2L0PA 2JT3A 3H4SE 1GGZA 1UHKA 1XFUO 1IGVA 3CZTX 2KBMA 2O60A 1TOPA 2R2IA 2KI6D 1SL7A 2OTGC 5AANA 3EVUA 2JWWA 1CMGA 1JF2A 1KFUS 1L2OC 2FCDA 3WHUB 4A4CA 4AQJA 1GGWA 1RJVA 2K61A 3DVMA 1CDLA 1XFXO 3LL8B 5AFPA 1DGUA 1BODA 4OV2A 4F0ZB 1CFDA 1KFUL 1E8AA 1K9UA 1NX0A 4M2QA 4DUQA 1JUOA 4PE7A 2OPOA 1J1DA 1DT7B 1S6IA 2B1UA 1K9KA 5FYXA 5BPJA 1C7WA 1Z4HA 3NHIA 2O5GA 1QXPA 2GV5A 1F54A 2KAVA 2WORA 1SW8A 1BR4B 3RLZA 4C0LA 3S0AA 3WXAA 4QJ4B 4QJ3B 1M45A 1TNQA 2KGRA 1RWYA 1GJYA 2KOTA 2M7NA 1FPWA
chains in the Genus database with same CATH topology
2QDIA 2P70A 3DY9A 3DYEA 3BFHA 3B7AA 2H8VA 2WCJA 1OOGA 3CABA 2WC6A 5DICA 4OZDA 2FJYA 3R1PA 3Q8IA 2WCMA 3DXLA 3D76A 3D78A 3NGVA 4FQTA 3L4LA 2P71A 1OOHA 3B6XA 1ORGA 3L4AA 4PT1A 1OOIX 2QEBA 3DZTA 1OW4A 2QEHA 3CZ2A 3BFAA 4INWA 3VB1A 4F7FA 3N7HA 1XFRA 3S0GA 3RZSA 1T14A 3CYZA 5EL2A 1C3ZA 3B88A 3R1OA 3FE9A 3D75A 3S0BA 2WCLA 3S0FA 3D77A 3CZ0A 1DQEA 1P28A 2GTEA 3S0EA 3V2LA 1C3YA 2QEVA 3B87A 3BJHA 4JD9A 3L47A 3D74A 3PJIA 3R72A 3D73A 3B86A 3NHTA 2PQLA 1TUJA 2KPHA 1GM0A 2WCKA 1QWVA 3BFBA 3FE8A 2QEOA 4INXA 2JPOA 1LS8A 2WC5A 3R1VA 1TWOA 3S0DA 3K1EA 2WCHA 3NHIA 2ERBA 2L2CA 3S0AA 1OOFA 3CDNA 3QMEA 3OGNA 3FE6A 3CZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QDI A;  2P70 A;  3DY9 A;  3DYE A;  3BFH A;  3B7A A;  2H8V A;  2WCJ A;  1OOG A;  3CAB A;  2WC6 A;  5DIC A;  4OZD A;  2FJY A;  3R1P A;  3Q8I A;  2WCM A;  3DXL A;  3D76 A;  3D78 A;  3NGV A;  4FQT A;  3L4L A;  2P71 A;  1OOH A;  3B6X A;  1ORG A;  3L4A A;  4PT1 A;  1OOI X;  2QEB A;  3DZT A;  1OW4 A;  2QEH A;  3CZ2 A;  3BFA A;  4INW A;  3VB1 A;  4F7F A;  3N7H A;  1XFR A;  3S0G A;  3RZS A;  1T14 A;  3CYZ A;  5EL2 A;  1C3Z A;  3B88 A;  3R1O A;  3FE9 A;  3D75 A;  3S0B A;  2WCL A;  3S0F A;  3D77 A;  3CZ0 A;  1DQE A;  1P28 A;  2GTE A;  3S0E A;  3V2L A;  1C3Y A;  2QEV A;  3B87 A;  3BJH A;  4JD9 A;  3L47 A;  3D74 A;  3PJI A;  3R72 A;  3D73 A;  3B86 A;  3NHT A;  2PQL A;  1TUJ A;  2KPH A;  1GM0 A;  2WCK A;  1QWV A;  3BFB A;  3FE8 A;  2QEO A;  4INX A;  2JPO A;  1LS8 A;  2WC5 A;  3R1V A;  1TWO A;  3S0D A;  3K1E A;  2WCH A;  3NHI A;  2ERB A;  2L2C A;  3S0A A;  1OOF A;  3CDN A;  3QME A;  3OGN A;  3FE6 A;  3CZ1 A; 
#chains in the Genus database with same CATH topology
 4AOM A;  2M49 B;  2F3Z A;  1UHJ A;  4YI8 A;  1YRU B;  4I5L B;  4YGE B;  4WQ2 A;  3TZ1 A;  3NSO A;  1BMO A;  1QIW A;  3DYE A;  1KSO A;  2WC8 A;  4MVF A;  4ORB B;  3BOW B;  2H8V A;  1MHO A;  2FOT A;  4XYN A;  1VRK A;  1FI5 A;  1IIO A;  4PHJ A;  5DIC A;  2K2F A;  1BG1 A;  4OZD A;  1OE9 B;  3KEV A;  2VRG A;  3A4U B;  1L7Z A;  2F3Y A;  1K93 D;  1QX5 B;  2Y4Q A;  3F45 A;  2M1U A;  3D78 A;  1SL8 A;  3O78 A;  3NGV A;  5AEQ A;  3L4L A;  1AJ5 A;  4PHM A;  2WCE A;  3LK0 A;  2KFH A;  5IBW A;  2BKH B;  2JT0 A;  3DVK A;  1YUS A;  1S6J A;  1DEK A;  1UUR A;  1UHH A;  1F4O A;  1IH0 A;  1JFJ A;  1OQP A;  1W7I B;  1PVB A;  1SCV A;  2RGI A;  1ORG A;  4JWQ A;  1IQ3 A;  3UNW A;  4GPL B;  2ZND A;  3DD4 A;  3CGA A;  4PT1 A;  1OOI X;  1M39 A;  4ZCU A;  2AMI A;  2PSR A;  4MZL A;  3PM8 A;  1BJF A;  4U8D A;  3TS5 B;  3UO9 A;  1NCX A;  1QLK A;  3BFA A;  3CZ2 A;  4FQO A;  4ORC B;  2LAN A;  1OZS A;  3S0G A;  1XFV O;  3BOW A;  3FS7 A;  1CMF A;  3ZWH A;  3O4X A;  3DVJ A;  1CTR A;  1S5G Z;  2BBM A;  4MLW A;  4GGF C;  4YGB B;  3SS4 A;  3FE9 A;  3S0B A;  1S3P A;  4NQG A;  2A4J A;  5HYD A;  4BY4 A;  3OB1 B;  3NSK A;  2L5X B;  3CR4 X;  1B8C A;  3D77 A;  3VRR A;  1P28 A;  2H61 C;  5I2O A;  1EXR A;  2WND A;  3V2L A;  2JXL A;  2SAS A;  1ZAC A;  1S5G Y;  1QV1 A;  1JWD A;  3D74 A;  1SRA A;  2YGU A;  3R72 A;  4GGF A;  4D1E A;  3FWC A;  2ZN8 A;  1ODB A;  4N5X A;  5F6T A;  4ICB A;  5JJG A;  1TUJ A;  1DJW A;  2F2O A;  3PSR A;  4N1G A;  4OVN F;  2MLE C;  2G9B A;  2H61 A;  2CBL A;  4DS7 A;  1JBA A;  1MR8 A;  3OP0 A;  2BCB A;  1UUS A;  2ISD A;  4HRG A;  2MRD A;  5CSI A;  1QWV A;  1RFJ A;  2JTZ A;  1JC2 A;  3FE8 A;  2NLN A;  1F55 A;  1MWN A;  2QEO A;  2QPT A;  4INX A;  2OTG B;  2BCX A;  1NPQ A;  4TNC A;  3R1V A;  1QTX A;  3EK7 A;  5I94 A;  1TWO A;  1OOJ A;  1QX7 A;  1DC1 A;  2K8M B;  4BY5 A;  3S0D A;  1LXF C;  2KAX A;  2KGB C;  1KK7 Z;  2EHB A;  4MSP A;  3SIB A;  1YUU A;  1UWO A;  5HKY A;  1CFF A;  1XFZ O;  4XJK B;  4YGA A;  3SG2 A;  3JTD B;  1TTX A;  1QX2 A;  3CLN A;  2JNX A;  2KNE A;  4MZK A;  1C07 A;  5J3X A;  3QME A;  2EGD A;  1B8L A;  2TN4 A;  3BXK A;  3KO0 A;  1WRZ A;  5HKZ A;  2Y1M A;  3OBV A;  1NUB A;  2LC5 A;  2WCF A;  4PE4 A;  1MXE A;  1NCZ A;  4HRE E;  3DY9 A;  1BT6 A;  3CWG A;  1K2H A;  2Y1N A;  3I5I B;  4I5K A;  4YI9 A;  4WQ3 A;  3SG5 A;  1QVI Y;  4HRH A;  3JTD C;  2FJY A;  1LA0 A;  3R1P A;  1EG3 A;  1W7J B;  2KBI A;  5DKR A;  2NXQ A;  2WCM A;  3DXL A;  5CPV A;  1G33 A;  1LKJ A;  2PAL A;  1KCY A;  3WHT B;  1SK6 D;  5I2Q A;  1W9Z A;  2ZNE A;  2FCE A;  2KI4 B;  4R1E A;  2KYF A;  1HT9 A;  2BEC A;  1ZOT B;  3NXA A;  2JNF A;  2LMT A;  3CS1 A;  3I5I C;  2ZRT A;  1A03 A;  4XJK A;  1OZO A;  2LM5 A;  5HL1 A;  2PYQ A;  1TCO B;  3ICB A;  1SR6 B;  3FIA A;  2L50 A;  3L4A A;  4YGD B;  4OCI A;  1XA5 A;  1AJ4 A;  1DVI A;  2IS9 A;  1TNW A;  2HET A;  3DZT A;  1PK0 D;  1QS7 A;  1RK9 A;  1G8I A;  2K7O A;  5GQQ C;  3D10 A;  5D7F A;  1CB1 A;  2F33 A;  2L98 A;  2V53 A;  2KI4 C;  4MBE A;  4OR9 B;  3VB1 A;  3CR5 X;  1PUL A;  2JOJ A;  4L9M A;  4IL1 A;  1CM4 A;  1JFK A;  1XFR A;  2KQ6 A;  2M97 A;  1N65 A;  1T14 A;  2ZKM X;  5I2L A;  1YRT B;  3KF9 A;  1FW4 A;  4YBH B;  1C3Z A;  3SG6 A;  3B88 A;  1CLB A;  2Y5I A;  1TUZ A;  1SYM A;  3BYA A;  4I5J A;  1DJY A;  2L5Y A;  4P2Y B;  2LV7 A;  2M0R A;  4DIR A;  1SPY A;  1SR6 C;  4JQ0 D;  2LMU A;  3E3R A;  1J7P A;  2M9G A;  1FF1 A;  2NCP A;  5AER A;  1LVC D;  1U5I B;  1YX8 A;  2D8N A;  2LUC A;  1J55 A;  3JVT C;  4PCW A;  5B8I B;  3RM1 A;  4PE0 A;  2LVK A;  1M46 A;  2QEV A;  4FTG A;  1B9A A;  1SL9 A;  2JXC A;  1UHN A;  2CXJ A;  3BJH A;  1KK8 B;  3BUM B;  4GAO A;  4GUK A;  4JD9 A;  2KLE A;  2I7A A;  2ZN9 A;  1YUR A;  3IQO A;  1TNX A;  3VRO A;  5K89 A;  5KTY A;  3D73 A;  3B86 A;  2I2R E;  3MSE B;  1KQM B;  5D69 A;  1XFW O;  1SSE B;  1DJI A;  4ETO A;  4I5N B;  1XK4 C;  1BU3 A;  1QLS A;  3I5F B;  3TUY C;  1F70 A;  3GOF A;  3QRX A;  1PAL A;  2WCK A;  1YX7 A;  4A4B A;  4ZCV A;  2K2A A;  5ER5 A;  1CKK A;  4QJ5 B;  2LVJ A;  1K95 A;  3PAT A;  5CSF A;  1RTP 1;  3BUO B;  3BQ3 A;  4YRU A;  1KFX S;  3BUN B;  1OSA A;  2LCP A;  3BUW B;  1KK8 C;  2GGZ A;  1Y1X A;  4PAL A;  2M7L A;  2KI6 C;  2KSP A;  2JRF A;  1A4P A;  1EL4 A;  1RRO A;  2WC5 A;  2DOQ A;  2L2E A;  1NX1 A;  2KYC A;  2Q4U A;  1IG5 A;  1KFX L;  1KQM C;  4PHN A;  1B8R A;  1DJZ A;  3EKJ A;  1XK4 A;  2L4H A;  1DF0 B;  1M31 A;  1BLQ A;  3I5F C;  4WRI A;  5JOL A;  1U5I A;  4DCK A;  1PSB A;  1PSR A;  2L2C A;  5G08 A;  1B47 A;  1CDN A;  3FWB A;  1NIW A;  3CDN A;  1R6P A;  3FE6 A;  1XO5 A;  3CZ1 A;  1D1O A;  1KWO C;  2BNX A;  2BBN A;  1F8H A;  4MRX A;  1UP5 A;  2QDI A;  2KDH A;  1CDP A;  4MN0 A;  2EC6 B;  1K94 A;  2M29 A;  3BFH A;  1J1E A;  3B7A A;  2NZ0 A;  1S26 D;  3OX6 A;  1FI6 A;  1B7T Z;  1TNP A;  2WCJ A;  3CAB A;  3K21 A;  3OB2 B;  1F71 A;  2WC6 A;  1DJG A;  3PAL A;  3DF0 B;  3PFV A;  3SJS A;  1YVH A;  2MBX A;  1V1F A;  2BL0 C;  1A29 A;  3Q8I A;  4ORA B;  3DVE A;  1EH2 A;  4YGC B;  3D76 A;  1XFY O;  1XVJ A;  1Y1U A;  2FJU B;  2LE9 B;  3GK4 X;  1CM1 A;  4KYN A;  1IQ5 A;  5PAL A;  3KPX A;  2H2K A;  4C0K A;  4C0J A;  1BR1 B;  2KHN A;  2PAS A;  1TIZ A;  2EC6 C;  2HQ8 A;  3I5H B;  5I8N A;  1ZFS A;  1K96 A;  1OOH A;  1DF0 A;  1YTZ C;  2PRU A;  2K0J A;  3B6X A;  1AHR A;  1Y6W A;  2KFG A;  1WLM A;  3PLF B;  1FBV A;  3SG4 A;  3CR2 A;  1KK7 Y;  1NX2 A;  3IVT A;  2I94 A;  1SY9 A;  1HQV A;  1MF8 B;  1DGV A;  1QV0 A;  2MHH A;  1QAT A;  2KFF A;  2PVB A;  5KU1 A;  1LIN A;  4CPV A;  4CLN A;  4INW A;  4UPG A;  3AAJ A;  3VRP A;  3N7H A;  3I5H C;  5FI2 A;  3GK1 A;  1AK8 A;  1JSA A;  1BOC A;  1REC A;  1CDM A;  1X02 A;  5EL2 A;  2JUL A;  5ER4 X;  2HQW A;  3DF0 A;  2P6B B;  1MXL C;  3LK1 A;  1NWD A;  1SMG A;  1WDC B;  4IJ7 A;  5DKN A;  1CFP A;  2LLT A;  2MJW B;  4E68 A;  2AUC A;  1YUT A;  2LAP A;  3ZNI A;  1NYA A;  1TCF A;  1GQM A;  1DJH A;  1DQE A;  2GTE A;  2MAZ A;  3S0E A;  1KQV A;  2LVI A;  1S6C A;  1C3Y A;  1DEL A;  3B87 A;  2M1K B;  3D0Y B;  3WNX B;  1QJT A;  1ALV A;  1OMD A;  1NP8 A;  1NSH A;  1WRL A;  2CTN A;  3IQQ A;  2JZI A;  3L47 A;  1CNP A;  1EJ3 A;  3PJI A;  1N0Y A;  1S36 A;  4MRY A;  1WY9 A;  2JQ6 A;  1M63 B;  3C1V A;  1AUI B;  1OMR A;  3JVT B;  4AQI A;  3SS5 A;  1G4Y R;  1WDC C;  5CSJ A;  3NHT A;  1PRW A;  2PQL A;  4MZJ A;  3HCM A;  1XYD A;  2KPH A;  1C7V A;  1GM0 A;  1F4Q A;  1J7O A;  4CID A;  1S1E A;  2G2B A;  2WCB A;  1DTL A;  4CFR A;  2LLU A;  3BFB A;  2GGM A;  1CLL A;  3PN7 B;  2JT8 A;  3NSL A;  3OHM B;  3TUY B;  2LP2 A;  4PE1 A;  3O6B A;  2JPO A;  3SS3 A;  1LS8 A;  2Q91 A;  2WOS A;  3TDU A;  1QAS A;  3LCP C;  1Z2C B;  2E6W A;  2HPS A;  2ZFD A;  3AKB A;  3LLE A;  3O2P A;  3PM2 A;  3K1E A;  2WCH A;  2PMY A;  2LVV A;  1NX3 A;  5KSZ A;  3AKA A;  1YVL A;  1MQ1 A;  2LUX A;  2NCO A;  3VRN A;  1JF0 A;  2ERB A;  1J7Q A;  3VGO A;  2F8P A;  3EG5 B;  3D0Y A;  3PN7 C;  1A2X A;  1OOF A;  3OGN A;  4M2P A;  1Y1A A;  2M3W A;  4GNK B;  1TRF A;  1IJ6 A;  1ALW A;  3EVR A;  2ZRS A;  2P70 A;  1AVS A;  4M2O A;  1K9P A;  1AP4 A;  4HSZ A;  1WLZ A;  3SG7 A;  4NDC A;  5D3O A;  2I18 A;  1IWQ A;  2BE4 A;  1KWO B;  1OOG A;  1SNL A;  4JPZ B;  5HKW A;  2KLD A;  3EKH A;  4PDZ A;  1CFC A;  4NDD A;  1K8U A;  1B4C A;  3NSI A;  1NCY A;  5FI6 A;  3RZS A;  1QIV A;  3KHE A;  1IKU A;  4FQT A;  4CFQ A;  1H8B A;  3EVV A;  3EK8 A;  3TDZ A;  1MUX A;  2BL0 B;  2MA2 A;  5FI7 A;  2LMV A;  4N1F A;  3M0W A;  2COL B;  2P71 A;  1SCM B;  2JTT A;  2JPT A;  2E30 A;  1EG4 A;  3A8R A;  2KAY A;  2MLF C;  2BAP A;  4P5O E;  1UHI A;  3TS5 C;  2LLS A;  5TNC A;  1A75 B;  2L51 A;  1V1G A;  2OS8 B;  3SIA A;  4USL A;  4GBA A;  3BUX B;  2QEB A;  3CTN A;  4GFT A;  2M8U A;  1OW4 A;  1SKT A;  1IJ5 A;  1IRJ A;  1PVA A;  2JC2 A;  2QEH A;  2K60 A;  1YR5 A;  4DRW A;  4F7F A;  1OMV A;  3GK2 A;  2QAC A;  1SCM C;  4PHK A;  1KSM A;  3I5G B;  3IF7 A;  1WRK A;  3CYZ A;  3AAK A;  5DKQ A;  2K7B A;  2CNP A;  3R1O A;  4NDB A;  5HLV A;  1ZMZ A;  3D75 A;  5CSN A;  2K7D A;  1B7T Y;  2WCL A;  1N2D A;  1H4B A;  1Y0V H;  2OS8 C;  3S0F A;  1J7R A;  2LP3 A;  1BF5 A;  2L4I A;  3O4Y A;  3SG3 A;  2BCA A;  1R2U A;  2BKI B;  2LHI A;  1LA3 A;  3CZ0 A;  4JKT A;  2K7C A;  1CLM A;  2AAO A;  5HLO A;  1L2O B;  2KQY A;  1Q80 A;  1B1G A;  1TN4 A;  4Q04 A;  1DJX A;  2JU0 A;  2CCM A;  4OKH A;  1SBJ A;  3I5G C;  2HF5 A;  2LNK A;  4MEW A;  5AXI A;  3HX4 A;  2SCP A;  3VRQ A;  2LHL A;  1A75 A;  2BE6 A;  3OX5 A;  4GGN A;  3TDI A;  3EK4 A;  1DMO A;  2CT9 A;  1K90 D;  1ZUZ A;  1QVI Z;  2F2P A;  2L0P A;  2JT3 A;  3H4S E;  1GGZ A;  1UHK A;  1XFU O;  1IGV A;  3CZT X;  2KBM A;  2O60 A;  1TOP A;  2R2I A;  2KI6 D;  1SL7 A;  2OTG C;  5AAN A;  3EVU A;  2JWW A;  1CMG A;  1JF2 A;  1KFU S;  1L2O C;  2FCD A;  3WHU B;  4A4C A;  4AQJ A;  1GGW A;  1RJV A;  2K61 A;  3DVM A;  1CDL A;  1XFX O;  3LL8 B;  5AFP A;  1DGU A;  1BOD A;  4OV2 A;  4F0Z B;  1CFD A;  1KFU L;  1E8A A;  1K9U A;  1NX0 A;  4M2Q A;  4DUQ A;  1JUO A;  4PE7 A;  2OPO A;  1J1D A;  1DT7 B;  1S6I A;  2B1U A;  1K9K A;  5FYX A;  5BPJ A;  1C7W A;  1Z4H A;  3NHI A;  2O5G A;  1QXP A;  2GV5 A;  1F54 A;  2KAV A;  2WOR A;  1SW8 A;  1BR4 B;  3RLZ A;  4C0L A;  3S0A A;  3WXA A;  4QJ4 B;  4QJ3 B;  1M45 A;  1TNQ A;  2KGR A;  1RWY A;  1GJY A;  2KOT A;  2M7N A;  1FPW A; 
#chains in the Genus database with same CATH homology
 2QDI A;  2P70 A;  3DY9 A;  3DYE A;  3BFH A;  3B7A A;  2H8V A;  2WCJ A;  1OOG A;  3CAB A;  2WC6 A;  5DIC A;  4OZD A;  2FJY A;  3R1P A;  3Q8I A;  2WCM A;  3DXL A;  3D76 A;  3D78 A;  3NGV A;  4FQT A;  3L4L A;  2P71 A;  1OOH A;  3B6X A;  1ORG A;  3L4A A;  4PT1 A;  1OOI X;  2QEB A;  3DZT A;  1OW4 A;  2QEH A;  3CZ2 A;  3BFA A;  4INW A;  3VB1 A;  4F7F A;  3N7H A;  1XFR A;  3S0G A;  3RZS A;  1T14 A;  3CYZ A;  5EL2 A;  1C3Z A;  3B88 A;  3R1O A;  3FE9 A;  3D75 A;  3S0B A;  2WCL A;  3S0F A;  3D77 A;  3CZ0 A;  1DQE A;  1P28 A;  2GTE A;  3S0E A;  3V2L A;  1C3Y A;  2QEV A;  3B87 A;  3BJH A;  4JD9 A;  3L47 A;  3D74 A;  3PJI A;  3R72 A;  3D73 A;  3B86 A;  3NHT A;  2PQL A;  1TUJ A;  2KPH A;  1GM0 A;  2WCK A;  1QWV A;  3BFB A;  3FE8 A;  2QEO A;  4INX A;  2JPO A;  1LS8 A;  2WC5 A;  3R1V A;  1TWO A;  3S0D A;  3K1E A;  2WCH A;  3NHI A;  2ERB A;  2L2C A;  3S0A A;  1OOF A;  3CDN A;  3QME A;  3OGN A;  3FE6 A;  3CZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...