1S1EA

Crystal structure of kv channel-interacting protein 1 (kchip-1)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
181
structure length
181
Chain Sequence
b'GLEQLEAQTNFTKRELQVLYRGFKNECPSGVVNEETFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFEDFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPVLKEDTPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQLFQNVMVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kv channel interacting protein 1
publication title Two N-terminal domains of Kv4 K(+) channels regulate binding to and modulation by KChIP1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 64
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2004-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1s1eA00
2JNFA 1LVCD 2KAYA 3ZWHA 2AMIA 1BF5A 1DGVA 2JU0A 4MN0A 2CBLA 2JT0A 1KQMB 1M46A 1S5GY 1SCVA 2G9BA 1A29A 1B1GA 1UHJA 1OMDA 1CM4A 1SL9A 3AKBA 4ZCUA 1A2XA 4YGBB 2SASA 1OZSA 2F2PA 3SG7A 1XFVO 2PMYA 1D1OA 1JSAA 2LMVA 3K21A 2OTGC 3FS7A 4P5OE 2K8MB 1BLQA 2KDHA 3FIAA 1R6PA 1Y6WA 1QVIY 2KGBC 1S6CA 1XFWO 1QLSA 2L4IA 3BUNB 2Q91A 4CFQA 1XK4A 2KOTA 2ZN9A 2LLTA 2M7NA 1S36A 4N1GA 1DMOA 1SPYA 2BCXA 3DVKA 4YI8A 4PALA 4M2OA 3JVTB 4I5JA 1DGUA 2WNDA 5F6TA 1N65A 1IJ5A 4MZJA 2L2EA 4A4BA 1WRLA 2LVIA 2WOSA 4U8DA 3SG4A 1S5GZ 1S1EA 1YVLA 3FWBA 5CSJA 4YGEB 1F54A 1CMFA 1XFYO 2I94A 3PN7C 1QV0A 1Q80A 1CLBA 5I2OA 2JT8A 1BU3A 1QIVA 2LHLA 2F33A 4YI9A 1IWQA 2KGRA 1M39A 1MUXA 4I5KA 3TS5C 1QVIZ 1UURA 2LMTA 1MQ1A 3VRNA 4CFRA 1OMRA 2LLUA 2KAXA 1RROA 3VRQA 2EHBA 3DVEA 1L2OC 3O6BA 3LCPC 1NX1A 1QX2A 4ICBA 2PSRA 1QX5B 3LK1A 1V1FA 1YX7A 2L4HA 1NX3A 4PHKA 5I2QA 3OB2B 2OS8B 3TUYB 2KQ6A 2F3YA 3JTDB 1UHIA 3O4YA 4A4CA 4HRGA 2PASA 2ZNDA 2BCBA 4NDCA 3BYAA 1QJTA 1ZMZA 4ORCB 3SJSA 2M3WA 3NXAA 2ZN8A 2JRFA 2BCAA 3OX6A 2BBNA 5KTYA 1NP8A 1S6JA 3TDIA 4HRHA 1EXRA 1A75A 1AJ4A 1F70A 3BUWB 1GJYA 1EJ3A 2MLFC 1KFUL 3CWGA 2CNPA 3EK7A 3WHTB 1RFJA 2A4JA 2JQ6A 2GGZA 4GAOA 1A75B 2M49B 5KSZA 3M0WA 1BR1B 1XVJA 1AK8A 1IH0A 2LCPA 5AEQA 1R2UA 2K0JA 3TZ1A 3BUXB 2CT9A 1XFXO 2KFHA 2FOTA 3ZNIA 1G8IA 5HKZA 1K9UA 4OKHA 2PVBA 3I5GB 1TN4A 2L50A 1PRWA 2E6WA 3I5GC 2M7LA 2FJUB 1C07A 5HLVA 2HETA 1TOPA 2KYCA 5B8IB 1B7TY 2K2AA 1LA3A 2QACA 1BR4B 3HCMA 1CM1A 1LINA 3FWCA 1MWNA 4XJKB 1QIWA 3I5FB 4GNKB 5JJGA 4OV2A 4GGFA 1SKTA 4E68A 1CFCA 3C1VA 2KBMA 3DF0A 1ODBA 3IF7A 4IL1A 1ALVA 1J1DA 2Y1NA 1JFKA 5JOLA 1EH2A 1F71A 1TCFA 1B4CA 1A4PA 2KFFA 1PVAA 2PRUA 4QJ5B 3DF0B 1K2HA 1IGVA 1YUSA 2KAVA 1GQMA 2LUXA 2M8UA 1LA0A 1NCXA 1UHKA 5K89A 4DRWA 1PVBA 1MHOA 4JWQA 2LMUA 2ZRSA 2K7BA 3ICBA 1KQVA 1IJ6A 3NSKA 4CLNA 1CTRA 2JT3A 1KK7Y 1MR8A 1KQMC 4PDZA 1PULA 1KWOB 4I5LB 1B7TZ 1JF0A 1KK8B 2KQYA 1N0YA 1M45A 4GBAA 2EC6B 4DIRA 1M63B 2PALA 4FTGA 1WRKA 4PHNA 3O78A 2KFGA 1YVHA 1QXPA 1XYDA 4HSZA 5AXIA 2LC5A 5CSFA 1K95A 1IRJA 3CR5X 5I8NA 1S6IA 4F0ZB 2V53A 2L98A 4XYNA 2AAOA 2O60A 3EKJA 4QJ3B 2WCEA 1TNQA 1MF8B 2BKIB 3I5HB 3KPXA 1K8UA 1H4BA 1K93D 3CGAA 1CDMA 1Y1XA 1IQ5A 1M31A 5G08A 5IBWA 1CFPA 1NIWA 1J7RA 2K7CA 1DJHA 2MJWB 3JVTC 1XK4C 4MEWA 1SW8A 3CZTX 3D10A 1SCMB 2JZIA 4NDBA 4HREE 1S3PA 3VRPA 3MSEB 4MBEA 2R2IA 4YRUA 3LK0A 2QPTA 1H8BA 1XO5A 2D8NA 2LHIA 2ISDA 3CR4X 1DTLA 2LANA 2DOQA 2P6BB 1W7IB 2G2BA 2FCDA 2KSPA 3VGOA 2LVJA 5BPJA 4PCWA 3OB1B 5AANA 1DJYA 4OVNF 2JNXA 3SG2A 3DD4A 1SL7A 3KEVA 2LAPA 4AQJA 2HPSA 3CR2A 2NZ0A 2OS8C 3TUYC 4CIDA 1CLLA 3JTDC 3NSLA 4QJ4B 2WORA 3PFVA 4M2QA 2M9GA 2L51A 2ZNEA 2JOJA 2Y1MA 1B8RA 3PLFB 1TNXA 1SMGA 1B47A 1MXLC 2JXCA 5PALA 2K2FA 1FF1A 3I5IB 4GPLB 1KCYA 1J55A 1YTZC 5CSNA 1ZACA 2VRGA 2MBXA 4C0JA 1CLMA 1F4QA 4OR9B 1GGWA 1B8CA 4ORAB 2BECA 1RECA 2MAZA 1NX2A 5CSIA 3AAKA 1K90D 3O2PA 2JC2A 2EGDA 3QRXA 5FYXA 2JTTA 2LV7A 4YGAA 1AVSA 1MXEA 1J7PA 1ALWA 4MSPA 1EL4A 2WC8A 4MLWA 3GK4X 2GGMA 1J1EA 3IQQA 1YURA 1AP4A 1QV1A 1ZOTB 3EK4A 1CDNA 5J3XA 1YRTB 3OX5A 2KI6D 1B9AA 2GV5A 3CS1A 1EG3A 1YX8A 4ORBB 1RJVA 1DJGA 1CFDA 1N2DA 4PHJA 1F4OA 2CCMA 4I5NB 2BL0B 1OQPA 1DF0A 3I5FC 1PSRA 1FPWA 1JFJA 4MRYA 5D69A 1LXFC 2BE6A 1YRUB 5GQQC 1TNPA 2COLB 2RGIA 2MLEC 1DF0B 2MA2A 4GGFC 3BQ3A 1WLMA 2CTNA 2ZFDA 1DJZA 2H61C 1NX0A 1K9KA 2L5XB 4OCIA 2KHNA 1V1GA 2F2OA 5TNCA 2NXQA 4YBHB 3BOWA 4DCKA 2KI4B 1K94A 4BY5A 2Y5IA 1J7QA 1BOCA 2WCBA 2E30A 1JBAA 4M2PA 2KBIA 4NQGA 3LL8B 3CLNA 1KWOC 3BOWB 1JWDA 2K7OA 4MZKA 1JF2A 2LP2A 1KK8C 4C0LA 1BT6A 2EC6C 1NCZA 1PSBA 1CDLA 1G4YR 1WDCB 3A4UB 1KSOA 1SYMA 5CPVA 1KSMA 3BXKA 2F3ZA 2B1UA 1E8AA 1SRAA 2HF5A 5ER5A 1K96A 5AERA 5D7FA 2LNKA 4N1FA 1PK0D 3TDZA 2ZKMX 4PE4A 1HQVA 3F45A 1UHNA 1UP5A 4D1EA 5I2LA 5ER4X 1U5IA 3I5HC 1TCOB 1DJWA 1C7VA 2KI6C 4CPVA 1KFXS 3SG3A 4N5XA 2OTGB 1L7ZA 1S26D 1TRFA 1XFUO 1Y1UA 4JQ0D 5HKYA 2BE4A 1A03A 1NPQA 1U5IB 3BUOB 1KK7Z 3DVMA 3SIAA 1OZOA 1YUTA 1FBVA 2M0RA 1SCMC 4YGDB 3WHUB 2H2KA 5HYDA 3SIBA 1UWOA 4FQOA 1IKUA 1QLKA 1XA5A 4GUKA 3PSRA 1ZFSA 3EKHA 2NCOA 2AUCA 3VROA 3H4SE 1TIZA 2I7AA 4ETOA 2M1UA 1FW4A 4WRIA 1DT7B 4JPZB 2MHHA 3NSOA 1FI5A 1AHRA 2ZRTA 1X02A 1QATA 1KFXL 3PN7B 1JUOA 1UUSA 3AAJA 1Y1AA 2LVKA 1AJ5A 1W7JB 2HQWA 4P2YB 1NUBA 2BBMA 4MZLA 2JTZA 1SBJA 1WLZA 1NWDA 1CMGA 1QTXA 1TTXA 3SG6A 3TS5B 3PATA 3HX4A 1IG5A 2M1KB 3EVVA 1IQ3A 1F8HA 3EVUA 3IQOA 1QASA 4PHMA 3PALA 1DVIA 1SY9A 4NDDA 3VRRA 5AFPA 1L2OB 2OPOA 1VRKA 1EG4A 1KFUS 1SK6D 4AOMA 1J7OA 3I5IC 2I2RE 2TN4A 4DS7A 1OE9B 1TNWA 1SR6B 2MRDA 2L0PA 5DKQA 2JPTA 2K61A 1SR6C 1Y0VH 2M29A 4UPGA 1YR5A 3SG5A 3NSIA 3RM1A 2JXLA 3GOFA 2LLSA 1BG1A 1FI6A 1B8LA 4GFTA 2I18A 1WY9A 1CNPA 1NCYA 1QS7A 3DVJA 4MRXA 4AQIA 4PE1A 3LLEA 1RK9A 4ZCVA 2LP3A 2KNEA 3KO0A 1NYAA 3GK1A 1NSHA 1CFFA 1BJFA 1BMOA 1UHHA 3E3RA 5DKNA 1DJIA 5HKWA 3EK8A 1CKKA 1DJXA 1HT9A 3OHMB 1GGZA 4PE0A 4TNCA 5HLOA 4DUQA 3RLZA 1RTP1 2LM5A 4USLA 2BKHB 3OP0A 4PE7A 2NLNA 2BL0C 1OOJA 3CTNA 3WXAA 2O5GA 2JWWA 1F55A 2Y4QA 5KU1A 1C7WA 4Q04A 1OMVA 2JULA 4XJKA 4YGCB 4C0KA 5DKRA 4WQ3A 1G33A 1LKJA 3KF9A 1JC2A 1SNLA 1WRZA 1ZUZA 4WQ2A 1AUIB 4R1EA 3BUMB 4BY4A 2LVVA 2SCPA 2NCPA 3AKAA 3GK2A 2Q4UA 2KI4C 1PALA 4L9MA 2CXJA 2FCEA 2H61A 2WCFA 3A8RA 2K7DA 1K9PA 4MVFA 3TDUA 2F8PA 3PM8A 2LE9B 2M97A 1CB1A 2KYFA 1OSAA 3D0YA 3KHEA 1QX7A 1BODA 2IS9A 1YUUA 4GGNA 1RWYA 1CDPA 1SL8A 3WNXB 1XFZO 2HQ8A 3EVRA 1WDCC 2LUCA 3D0YB
chains in the Genus database with same CATH superfamily
2JNFA 1LVCD 2KAYA 3D76A 3ZWHA 2AMIA 3S0BA 1BF5A 1DGVA 2JU0A 4MN0A 2CBLA 2JT0A 1KQMB 1M46A 1S5GY 1SCVA 2G9BA 1A29A 2L2CA 1B1GA 1UHJA 1OMDA 1CM4A 1SL9A 3AKBA 3NHTA 1A2XA 4ZCUA 4YGBB 2SASA 1OZSA 1SSEB 2F2PA 3UNWA 3SG7A 1XFVO 2PMYA 1D1OA 1JSAA 2LMVA 3K21A 2OTGC 3FS7A 4P5OE 2K8MB 1BLQA 2KDHA 3FIAA 1R6PA 1Y6WA 1QVIY 2KGBC 1S6CA 1XFWO 1QLSA 2L4IA 3N7HA 3BUNB 2Q91A 4CFQA 1XK4A 2KOTA 2ZN9A 2LLTA 2M7NA 1S36A 3R72A 4N1GA 1DMOA 1SPYA 2BCXA 3DVKA 4YI8A 4PALA 4M2OA 3JVTB 4I5JA 1DGUA 2WNDA 5F6TA 1N65A 5DICA 1IJ5A 3O4XA 4MZJA 2L2EA 2PYQA 4A4BA 1WRLA 2LVIA 2WOSA 4U8DA 3SG4A 1S5GZ 1S1EA 1YVLA 2GTEA 3FWBA 5CSJA 4YGEB 1CMFA 1XFYO 1F54A 2I94A 3PN7C 1QV0A 3RZSA 1Q80A 3NHIA 5I2OA 2JT8A 1BU3A 1QIVA 1CLBA 2LHLA 2F33A 1DC1A 4YI9A 1IWQA 2KGRA 1M39A 1MUXA 4I5KA 3TS5C 1QVIZ 4PT1A 1UURA 2LMTA 1MQ1A 3VRNA 4CFRA 1OMRA 2KPHA 2KLDA 2LLUA 2KAXA 1RROA 3VRQA 2EHBA 3DVEA 1L2OC 3O6BA 3LCPC 1NX1A 1QX2A 4ICBA 3PJIA 2PSRA 1QX5B 3LK1A 1V1FA 1YX7A 2L4HA 1NX3A 4PHKA 5I2QA 3V2LA 3OB2B 2OS8B 3B6XA 3TUYB 2KQ6A 2F3YA 3JTDB 4IJ7A 1UHIA 3O4YA 4A4CA 4HRGA 2PASA 2ZNDA 2BCBA 4NDCA 3BYAA 3S0AA 1QJTA 1ZMZA 4ORCB 3SJSA 2M3WA 3NXAA 2ZN8A 2JRFA 2BCAA 3OX6A 2BBNA 5KTYA 1NP8A 1S6JA 2WCKA 3TDIA 4HRHA 1EXRA 1A75A 1AJ4A 1F70A 1C3YA 3BUWB 3B88A 1GJYA 1EJ3A 2MLFC 1KFUL 3CWGA 2CNPA 3EK7A 3WHTB 1RFJA 2A4JA 2JQ6A 2GGZA 4GAOA 1A75B 2M49B 3D74A 5KSZA 3M0WA 1BR1B 1XVJA 5FI6A 1AK8A 1IH0A 2LCPA 5AEQA 1R2UA 2K0JA 3TZ1A 3BUXB 2CT9A 1XFXO 2KFHA 2FOTA 3ZNIA 1G8IA 5HKZA 1K9UA 4OKHA 2PVBA 1DEKA 1TN4A 2L50A 3D73A 1PRWA 3I5GB 2E6WA 1ORGA 3I5GC 2M7LA 2FJUB 1C07A 5HLVA 2HETA 1TOPA 2KYCA 5B8IB 1B7TY 2K2AA 1LA3A 2QACA 1BR4B 3HCMA 1CM1A 3D78A 1LINA 3FWCA 1MWNA 4XJKB 1QIWA 3I5FB 4GNKB 5JJGA 4OV2A 4GGFA 1SKTA 4E68A 1CFCA 3C1VA 2KBMA 3DF0A 1ODBA 3IF7A 4IL1A 1ALVA 1J1DA 1LS8A 1JFKA 2Y1NA 5JOLA 1EH2A 1F71A 1TCFA 1B4CA 1A4PA 2KFFA 1GM0A 1PVAA 2PRUA 2H8VA 4QJ5B 3DF0B 1K2HA 1IGVA 1YUSA 2KAVA 1GQMA 2LUXA 2M8UA 1LA0A 1NCXA 1UHKA 5K89A 4DRWA 1PVBA 1MHOA 4JWQA 1T14A 4OZDA 2LMUA 2ZRSA 2K7BA 1OOHA 3ICBA 1KQVA 1IJ6A 3NSKA 4CLNA 1CTRA 2JT3A 1KK7Y 2WC6A 1MR8A 1KQMC 4PDZA 1PULA 1KWOB 4I5LB 3DXLA 1B7TZ 1JF0A 1KK8B 2KQYA 1N0YA 3CABA 1M45A 4GBAA 2EC6B 4DIRA 1M63B 2PALA 4FTGA 1WRKA 4PHNA 3O78A 2KFGA 1YVHA 1QXPA 3DYEA 1C3ZA 1XYDA 4HSZA 2LC5A 5AXIA 5CSFA 1K95A 1IRJA 3D75A 2WCHA 3CR5X 5I8NA 1S6IA 3CYZA 3S0EA 4F0ZB 2V53A 2L98A 4XYNA 2AAOA 3BFHA 2O60A 3EKJA 4QJ3B 2FJYA 2WCEA 1TNQA 1MF8B 2BKIB 3I5HB 3KPXA 1K8UA 1H4BA 1K93D 3CGAA 3BFAA 1CDMA 1Y1XA 1IQ5A 1M31A 5G08A 5IBWA 1CFPA 1NIWA 1J7RA 2K7CA 1DJHA 2MJWB 2K60A 3JVTC 3Q8IA 1XK4C 3L47A 1SW8A 4MEWA 3CZTX 3D10A 4JD9A 1SCMB 2JZIA 4NDBA 4HREE 1S3PA 3R1VA 3VRPA 3MSEB 3DY9A 4MBEA 2R2IA 4YRUA 3LK0A 2QPTA 1H8BA 5FI2A 1XO5A 2D8NA 2LHIA 3IVTA 2ISDA 3CR4X 1DTLA 2LANA 2DOQA 2KLEA 2P6BB 1W7IB 2G2BA 2FCDA 2KSPA 3VGOA 2LVJA 5BPJA 1TWOA 4PCWA 2PQLA 3OB1B 5AANA 1DJYA 4OVNF 2JNXA 3SG2A 3K1EA 3DD4A 1SL7A 3KEVA 2LAPA 1QWVA 4AQJA 2HPSA 3OBVA 3CR2A 4JKTA 2QDIA 3CDNA 2NZ0A 1DQEA 2OS8C 3TUYC 4CIDA 1CLLA 3JTDC 3NSLA 4QJ4B 2WORA 3PFVA 4M2QA 2M9GA 2L51A 3L4LA 2ZNEA 2JOJA 2Y1MA 2YGUA 1B8RA 3B7AA 3PLFB 1TNXA 1SMGA 1B47A 1MXLC 2JXCA 5PALA 2K2FA 1FF1A 3I5IB 4GPLB 1KCYA 1J55A 1YTZC 5CSNA 1ZACA 2VRGA 4INXA 3BJHA 2MBXA 4C0JA 1CLMA 1F4QA 2WC5A 4OR9B 1GGWA 1B8CA 4ORAB 2BECA 1RECA 2MAZA 1NX2A 3SS5A 5CSIA 3AAKA 1K90D 3O2PA 2JC2A 2EGDA 3QRXA 5FYXA 2JTTA 2LV7A 4YGAA 1AVSA 1TUZA 1MXEA 1J7PA 1ALWA 4MSPA 1EL4A 2WC8A 4MLWA 3GK4X 2GGMA 1J1EA 3IQQA 1YURA 1AP4A 1QV1A 1ZOTB 3EK4A 1CDNA 5J3XA 1YRTB 3OX5A 2KI6D 1B9AA 1OOGA 2GV5A 3R1PA 3CS1A 1EG3A 1YX8A 1XFRA 4ORBB 1RJVA 5HL1A 1DJGA 1CFDA 1N2DA 1OW4A 4PHJA 1F4OA 2CCMA 4I5NB 2BL0B 1OQPA 1DF0A 3I5FC 1PSRA 1FPWA 1JFJA 4MRYA 5D69A 1LXFC 2BE6A 1YRUB 5GQQC 1TNPA 2COLB 2RGIA 2MLEC 1DF0B 2MA2A 4GGFC 3BQ3A 1WLMA 2CTNA 2ZFDA 1DJZA 2H61C 1NX0A 1K9KA 2L5XB 4OCIA 5D3OA 2KHNA 1V1GA 2JPOA 2F2OA 5TNCA 2NXQA 4YBHB 3BOWA 4DCKA 2KI4B 1K94A 4BY5A 2Y5IA 1J7QA 1BOCA 2WCBA 2E30A 1JBAA 4M2PA 2KBIA 4NQGA 1TUJA 3LL8B 3CLNA 3S0GA 1KWOC 3BOWB 1JWDA 2K7OA 4MZKA 1JF2A 2LP2A 1KK8C 4C0LA 2QEOA 1BT6A 2EC6C 1NCZA 1PSBA 1CDLA 1G4YR 1WDCB 1OOFA 3A4UB 3SS3A 1KSOA 1SYMA 5CPVA 2QEHA 1KSMA 3BXKA 2F3ZA 2B1UA 1E8AA 1SRAA 2HF5A 5ER5A 1K96A 5AERA 5D7FA 2LNKA 4N1FA 1PK0D 3TDZA 2ZKMX 2L5YA 4PE4A 1HQVA 3F45A 1UHNA 1UP5A 3CZ2A 4D1EA 5I2LA 3BFBA 2ERBA 5ER4X 1U5IA 3I5HC 2WCMA 1TCOB 1DJWA 1C7VA 3CZ1A 2KI6C 3PM2A 4CPVA 1KFXS 3SG3A 4N5XA 2OTGB 1L7ZA 1S26D 1TRFA 1XFUO 1Y1UA 4JQ0D 5HKYA 2BE4A 1A03A 1NPQA 1U5IB 3BUOB 1DELA 1KK7Z 3DVMA 3SIAA 1OZOA 1YUTA 1FBVA 2M0RA 1SCMC 3R1OA 4YGDB 5EL2A 3WHUB 5I94A 2H2KA 5HYDA 3SIBA 1UWOA 4FQOA 1IKUA 1QLKA 1XA5A 4GUKA 3PSRA 1ZFSA 3EKHA 2NCOA 2AUCA 1Z2CB 3VROA 3H4SE 1TIZA 2I7AA 3DZTA 4ETOA 2M1UA 1FW4A 4WRIA 1DT7B 4JPZB 2MHHA 3NSOA 1FI5A 1AHRA 2ZRTA 1OOIX 1X02A 1QATA 1KFXL 3PN7B 1JUOA 1UUSA 3AAJA 1Y1AA 2LVKA 1P28A 1AJ5A 1W7JB 2HQWA 4P2YB 1NUBA 2BBMA 4MZLA 2JTZA 1IIOA 1SBJA 1WLZA 3FE8A 3FE6A 4KYNA 1NWDA 1CMGA 1QTXA 1TTXA 3SG6A 2BNXA 2WCLA 3TS5B 3PATA 3HX4A 1IG5A 2M1KB 3EVVA 1IQ3A 1F8HA 3FE9A 3EVUA 3IQOA 1Z4HA 1QASA 4PHMA 3PALA 1DVIA 1SY9A 4NDDA 3VRRA 5AFPA 1L2OB 2OPOA 1VRKA 1EG4A 1KFUS 1SK6D 4AOMA 1J7OA 2P71A 2I2RE 2TN4A 3I5IC 4DS7A 1OE9B 1TNWA 1SR6B 2MRDA 2L0PA 3NGVA 5DKQA 2JPTA 2K61A 1SR6C 1Y0VH 2M29A 4UPGA 1YR5A 3SG5A 3NSIA 3RM1A 2JXLA 3GOFA 2LLSA 1BG1A 1FI6A 3VB1A 1B8LA 4GFTA 2I18A 1WY9A 1CNPA 1NCYA 1QS7A 3DVJA 4MRXA 3EG5B 4AQIA 4PE1A 3LLEA 1RK9A 4ZCVA 2BAPA 2LP3A 2KNEA 3KO0A 1NYAA 3GK1A 3L4AA 3UO9A 1NSHA 4F7FA 1CFFA 1BJFA 1BMOA 1UHHA 3B87A 3E3RA 5DKNA 1DJIA 4FQTA 3D77A 3EK8A 5HKWA 1CKKA 1DJXA 1HT9A 3OHMB 1GGZA 4PE0A 4TNCA 5HLOA 4DUQA 3RLZA 1RTP1 2LM5A 4USLA 2BKHB 3OP0A 3SS4A 4PE7A 2P70A 2NLNA 2BL0C 1OOJA 3CTNA 3WXAA 2O5GA 2JWWA 1F55A 2Y4QA 5KU1A 3OGNA 1C7WA 4Q04A 1OMVA 4INWA 2QEVA 2JULA 4XJKA 2WCJA 4YGCB 4C0KA 5DKRA 4WQ3A 3CZ0A 1G33A 1LKJA 3KF9A 3QMEA 1JC2A 1SNLA 3S0DA 1WRZA 1ZUZA 4WQ2A 1AUIB 4R1EA 3BUMB 4BY4A 2LVVA 2SCPA 2NCPA 3AKAA 3GK2A 2Q4UA 2KI4C 1PALA 4L9MA 2CXJA 2FCEA 5FI7A 2H61A 2WCFA 1W9ZA 2K7DA 1K9PA 3A8RA 4MVFA 3TDUA 2F8PA 3PM8A 2LE9B 2M97A 1CB1A 2KYFA 1OSAA 3D0YA 2QEBA 3KHEA 1QX7A 1BODA 2IS9A 1YUUA 3B86A 4GGNA 1RWYA 1CDPA 1SL8A 3WNXB 1XFZO 2HQ8A 3S0FA 3EVRA 1WDCC 2LUCA 3D0YB
chains in the Genus database with same CATH topology
2JNFA 1LVCD 2KAYA 3ZWHA 2AMIA 1BF5A 1DGVA 2JU0A 4MN0A 2CBLA 2JT0A 1KQMB 1M46A 1S5GY 1SCVA 2G9BA 1A29A 1B1GA 1UHJA 1OMDA 1CM4A 1SL9A 3AKBA 4ZCUA 1A2XA 4YGBB 2SASA 1OZSA 2F2PA 3SG7A 1XFVO 2PMYA 1D1OA 1JSAA 2LMVA 3K21A 2OTGC 3FS7A 4P5OE 2K8MB 1BLQA 2KDHA 3FIAA 1R6PA 1Y6WA 1QVIY 2KGBC 1S6CA 1XFWO 1QLSA 2L4IA 3BUNB 2Q91A 4CFQA 1XK4A 2KOTA 2ZN9A 2LLTA 2M7NA 1S36A 4N1GA 1DMOA 1SPYA 2BCXA 3DVKA 4YI8A 4PALA 4M2OA 3JVTB 4I5JA 1DGUA 2WNDA 5F6TA 1N65A 1IJ5A 4MZJA 2L2EA 4A4BA 1WRLA 2LVIA 2WOSA 4U8DA 3SG4A 1S5GZ 1S1EA 1YVLA 3FWBA 5CSJA 4YGEB 1F54A 1CMFA 1XFYO 2I94A 3PN7C 1QV0A 1Q80A 1CLBA 5I2OA 2JT8A 1BU3A 1QIVA 2LHLA 2F33A 4YI9A 1IWQA 2KGRA 1M39A 1MUXA 4I5KA 3TS5C 1QVIZ 1UURA 2LMTA 1MQ1A 3VRNA 4CFRA 1OMRA 2LLUA 2KAXA 1RROA 3VRQA 2EHBA 3DVEA 1L2OC 3O6BA 3LCPC 1NX1A 1QX2A 4ICBA 2PSRA 1QX5B 3LK1A 1V1FA 1YX7A 2L4HA 1NX3A 4PHKA 5I2QA 3OB2B 2OS8B 3TUYB 2KQ6A 2F3YA 3JTDB 1UHIA 3O4YA 4A4CA 4HRGA 2PASA 2ZNDA 2BCBA 4NDCA 3BYAA 1QJTA 1ZMZA 4ORCB 3SJSA 2M3WA 3NXAA 2ZN8A 2JRFA 2BCAA 3OX6A 2BBNA 5KTYA 1NP8A 1S6JA 3TDIA 4HRHA 1EXRA 1A75A 1AJ4A 1F70A 3BUWB 1GJYA 1EJ3A 2MLFC 1KFUL 3CWGA 2CNPA 3EK7A 3WHTB 1RFJA 2A4JA 2JQ6A 2GGZA 4GAOA 1A75B 2M49B 5KSZA 3M0WA 1BR1B 1XVJA 1AK8A 1IH0A 2LCPA 5AEQA 1R2UA 2K0JA 3TZ1A 3BUXB 2CT9A 1XFXO 2KFHA 2FOTA 3ZNIA 1G8IA 5HKZA 1K9UA 4OKHA 2PVBA 3I5GB 1TN4A 2L50A 1PRWA 2E6WA 3I5GC 2M7LA 2FJUB 1C07A 5HLVA 2HETA 1TOPA 2KYCA 5B8IB 1B7TY 2K2AA 1LA3A 2QACA 1BR4B 3HCMA 1CM1A 1LINA 3FWCA 1MWNA 4XJKB 1QIWA 3I5FB 4GNKB 5JJGA 4OV2A 4GGFA 1SKTA 4E68A 1CFCA 3C1VA 2KBMA 3DF0A 1ODBA 3IF7A 4IL1A 1ALVA 1J1DA 2Y1NA 1JFKA 5JOLA 1EH2A 1F71A 1TCFA 1B4CA 1A4PA 2KFFA 1PVAA 2PRUA 4QJ5B 3DF0B 1K2HA 1IGVA 1YUSA 2KAVA 1GQMA 2LUXA 2M8UA 1LA0A 1NCXA 1UHKA 5K89A 4DRWA 1PVBA 1MHOA 4JWQA 2LMUA 2ZRSA 2K7BA 3ICBA 1KQVA 1IJ6A 3NSKA 4CLNA 1CTRA 2JT3A 1KK7Y 1MR8A 1KQMC 4PDZA 1PULA 1KWOB 4I5LB 1B7TZ 1JF0A 1KK8B 2KQYA 1N0YA 1M45A 4GBAA 2EC6B 4DIRA 1M63B 2PALA 4FTGA 1WRKA 4PHNA 3O78A 2KFGA 1YVHA 1QXPA 1XYDA 4HSZA 5AXIA 2LC5A 5CSFA 1K95A 1IRJA 3CR5X 5I8NA 1S6IA 4F0ZB 2V53A 2L98A 4XYNA 2AAOA 2O60A 3EKJA 4QJ3B 2WCEA 1TNQA 1MF8B 2BKIB 3I5HB 3KPXA 1K8UA 1H4BA 1K93D 3CGAA 1CDMA 1Y1XA 1IQ5A 1M31A 5G08A 5IBWA 1CFPA 1NIWA 1J7RA 2K7CA 1DJHA 2MJWB 3JVTC 1XK4C 4MEWA 1SW8A 3CZTX 3D10A 1SCMB 2JZIA 4NDBA 4HREE 1S3PA 3VRPA 3MSEB 4MBEA 2R2IA 4YRUA 3LK0A 2QPTA 1H8BA 1XO5A 2D8NA 2LHIA 2ISDA 3CR4X 1DTLA 2LANA 2DOQA 2P6BB 1W7IB 2G2BA 2FCDA 2KSPA 3VGOA 2LVJA 5BPJA 4PCWA 3OB1B 5AANA 1DJYA 4OVNF 2JNXA 3SG2A 3DD4A 1SL7A 3KEVA 2LAPA 4AQJA 2HPSA 3CR2A 2NZ0A 2OS8C 3TUYC 4CIDA 1CLLA 3JTDC 3NSLA 4QJ4B 2WORA 3PFVA 4M2QA 2M9GA 2L51A 2ZNEA 2JOJA 2Y1MA 1B8RA 3PLFB 1TNXA 1SMGA 1B47A 1MXLC 2JXCA 5PALA 2K2FA 1FF1A 3I5IB 4GPLB 1KCYA 1J55A 1YTZC 5CSNA 1ZACA 2VRGA 2MBXA 4C0JA 1CLMA 1F4QA 4OR9B 1GGWA 1B8CA 4ORAB 2BECA 1RECA 2MAZA 1NX2A 5CSIA 3AAKA 1K90D 3O2PA 2JC2A 2EGDA 3QRXA 5FYXA 2JTTA 2LV7A 4YGAA 1AVSA 1MXEA 1J7PA 1ALWA 4MSPA 1EL4A 2WC8A 4MLWA 3GK4X 2GGMA 1J1EA 3IQQA 1YURA 1AP4A 1QV1A 1ZOTB 3EK4A 1CDNA 5J3XA 1YRTB 3OX5A 2KI6D 1B9AA 2GV5A 3CS1A 1EG3A 1YX8A 4ORBB 1RJVA 1DJGA 1CFDA 1N2DA 4PHJA 1F4OA 2CCMA 4I5NB 2BL0B 1OQPA 1DF0A 3I5FC 1PSRA 1FPWA 1JFJA 4MRYA 5D69A 1LXFC 2BE6A 1YRUB 5GQQC 1TNPA 2COLB 2RGIA 2MLEC 1DF0B 2MA2A 4GGFC 3BQ3A 1WLMA 2CTNA 2ZFDA 1DJZA 2H61C 1NX0A 1K9KA 2L5XB 4OCIA 2KHNA 1V1GA 2F2OA 5TNCA 2NXQA 4YBHB 3BOWA 4DCKA 2KI4B 1K94A 4BY5A 2Y5IA 1J7QA 1BOCA 2WCBA 2E30A 1JBAA 4M2PA 2KBIA 4NQGA 3LL8B 3CLNA 1KWOC 3BOWB 1JWDA 2K7OA 4MZKA 1JF2A 2LP2A 1KK8C 4C0LA 1BT6A 2EC6C 1NCZA 1PSBA 1CDLA 1G4YR 1WDCB 3A4UB 1KSOA 1SYMA 5CPVA 1KSMA 3BXKA 2F3ZA 2B1UA 1E8AA 1SRAA 2HF5A 5ER5A 1K96A 5AERA 5D7FA 2LNKA 4N1FA 1PK0D 3TDZA 2ZKMX 4PE4A 1HQVA 3F45A 1UHNA 1UP5A 4D1EA 5I2LA 5ER4X 1U5IA 3I5HC 1TCOB 1DJWA 1C7VA 2KI6C 4CPVA 1KFXS 3SG3A 4N5XA 2OTGB 1L7ZA 1S26D 1TRFA 1XFUO 1Y1UA 4JQ0D 5HKYA 2BE4A 1A03A 1NPQA 1U5IB 3BUOB 1KK7Z 3DVMA 3SIAA 1OZOA 1YUTA 1FBVA 2M0RA 1SCMC 4YGDB 3WHUB 2H2KA 5HYDA 3SIBA 1UWOA 4FQOA 1IKUA 1QLKA 1XA5A 4GUKA 3PSRA 1ZFSA 3EKHA 2NCOA 2AUCA 3VROA 3H4SE 1TIZA 2I7AA 4ETOA 2M1UA 1FW4A 4WRIA 1DT7B 4JPZB 2MHHA 3NSOA 1FI5A 1AHRA 2ZRTA 1X02A 1QATA 1KFXL 3PN7B 1JUOA 1UUSA 3AAJA 1Y1AA 2LVKA 1AJ5A 1W7JB 2HQWA 4P2YB 1NUBA 2BBMA 4MZLA 2JTZA 1SBJA 1WLZA 1NWDA 1CMGA 1QTXA 1TTXA 3SG6A 3TS5B 3PATA 3HX4A 1IG5A 2M1KB 3EVVA 1IQ3A 1F8HA 3EVUA 3IQOA 1QASA 4PHMA 3PALA 1DVIA 1SY9A 4NDDA 3VRRA 5AFPA 1L2OB 2OPOA 1VRKA 1EG4A 1KFUS 1SK6D 4AOMA 1J7OA 3I5IC 2I2RE 2TN4A 4DS7A 1OE9B 1TNWA 1SR6B 2MRDA 2L0PA 5DKQA 2JPTA 2K61A 1SR6C 1Y0VH 2M29A 4UPGA 1YR5A 3SG5A 3NSIA 3RM1A 2JXLA 3GOFA 2LLSA 1BG1A 1FI6A 1B8LA 4GFTA 2I18A 1WY9A 1CNPA 1NCYA 1QS7A 3DVJA 4MRXA 4AQIA 4PE1A 3LLEA 1RK9A 4ZCVA 2LP3A 2KNEA 3KO0A 1NYAA 3GK1A 1NSHA 1CFFA 1BJFA 1BMOA 1UHHA 3E3RA 5DKNA 1DJIA 5HKWA 3EK8A 1CKKA 1DJXA 1HT9A 3OHMB 1GGZA 4PE0A 4TNCA 5HLOA 4DUQA 3RLZA 1RTP1 2LM5A 4USLA 2BKHB 3OP0A 4PE7A 2NLNA 2BL0C 1OOJA 3CTNA 3WXAA 2O5GA 2JWWA 1F55A 2Y4QA 5KU1A 1C7WA 4Q04A 1OMVA 2JULA 4XJKA 4YGCB 4C0KA 5DKRA 4WQ3A 1G33A 1LKJA 3KF9A 1JC2A 1SNLA 1WRZA 1ZUZA 4WQ2A 1AUIB 4R1EA 3BUMB 4BY4A 2LVVA 2SCPA 2NCPA 3AKAA 3GK2A 2Q4UA 2KI4C 1PALA 4L9MA 2CXJA 2FCEA 2H61A 2WCFA 3A8RA 2K7DA 1K9PA 4MVFA 3TDUA 2F8PA 3PM8A 2LE9B 2M97A 1CB1A 2KYFA 1OSAA 3D0YA 3KHEA 1QX7A 1BODA 2IS9A 1YUUA 4GGNA 1RWYA 1CDPA 1SL8A 3WNXB 1XFZO 2HQ8A 3EVRA 1WDCC 2LUCA 3D0YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JNF A;  1LVC D;  2KAY A;  3ZWH A;  2AMI A;  1BF5 A;  1DGV A;  2JU0 A;  4MN0 A;  2CBL A;  2JT0 A;  1KQM B;  1M46 A;  1S5G Y;  1SCV A;  2G9B A;  1A29 A;  1B1G A;  1UHJ A;  1OMD A;  1CM4 A;  1SL9 A;  3AKB A;  4ZCU A;  1A2X A;  4YGB B;  2SAS A;  1OZS A;  2F2P A;  3SG7 A;  1XFV O;  2PMY A;  1D1O A;  1JSA A;  2LMV A;  3K21 A;  2OTG C;  3FS7 A;  4P5O E;  2K8M B;  1BLQ A;  2KDH A;  3FIA A;  1R6P A;  1Y6W A;  1QVI Y;  2KGB C;  1S6C A;  1XFW O;  1QLS A;  2L4I A;  3BUN B;  2Q91 A;  4CFQ A;  1XK4 A;  2KOT A;  2ZN9 A;  2LLT A;  2M7N A;  1S36 A;  4N1G A;  1DMO A;  1SPY A;  2BCX A;  3DVK A;  4YI8 A;  4PAL A;  4M2O A;  3JVT B;  4I5J A;  1DGU A;  2WND A;  5F6T A;  1N65 A;  1IJ5 A;  4MZJ A;  2L2E A;  4A4B A;  1WRL A;  2LVI A;  2WOS A;  4U8D A;  3SG4 A;  1S5G Z;  1S1E A;  1YVL A;  3FWB A;  5CSJ A;  4YGE B;  1F54 A;  1CMF A;  1XFY O;  2I94 A;  3PN7 C;  1QV0 A;  1Q80 A;  1CLB A;  5I2O A;  2JT8 A;  1BU3 A;  1QIV A;  2LHL A;  2F33 A;  4YI9 A;  1IWQ A;  2KGR A;  1M39 A;  1MUX A;  4I5K A;  3TS5 C;  1QVI Z;  1UUR A;  2LMT A;  1MQ1 A;  3VRN A;  4CFR A;  1OMR A;  2LLU A;  2KAX A;  1RRO A;  3VRQ A;  2EHB A;  3DVE A;  1L2O C;  3O6B A;  3LCP C;  1NX1 A;  1QX2 A;  4ICB A;  2PSR A;  1QX5 B;  3LK1 A;  1V1F A;  1YX7 A;  2L4H A;  1NX3 A;  4PHK A;  5I2Q A;  3OB2 B;  2OS8 B;  3TUY B;  2KQ6 A;  2F3Y A;  3JTD B;  1UHI A;  3O4Y A;  4A4C A;  4HRG A;  2PAS A;  2ZND A;  2BCB A;  4NDC A;  3BYA A;  1QJT A;  1ZMZ A;  4ORC B;  3SJS A;  2M3W A;  3NXA A;  2ZN8 A;  2JRF A;  2BCA A;  3OX6 A;  2BBN A;  5KTY A;  1NP8 A;  1S6J A;  3TDI A;  4HRH A;  1EXR A;  1A75 A;  1AJ4 A;  1F70 A;  3BUW B;  1GJY A;  1EJ3 A;  2MLF C;  1KFU L;  3CWG A;  2CNP A;  3EK7 A;  3WHT B;  1RFJ A;  2A4J A;  2JQ6 A;  2GGZ A;  4GAO A;  1A75 B;  2M49 B;  5KSZ A;  3M0W A;  1BR1 B;  1XVJ A;  1AK8 A;  1IH0 A;  2LCP A;  5AEQ A;  1R2U A;  2K0J A;  3TZ1 A;  3BUX B;  2CT9 A;  1XFX O;  2KFH A;  2FOT A;  3ZNI A;  1G8I A;  5HKZ A;  1K9U A;  4OKH A;  2PVB A;  3I5G B;  1TN4 A;  2L50 A;  1PRW A;  2E6W A;  3I5G C;  2M7L A;  2FJU B;  1C07 A;  5HLV A;  2HET A;  1TOP A;  2KYC A;  5B8I B;  1B7T Y;  2K2A A;  1LA3 A;  2QAC A;  1BR4 B;  3HCM A;  1CM1 A;  1LIN A;  3FWC A;  1MWN A;  4XJK B;  1QIW A;  3I5F B;  4GNK B;  5JJG A;  4OV2 A;  4GGF A;  1SKT A;  4E68 A;  1CFC A;  3C1V A;  2KBM A;  3DF0 A;  1ODB A;  3IF7 A;  4IL1 A;  1ALV A;  1J1D A;  2Y1N A;  1JFK A;  5JOL A;  1EH2 A;  1F71 A;  1TCF A;  1B4C A;  1A4P A;  2KFF A;  1PVA A;  2PRU A;  4QJ5 B;  3DF0 B;  1K2H A;  1IGV A;  1YUS A;  2KAV A;  1GQM A;  2LUX A;  2M8U A;  1LA0 A;  1NCX A;  1UHK A;  5K89 A;  4DRW A;  1PVB A;  1MHO A;  4JWQ A;  2LMU A;  2ZRS A;  2K7B A;  3ICB A;  1KQV A;  1IJ6 A;  3NSK A;  4CLN A;  1CTR A;  2JT3 A;  1KK7 Y;  1MR8 A;  1KQM C;  4PDZ A;  1PUL A;  1KWO B;  4I5L B;  1B7T Z;  1JF0 A;  1KK8 B;  2KQY A;  1N0Y A;  1M45 A;  4GBA A;  2EC6 B;  4DIR A;  1M63 B;  2PAL A;  4FTG A;  1WRK A;  4PHN A;  3O78 A;  2KFG A;  1YVH A;  1QXP A;  1XYD A;  4HSZ A;  5AXI A;  2LC5 A;  5CSF A;  1K95 A;  1IRJ A;  3CR5 X;  5I8N A;  1S6I A;  4F0Z B;  2V53 A;  2L98 A;  4XYN A;  2AAO A;  2O60 A;  3EKJ A;  4QJ3 B;  2WCE A;  1TNQ A;  1MF8 B;  2BKI B;  3I5H B;  3KPX A;  1K8U A;  1H4B A;  1K93 D;  3CGA A;  1CDM A;  1Y1X A;  1IQ5 A;  1M31 A;  5G08 A;  5IBW A;  1CFP A;  1NIW A;  1J7R A;  2K7C A;  1DJH A;  2MJW B;  3JVT C;  1XK4 C;  4MEW A;  1SW8 A;  3CZT X;  3D10 A;  1SCM B;  2JZI A;  4NDB A;  4HRE E;  1S3P A;  3VRP A;  3MSE B;  4MBE A;  2R2I A;  4YRU A;  3LK0 A;  2QPT A;  1H8B A;  1XO5 A;  2D8N A;  2LHI A;  2ISD A;  3CR4 X;  1DTL A;  2LAN A;  2DOQ A;  2P6B B;  1W7I B;  2G2B A;  2FCD A;  2KSP A;  3VGO A;  2LVJ A;  5BPJ A;  4PCW A;  3OB1 B;  5AAN A;  1DJY A;  4OVN F;  2JNX A;  3SG2 A;  3DD4 A;  1SL7 A;  3KEV A;  2LAP A;  4AQJ A;  2HPS A;  3CR2 A;  2NZ0 A;  2OS8 C;  3TUY C;  4CID A;  1CLL A;  3JTD C;  3NSL A;  4QJ4 B;  2WOR A;  3PFV A;  4M2Q A;  2M9G A;  2L51 A;  2ZNE A;  2JOJ A;  2Y1M A;  1B8R A;  3PLF B;  1TNX A;  1SMG A;  1B47 A;  1MXL C;  2JXC A;  5PAL A;  2K2F A;  1FF1 A;  3I5I B;  4GPL B;  1KCY A;  1J55 A;  1YTZ C;  5CSN A;  1ZAC A;  2VRG A;  2MBX A;  4C0J A;  1CLM A;  1F4Q A;  4OR9 B;  1GGW A;  1B8C A;  4ORA B;  2BEC A;  1REC A;  2MAZ A;  1NX2 A;  5CSI A;  3AAK A;  1K90 D;  3O2P A;  2JC2 A;  2EGD A;  3QRX A;  5FYX A;  2JTT A;  2LV7 A;  4YGA A;  1AVS A;  1MXE A;  1J7P A;  1ALW A;  4MSP A;  1EL4 A;  2WC8 A;  4MLW A;  3GK4 X;  2GGM A;  1J1E A;  3IQQ A;  1YUR A;  1AP4 A;  1QV1 A;  1ZOT B;  3EK4 A;  1CDN A;  5J3X A;  1YRT B;  3OX5 A;  2KI6 D;  1B9A A;  2GV5 A;  3CS1 A;  1EG3 A;  1YX8 A;  4ORB B;  1RJV A;  1DJG A;  1CFD A;  1N2D A;  4PHJ A;  1F4O A;  2CCM A;  4I5N B;  2BL0 B;  1OQP A;  1DF0 A;  3I5F C;  1PSR A;  1FPW A;  1JFJ A;  4MRY A;  5D69 A;  1LXF C;  2BE6 A;  1YRU B;  5GQQ C;  1TNP A;  2COL B;  2RGI A;  2MLE C;  1DF0 B;  2MA2 A;  4GGF C;  3BQ3 A;  1WLM A;  2CTN A;  2ZFD A;  1DJZ A;  2H61 C;  1NX0 A;  1K9K A;  2L5X B;  4OCI A;  2KHN A;  1V1G A;  2F2O A;  5TNC A;  2NXQ A;  4YBH B;  3BOW A;  4DCK A;  2KI4 B;  1K94 A;  4BY5 A;  2Y5I A;  1J7Q A;  1BOC A;  2WCB A;  2E30 A;  1JBA A;  4M2P A;  2KBI A;  4NQG A;  3LL8 B;  3CLN A;  1KWO C;  3BOW B;  1JWD A;  2K7O A;  4MZK A;  1JF2 A;  2LP2 A;  1KK8 C;  4C0L A;  1BT6 A;  2EC6 C;  1NCZ A;  1PSB A;  1CDL A;  1G4Y R;  1WDC B;  3A4U B;  1KSO A;  1SYM A;  5CPV A;  1KSM A;  3BXK A;  2F3Z A;  2B1U A;  1E8A A;  1SRA A;  2HF5 A;  5ER5 A;  1K96 A;  5AER A;  5D7F A;  2LNK A;  4N1F A;  1PK0 D;  3TDZ A;  2ZKM X;  4PE4 A;  1HQV A;  3F45 A;  1UHN A;  1UP5 A;  4D1E A;  5I2L A;  5ER4 X;  1U5I A;  3I5H C;  1TCO B;  1DJW A;  1C7V A;  2KI6 C;  4CPV A;  1KFX S;  3SG3 A;  4N5X A;  2OTG B;  1L7Z A;  1S26 D;  1TRF A;  1XFU O;  1Y1U A;  4JQ0 D;  5HKY A;  2BE4 A;  1A03 A;  1NPQ A;  1U5I B;  3BUO B;  1KK7 Z;  3DVM A;  3SIA A;  1OZO A;  1YUT A;  1FBV A;  2M0R A;  1SCM C;  4YGD B;  3WHU B;  2H2K A;  5HYD A;  3SIB A;  1UWO A;  4FQO A;  1IKU A;  1QLK A;  1XA5 A;  4GUK A;  3PSR A;  1ZFS A;  3EKH A;  2NCO A;  2AUC A;  3VRO A;  3H4S E;  1TIZ A;  2I7A A;  4ETO A;  2M1U A;  1FW4 A;  4WRI A;  1DT7 B;  4JPZ B;  2MHH A;  3NSO A;  1FI5 A;  1AHR A;  2ZRT A;  1X02 A;  1QAT A;  1KFX L;  3PN7 B;  1JUO A;  1UUS A;  3AAJ A;  1Y1A A;  2LVK A;  1AJ5 A;  1W7J B;  2HQW A;  4P2Y B;  1NUB A;  2BBM A;  4MZL A;  2JTZ A;  1SBJ A;  1WLZ A;  1NWD A;  1CMG A;  1QTX A;  1TTX A;  3SG6 A;  3TS5 B;  3PAT A;  3HX4 A;  1IG5 A;  2M1K B;  3EVV A;  1IQ3 A;  1F8H A;  3EVU A;  3IQO A;  1QAS A;  4PHM A;  3PAL A;  1DVI A;  1SY9 A;  4NDD A;  3VRR A;  5AFP A;  1L2O B;  2OPO A;  1VRK A;  1EG4 A;  1KFU S;  1SK6 D;  4AOM A;  1J7O A;  3I5I C;  2I2R E;  2TN4 A;  4DS7 A;  1OE9 B;  1TNW A;  1SR6 B;  2MRD A;  2L0P A;  5DKQ A;  2JPT A;  2K61 A;  1SR6 C;  1Y0V H;  2M29 A;  4UPG A;  1YR5 A;  3SG5 A;  3NSI A;  3RM1 A;  2JXL A;  3GOF A;  2LLS A;  1BG1 A;  1FI6 A;  1B8L A;  4GFT A;  2I18 A;  1WY9 A;  1CNP A;  1NCY A;  1QS7 A;  3DVJ A;  4MRX A;  4AQI A;  4PE1 A;  3LLE A;  1RK9 A;  4ZCV A;  2LP3 A;  2KNE A;  3KO0 A;  1NYA A;  3GK1 A;  1NSH A;  1CFF A;  1BJF A;  1BMO A;  1UHH A;  3E3R A;  5DKN A;  1DJI A;  5HKW A;  3EK8 A;  1CKK A;  1DJX A;  1HT9 A;  3OHM B;  1GGZ A;  4PE0 A;  4TNC A;  5HLO A;  4DUQ A;  3RLZ A;  1RTP 1;  2LM5 A;  4USL A;  2BKH B;  3OP0 A;  4PE7 A;  2NLN A;  2BL0 C;  1OOJ A;  3CTN A;  3WXA A;  2O5G A;  2JWW A;  1F55 A;  2Y4Q A;  5KU1 A;  1C7W A;  4Q04 A;  1OMV A;  2JUL A;  4XJK A;  4YGC B;  4C0K A;  5DKR A;  4WQ3 A;  1G33 A;  1LKJ A;  3KF9 A;  1JC2 A;  1SNL A;  1WRZ A;  1ZUZ A;  4WQ2 A;  1AUI B;  4R1E A;  3BUM B;  4BY4 A;  2LVV A;  2SCP A;  2NCP A;  3AKA A;  3GK2 A;  2Q4U A;  2KI4 C;  1PAL A;  4L9M A;  2CXJ A;  2FCE A;  2H61 A;  2WCF A;  3A8R A;  2K7D A;  1K9P A;  4MVF A;  3TDU A;  2F8P A;  3PM8 A;  2LE9 B;  2M97 A;  1CB1 A;  2KYF A;  1OSA A;  3D0Y A;  3KHE A;  1QX7 A;  1BOD A;  2IS9 A;  1YUU A;  4GGN A;  1RWY A;  1CDP A;  1SL8 A;  3WNX B;  1XFZ O;  2HQ8 A;  3EVR A;  1WDC C;  2LUC A;  3D0Y B; 
#chains in the Genus database with same CATH topology
 2JNF A;  1LVC D;  2KAY A;  3D76 A;  3ZWH A;  2AMI A;  3S0B A;  1BF5 A;  1DGV A;  2JU0 A;  4MN0 A;  2CBL A;  2JT0 A;  1KQM B;  1M46 A;  1S5G Y;  1SCV A;  2G9B A;  1A29 A;  2L2C A;  1B1G A;  1UHJ A;  1OMD A;  1CM4 A;  1SL9 A;  3AKB A;  3NHT A;  1A2X A;  4ZCU A;  4YGB B;  2SAS A;  1OZS A;  1SSE B;  2F2P A;  3UNW A;  3SG7 A;  1XFV O;  2PMY A;  1D1O A;  1JSA A;  2LMV A;  3K21 A;  2OTG C;  3FS7 A;  4P5O E;  2K8M B;  1BLQ A;  2KDH A;  3FIA A;  1R6P A;  1Y6W A;  1QVI Y;  2KGB C;  1S6C A;  1XFW O;  1QLS A;  2L4I A;  3N7H A;  3BUN B;  2Q91 A;  4CFQ A;  1XK4 A;  2KOT A;  2ZN9 A;  2LLT A;  2M7N A;  1S36 A;  3R72 A;  4N1G A;  1DMO A;  1SPY A;  2BCX A;  3DVK A;  4YI8 A;  4PAL A;  4M2O A;  3JVT B;  4I5J A;  1DGU A;  2WND A;  5F6T A;  1N65 A;  5DIC A;  1IJ5 A;  3O4X A;  4MZJ A;  2L2E A;  2PYQ A;  4A4B A;  1WRL A;  2LVI A;  2WOS A;  4U8D A;  3SG4 A;  1S5G Z;  1S1E A;  1YVL A;  2GTE A;  3FWB A;  5CSJ A;  4YGE B;  1CMF A;  1XFY O;  1F54 A;  2I94 A;  3PN7 C;  1QV0 A;  3RZS A;  1Q80 A;  3NHI A;  5I2O A;  2JT8 A;  1BU3 A;  1QIV A;  1CLB A;  2LHL A;  2F33 A;  1DC1 A;  4YI9 A;  1IWQ A;  2KGR A;  1M39 A;  1MUX A;  4I5K A;  3TS5 C;  1QVI Z;  4PT1 A;  1UUR A;  2LMT A;  1MQ1 A;  3VRN A;  4CFR A;  1OMR A;  2KPH A;  2KLD A;  2LLU A;  2KAX A;  1RRO A;  3VRQ A;  2EHB A;  3DVE A;  1L2O C;  3O6B A;  3LCP C;  1NX1 A;  1QX2 A;  4ICB A;  3PJI A;  2PSR A;  1QX5 B;  3LK1 A;  1V1F A;  1YX7 A;  2L4H A;  1NX3 A;  4PHK A;  5I2Q A;  3V2L A;  3OB2 B;  2OS8 B;  3B6X A;  3TUY B;  2KQ6 A;  2F3Y A;  3JTD B;  4IJ7 A;  1UHI A;  3O4Y A;  4A4C A;  4HRG A;  2PAS A;  2ZND A;  2BCB A;  4NDC A;  3BYA A;  3S0A A;  1QJT A;  1ZMZ A;  4ORC B;  3SJS A;  2M3W A;  3NXA A;  2ZN8 A;  2JRF A;  2BCA A;  3OX6 A;  2BBN A;  5KTY A;  1NP8 A;  1S6J A;  2WCK A;  3TDI A;  4HRH A;  1EXR A;  1A75 A;  1AJ4 A;  1F70 A;  1C3Y A;  3BUW B;  3B88 A;  1GJY A;  1EJ3 A;  2MLF C;  1KFU L;  3CWG A;  2CNP A;  3EK7 A;  3WHT B;  1RFJ A;  2A4J A;  2JQ6 A;  2GGZ A;  4GAO A;  1A75 B;  2M49 B;  3D74 A;  5KSZ A;  3M0W A;  1BR1 B;  1XVJ A;  5FI6 A;  1AK8 A;  1IH0 A;  2LCP A;  5AEQ A;  1R2U A;  2K0J A;  3TZ1 A;  3BUX B;  2CT9 A;  1XFX O;  2KFH A;  2FOT A;  3ZNI A;  1G8I A;  5HKZ A;  1K9U A;  4OKH A;  2PVB A;  1DEK A;  1TN4 A;  2L50 A;  3D73 A;  1PRW A;  3I5G B;  2E6W A;  1ORG A;  3I5G C;  2M7L A;  2FJU B;  1C07 A;  5HLV A;  2HET A;  1TOP A;  2KYC A;  5B8I B;  1B7T Y;  2K2A A;  1LA3 A;  2QAC A;  1BR4 B;  3HCM A;  1CM1 A;  3D78 A;  1LIN A;  3FWC A;  1MWN A;  4XJK B;  1QIW A;  3I5F B;  4GNK B;  5JJG A;  4OV2 A;  4GGF A;  1SKT A;  4E68 A;  1CFC A;  3C1V A;  2KBM A;  3DF0 A;  1ODB A;  3IF7 A;  4IL1 A;  1ALV A;  1J1D A;  1LS8 A;  1JFK A;  2Y1N A;  5JOL A;  1EH2 A;  1F71 A;  1TCF A;  1B4C A;  1A4P A;  2KFF A;  1GM0 A;  1PVA A;  2PRU A;  2H8V A;  4QJ5 B;  3DF0 B;  1K2H A;  1IGV A;  1YUS A;  2KAV A;  1GQM A;  2LUX A;  2M8U A;  1LA0 A;  1NCX A;  1UHK A;  5K89 A;  4DRW A;  1PVB A;  1MHO A;  4JWQ A;  1T14 A;  4OZD A;  2LMU A;  2ZRS A;  2K7B A;  1OOH A;  3ICB A;  1KQV A;  1IJ6 A;  3NSK A;  4CLN A;  1CTR A;  2JT3 A;  1KK7 Y;  2WC6 A;  1MR8 A;  1KQM C;  4PDZ A;  1PUL A;  1KWO B;  4I5L B;  3DXL A;  1B7T Z;  1JF0 A;  1KK8 B;  2KQY A;  1N0Y A;  3CAB A;  1M45 A;  4GBA A;  2EC6 B;  4DIR A;  1M63 B;  2PAL A;  4FTG A;  1WRK A;  4PHN A;  3O78 A;  2KFG A;  1YVH A;  1QXP A;  3DYE A;  1C3Z A;  1XYD A;  4HSZ A;  2LC5 A;  5AXI A;  5CSF A;  1K95 A;  1IRJ A;  3D75 A;  2WCH A;  3CR5 X;  5I8N A;  1S6I A;  3CYZ A;  3S0E A;  4F0Z B;  2V53 A;  2L98 A;  4XYN A;  2AAO A;  3BFH A;  2O60 A;  3EKJ A;  4QJ3 B;  2FJY A;  2WCE A;  1TNQ A;  1MF8 B;  2BKI B;  3I5H B;  3KPX A;  1K8U A;  1H4B A;  1K93 D;  3CGA A;  3BFA A;  1CDM A;  1Y1X A;  1IQ5 A;  1M31 A;  5G08 A;  5IBW A;  1CFP A;  1NIW A;  1J7R A;  2K7C A;  1DJH A;  2MJW B;  2K60 A;  3JVT C;  3Q8I A;  1XK4 C;  3L47 A;  1SW8 A;  4MEW A;  3CZT X;  3D10 A;  4JD9 A;  1SCM B;  2JZI A;  4NDB A;  4HRE E;  1S3P A;  3R1V A;  3VRP A;  3MSE B;  3DY9 A;  4MBE A;  2R2I A;  4YRU A;  3LK0 A;  2QPT A;  1H8B A;  5FI2 A;  1XO5 A;  2D8N A;  2LHI A;  3IVT A;  2ISD A;  3CR4 X;  1DTL A;  2LAN A;  2DOQ A;  2KLE A;  2P6B B;  1W7I B;  2G2B A;  2FCD A;  2KSP A;  3VGO A;  2LVJ A;  5BPJ A;  1TWO A;  4PCW A;  2PQL A;  3OB1 B;  5AAN A;  1DJY A;  4OVN F;  2JNX A;  3SG2 A;  3K1E A;  3DD4 A;  1SL7 A;  3KEV A;  2LAP A;  1QWV A;  4AQJ A;  2HPS A;  3OBV A;  3CR2 A;  4JKT A;  2QDI A;  3CDN A;  2NZ0 A;  1DQE A;  2OS8 C;  3TUY C;  4CID A;  1CLL A;  3JTD C;  3NSL A;  4QJ4 B;  2WOR A;  3PFV A;  4M2Q A;  2M9G A;  2L51 A;  3L4L A;  2ZNE A;  2JOJ A;  2Y1M A;  2YGU A;  1B8R A;  3B7A A;  3PLF B;  1TNX A;  1SMG A;  1B47 A;  1MXL C;  2JXC A;  5PAL A;  2K2F A;  1FF1 A;  3I5I B;  4GPL B;  1KCY A;  1J55 A;  1YTZ C;  5CSN A;  1ZAC A;  2VRG A;  4INX A;  3BJH A;  2MBX A;  4C0J A;  1CLM A;  1F4Q A;  2WC5 A;  4OR9 B;  1GGW A;  1B8C A;  4ORA B;  2BEC A;  1REC A;  2MAZ A;  1NX2 A;  3SS5 A;  5CSI A;  3AAK A;  1K90 D;  3O2P A;  2JC2 A;  2EGD A;  3QRX A;  5FYX A;  2JTT A;  2LV7 A;  4YGA A;  1AVS A;  1TUZ A;  1MXE A;  1J7P A;  1ALW A;  4MSP A;  1EL4 A;  2WC8 A;  4MLW A;  3GK4 X;  2GGM A;  1J1E A;  3IQQ A;  1YUR A;  1AP4 A;  1QV1 A;  1ZOT B;  3EK4 A;  1CDN A;  5J3X A;  1YRT B;  3OX5 A;  2KI6 D;  1B9A A;  1OOG A;  2GV5 A;  3R1P A;  3CS1 A;  1EG3 A;  1YX8 A;  1XFR A;  4ORB B;  1RJV A;  5HL1 A;  1DJG A;  1CFD A;  1N2D A;  1OW4 A;  4PHJ A;  1F4O A;  2CCM A;  4I5N B;  2BL0 B;  1OQP A;  1DF0 A;  3I5F C;  1PSR A;  1FPW A;  1JFJ A;  4MRY A;  5D69 A;  1LXF C;  2BE6 A;  1YRU B;  5GQQ C;  1TNP A;  2COL B;  2RGI A;  2MLE C;  1DF0 B;  2MA2 A;  4GGF C;  3BQ3 A;  1WLM A;  2CTN A;  2ZFD A;  1DJZ A;  2H61 C;  1NX0 A;  1K9K A;  2L5X B;  4OCI A;  5D3O A;  2KHN A;  1V1G A;  2JPO A;  2F2O A;  5TNC A;  2NXQ A;  4YBH B;  3BOW A;  4DCK A;  2KI4 B;  1K94 A;  4BY5 A;  2Y5I A;  1J7Q A;  1BOC A;  2WCB A;  2E30 A;  1JBA A;  4M2P A;  2KBI A;  4NQG A;  1TUJ A;  3LL8 B;  3CLN A;  3S0G A;  1KWO C;  3BOW B;  1JWD A;  2K7O A;  4MZK A;  1JF2 A;  2LP2 A;  1KK8 C;  4C0L A;  2QEO A;  1BT6 A;  2EC6 C;  1NCZ A;  1PSB A;  1CDL A;  1G4Y R;  1WDC B;  1OOF A;  3A4U B;  3SS3 A;  1KSO A;  1SYM A;  5CPV A;  2QEH A;  1KSM A;  3BXK A;  2F3Z A;  2B1U A;  1E8A A;  1SRA A;  2HF5 A;  5ER5 A;  1K96 A;  5AER A;  5D7F A;  2LNK A;  4N1F A;  1PK0 D;  3TDZ A;  2ZKM X;  2L5Y A;  4PE4 A;  1HQV A;  3F45 A;  1UHN A;  1UP5 A;  3CZ2 A;  4D1E A;  5I2L A;  3BFB A;  2ERB A;  5ER4 X;  1U5I A;  3I5H C;  2WCM A;  1TCO B;  1DJW A;  1C7V A;  3CZ1 A;  2KI6 C;  3PM2 A;  4CPV A;  1KFX S;  3SG3 A;  4N5X A;  2OTG B;  1L7Z A;  1S26 D;  1TRF A;  1XFU O;  1Y1U A;  4JQ0 D;  5HKY A;  2BE4 A;  1A03 A;  1NPQ A;  1U5I B;  3BUO B;  1DEL A;  1KK7 Z;  3DVM A;  3SIA A;  1OZO A;  1YUT A;  1FBV A;  2M0R A;  1SCM C;  3R1O A;  4YGD B;  5EL2 A;  3WHU B;  5I94 A;  2H2K A;  5HYD A;  3SIB A;  1UWO A;  4FQO A;  1IKU A;  1QLK A;  1XA5 A;  4GUK A;  3PSR A;  1ZFS A;  3EKH A;  2NCO A;  2AUC A;  1Z2C B;  3VRO A;  3H4S E;  1TIZ A;  2I7A A;  3DZT A;  4ETO A;  2M1U A;  1FW4 A;  4WRI A;  1DT7 B;  4JPZ B;  2MHH A;  3NSO A;  1FI5 A;  1AHR A;  2ZRT A;  1OOI X;  1X02 A;  1QAT A;  1KFX L;  3PN7 B;  1JUO A;  1UUS A;  3AAJ A;  1Y1A A;  2LVK A;  1P28 A;  1AJ5 A;  1W7J B;  2HQW A;  4P2Y B;  1NUB A;  2BBM A;  4MZL A;  2JTZ A;  1IIO A;  1SBJ A;  1WLZ A;  3FE8 A;  3FE6 A;  4KYN A;  1NWD A;  1CMG A;  1QTX A;  1TTX A;  3SG6 A;  2BNX A;  2WCL A;  3TS5 B;  3PAT A;  3HX4 A;  1IG5 A;  2M1K B;  3EVV A;  1IQ3 A;  1F8H A;  3FE9 A;  3EVU A;  3IQO A;  1Z4H A;  1QAS A;  4PHM A;  3PAL A;  1DVI A;  1SY9 A;  4NDD A;  3VRR A;  5AFP A;  1L2O B;  2OPO A;  1VRK A;  1EG4 A;  1KFU S;  1SK6 D;  4AOM A;  1J7O A;  2P71 A;  2I2R E;  2TN4 A;  3I5I C;  4DS7 A;  1OE9 B;  1TNW A;  1SR6 B;  2MRD A;  2L0P A;  3NGV A;  5DKQ A;  2JPT A;  2K61 A;  1SR6 C;  1Y0V H;  2M29 A;  4UPG A;  1YR5 A;  3SG5 A;  3NSI A;  3RM1 A;  2JXL A;  3GOF A;  2LLS A;  1BG1 A;  1FI6 A;  3VB1 A;  1B8L A;  4GFT A;  2I18 A;  1WY9 A;  1CNP A;  1NCY A;  1QS7 A;  3DVJ A;  4MRX A;  3EG5 B;  4AQI A;  4PE1 A;  3LLE A;  1RK9 A;  4ZCV A;  2BAP A;  2LP3 A;  2KNE A;  3KO0 A;  1NYA A;  3GK1 A;  3L4A A;  3UO9 A;  1NSH A;  4F7F A;  1CFF A;  1BJF A;  1BMO A;  1UHH A;  3B87 A;  3E3R A;  5DKN A;  1DJI A;  4FQT A;  3D77 A;  3EK8 A;  5HKW A;  1CKK A;  1DJX A;  1HT9 A;  3OHM B;  1GGZ A;  4PE0 A;  4TNC A;  5HLO A;  4DUQ A;  3RLZ A;  1RTP 1;  2LM5 A;  4USL A;  2BKH B;  3OP0 A;  3SS4 A;  4PE7 A;  2P70 A;  2NLN A;  2BL0 C;  1OOJ A;  3CTN A;  3WXA A;  2O5G A;  2JWW A;  1F55 A;  2Y4Q A;  5KU1 A;  3OGN A;  1C7W A;  4Q04 A;  1OMV A;  4INW A;  2QEV A;  2JUL A;  4XJK A;  2WCJ A;  4YGC B;  4C0K A;  5DKR A;  4WQ3 A;  3CZ0 A;  1G33 A;  1LKJ A;  3KF9 A;  3QME A;  1JC2 A;  1SNL A;  3S0D A;  1WRZ A;  1ZUZ A;  4WQ2 A;  1AUI B;  4R1E A;  3BUM B;  4BY4 A;  2LVV A;  2SCP A;  2NCP A;  3AKA A;  3GK2 A;  2Q4U A;  2KI4 C;  1PAL A;  4L9M A;  2CXJ A;  2FCE A;  5FI7 A;  2H61 A;  2WCF A;  1W9Z A;  2K7D A;  1K9P A;  3A8R A;  4MVF A;  3TDU A;  2F8P A;  3PM8 A;  2LE9 B;  2M97 A;  1CB1 A;  2KYF A;  1OSA A;  3D0Y A;  2QEB A;  3KHE A;  1QX7 A;  1BOD A;  2IS9 A;  1YUU A;  3B86 A;  4GGN A;  1RWY A;  1CDP A;  1SL8 A;  3WNX B;  1XFZ O;  2HQ8 A;  3S0F A;  3EVR A;  1WDC C;  2LUC A;  3D0Y B; 
#chains in the Genus database with same CATH homology
 2JNF A;  1LVC D;  2KAY A;  3ZWH A;  2AMI A;  1BF5 A;  1DGV A;  2JU0 A;  4MN0 A;  2CBL A;  2JT0 A;  1KQM B;  1M46 A;  1S5G Y;  1SCV A;  2G9B A;  1A29 A;  1B1G A;  1UHJ A;  1OMD A;  1CM4 A;  1SL9 A;  3AKB A;  4ZCU A;  1A2X A;  4YGB B;  2SAS A;  1OZS A;  2F2P A;  3SG7 A;  1XFV O;  2PMY A;  1D1O A;  1JSA A;  2LMV A;  3K21 A;  2OTG C;  3FS7 A;  4P5O E;  2K8M B;  1BLQ A;  2KDH A;  3FIA A;  1R6P A;  1Y6W A;  1QVI Y;  2KGB C;  1S6C A;  1XFW O;  1QLS A;  2L4I A;  3BUN B;  2Q91 A;  4CFQ A;  1XK4 A;  2KOT A;  2ZN9 A;  2LLT A;  2M7N A;  1S36 A;  4N1G A;  1DMO A;  1SPY A;  2BCX A;  3DVK A;  4YI8 A;  4PAL A;  4M2O A;  3JVT B;  4I5J A;  1DGU A;  2WND A;  5F6T A;  1N65 A;  1IJ5 A;  4MZJ A;  2L2E A;  4A4B A;  1WRL A;  2LVI A;  2WOS A;  4U8D A;  3SG4 A;  1S5G Z;  1S1E A;  1YVL A;  3FWB A;  5CSJ A;  4YGE B;  1F54 A;  1CMF A;  1XFY O;  2I94 A;  3PN7 C;  1QV0 A;  1Q80 A;  1CLB A;  5I2O A;  2JT8 A;  1BU3 A;  1QIV A;  2LHL A;  2F33 A;  4YI9 A;  1IWQ A;  2KGR A;  1M39 A;  1MUX A;  4I5K A;  3TS5 C;  1QVI Z;  1UUR A;  2LMT A;  1MQ1 A;  3VRN A;  4CFR A;  1OMR A;  2LLU A;  2KAX A;  1RRO A;  3VRQ A;  2EHB A;  3DVE A;  1L2O C;  3O6B A;  3LCP C;  1NX1 A;  1QX2 A;  4ICB A;  2PSR A;  1QX5 B;  3LK1 A;  1V1F A;  1YX7 A;  2L4H A;  1NX3 A;  4PHK A;  5I2Q A;  3OB2 B;  2OS8 B;  3TUY B;  2KQ6 A;  2F3Y A;  3JTD B;  1UHI A;  3O4Y A;  4A4C A;  4HRG A;  2PAS A;  2ZND A;  2BCB A;  4NDC A;  3BYA A;  1QJT A;  1ZMZ A;  4ORC B;  3SJS A;  2M3W A;  3NXA A;  2ZN8 A;  2JRF A;  2BCA A;  3OX6 A;  2BBN A;  5KTY A;  1NP8 A;  1S6J A;  3TDI A;  4HRH A;  1EXR A;  1A75 A;  1AJ4 A;  1F70 A;  3BUW B;  1GJY A;  1EJ3 A;  2MLF C;  1KFU L;  3CWG A;  2CNP A;  3EK7 A;  3WHT B;  1RFJ A;  2A4J A;  2JQ6 A;  2GGZ A;  4GAO A;  1A75 B;  2M49 B;  5KSZ A;  3M0W A;  1BR1 B;  1XVJ A;  1AK8 A;  1IH0 A;  2LCP A;  5AEQ A;  1R2U A;  2K0J A;  3TZ1 A;  3BUX B;  2CT9 A;  1XFX O;  2KFH A;  2FOT A;  3ZNI A;  1G8I A;  5HKZ A;  1K9U A;  4OKH A;  2PVB A;  3I5G B;  1TN4 A;  2L50 A;  1PRW A;  2E6W A;  3I5G C;  2M7L A;  2FJU B;  1C07 A;  5HLV A;  2HET A;  1TOP A;  2KYC A;  5B8I B;  1B7T Y;  2K2A A;  1LA3 A;  2QAC A;  1BR4 B;  3HCM A;  1CM1 A;  1LIN A;  3FWC A;  1MWN A;  4XJK B;  1QIW A;  3I5F B;  4GNK B;  5JJG A;  4OV2 A;  4GGF A;  1SKT A;  4E68 A;  1CFC A;  3C1V A;  2KBM A;  3DF0 A;  1ODB A;  3IF7 A;  4IL1 A;  1ALV A;  1J1D A;  2Y1N A;  1JFK A;  5JOL A;  1EH2 A;  1F71 A;  1TCF A;  1B4C A;  1A4P A;  2KFF A;  1PVA A;  2PRU A;  4QJ5 B;  3DF0 B;  1K2H A;  1IGV A;  1YUS A;  2KAV A;  1GQM A;  2LUX A;  2M8U A;  1LA0 A;  1NCX A;  1UHK A;  5K89 A;  4DRW A;  1PVB A;  1MHO A;  4JWQ A;  2LMU A;  2ZRS A;  2K7B A;  3ICB A;  1KQV A;  1IJ6 A;  3NSK A;  4CLN A;  1CTR A;  2JT3 A;  1KK7 Y;  1MR8 A;  1KQM C;  4PDZ A;  1PUL A;  1KWO B;  4I5L B;  1B7T Z;  1JF0 A;  1KK8 B;  2KQY A;  1N0Y A;  1M45 A;  4GBA A;  2EC6 B;  4DIR A;  1M63 B;  2PAL A;  4FTG A;  1WRK A;  4PHN A;  3O78 A;  2KFG A;  1YVH A;  1QXP A;  1XYD A;  4HSZ A;  5AXI A;  2LC5 A;  5CSF A;  1K95 A;  1IRJ A;  3CR5 X;  5I8N A;  1S6I A;  4F0Z B;  2V53 A;  2L98 A;  4XYN A;  2AAO A;  2O60 A;  3EKJ A;  4QJ3 B;  2WCE A;  1TNQ A;  1MF8 B;  2BKI B;  3I5H B;  3KPX A;  1K8U A;  1H4B A;  1K93 D;  3CGA A;  1CDM A;  1Y1X A;  1IQ5 A;  1M31 A;  5G08 A;  5IBW A;  1CFP A;  1NIW A;  1J7R A;  2K7C A;  1DJH A;  2MJW B;  3JVT C;  1XK4 C;  4MEW A;  1SW8 A;  3CZT X;  3D10 A;  1SCM B;  2JZI A;  4NDB A;  4HRE E;  1S3P A;  3VRP A;  3MSE B;  4MBE A;  2R2I A;  4YRU A;  3LK0 A;  2QPT A;  1H8B A;  1XO5 A;  2D8N A;  2LHI A;  2ISD A;  3CR4 X;  1DTL A;  2LAN A;  2DOQ A;  2P6B B;  1W7I B;  2G2B A;  2FCD A;  2KSP A;  3VGO A;  2LVJ A;  5BPJ A;  4PCW A;  3OB1 B;  5AAN A;  1DJY A;  4OVN F;  2JNX A;  3SG2 A;  3DD4 A;  1SL7 A;  3KEV A;  2LAP A;  4AQJ A;  2HPS A;  3CR2 A;  2NZ0 A;  2OS8 C;  3TUY C;  4CID A;  1CLL A;  3JTD C;  3NSL A;  4QJ4 B;  2WOR A;  3PFV A;  4M2Q A;  2M9G A;  2L51 A;  2ZNE A;  2JOJ A;  2Y1M A;  1B8R A;  3PLF B;  1TNX A;  1SMG A;  1B47 A;  1MXL C;  2JXC A;  5PAL A;  2K2F A;  1FF1 A;  3I5I B;  4GPL B;  1KCY A;  1J55 A;  1YTZ C;  5CSN A;  1ZAC A;  2VRG A;  2MBX A;  4C0J A;  1CLM A;  1F4Q A;  4OR9 B;  1GGW A;  1B8C A;  4ORA B;  2BEC A;  1REC A;  2MAZ A;  1NX2 A;  5CSI A;  3AAK A;  1K90 D;  3O2P A;  2JC2 A;  2EGD A;  3QRX A;  5FYX A;  2JTT A;  2LV7 A;  4YGA A;  1AVS A;  1MXE A;  1J7P A;  1ALW A;  4MSP A;  1EL4 A;  2WC8 A;  4MLW A;  3GK4 X;  2GGM A;  1J1E A;  3IQQ A;  1YUR A;  1AP4 A;  1QV1 A;  1ZOT B;  3EK4 A;  1CDN A;  5J3X A;  1YRT B;  3OX5 A;  2KI6 D;  1B9A A;  2GV5 A;  3CS1 A;  1EG3 A;  1YX8 A;  4ORB B;  1RJV A;  1DJG A;  1CFD A;  1N2D A;  4PHJ A;  1F4O A;  2CCM A;  4I5N B;  2BL0 B;  1OQP A;  1DF0 A;  3I5F C;  1PSR A;  1FPW A;  1JFJ A;  4MRY A;  5D69 A;  1LXF C;  2BE6 A;  1YRU B;  5GQQ C;  1TNP A;  2COL B;  2RGI A;  2MLE C;  1DF0 B;  2MA2 A;  4GGF C;  3BQ3 A;  1WLM A;  2CTN A;  2ZFD A;  1DJZ A;  2H61 C;  1NX0 A;  1K9K A;  2L5X B;  4OCI A;  2KHN A;  1V1G A;  2F2O A;  5TNC A;  2NXQ A;  4YBH B;  3BOW A;  4DCK A;  2KI4 B;  1K94 A;  4BY5 A;  2Y5I A;  1J7Q A;  1BOC A;  2WCB A;  2E30 A;  1JBA A;  4M2P A;  2KBI A;  4NQG A;  3LL8 B;  3CLN A;  1KWO C;  3BOW B;  1JWD A;  2K7O A;  4MZK A;  1JF2 A;  2LP2 A;  1KK8 C;  4C0L A;  1BT6 A;  2EC6 C;  1NCZ A;  1PSB A;  1CDL A;  1G4Y R;  1WDC B;  3A4U B;  1KSO A;  1SYM A;  5CPV A;  1KSM A;  3BXK A;  2F3Z A;  2B1U A;  1E8A A;  1SRA A;  2HF5 A;  5ER5 A;  1K96 A;  5AER A;  5D7F A;  2LNK A;  4N1F A;  1PK0 D;  3TDZ A;  2ZKM X;  4PE4 A;  1HQV A;  3F45 A;  1UHN A;  1UP5 A;  4D1E A;  5I2L A;  5ER4 X;  1U5I A;  3I5H C;  1TCO B;  1DJW A;  1C7V A;  2KI6 C;  4CPV A;  1KFX S;  3SG3 A;  4N5X A;  2OTG B;  1L7Z A;  1S26 D;  1TRF A;  1XFU O;  1Y1U A;  4JQ0 D;  5HKY A;  2BE4 A;  1A03 A;  1NPQ A;  1U5I B;  3BUO B;  1KK7 Z;  3DVM A;  3SIA A;  1OZO A;  1YUT A;  1FBV A;  2M0R A;  1SCM C;  4YGD B;  3WHU B;  2H2K A;  5HYD A;  3SIB A;  1UWO A;  4FQO A;  1IKU A;  1QLK A;  1XA5 A;  4GUK A;  3PSR A;  1ZFS A;  3EKH A;  2NCO A;  2AUC A;  3VRO A;  3H4S E;  1TIZ A;  2I7A A;  4ETO A;  2M1U A;  1FW4 A;  4WRI A;  1DT7 B;  4JPZ B;  2MHH A;  3NSO A;  1FI5 A;  1AHR A;  2ZRT A;  1X02 A;  1QAT A;  1KFX L;  3PN7 B;  1JUO A;  1UUS A;  3AAJ A;  1Y1A A;  2LVK A;  1AJ5 A;  1W7J B;  2HQW A;  4P2Y B;  1NUB A;  2BBM A;  4MZL A;  2JTZ A;  1SBJ A;  1WLZ A;  1NWD A;  1CMG A;  1QTX A;  1TTX A;  3SG6 A;  3TS5 B;  3PAT A;  3HX4 A;  1IG5 A;  2M1K B;  3EVV A;  1IQ3 A;  1F8H A;  3EVU A;  3IQO A;  1QAS A;  4PHM A;  3PAL A;  1DVI A;  1SY9 A;  4NDD A;  3VRR A;  5AFP A;  1L2O B;  2OPO A;  1VRK A;  1EG4 A;  1KFU S;  1SK6 D;  4AOM A;  1J7O A;  3I5I C;  2I2R E;  2TN4 A;  4DS7 A;  1OE9 B;  1TNW A;  1SR6 B;  2MRD A;  2L0P A;  5DKQ A;  2JPT A;  2K61 A;  1SR6 C;  1Y0V H;  2M29 A;  4UPG A;  1YR5 A;  3SG5 A;  3NSI A;  3RM1 A;  2JXL A;  3GOF A;  2LLS A;  1BG1 A;  1FI6 A;  1B8L A;  4GFT A;  2I18 A;  1WY9 A;  1CNP A;  1NCY A;  1QS7 A;  3DVJ A;  4MRX A;  4AQI A;  4PE1 A;  3LLE A;  1RK9 A;  4ZCV A;  2LP3 A;  2KNE A;  3KO0 A;  1NYA A;  3GK1 A;  1NSH A;  1CFF A;  1BJF A;  1BMO A;  1UHH A;  3E3R A;  5DKN A;  1DJI A;  5HKW A;  3EK8 A;  1CKK A;  1DJX A;  1HT9 A;  3OHM B;  1GGZ A;  4PE0 A;  4TNC A;  5HLO A;  4DUQ A;  3RLZ A;  1RTP 1;  2LM5 A;  4USL A;  2BKH B;  3OP0 A;  4PE7 A;  2NLN A;  2BL0 C;  1OOJ A;  3CTN A;  3WXA A;  2O5G A;  2JWW A;  1F55 A;  2Y4Q A;  5KU1 A;  1C7W A;  4Q04 A;  1OMV A;  2JUL A;  4XJK A;  4YGC B;  4C0K A;  5DKR A;  4WQ3 A;  1G33 A;  1LKJ A;  3KF9 A;  1JC2 A;  1SNL A;  1WRZ A;  1ZUZ A;  4WQ2 A;  1AUI B;  4R1E A;  3BUM B;  4BY4 A;  2LVV A;  2SCP A;  2NCP A;  3AKA A;  3GK2 A;  2Q4U A;  2KI4 C;  1PAL A;  4L9M A;  2CXJ A;  2FCE A;  2H61 A;  2WCF A;  3A8R A;  2K7D A;  1K9P A;  4MVF A;  3TDU A;  2F8P A;  3PM8 A;  2LE9 B;  2M97 A;  1CB1 A;  2KYF A;  1OSA A;  3D0Y A;  3KHE A;  1QX7 A;  1BOD A;  2IS9 A;  1YUU A;  4GGN A;  1RWY A;  1CDP A;  1SL8 A;  3WNX B;  1XFZ O;  2HQ8 A;  3EVR A;  1WDC C;  2LUC A;  3D0Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...