1S1EA

Crystal structure of kv channel-interacting protein 1 (kchip-1)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
181
structure length
181
Chain Sequence
GLEQLEAQTNFTKRELQVLYRGFKNECPSGVVNEETFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFEDFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPVLKEDTPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQLFQNVMVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two N-terminal domains of Kv4 K(+) channels regulate binding to and modulation by KChIP1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Kv channel interacting protein 1
total genus 64
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2004-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1s1eA00
2KI6D 2BBNA 1QV0A 2KHNA 4MZJA 1K9KA 3GK1A 3SJSA 3AKBA 3NSLA 3VRRA 2HPSA 1C7WA 2LHIA 1B7TZ 2M7NA 4MSPA 3I5IC 3SG2A 2GGMA 4I5NB 2NXQA 3A8RA 2EHBA 1UHNA 3O4YA 1IQ5A 1IJ6A 1YUUA 4OKHA 2LUXA 1XFWO 5CSFA 3WHTB 2BKIB 4USLA 2KOTA 1S6JA 3PN7C 1CFDA 4MN0A 1TIZA 1XFXO 1S36A 3O2PA 1N0YA 2Y1NA 2ZRTA 3IQQA 4Q04A 1IG5A 5AERA 1U5IA 3PFVA 4ZCUA 4I5JA 1QLKA 2JRFA 3AAKA 5I2LA 4XJKA 1OZOA 1MUXA 3SG6A 1YUTA 1NIWA 2OTGC 1EXRA 1J7QA 3VRNA 1TN4A 1V1FA 1KCYA 1M31A 4GGNA 2JZIA 1KWOC 2KI4C 4MRXA 5AXIA 1CDPA 4MZKA 1JBAA 2KAXA 3JVTB 4DIRA 3WHUB 3HX4A 1DJIA 1F55A 4AQIA 1WDCC 2BBMA 2H61C 3ZNIA 1LINA 1NUBA 2K2AA 3DVEA 3EK8A 4N1GA 1LXFC 4ORBB 5CSJA 5JOLA 4BY5A 5CSNA 1DT7B 1ZFSA 2JC2A 2IS9A 1KK7Y 2LVJA 1KSOA 3D0YA 4YBHB 1XFUO 1SBJA 1KFXS 1KQMC 3BQ3A 2KAYA 1J1DA 1YURA 4OCIA 1LA0A 3TS5C 2BL0B 2F33A 1XVJA 2M1UA 5KU1A 1KSMA 4WQ3A 1B4CA 3DD4A 1CDNA 1TCOB 2V53A 3CR4X 2VRGA 1K9UA 4MVFA 2WOSA 4GGFA 1BF5A 2HQ8A 2LC5A 1NCYA 3I5GB 1B9AA 1UHJA 1FI6A 4D1EA 2PMYA 1CTRA 2LMUA 2O5GA 3ICBA 2BCXA 1CMFA 1SCMC 3I5FB 1HT9A 2Y1MA 3FWCA 5I2QA 4NQGA 4YRUA 2MLFC 1CFCA 2JPTA 1FF1A 1OQPA 1CMGA 1PSBA 4M2QA 4QJ4B 3EK7A 2MA2A 2M7LA 4UPGA 2PRUA 3BXKA 4GGFC 4YI8A 1MR8A 5AFPA 4IL1A 1Y1UA 1CLLA 2FCEA 5CSIA 3EK4A 1U5IB 3KF9A 5JJGA 2G2BA 2BECA 3SG3A 1M45A 2KSPA 1D1OA 5KTYA 4JPZB 4BY4A 3VRPA 1A75B 2JT3A 2KGRA 1KK8B 3SG5A 1ALWA 2Y4QA 4MLWA 2K2FA 4JWQA 4C0JA 2JTTA 5ER5A 1HQVA 2NCPA 2WORA 2KNEA 3NSKA 1SCMB 2M97A 2R2IA 1QTXA 2LANA 3WNXB 1SK6D 2PSRA 2GV5A 4ICBA 1YR5A 2CT9A 3BUNB 5J3XA 2H2KA 1B1GA 2KI6C 2Q91A 2M1KB 1N65A 1XA5A 1EG4A 2JU0A 2ZNDA 4FQOA 1RFJA 1NSHA 1RWYA 3PSRA 5AEQA 2EC6B 2M0RA 2KBMA 1GJYA 3NSOA 1PK0D 3SG7A 1FPWA 2KAVA 2LM5A 1F4QA 4PHNA 2K7DA 2TN4A 1KFUL 3BOWB 3VRQA 2D8NA 3DF0B 2L51A 2MBXA 3LL8B 3VROA 1B7TY 1M39A 2LP2A 1MF8B 1IGVA 3F45A 1M63B 1UUSA 4PHKA 2LP3A 1NPQA 4CFRA 3I5FC 3LK1A 2AAOA 4HRGA 1UHHA 2KFHA 2NLNA 4P5OE 1ODBA 1KQVA 1NX1A 1G8IA 1X02A 5HLVA 1DTLA 2OTGB 1NYAA 2LMVA 3DVMA 3OP0A 3BYAA 1S26D 1TOPA 3PLFB 3OB1B 4GFTA 2CNPA 1XO5A 1EH2A 2I94A 3CZTX 1V1GA 1DJYA 3EVRA 4GAOA 1SRAA 1SPYA 1SCVA 3BUXB 2EC6C 4U8DA 1B8CA 1CB1A 2COLB 3WXAA 5AANA 3DF0A 2RGIA 1VRKA 1LKJA 2PALA 1DJGA 1QX5B 4NDBA 5FYXA 3PATA 4HSZA 2M9GA 5CPVA 1NCXA 1NX0A 1YVLA 1UHIA 1JF2A 3KHEA 1CDLA 1S5GZ 3H4SE 2MAZA 3KEVA 1MXEA 3CR2A 5D7FA 4GUKA 2F3ZA 2QPTA 1S3PA 2BCBA 1A2XA 1WLMA 1TRFA 1ZMZA 1BOCA 1CKKA 1QS7A 3TS5B 1F4OA 1XK4C 1ALVA 1EL4A 2FOTA 2B1UA 2SCPA 3LCPC 2LE9B 4QJ5B 1JSAA 3CTNA 1NX3A 5KSZA 1UURA 1GGWA 2CTNA 1YX8A 2BE6A 1YRTB 3E3RA 4PE7A 4ZCVA 1RROA 2LNKA 2FCDA 4CPVA 2JQ6A 2LMTA 1CNPA 2KYCA 2LVVA 1SNLA 4YGDB 1QIVA 1OZSA 1DJZA 3PN7B 1CFPA 3FIAA 2AMIA 2LAPA 3GK4X 1NWDA 1QXPA 3TUYB 2KDHA 2BKHB 1KWOB 5HKYA 3RM1A 1K93D 3I5IB 1DJXA 3AKAA 1UP5A 1C07A 1SY9A 3EKHA 2PASA 2MHHA 1LVCD 1KK8C 1AP4A 2KFGA 4A4BA 4C0LA 4GNKB 1TNQA 2KI4B 5IBWA 1MQ1A 2JULA 1L2OB 1OE9B 4GPLB 4PHJA 1J7PA 4GBAA 3OHMB 1KFUS 3VGOA 1F70A 3K21A 2BE4A 1WRKA 1XFZO 1J55A 3HCMA 1IKUA 1DGVA 1G33A 1QVIY 1TCFA 2LLSA 1CM4A 1YX7A 4OR9B 1GQMA 2BL0C 1CLMA 3CLNA 3TDUA 2NZ0A 3GOFA 4P2YB 1OOJA 2M8UA 1S1EA 2Q4UA 1PVAA 4WQ2A 5DKQA 1FBVA 1KK7Z 1JFKA 2WCBA 1NP8A 2H61A 3FS7A 1B47A 2WC8A 1ZOTB 2F8PA 2JT8A 1L7ZA 1B8LA 3I5GC 1S6IA 3LLEA 1WDCB 1QATA 2KQYA 3JTDC 4ORCB 4ETOA 2I7AA 3IF7A 1QX7A 1XFVO 1SMGA 2F3YA 3C1VA 3SIBA 3KPXA 1JF0A 1SL7A 1DMOA 3TDIA 1BR1B 1QV1A 1RECA 2SASA 1DF0A 1S6CA 4PDZA 3MSEB 4YGAA 1FI5A 1EJ3A 5HYDA 2JT0A 4XJKB 1QASA 2LUCA 2ZN8A 2JWWA 2I18A 4R1EA 1AHRA 1Y1AA 1SW8A 4DS7A 3TDZA 2M3WA 4PHMA 1TNXA 4DCKA 2ZN9A 4CIDA 3CR5X 3PM8A 4OVNF 4YI9A 1K2HA 4L9MA 1N2DA 2LLTA 4OV2A 1KFXL 2L5XB 3JVTC 4PALA 1PVBA 1SL9A 2JNXA 2KYFA 1CM1A 1SYMA 2ZKMX 2L0PA 1AK8A 1M46A 2MLEC 1H8BA 1LA3A 2LLUA 2L50A 5PALA 2CCMA 3RLZA 1BMOA 1WRZA 1WY9A 1GGZA 3M0WA 3NSIA 3SG4A 2LV7A 1BODA 1DF0B 1SR6B 1F8HA 1AJ4A 1W7IB 3OX5A 3BUWB 4XYNA 2I2RE 3CWGA 2K61A 4MZLA 2CBLA 2MJWB 1KQMB 1E8AA 2WCFA 4YGBB 2ZRSA 4M2PA 1AUIB 5D69A 5I2OA 2QACA 1BLQA 1G4YR 2F2OA 1IRJA 1QIWA 4HRHA 2ZFDA 1CLBA 4JQ0D 1Y1XA 4F0ZB 3DVJA 4PCWA 4DUQA 2K0JA 3TZ1A 2WCEA 2L2EA 2M29A 2WNDA 4MEWA 1CFFA 4AOMA 1OMVA 1YRUB 2L4HA 2JXLA 3PALA 2L98A 1OMDA 1Y0VH 3A4UB 4DRWA 1A75A 2KGBC 3I5HB 1YVHA 1R6PA 2FJUB 3SIAA 1S5GY 5HKZA 1TNWA 4WRIA 1SL8A 5HKWA 1CDMA 1SKTA 1MHOA 1A03A 2MRDA 2JNFA 1DVIA 4ORAB 3FWBA 1YUSA 1BJFA 2K7CA 4N5XA 3JTDB 1K90D 1DGUA 1Q80A 3D0YB 4PE1A 2KQ6A 1PULA 4C0KA 1K95A 2EGDA 4MBEA 1K96A 1YTZC 3BUMB 1JUOA 1IWQA 3ZWHA 1J7OA 1F71A 3BUOB 5B8IB 1OMRA 5G08A 2G9BA 1NX2A 1R2UA 3EVUA 1QLSA 3QRXA 1IJ5A 2HETA 4I5LB 5ER4X 5K89A 2O60A 2K8MB 5BPJA 2HQWA 3CGAA 1QX2A 1UHKA 2HF5A 4N1FA 5HLOA 1MWNA 2K7BA 3GK2A 4NDCA 1H4BA 2JTZA 5DKRA 4E68A 1XK4A 1JFJA 2BCAA 1A29A 3LK0A 3OB2B 3NXAA 1IQ3A 4MRYA 2L4IA 1AJ5A 4HREE 4CLNA 1JWDA 2OS8C 4I5KA 1B8RA 1UWOA 1XFYO 2JOJA 2Y5IA 1A4PA 1PRWA 3BOWA 2P6BB 2AUCA 4PE4A 1L2OC 2LCPA 3KO0A 1C7VA 1JC2A 2E6WA 2LHLA 2GGZA 3OX6A 2F2PA 1RJVA 2PVBA 2E30A 1NCZA 4FTGA 1QJTA 3CS1A 1XYDA 1WRLA 2KBIA 4TNCA 1DJWA 1ZUZA 4AQJA 3D10A 3IQOA 3EVVA 5DKNA 1F54A 1DJHA 1PALA 1RTP1 2OPOA 1OSAA 2ZNEA 1IH0A 2JXCA 4PE0A 1TTXA 1WLZA 3O6BA 3TUYC 1PSRA 4CFQA 1BT6A 2LVKA 4A4CA 4NDDA 1BG1A 3DVKA 2NCOA 5GQQC 1K8UA 1W7JB 3EKJA 3AAJA 1FW4A 4YGCB 2ISDA 2K7OA 1K9PA 1J1EA 2KFFA 1AVSA 2DOQA 1SR6C 4QJ3B 4YGEB 2A4JA 5F6TA 1J7RA 2LVIA 3O78A 1BR4B 1TNPA 1BU3A 1QVIZ 4M2OA 5TNCA 1EG3A 1RK9A 1ZACA 1Y6WA 1K94A 2CXJA 2M49B 1MXLC 5I8NA 3I5HC 2OS8B
chains in the Genus database with same CATH superfamily
2KI6D 2BBNA 1QV0A 2KHNA 2WC5A 4MZJA 1K9KA 3GK1A 3SJSA 3AKBA 3NSLA 3VRRA 2KLEA 2HPSA 1C7WA 2LHIA 3V2LA 1B7TZ 2M7NA 4MSPA 3I5IC 3SG2A 2GGMA 4I5NB 2NXQA 3A8RA 2EHBA 1UHNA 3O4YA 1IQ5A 1IJ6A 1YUUA 4OKHA 2LUXA 1XFWO 5CSFA 3WHTB 2BKIB 4USLA 1OOHA 2KOTA 1S6JA 3PN7C 1CFDA 4MN0A 3S0GA 1TIZA 4JD9A 1XFXO 1S36A 2BNXA 3O2PA 1N0YA 2Y1NA 2ZRTA 3IQQA 4Q04A 1IG5A 5AERA 1U5IA 4F7FA 3PFVA 4ZCUA 4I5JA 1QLKA 2JRFA 3AAKA 5I2LA 4XJKA 1OZOA 1MUXA 3SG6A 1YUTA 1NIWA 2OTGC 1EXRA 3BJHA 1J7QA 3VRNA 1TN4A 1V1FA 1KCYA 1M31A 4GGNA 2JZIA 1KWOC 2KI4C 4MRXA 5AXIA 1CDPA 4MZKA 1JBAA 3PM2A 2KAXA 4PT1A 3JVTB 3R72A 4DIRA 3WHUB 3HX4A 2FJYA 1DJIA 1F55A 3BFBA 4AQIA 1WDCC 2BBMA 2H61C 3ZNIA 1LINA 1NUBA 2K2AA 3DVEA 3EK8A 3R1PA 1LXFC 4N1GA 2PYQA 4ORBB 5CSJA 4BY5A 5CSNA 1DT7B 1ZFSA 2JC2A 2IS9A 1KK7Y 2LVJA 1KSOA 3D0YA 2P71A 4YBHB 1XFUO 1SBJA 1KFXS 1KQMC 3BQ3A 2KAYA 1LS8A 1YURA 1J1DA 4OCIA 1LA0A 3TS5C 2BL0B 2F33A 3OBVA 1XVJA 1W9ZA 2M1UA 5KU1A 1KSMA 4WQ3A 1B4CA 3DD4A 1CDNA 1TCOB 2V53A 3SS5A 3SS3A 3BFHA 3CR4X 2VRGA 1K9UA 4MVFA 2WOSA 4GGFA 1BF5A 3R1OA 1OOFA 2HQ8A 1NCYA 2LC5A 1B9AA 3I5GB 1UHJA 1FI6A 4D1EA 2PMYA 1CTRA 1SSEB 2LMUA 2O5GA 3ICBA 2BCXA 1CMFA 1SCMC 3I5FB 1HT9A 2Y1MA 3FWCA 5DICA 5I2QA 4NQGA 4YRUA 2MLFC 3L4AA 1CFCA 2JPTA 3R1VA 1FF1A 1OQPA 1CMGA 1PSBA 4M2QA 4QJ4B 3EK7A 2MA2A 4OZDA 2M7LA 4UPGA 2PRUA 3BXKA 4GGFC 4YI8A 5JOLA 1MR8A 5AFPA 1QWVA 4IL1A 1Y1UA 1CLLA 2FCEA 5CSIA 2L5YA 3OGNA 3EK4A 1U5IB 3KF9A 5JJGA 2G2BA 3DZTA 2BECA 3SG3A 3S0AA 1M45A 2KSPA 2ERBA 1D1OA 5KTYA 4JPZB 4BY4A 3VRPA 1A75B 2H8VA 2JT3A 2KGRA 5FI6A 1KK8B 3SG5A 3NHTA 1ALWA 2Y4QA 4MLWA 2K2FA 4JWQA 4C0JA 2JTTA 5ER5A 1HQVA 2NCPA 2WORA 2KNEA 3NSKA 1SCMB 2M97A 3D78A 2R2IA 1QTXA 2LANA 3WNXB 1SK6D 2PSRA 2GV5A 4ICBA 1YR5A 2CT9A 3NHIA 3UO9A 3BUNB 3PJIA 5J3XA 2H2KA 1B1GA 2KI6C 2Q91A 2M1KB 1N65A 1XA5A 1EG4A 2JU0A 2ZNDA 4FQOA 1RFJA 1NSHA 1RWYA 3PSRA 4IJ7A 5AEQA 2EC6B 2WCJA 2M0RA 2KBMA 1GJYA 3NSOA 1PK0D 3SG7A 1FPWA 2KAVA 2LM5A 5EL2A 1F4QA 4PHNA 2K7DA 2JPOA 1KFUL 2TN4A 3BOWB 3VRQA 2D8NA 3DF0B 2L51A 2QEBA 2MBXA 3LL8B 3VROA 1B7TY 1M39A 2LP2A 1MF8B 1IGVA 3F45A 1M63B 1UUSA 4PHKA 2LP3A 1NPQA 4CFRA 1OOGA 3I5FC 3LK1A 2AAOA 4HRGA 1UHHA 2KFHA 2NLNA 4P5OE 1ODBA 1KQVA 1NX1A 1G8IA 1X02A 5HLVA 1DTLA 2OTGB 1TUJA 1NYAA 3S0BA 2LMVA 3DVMA 3OP0A 3BYAA 1S26D 1TOPA 3PLFB 3OB1B 4GFTA 2CNPA 1XO5A 1EH2A 2I94A 3CZTX 1V1GA 1DJYA 1Z4HA 3EVRA 4GAOA 1SRAA 1SPYA 1SCVA 3BUXB 2EC6C 4U8DA 1B8CA 1CB1A 2COLB 3S0DA 3WXAA 5AANA 3DF0A 2RGIA 1VRKA 1LKJA 2PALA 1DJGA 1QX5B 2L2CA 4NDBA 5FYXA 3D73A 3PATA 4HSZA 2M9GA 5CPVA 1NCXA 1C3ZA 1NX0A 1YVLA 1UHIA 1JF2A 3KHEA 1CDLA 1S5GZ 3CZ2A 3H4SE 2MAZA 3KEVA 3D76A 3QMEA 1MXEA 3CR2A 5D7FA 4GUKA 2F3ZA 2QPTA 1S3PA 2BCBA 1A2XA 2P70A 1WLMA 1TRFA 3IVTA 3VB1A 1ZMZA 1BOCA 1CKKA 1QS7A 3TS5B 1F4OA 1XK4C 1ALVA 1EL4A 2FOTA 2B1UA 2SCPA 3LCPC 2LE9B 4QJ5B 1JSAA 3CTNA 1NX3A 5KSZA 1UURA 2PQLA 1GGWA 3CZ0A 1XFRA 2CTNA 1YX8A 2BE6A 1GM0A 1YRTB 3E3RA 4PE7A 4ZCVA 1RROA 2LNKA 2FCDA 4CPVA 3Q8IA 2JQ6A 2LMTA 3B7AA 1CNPA 2WCMA 2KYCA 2LVVA 1SNLA 3K1EA 4JKTA 2WCKA 1OW4A 4YGDB 1QIVA 1OZSA 1DJZA 3PN7B 1CFPA 3FIAA 2AMIA 2LAPA 3GK4X 1NWDA 1QXPA 3TUYB 3FE6A 2KDHA 2BKHB 1KWOB 5HKYA 3RM1A 1K93D 3FE9A 5D3OA 3I5IB 3BFAA 1DJXA 3O4XA 2KPHA 1UP5A 3AKAA 1C07A 1SY9A 3DYEA 3EKHA 2PASA 2MHHA 1LVCD 1KK8C 5HL1A 1AP4A 2KFGA 3DXLA 4A4BA 4C0LA 2WC6A 4GNKB 1TNQA 2KI4B 3B86A 5IBWA 1MQ1A 2JULA 1L2OB 1OE9B 4GPLB 3L47A 4INXA 4PHJA 1J7PA 4GBAA 3OHMB 3FE8A 3RZSA 1KFUS 3VGOA 1F70A 3K21A 2BE4A 1WRKA 3S0EA 5FI7A 1XFZO 1J55A 3HCMA 3UNWA 3D74A 1DGVA 1DC1A 1IKUA 1G33A 1QVIY 1TCFA 2LLSA 1CM4A 1YX7A 4OR9B 1GQMA 2BL0C 1CLMA 3CLNA 1DQEA 3TDUA 2NZ0A 3B88A 2WCLA 3GOFA 3EG5B 1OOJA 2M8UA 4P2YB 1S1EA 2BAPA 1PVAA 2Q4UA 4WQ2A 1FBVA 1KK7Z 1JFKA 2WCBA 5DKQA 1NP8A 2H61A 3FS7A 1B47A 2WC8A 1ZOTB 2F8PA 2JT8A 1L7ZA 1B8LA 3I5GC 1S6IA 3LLEA 3N7HA 1WDCB 1QATA 2KQYA 3JTDC 4ORCB 4ETOA 2I7AA 3IF7A 1QX7A 1XFVO 1SMGA 2F3YA 3C1VA 3SIBA 3KPXA 1JF0A 1SL7A 1DMOA 3TDIA 1BR1B 2GTEA 1QV1A 1RECA 2QDIA 2SASA 1DF0A 1S6CA 4PDZA 3MSEB 4YGAA 1FI5A 1EJ3A 5HYDA 3DY9A 2JT0A 4XJKB 1QASA 2LUCA 2ZN8A 2JWWA 2I18A 4R1EA 1AHRA 1Y1AA 1SW8A 4DS7A 3TDZA 2M3WA 2KLDA 2YGUA 1TNXA 4PHMA 4DCKA 2ZN9A 4CIDA 3CR5X 3PM8A 4OVNF 4YI9A 1K2HA 4L9MA 1N2DA 2LLTA 4OV2A 1KFXL 1T14A 1DELA 2L5XB 3JVTC 4FQTA 4PALA 1PVBA 1SL9A 2JNXA 2KYFA 1CM1A 1SYMA 2ZKMX 2L0PA 1AK8A 1M46A 2MLEC 1H8BA 1LA3A 2LLUA 2L50A 5PALA 2CCMA 3RLZA 1BMOA 1WRZA 1WY9A 1GGZA 3M0WA 3B6XA 3NSIA 3SG4A 2LV7A 1BODA 1DF0B 1SR6B 1F8HA 1DEKA 1AJ4A 1W7IB 3OX5A 3BUWB 4XYNA 2I2RE 3CWGA 2K61A 4MZLA 2CBLA 2MJWB 1KQMB 1E8AA 2WCFA 4YGBB 2ZRSA 4M2PA 1AUIB 1TUZA 5D69A 5I2OA 2QACA 1IIOA 1BLQA 1G4YR 2F2OA 1IRJA 4INWA 1QIWA 4HRHA 2ZFDA 1CLBA 4JQ0D 1Y1XA 4F0ZB 3DVJA 4KYNA 4PCWA 4DUQA 2K0JA 3TZ1A 2WCEA 2L2EA 2M29A 1ORGA 2WNDA 4MEWA 5I94A 1CFFA 4AOMA 1OMVA 1YRUB 2L4HA 2JXLA 3PALA 2L98A 1OMDA 1Y0VH 3A4UB 4DRWA 1A75A 2KGBC 3I5HB 1YVHA 1R6PA 2FJUB 3SIAA 1S5GY 5HKZA 1TNWA 4WRIA 1C3YA 1SL8A 5HKWA 1CDMA 3CABA 1SKTA 1MHOA 1A03A 2MRDA 2JNFA 1DVIA 5FI2A 4ORAB 3FWBA 1YUSA 1BJFA 2QEHA 2K7CA 4N5XA 3S0FA 3JTDB 1K90D 1DGUA 1Q80A 3D0YB 4PE1A 2KQ6A 1PULA 4C0KA 1K95A 2EGDA 4MBEA 3NGVA 1K96A 1YTZC 3BUMB 1JUOA 1IWQA 3ZWHA 1J7OA 1F71A 3BUOB 5B8IB 1OMRA 5G08A 1NX2A 1R2UA 2G9BA 3EVUA 1QLSA 3QRXA 1IJ5A 2HETA 4I5LB 5ER4X 5K89A 2O60A 2K8MB 5BPJA 2HQWA 3CGAA 3CYZA 1QX2A 1UHKA 2HF5A 4N1FA 1Z2CB 5HLOA 1MWNA 2K7BA 3GK2A 4NDCA 1H4BA 2JTZA 5DKRA 4E68A 1XK4A 1JFJA 2BCAA 1A29A 3LK0A 3OB2B 3NXAA 1IQ3A 4MRYA 2L4IA 1AJ5A 3B87A 4HREE 4CLNA 2OS8C 1JWDA 4I5KA 1B8RA 1UWOA 1XFYO 2JOJA 1P28A 1TWOA 1A4PA 1PRWA 2Y5IA 3BOWA 2P6BB 2AUCA 3CDNA 1L2OC 4PE4A 2LCPA 3KO0A 1C7VA 3SS4A 1JC2A 1OOIX 2E6WA 2LHLA 2GGZA 3OX6A 2F2PA 1RJVA 2PVBA 2E30A 1NCZA 4FTGA 1QJTA 3CS1A 1XYDA 1WRLA 2KBIA 2WCHA 1DJWA 1ZUZA 4TNCA 4AQJA 3D10A 3IQOA 3EVVA 5DKNA 1F54A 1DJHA 1PALA 1RTP1 2OPOA 1OSAA 2QEOA 2ZNEA 1IH0A 2JXCA 4PE0A 1TTXA 1WLZA 2QEVA 3D77A 3L4LA 3O6BA 3TUYC 1PSRA 4CFQA 1BT6A 2LVKA 4A4CA 4NDDA 1BG1A 3DVKA 2NCOA 5GQQC 1K8UA 1W7JB 3EKJA 3AAJA 1FW4A 4YGCB 2ISDA 2K7OA 1K9PA 1J1EA 2KFFA 1AVSA 2DOQA 1SR6C 4QJ3B 4YGEB 2K60A 2A4JA 3CZ1A 5F6TA 1J7RA 2LVIA 3O78A 1BR4B 1TNPA 1BU3A 1QVIZ 4M2OA 5TNCA 1EG3A 1RK9A 1ZACA 1Y6WA 1K94A 2CXJA 2M49B 1MXLC 3D75A 5I8NA 3I5HC 2OS8B
chains in the Genus database with same CATH topology
2KI6D 2BBNA 1QV0A 2KHNA 4MZJA 1K9KA 3GK1A 3SJSA 3AKBA 3NSLA 3VRRA 2HPSA 1C7WA 2LHIA 1B7TZ 2M7NA 4MSPA 3I5IC 3SG2A 2GGMA 4I5NB 2NXQA 3A8RA 2EHBA 1UHNA 3O4YA 1IQ5A 1IJ6A 1YUUA 4OKHA 2LUXA 1XFWO 5CSFA 3WHTB 2BKIB 4USLA 2KOTA 1S6JA 3PN7C 1CFDA 4MN0A 1TIZA 1XFXO 1S36A 3O2PA 1N0YA 2Y1NA 2ZRTA 3IQQA 4Q04A 1IG5A 5AERA 1U5IA 3PFVA 4ZCUA 4I5JA 1QLKA 2JRFA 3AAKA 5I2LA 4XJKA 1OZOA 1MUXA 3SG6A 1YUTA 1NIWA 2OTGC 1EXRA 1J7QA 3VRNA 1TN4A 1V1FA 1KCYA 1M31A 4GGNA 2JZIA 1KWOC 2KI4C 4MRXA 5AXIA 1CDPA 4MZKA 1JBAA 2KAXA 3JVTB 4DIRA 3WHUB 3HX4A 1DJIA 1F55A 4AQIA 1WDCC 2BBMA 2H61C 3ZNIA 1LINA 1NUBA 2K2AA 3DVEA 3EK8A 4N1GA 1LXFC 4ORBB 5CSJA 5JOLA 4BY5A 5CSNA 1DT7B 1ZFSA 2JC2A 2IS9A 1KK7Y 2LVJA 1KSOA 3D0YA 4YBHB 1XFUO 1SBJA 1KFXS 1KQMC 3BQ3A 2KAYA 1J1DA 1YURA 4OCIA 1LA0A 3TS5C 2BL0B 2F33A 1XVJA 2M1UA 5KU1A 1KSMA 4WQ3A 1B4CA 3DD4A 1CDNA 1TCOB 2V53A 3CR4X 2VRGA 1K9UA 4MVFA 2WOSA 4GGFA 1BF5A 2HQ8A 2LC5A 1NCYA 3I5GB 1B9AA 1UHJA 1FI6A 4D1EA 2PMYA 1CTRA 2LMUA 2O5GA 3ICBA 2BCXA 1CMFA 1SCMC 3I5FB 1HT9A 2Y1MA 3FWCA 5I2QA 4NQGA 4YRUA 2MLFC 1CFCA 2JPTA 1FF1A 1OQPA 1CMGA 1PSBA 4M2QA 4QJ4B 3EK7A 2MA2A 2M7LA 4UPGA 2PRUA 3BXKA 4GGFC 4YI8A 1MR8A 5AFPA 4IL1A 1Y1UA 1CLLA 2FCEA 5CSIA 3EK4A 1U5IB 3KF9A 5JJGA 2G2BA 2BECA 3SG3A 1M45A 2KSPA 1D1OA 5KTYA 4JPZB 4BY4A 3VRPA 1A75B 2JT3A 2KGRA 1KK8B 3SG5A 1ALWA 2Y4QA 4MLWA 2K2FA 4JWQA 4C0JA 2JTTA 5ER5A 1HQVA 2NCPA 2WORA 2KNEA 3NSKA 1SCMB 2M97A 2R2IA 1QTXA 2LANA 3WNXB 1SK6D 2PSRA 2GV5A 4ICBA 1YR5A 2CT9A 3BUNB 5J3XA 2H2KA 1B1GA 2KI6C 2Q91A 2M1KB 1N65A 1XA5A 1EG4A 2JU0A 2ZNDA 4FQOA 1RFJA 1NSHA 1RWYA 3PSRA 5AEQA 2EC6B 2M0RA 2KBMA 1GJYA 3NSOA 1PK0D 3SG7A 1FPWA 2KAVA 2LM5A 1F4QA 4PHNA 2K7DA 2TN4A 1KFUL 3BOWB 3VRQA 2D8NA 3DF0B 2L51A 2MBXA 3LL8B 3VROA 1B7TY 1M39A 2LP2A 1MF8B 1IGVA 3F45A 1M63B 1UUSA 4PHKA 2LP3A 1NPQA 4CFRA 3I5FC 3LK1A 2AAOA 4HRGA 1UHHA 2KFHA 2NLNA 4P5OE 1ODBA 1KQVA 1NX1A 1G8IA 1X02A 5HLVA 1DTLA 2OTGB 1NYAA 2LMVA 3DVMA 3OP0A 3BYAA 1S26D 1TOPA 3PLFB 3OB1B 4GFTA 2CNPA 1XO5A 1EH2A 2I94A 3CZTX 1V1GA 1DJYA 3EVRA 4GAOA 1SRAA 1SPYA 1SCVA 3BUXB 2EC6C 4U8DA 1B8CA 1CB1A 2COLB 3WXAA 5AANA 3DF0A 2RGIA 1VRKA 1LKJA 2PALA 1DJGA 1QX5B 4NDBA 5FYXA 3PATA 4HSZA 2M9GA 5CPVA 1NCXA 1NX0A 1YVLA 1UHIA 1JF2A 3KHEA 1CDLA 1S5GZ 3H4SE 2MAZA 3KEVA 1MXEA 3CR2A 5D7FA 4GUKA 2F3ZA 2QPTA 1S3PA 2BCBA 1A2XA 1WLMA 1TRFA 1ZMZA 1BOCA 1CKKA 1QS7A 3TS5B 1F4OA 1XK4C 1ALVA 1EL4A 2FOTA 2B1UA 2SCPA 3LCPC 2LE9B 4QJ5B 1JSAA 3CTNA 1NX3A 5KSZA 1UURA 1GGWA 2CTNA 1YX8A 2BE6A 1YRTB 3E3RA 4PE7A 4ZCVA 1RROA 2LNKA 2FCDA 4CPVA 2JQ6A 2LMTA 1CNPA 2KYCA 2LVVA 1SNLA 4YGDB 1QIVA 1OZSA 1DJZA 3PN7B 1CFPA 3FIAA 2AMIA 2LAPA 3GK4X 1NWDA 1QXPA 3TUYB 2KDHA 2BKHB 1KWOB 5HKYA 3RM1A 1K93D 3I5IB 1DJXA 3AKAA 1UP5A 1C07A 1SY9A 3EKHA 2PASA 2MHHA 1LVCD 1KK8C 1AP4A 2KFGA 4A4BA 4C0LA 4GNKB 1TNQA 2KI4B 5IBWA 1MQ1A 2JULA 1L2OB 1OE9B 4GPLB 4PHJA 1J7PA 4GBAA 3OHMB 1KFUS 3VGOA 1F70A 3K21A 2BE4A 1WRKA 1XFZO 1J55A 3HCMA 1IKUA 1DGVA 1G33A 1QVIY 1TCFA 2LLSA 1CM4A 1YX7A 4OR9B 1GQMA 2BL0C 1CLMA 3CLNA 3TDUA 2NZ0A 3GOFA 4P2YB 1OOJA 2M8UA 1S1EA 2Q4UA 1PVAA 4WQ2A 5DKQA 1FBVA 1KK7Z 1JFKA 2WCBA 1NP8A 2H61A 3FS7A 1B47A 2WC8A 1ZOTB 2F8PA 2JT8A 1L7ZA 1B8LA 3I5GC 1S6IA 3LLEA 1WDCB 1QATA 2KQYA 3JTDC 4ORCB 4ETOA 2I7AA 3IF7A 1QX7A 1XFVO 1SMGA 2F3YA 3C1VA 3SIBA 3KPXA 1JF0A 1SL7A 1DMOA 3TDIA 1BR1B 1QV1A 1RECA 2SASA 1DF0A 1S6CA 4PDZA 3MSEB 4YGAA 1FI5A 1EJ3A 5HYDA 2JT0A 4XJKB 1QASA 2LUCA 2ZN8A 2JWWA 2I18A 4R1EA 1AHRA 1Y1AA 1SW8A 4DS7A 3TDZA 2M3WA 4PHMA 1TNXA 4DCKA 2ZN9A 4CIDA 3CR5X 3PM8A 4OVNF 4YI9A 1K2HA 4L9MA 1N2DA 2LLTA 4OV2A 1KFXL 2L5XB 3JVTC 4PALA 1PVBA 1SL9A 2JNXA 2KYFA 1CM1A 1SYMA 2ZKMX 2L0PA 1AK8A 1M46A 2MLEC 1H8BA 1LA3A 2LLUA 2L50A 5PALA 2CCMA 3RLZA 1BMOA 1WRZA 1WY9A 1GGZA 3M0WA 3NSIA 3SG4A 2LV7A 1BODA 1DF0B 1SR6B 1F8HA 1AJ4A 1W7IB 3OX5A 3BUWB 4XYNA 2I2RE 3CWGA 2K61A 4MZLA 2CBLA 2MJWB 1KQMB 1E8AA 2WCFA 4YGBB 2ZRSA 4M2PA 1AUIB 5D69A 5I2OA 2QACA 1BLQA 1G4YR 2F2OA 1IRJA 1QIWA 4HRHA 2ZFDA 1CLBA 4JQ0D 1Y1XA 4F0ZB 3DVJA 4PCWA 4DUQA 2K0JA 3TZ1A 2WCEA 2L2EA 2M29A 2WNDA 4MEWA 1CFFA 4AOMA 1OMVA 1YRUB 2L4HA 2JXLA 3PALA 2L98A 1OMDA 1Y0VH 3A4UB 4DRWA 1A75A 2KGBC 3I5HB 1YVHA 1R6PA 2FJUB 3SIAA 1S5GY 5HKZA 1TNWA 4WRIA 1SL8A 5HKWA 1CDMA 1SKTA 1MHOA 1A03A 2MRDA 2JNFA 1DVIA 4ORAB 3FWBA 1YUSA 1BJFA 2K7CA 4N5XA 3JTDB 1K90D 1DGUA 1Q80A 3D0YB 4PE1A 2KQ6A 1PULA 4C0KA 1K95A 2EGDA 4MBEA 1K96A 1YTZC 3BUMB 1JUOA 1IWQA 3ZWHA 1J7OA 1F71A 3BUOB 5B8IB 1OMRA 5G08A 2G9BA 1NX2A 1R2UA 3EVUA 1QLSA 3QRXA 1IJ5A 2HETA 4I5LB 5ER4X 5K89A 2O60A 2K8MB 5BPJA 2HQWA 3CGAA 1QX2A 1UHKA 2HF5A 4N1FA 5HLOA 1MWNA 2K7BA 3GK2A 4NDCA 1H4BA 2JTZA 5DKRA 4E68A 1XK4A 1JFJA 2BCAA 1A29A 3LK0A 3OB2B 3NXAA 1IQ3A 4MRYA 2L4IA 1AJ5A 4HREE 4CLNA 1JWDA 2OS8C 4I5KA 1B8RA 1UWOA 1XFYO 2JOJA 2Y5IA 1A4PA 1PRWA 3BOWA 2P6BB 2AUCA 4PE4A 1L2OC 2LCPA 3KO0A 1C7VA 1JC2A 2E6WA 2LHLA 2GGZA 3OX6A 2F2PA 1RJVA 2PVBA 2E30A 1NCZA 4FTGA 1QJTA 3CS1A 1XYDA 1WRLA 2KBIA 4TNCA 1DJWA 1ZUZA 4AQJA 3D10A 3IQOA 3EVVA 5DKNA 1F54A 1DJHA 1PALA 1RTP1 2OPOA 1OSAA 2ZNEA 1IH0A 2JXCA 4PE0A 1TTXA 1WLZA 3O6BA 3TUYC 1PSRA 4CFQA 1BT6A 2LVKA 4A4CA 4NDDA 1BG1A 3DVKA 2NCOA 5GQQC 1K8UA 1W7JB 3EKJA 3AAJA 1FW4A 4YGCB 2ISDA 2K7OA 1K9PA 1J1EA 2KFFA 1AVSA 2DOQA 1SR6C 4QJ3B 4YGEB 2A4JA 5F6TA 1J7RA 2LVIA 3O78A 1BR4B 1TNPA 1BU3A 1QVIZ 4M2OA 5TNCA 1EG3A 1RK9A 1ZACA 1Y6WA 1K94A 2CXJA 2M49B 1MXLC 5I8NA 3I5HC 2OS8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KI6 D;  2BBN A;  1QV0 A;  2KHN A;  4MZJ A;  1K9K A;  3GK1 A;  3SJS A;  3AKB A;  3NSL A;  3VRR A;  2HPS A;  1C7W A;  2LHI A;  1B7T Z;  2M7N A;  4MSP A;  3I5I C;  3SG2 A;  2GGM A;  4I5N B;  2NXQ A;  3A8R A;  2EHB A;  1UHN A;  3O4Y A;  1IQ5 A;  1IJ6 A;  1YUU A;  4OKH A;  2LUX A;  1XFW O;  5CSF A;  3WHT B;  2BKI B;  4USL A;  2KOT A;  1S6J A;  3PN7 C;  1CFD A;  4MN0 A;  1TIZ A;  1XFX O;  1S36 A;  3O2P A;  1N0Y A;  2Y1N A;  2ZRT A;  3IQQ A;  4Q04 A;  1IG5 A;  5AER A;  1U5I A;  3PFV A;  4ZCU A;  4I5J A;  1QLK A;  2JRF A;  3AAK A;  5I2L A;  4XJK A;  1OZO A;  1MUX A;  3SG6 A;  1YUT A;  1NIW A;  2OTG C;  1EXR A;  1J7Q A;  3VRN A;  1TN4 A;  1V1F A;  1KCY A;  1M31 A;  4GGN A;  2JZI A;  1KWO C;  2KI4 C;  4MRX A;  5AXI A;  1CDP A;  4MZK A;  1JBA A;  2KAX A;  3JVT B;  4DIR A;  3WHU B;  3HX4 A;  1DJI A;  1F55 A;  4AQI A;  1WDC C;  2BBM A;  2H61 C;  3ZNI A;  1LIN A;  1NUB A;  2K2A A;  3DVE A;  3EK8 A;  4N1G A;  1LXF C;  4ORB B;  5CSJ A;  5JOL A;  4BY5 A;  5CSN A;  1DT7 B;  1ZFS A;  2JC2 A;  2IS9 A;  1KK7 Y;  2LVJ A;  1KSO A;  3D0Y A;  4YBH B;  1XFU O;  1SBJ A;  1KFX S;  1KQM C;  3BQ3 A;  2KAY A;  1J1D A;  1YUR A;  4OCI A;  1LA0 A;  3TS5 C;  2BL0 B;  2F33 A;  1XVJ A;  2M1U A;  5KU1 A;  1KSM A;  4WQ3 A;  1B4C A;  3DD4 A;  1CDN A;  1TCO B;  2V53 A;  3CR4 X;  2VRG A;  1K9U A;  4MVF A;  2WOS A;  4GGF A;  1BF5 A;  2HQ8 A;  2LC5 A;  1NCY A;  3I5G B;  1B9A A;  1UHJ A;  1FI6 A;  4D1E A;  2PMY A;  1CTR A;  2LMU A;  2O5G A;  3ICB A;  2BCX A;  1CMF A;  1SCM C;  3I5F B;  1HT9 A;  2Y1M A;  3FWC A;  5I2Q A;  4NQG A;  4YRU A;  2MLF C;  1CFC A;  2JPT A;  1FF1 A;  1OQP A;  1CMG A;  1PSB A;  4M2Q A;  4QJ4 B;  3EK7 A;  2MA2 A;  2M7L A;  4UPG A;  2PRU A;  3BXK A;  4GGF C;  4YI8 A;  1MR8 A;  5AFP A;  4IL1 A;  1Y1U A;  1CLL A;  2FCE A;  5CSI A;  3EK4 A;  1U5I B;  3KF9 A;  5JJG A;  2G2B A;  2BEC A;  3SG3 A;  1M45 A;  2KSP A;  1D1O A;  5KTY A;  4JPZ B;  4BY4 A;  3VRP A;  1A75 B;  2JT3 A;  2KGR A;  1KK8 B;  3SG5 A;  1ALW A;  2Y4Q A;  4MLW A;  2K2F A;  4JWQ A;  4C0J A;  2JTT A;  5ER5 A;  1HQV A;  2NCP A;  2WOR A;  2KNE A;  3NSK A;  1SCM B;  2M97 A;  2R2I A;  1QTX A;  2LAN A;  3WNX B;  1SK6 D;  2PSR A;  2GV5 A;  4ICB A;  1YR5 A;  2CT9 A;  3BUN B;  5J3X A;  2H2K A;  1B1G A;  2KI6 C;  2Q91 A;  2M1K B;  1N65 A;  1XA5 A;  1EG4 A;  2JU0 A;  2ZND A;  4FQO A;  1RFJ A;  1NSH A;  1RWY A;  3PSR A;  5AEQ A;  2EC6 B;  2M0R A;  2KBM A;  1GJY A;  3NSO A;  1PK0 D;  3SG7 A;  1FPW A;  2KAV A;  2LM5 A;  1F4Q A;  4PHN A;  2K7D A;  2TN4 A;  1KFU L;  3BOW B;  3VRQ A;  2D8N A;  3DF0 B;  2L51 A;  2MBX A;  3LL8 B;  3VRO A;  1B7T Y;  1M39 A;  2LP2 A;  1MF8 B;  1IGV A;  3F45 A;  1M63 B;  1UUS A;  4PHK A;  2LP3 A;  1NPQ A;  4CFR A;  3I5F C;  3LK1 A;  2AAO A;  4HRG A;  1UHH A;  2KFH A;  2NLN A;  4P5O E;  1ODB A;  1KQV A;  1NX1 A;  1G8I A;  1X02 A;  5HLV A;  1DTL A;  2OTG B;  1NYA A;  2LMV A;  3DVM A;  3OP0 A;  3BYA A;  1S26 D;  1TOP A;  3PLF B;  3OB1 B;  4GFT A;  2CNP A;  1XO5 A;  1EH2 A;  2I94 A;  3CZT X;  1V1G A;  1DJY A;  3EVR A;  4GAO A;  1SRA A;  1SPY A;  1SCV A;  3BUX B;  2EC6 C;  4U8D A;  1B8C A;  1CB1 A;  2COL B;  3WXA A;  5AAN A;  3DF0 A;  2RGI A;  1VRK A;  1LKJ A;  2PAL A;  1DJG A;  1QX5 B;  4NDB A;  5FYX A;  3PAT A;  4HSZ A;  2M9G A;  5CPV A;  1NCX A;  1NX0 A;  1YVL A;  1UHI A;  1JF2 A;  3KHE A;  1CDL A;  1S5G Z;  3H4S E;  2MAZ A;  3KEV A;  1MXE A;  3CR2 A;  5D7F A;  4GUK A;  2F3Z A;  2QPT A;  1S3P A;  2BCB A;  1A2X A;  1WLM A;  1TRF A;  1ZMZ A;  1BOC A;  1CKK A;  1QS7 A;  3TS5 B;  1F4O A;  1XK4 C;  1ALV A;  1EL4 A;  2FOT A;  2B1U A;  2SCP A;  3LCP C;  2LE9 B;  4QJ5 B;  1JSA A;  3CTN A;  1NX3 A;  5KSZ A;  1UUR A;  1GGW A;  2CTN A;  1YX8 A;  2BE6 A;  1YRT B;  3E3R A;  4PE7 A;  4ZCV A;  1RRO A;  2LNK A;  2FCD A;  4CPV A;  2JQ6 A;  2LMT A;  1CNP A;  2KYC A;  2LVV A;  1SNL A;  4YGD B;  1QIV A;  1OZS A;  1DJZ A;  3PN7 B;  1CFP A;  3FIA A;  2AMI A;  2LAP A;  3GK4 X;  1NWD A;  1QXP A;  3TUY B;  2KDH A;  2BKH B;  1KWO B;  5HKY A;  3RM1 A;  1K93 D;  3I5I B;  1DJX A;  3AKA A;  1UP5 A;  1C07 A;  1SY9 A;  3EKH A;  2PAS A;  2MHH A;  1LVC D;  1KK8 C;  1AP4 A;  2KFG A;  4A4B A;  4C0L A;  4GNK B;  1TNQ A;  2KI4 B;  5IBW A;  1MQ1 A;  2JUL A;  1L2O B;  1OE9 B;  4GPL B;  4PHJ A;  1J7P A;  4GBA A;  3OHM B;  1KFU S;  3VGO A;  1F70 A;  3K21 A;  2BE4 A;  1WRK A;  1XFZ O;  1J55 A;  3HCM A;  1IKU A;  1DGV A;  1G33 A;  1QVI Y;  1TCF A;  2LLS A;  1CM4 A;  1YX7 A;  4OR9 B;  1GQM A;  2BL0 C;  1CLM A;  3CLN A;  3TDU A;  2NZ0 A;  3GOF A;  4P2Y B;  1OOJ A;  2M8U A;  1S1E A;  2Q4U A;  1PVA A;  4WQ2 A;  5DKQ A;  1FBV A;  1KK7 Z;  1JFK A;  2WCB A;  1NP8 A;  2H61 A;  3FS7 A;  1B47 A;  2WC8 A;  1ZOT B;  2F8P A;  2JT8 A;  1L7Z A;  1B8L A;  3I5G C;  1S6I A;  3LLE A;  1WDC B;  1QAT A;  2KQY A;  3JTD C;  4ORC B;  4ETO A;  2I7A A;  3IF7 A;  1QX7 A;  1XFV O;  1SMG A;  2F3Y A;  3C1V A;  3SIB A;  3KPX A;  1JF0 A;  1SL7 A;  1DMO A;  3TDI A;  1BR1 B;  1QV1 A;  1REC A;  2SAS A;  1DF0 A;  1S6C A;  4PDZ A;  3MSE B;  4YGA A;  1FI5 A;  1EJ3 A;  5HYD A;  2JT0 A;  4XJK B;  1QAS A;  2LUC A;  2ZN8 A;  2JWW A;  2I18 A;  4R1E A;  1AHR A;  1Y1A A;  1SW8 A;  4DS7 A;  3TDZ A;  2M3W A;  4PHM A;  1TNX A;  4DCK A;  2ZN9 A;  4CID A;  3CR5 X;  3PM8 A;  4OVN F;  4YI9 A;  1K2H A;  4L9M A;  1N2D A;  2LLT A;  4OV2 A;  1KFX L;  2L5X B;  3JVT C;  4PAL A;  1PVB A;  1SL9 A;  2JNX A;  2KYF A;  1CM1 A;  1SYM A;  2ZKM X;  2L0P A;  1AK8 A;  1M46 A;  2MLE C;  1H8B A;  1LA3 A;  2LLU A;  2L50 A;  5PAL A;  2CCM A;  3RLZ A;  1BMO A;  1WRZ A;  1WY9 A;  1GGZ A;  3M0W A;  3NSI A;  3SG4 A;  2LV7 A;  1BOD A;  1DF0 B;  1SR6 B;  1F8H A;  1AJ4 A;  1W7I B;  3OX5 A;  3BUW B;  4XYN A;  2I2R E;  3CWG A;  2K61 A;  4MZL A;  2CBL A;  2MJW B;  1KQM B;  1E8A A;  2WCF A;  4YGB B;  2ZRS A;  4M2P A;  1AUI B;  5D69 A;  5I2O A;  2QAC A;  1BLQ A;  1G4Y R;  2F2O A;  1IRJ A;  1QIW A;  4HRH A;  2ZFD A;  1CLB A;  4JQ0 D;  1Y1X A;  4F0Z B;  3DVJ A;  4PCW A;  4DUQ A;  2K0J A;  3TZ1 A;  2WCE A;  2L2E A;  2M29 A;  2WND A;  4MEW A;  1CFF A;  4AOM A;  1OMV A;  1YRU B;  2L4H A;  2JXL A;  3PAL A;  2L98 A;  1OMD A;  1Y0V H;  3A4U B;  4DRW A;  1A75 A;  2KGB C;  3I5H B;  1YVH A;  1R6P A;  2FJU B;  3SIA A;  1S5G Y;  5HKZ A;  1TNW A;  4WRI A;  1SL8 A;  5HKW A;  1CDM A;  1SKT A;  1MHO A;  1A03 A;  2MRD A;  2JNF A;  1DVI A;  4ORA B;  3FWB A;  1YUS A;  1BJF A;  2K7C A;  4N5X A;  3JTD B;  1K90 D;  1DGU A;  1Q80 A;  3D0Y B;  4PE1 A;  2KQ6 A;  1PUL A;  4C0K A;  1K95 A;  2EGD A;  4MBE A;  1K96 A;  1YTZ C;  3BUM B;  1JUO A;  1IWQ A;  3ZWH A;  1J7O A;  1F71 A;  3BUO B;  5B8I B;  1OMR A;  5G08 A;  2G9B A;  1NX2 A;  1R2U A;  3EVU A;  1QLS A;  3QRX A;  1IJ5 A;  2HET A;  4I5L B;  5ER4 X;  5K89 A;  2O60 A;  2K8M B;  5BPJ A;  2HQW A;  3CGA A;  1QX2 A;  1UHK A;  2HF5 A;  4N1F A;  5HLO A;  1MWN A;  2K7B A;  3GK2 A;  4NDC A;  1H4B A;  2JTZ A;  5DKR A;  4E68 A;  1XK4 A;  1JFJ A;  2BCA A;  1A29 A;  3LK0 A;  3OB2 B;  3NXA A;  1IQ3 A;  4MRY A;  2L4I A;  1AJ5 A;  4HRE E;  4CLN A;  1JWD A;  2OS8 C;  4I5K A;  1B8R A;  1UWO A;  1XFY O;  2JOJ A;  2Y5I A;  1A4P A;  1PRW A;  3BOW A;  2P6B B;  2AUC A;  4PE4 A;  1L2O C;  2LCP A;  3KO0 A;  1C7V A;  1JC2 A;  2E6W A;  2LHL A;  2GGZ A;  3OX6 A;  2F2P A;  1RJV A;  2PVB A;  2E30 A;  1NCZ A;  4FTG A;  1QJT A;  3CS1 A;  1XYD A;  1WRL A;  2KBI A;  4TNC A;  1DJW A;  1ZUZ A;  4AQJ A;  3D10 A;  3IQO A;  3EVV A;  5DKN A;  1F54 A;  1DJH A;  1PAL A;  1RTP 1;  2OPO A;  1OSA A;  2ZNE A;  1IH0 A;  2JXC A;  4PE0 A;  1TTX A;  1WLZ A;  3O6B A;  3TUY C;  1PSR A;  4CFQ A;  1BT6 A;  2LVK A;  4A4C A;  4NDD A;  1BG1 A;  3DVK A;  2NCO A;  5GQQ C;  1K8U A;  1W7J B;  3EKJ A;  3AAJ A;  1FW4 A;  4YGC B;  2ISD A;  2K7O A;  1K9P A;  1J1E A;  2KFF A;  1AVS A;  2DOQ A;  1SR6 C;  4QJ3 B;  4YGE B;  2A4J A;  5F6T A;  1J7R A;  2LVI A;  3O78 A;  1BR4 B;  1TNP A;  1BU3 A;  1QVI Z;  4M2O A;  5TNC A;  1EG3 A;  1RK9 A;  1ZAC A;  1Y6W A;  1K94 A;  2CXJ A;  2M49 B;  1MXL C;  5I8N A;  3I5H C;  2OS8 B; 
#chains in the Genus database with same CATH topology
 2KI6 D;  2BBN A;  1QV0 A;  2KHN A;  2WC5 A;  4MZJ A;  1K9K A;  3GK1 A;  3SJS A;  3AKB A;  3NSL A;  3VRR A;  2KLE A;  2HPS A;  1C7W A;  2LHI A;  3V2L A;  1B7T Z;  2M7N A;  4MSP A;  3I5I C;  3SG2 A;  2GGM A;  4I5N B;  2NXQ A;  3A8R A;  2EHB A;  1UHN A;  3O4Y A;  1IQ5 A;  1IJ6 A;  1YUU A;  4OKH A;  2LUX A;  1XFW O;  5CSF A;  3WHT B;  2BKI B;  4USL A;  1OOH A;  2KOT A;  1S6J A;  3PN7 C;  1CFD A;  4MN0 A;  3S0G A;  1TIZ A;  4JD9 A;  1XFX O;  1S36 A;  2BNX A;  3O2P A;  1N0Y A;  2Y1N A;  2ZRT A;  3IQQ A;  4Q04 A;  1IG5 A;  5AER A;  1U5I A;  4F7F A;  3PFV A;  4ZCU A;  4I5J A;  1QLK A;  2JRF A;  3AAK A;  5I2L A;  4XJK A;  1OZO A;  1MUX A;  3SG6 A;  1YUT A;  1NIW A;  2OTG C;  1EXR A;  3BJH A;  1J7Q A;  3VRN A;  1TN4 A;  1V1F A;  1KCY A;  1M31 A;  4GGN A;  2JZI A;  1KWO C;  2KI4 C;  4MRX A;  5AXI A;  1CDP A;  4MZK A;  1JBA A;  3PM2 A;  2KAX A;  4PT1 A;  3JVT B;  3R72 A;  4DIR A;  3WHU B;  3HX4 A;  2FJY A;  1DJI A;  1F55 A;  3BFB A;  4AQI A;  1WDC C;  2BBM A;  2H61 C;  3ZNI A;  1LIN A;  1NUB A;  2K2A A;  3DVE A;  3EK8 A;  3R1P A;  1LXF C;  4N1G A;  2PYQ A;  4ORB B;  5CSJ A;  4BY5 A;  5CSN A;  1DT7 B;  1ZFS A;  2JC2 A;  2IS9 A;  1KK7 Y;  2LVJ A;  1KSO A;  3D0Y A;  2P71 A;  4YBH B;  1XFU O;  1SBJ A;  1KFX S;  1KQM C;  3BQ3 A;  2KAY A;  1LS8 A;  1YUR A;  1J1D A;  4OCI A;  1LA0 A;  3TS5 C;  2BL0 B;  2F33 A;  3OBV A;  1XVJ A;  1W9Z A;  2M1U A;  5KU1 A;  1KSM A;  4WQ3 A;  1B4C A;  3DD4 A;  1CDN A;  1TCO B;  2V53 A;  3SS5 A;  3SS3 A;  3BFH A;  3CR4 X;  2VRG A;  1K9U A;  4MVF A;  2WOS A;  4GGF A;  1BF5 A;  3R1O A;  1OOF A;  2HQ8 A;  1NCY A;  2LC5 A;  1B9A A;  3I5G B;  1UHJ A;  1FI6 A;  4D1E A;  2PMY A;  1CTR A;  1SSE B;  2LMU A;  2O5G A;  3ICB A;  2BCX A;  1CMF A;  1SCM C;  3I5F B;  1HT9 A;  2Y1M A;  3FWC A;  5DIC A;  5I2Q A;  4NQG A;  4YRU A;  2MLF C;  3L4A A;  1CFC A;  2JPT A;  3R1V A;  1FF1 A;  1OQP A;  1CMG A;  1PSB A;  4M2Q A;  4QJ4 B;  3EK7 A;  2MA2 A;  4OZD A;  2M7L A;  4UPG A;  2PRU A;  3BXK A;  4GGF C;  4YI8 A;  5JOL A;  1MR8 A;  5AFP A;  1QWV A;  4IL1 A;  1Y1U A;  1CLL A;  2FCE A;  5CSI A;  2L5Y A;  3OGN A;  3EK4 A;  1U5I B;  3KF9 A;  5JJG A;  2G2B A;  3DZT A;  2BEC A;  3SG3 A;  3S0A A;  1M45 A;  2KSP A;  2ERB A;  1D1O A;  5KTY A;  4JPZ B;  4BY4 A;  3VRP A;  1A75 B;  2H8V A;  2JT3 A;  2KGR A;  5FI6 A;  1KK8 B;  3SG5 A;  3NHT A;  1ALW A;  2Y4Q A;  4MLW A;  2K2F A;  4JWQ A;  4C0J A;  2JTT A;  5ER5 A;  1HQV A;  2NCP A;  2WOR A;  2KNE A;  3NSK A;  1SCM B;  2M97 A;  3D78 A;  2R2I A;  1QTX A;  2LAN A;  3WNX B;  1SK6 D;  2PSR A;  2GV5 A;  4ICB A;  1YR5 A;  2CT9 A;  3NHI A;  3UO9 A;  3BUN B;  3PJI A;  5J3X A;  2H2K A;  1B1G A;  2KI6 C;  2Q91 A;  2M1K B;  1N65 A;  1XA5 A;  1EG4 A;  2JU0 A;  2ZND A;  4FQO A;  1RFJ A;  1NSH A;  1RWY A;  3PSR A;  4IJ7 A;  5AEQ A;  2EC6 B;  2WCJ A;  2M0R A;  2KBM A;  1GJY A;  3NSO A;  1PK0 D;  3SG7 A;  1FPW A;  2KAV A;  2LM5 A;  5EL2 A;  1F4Q A;  4PHN A;  2K7D A;  2JPO A;  1KFU L;  2TN4 A;  3BOW B;  3VRQ A;  2D8N A;  3DF0 B;  2L51 A;  2QEB A;  2MBX A;  3LL8 B;  3VRO A;  1B7T Y;  1M39 A;  2LP2 A;  1MF8 B;  1IGV A;  3F45 A;  1M63 B;  1UUS A;  4PHK A;  2LP3 A;  1NPQ A;  4CFR A;  1OOG A;  3I5F C;  3LK1 A;  2AAO A;  4HRG A;  1UHH A;  2KFH A;  2NLN A;  4P5O E;  1ODB A;  1KQV A;  1NX1 A;  1G8I A;  1X02 A;  5HLV A;  1DTL A;  2OTG B;  1TUJ A;  1NYA A;  3S0B A;  2LMV A;  3DVM A;  3OP0 A;  3BYA A;  1S26 D;  1TOP A;  3PLF B;  3OB1 B;  4GFT A;  2CNP A;  1XO5 A;  1EH2 A;  2I94 A;  3CZT X;  1V1G A;  1DJY A;  1Z4H A;  3EVR A;  4GAO A;  1SRA A;  1SPY A;  1SCV A;  3BUX B;  2EC6 C;  4U8D A;  1B8C A;  1CB1 A;  2COL B;  3S0D A;  3WXA A;  5AAN A;  3DF0 A;  2RGI A;  1VRK A;  1LKJ A;  2PAL A;  1DJG A;  1QX5 B;  2L2C A;  4NDB A;  5FYX A;  3D73 A;  3PAT A;  4HSZ A;  2M9G A;  5CPV A;  1NCX A;  1C3Z A;  1NX0 A;  1YVL A;  1UHI A;  1JF2 A;  3KHE A;  1CDL A;  1S5G Z;  3CZ2 A;  3H4S E;  2MAZ A;  3KEV A;  3D76 A;  3QME A;  1MXE A;  3CR2 A;  5D7F A;  4GUK A;  2F3Z A;  2QPT A;  1S3P A;  2BCB A;  1A2X A;  2P70 A;  1WLM A;  1TRF A;  3IVT A;  3VB1 A;  1ZMZ A;  1BOC A;  1CKK A;  1QS7 A;  3TS5 B;  1F4O A;  1XK4 C;  1ALV A;  1EL4 A;  2FOT A;  2B1U A;  2SCP A;  3LCP C;  2LE9 B;  4QJ5 B;  1JSA A;  3CTN A;  1NX3 A;  5KSZ A;  1UUR A;  2PQL A;  1GGW A;  3CZ0 A;  1XFR A;  2CTN A;  1YX8 A;  2BE6 A;  1GM0 A;  1YRT B;  3E3R A;  4PE7 A;  4ZCV A;  1RRO A;  2LNK A;  2FCD A;  4CPV A;  3Q8I A;  2JQ6 A;  2LMT A;  3B7A A;  1CNP A;  2WCM A;  2KYC A;  2LVV A;  1SNL A;  3K1E A;  4JKT A;  2WCK A;  1OW4 A;  4YGD B;  1QIV A;  1OZS A;  1DJZ A;  3PN7 B;  1CFP A;  3FIA A;  2AMI A;  2LAP A;  3GK4 X;  1NWD A;  1QXP A;  3TUY B;  3FE6 A;  2KDH A;  2BKH B;  1KWO B;  5HKY A;  3RM1 A;  1K93 D;  3FE9 A;  5D3O A;  3I5I B;  3BFA A;  1DJX A;  3O4X A;  2KPH A;  1UP5 A;  3AKA A;  1C07 A;  1SY9 A;  3DYE A;  3EKH A;  2PAS A;  2MHH A;  1LVC D;  1KK8 C;  5HL1 A;  1AP4 A;  2KFG A;  3DXL A;  4A4B A;  4C0L A;  2WC6 A;  4GNK B;  1TNQ A;  2KI4 B;  3B86 A;  5IBW A;  1MQ1 A;  2JUL A;  1L2O B;  1OE9 B;  4GPL B;  3L47 A;  4INX A;  4PHJ A;  1J7P A;  4GBA A;  3OHM B;  3FE8 A;  3RZS A;  1KFU S;  3VGO A;  1F70 A;  3K21 A;  2BE4 A;  1WRK A;  3S0E A;  5FI7 A;  1XFZ O;  1J55 A;  3HCM A;  3UNW A;  3D74 A;  1DGV A;  1DC1 A;  1IKU A;  1G33 A;  1QVI Y;  1TCF A;  2LLS A;  1CM4 A;  1YX7 A;  4OR9 B;  1GQM A;  2BL0 C;  1CLM A;  3CLN A;  1DQE A;  3TDU A;  2NZ0 A;  3B88 A;  2WCL A;  3GOF A;  3EG5 B;  1OOJ A;  2M8U A;  4P2Y B;  1S1E A;  2BAP A;  1PVA A;  2Q4U A;  4WQ2 A;  1FBV A;  1KK7 Z;  1JFK A;  2WCB A;  5DKQ A;  1NP8 A;  2H61 A;  3FS7 A;  1B47 A;  2WC8 A;  1ZOT B;  2F8P A;  2JT8 A;  1L7Z A;  1B8L A;  3I5G C;  1S6I A;  3LLE A;  3N7H A;  1WDC B;  1QAT A;  2KQY A;  3JTD C;  4ORC B;  4ETO A;  2I7A A;  3IF7 A;  1QX7 A;  1XFV O;  1SMG A;  2F3Y A;  3C1V A;  3SIB A;  3KPX A;  1JF0 A;  1SL7 A;  1DMO A;  3TDI A;  1BR1 B;  2GTE A;  1QV1 A;  1REC A;  2QDI A;  2SAS A;  1DF0 A;  1S6C A;  4PDZ A;  3MSE B;  4YGA A;  1FI5 A;  1EJ3 A;  5HYD A;  3DY9 A;  2JT0 A;  4XJK B;  1QAS A;  2LUC A;  2ZN8 A;  2JWW A;  2I18 A;  4R1E A;  1AHR A;  1Y1A A;  1SW8 A;  4DS7 A;  3TDZ A;  2M3W A;  2KLD A;  2YGU A;  1TNX A;  4PHM A;  4DCK A;  2ZN9 A;  4CID A;  3CR5 X;  3PM8 A;  4OVN F;  4YI9 A;  1K2H A;  4L9M A;  1N2D A;  2LLT A;  4OV2 A;  1KFX L;  1T14 A;  1DEL A;  2L5X B;  3JVT C;  4FQT A;  4PAL A;  1PVB A;  1SL9 A;  2JNX A;  2KYF A;  1CM1 A;  1SYM A;  2ZKM X;  2L0P A;  1AK8 A;  1M46 A;  2MLE C;  1H8B A;  1LA3 A;  2LLU A;  2L50 A;  5PAL A;  2CCM A;  3RLZ A;  1BMO A;  1WRZ A;  1WY9 A;  1GGZ A;  3M0W A;  3B6X A;  3NSI A;  3SG4 A;  2LV7 A;  1BOD A;  1DF0 B;  1SR6 B;  1F8H A;  1DEK A;  1AJ4 A;  1W7I B;  3OX5 A;  3BUW B;  4XYN A;  2I2R E;  3CWG A;  2K61 A;  4MZL A;  2CBL A;  2MJW B;  1KQM B;  1E8A A;  2WCF A;  4YGB B;  2ZRS A;  4M2P A;  1AUI B;  1TUZ A;  5D69 A;  5I2O A;  2QAC A;  1IIO A;  1BLQ A;  1G4Y R;  2F2O A;  1IRJ A;  4INW A;  1QIW A;  4HRH A;  2ZFD A;  1CLB A;  4JQ0 D;  1Y1X A;  4F0Z B;  3DVJ A;  4KYN A;  4PCW A;  4DUQ A;  2K0J A;  3TZ1 A;  2WCE A;  2L2E A;  2M29 A;  1ORG A;  2WND A;  4MEW A;  5I94 A;  1CFF A;  4AOM A;  1OMV A;  1YRU B;  2L4H A;  2JXL A;  3PAL A;  2L98 A;  1OMD A;  1Y0V H;  3A4U B;  4DRW A;  1A75 A;  2KGB C;  3I5H B;  1YVH A;  1R6P A;  2FJU B;  3SIA A;  1S5G Y;  5HKZ A;  1TNW A;  4WRI A;  1C3Y A;  1SL8 A;  5HKW A;  1CDM A;  3CAB A;  1SKT A;  1MHO A;  1A03 A;  2MRD A;  2JNF A;  1DVI A;  5FI2 A;  4ORA B;  3FWB A;  1YUS A;  1BJF A;  2QEH A;  2K7C A;  4N5X A;  3S0F A;  3JTD B;  1K90 D;  1DGU A;  1Q80 A;  3D0Y B;  4PE1 A;  2KQ6 A;  1PUL A;  4C0K A;  1K95 A;  2EGD A;  4MBE A;  3NGV A;  1K96 A;  1YTZ C;  3BUM B;  1JUO A;  1IWQ A;  3ZWH A;  1J7O A;  1F71 A;  3BUO B;  5B8I B;  1OMR A;  5G08 A;  1NX2 A;  1R2U A;  2G9B A;  3EVU A;  1QLS A;  3QRX A;  1IJ5 A;  2HET A;  4I5L B;  5ER4 X;  5K89 A;  2O60 A;  2K8M B;  5BPJ A;  2HQW A;  3CGA A;  3CYZ A;  1QX2 A;  1UHK A;  2HF5 A;  4N1F A;  1Z2C B;  5HLO A;  1MWN A;  2K7B A;  3GK2 A;  4NDC A;  1H4B A;  2JTZ A;  5DKR A;  4E68 A;  1XK4 A;  1JFJ A;  2BCA A;  1A29 A;  3LK0 A;  3OB2 B;  3NXA A;  1IQ3 A;  4MRY A;  2L4I A;  1AJ5 A;  3B87 A;  4HRE E;  4CLN A;  2OS8 C;  1JWD A;  4I5K A;  1B8R A;  1UWO A;  1XFY O;  2JOJ A;  1P28 A;  1TWO A;  1A4P A;  1PRW A;  2Y5I A;  3BOW A;  2P6B B;  2AUC A;  3CDN A;  1L2O C;  4PE4 A;  2LCP A;  3KO0 A;  1C7V A;  3SS4 A;  1JC2 A;  1OOI X;  2E6W A;  2LHL A;  2GGZ A;  3OX6 A;  2F2P A;  1RJV A;  2PVB A;  2E30 A;  1NCZ A;  4FTG A;  1QJT A;  3CS1 A;  1XYD A;  1WRL A;  2KBI A;  2WCH A;  1DJW A;  1ZUZ A;  4TNC A;  4AQJ A;  3D10 A;  3IQO A;  3EVV A;  5DKN A;  1F54 A;  1DJH A;  1PAL A;  1RTP 1;  2OPO A;  1OSA A;  2QEO A;  2ZNE A;  1IH0 A;  2JXC A;  4PE0 A;  1TTX A;  1WLZ A;  2QEV A;  3D77 A;  3L4L A;  3O6B A;  3TUY C;  1PSR A;  4CFQ A;  1BT6 A;  2LVK A;  4A4C A;  4NDD A;  1BG1 A;  3DVK A;  2NCO A;  5GQQ C;  1K8U A;  1W7J B;  3EKJ A;  3AAJ A;  1FW4 A;  4YGC B;  2ISD A;  2K7O A;  1K9P A;  1J1E A;  2KFF A;  1AVS A;  2DOQ A;  1SR6 C;  4QJ3 B;  4YGE B;  2K60 A;  2A4J A;  3CZ1 A;  5F6T A;  1J7R A;  2LVI A;  3O78 A;  1BR4 B;  1TNP A;  1BU3 A;  1QVI Z;  4M2O A;  5TNC A;  1EG3 A;  1RK9 A;  1ZAC A;  1Y6W A;  1K94 A;  2CXJ A;  2M49 B;  1MXL C;  3D75 A;  5I8N A;  3I5H C;  2OS8 B; 
#chains in the Genus database with same CATH homology
 2KI6 D;  2BBN A;  1QV0 A;  2KHN A;  4MZJ A;  1K9K A;  3GK1 A;  3SJS A;  3AKB A;  3NSL A;  3VRR A;  2HPS A;  1C7W A;  2LHI A;  1B7T Z;  2M7N A;  4MSP A;  3I5I C;  3SG2 A;  2GGM A;  4I5N B;  2NXQ A;  3A8R A;  2EHB A;  1UHN A;  3O4Y A;  1IQ5 A;  1IJ6 A;  1YUU A;  4OKH A;  2LUX A;  1XFW O;  5CSF A;  3WHT B;  2BKI B;  4USL A;  2KOT A;  1S6J A;  3PN7 C;  1CFD A;  4MN0 A;  1TIZ A;  1XFX O;  1S36 A;  3O2P A;  1N0Y A;  2Y1N A;  2ZRT A;  3IQQ A;  4Q04 A;  1IG5 A;  5AER A;  1U5I A;  3PFV A;  4ZCU A;  4I5J A;  1QLK A;  2JRF A;  3AAK A;  5I2L A;  4XJK A;  1OZO A;  1MUX A;  3SG6 A;  1YUT A;  1NIW A;  2OTG C;  1EXR A;  1J7Q A;  3VRN A;  1TN4 A;  1V1F A;  1KCY A;  1M31 A;  4GGN A;  2JZI A;  1KWO C;  2KI4 C;  4MRX A;  5AXI A;  1CDP A;  4MZK A;  1JBA A;  2KAX A;  3JVT B;  4DIR A;  3WHU B;  3HX4 A;  1DJI A;  1F55 A;  4AQI A;  1WDC C;  2BBM A;  2H61 C;  3ZNI A;  1LIN A;  1NUB A;  2K2A A;  3DVE A;  3EK8 A;  4N1G A;  1LXF C;  4ORB B;  5CSJ A;  5JOL A;  4BY5 A;  5CSN A;  1DT7 B;  1ZFS A;  2JC2 A;  2IS9 A;  1KK7 Y;  2LVJ A;  1KSO A;  3D0Y A;  4YBH B;  1XFU O;  1SBJ A;  1KFX S;  1KQM C;  3BQ3 A;  2KAY A;  1J1D A;  1YUR A;  4OCI A;  1LA0 A;  3TS5 C;  2BL0 B;  2F33 A;  1XVJ A;  2M1U A;  5KU1 A;  1KSM A;  4WQ3 A;  1B4C A;  3DD4 A;  1CDN A;  1TCO B;  2V53 A;  3CR4 X;  2VRG A;  1K9U A;  4MVF A;  2WOS A;  4GGF A;  1BF5 A;  2HQ8 A;  2LC5 A;  1NCY A;  3I5G B;  1B9A A;  1UHJ A;  1FI6 A;  4D1E A;  2PMY A;  1CTR A;  2LMU A;  2O5G A;  3ICB A;  2BCX A;  1CMF A;  1SCM C;  3I5F B;  1HT9 A;  2Y1M A;  3FWC A;  5I2Q A;  4NQG A;  4YRU A;  2MLF C;  1CFC A;  2JPT A;  1FF1 A;  1OQP A;  1CMG A;  1PSB A;  4M2Q A;  4QJ4 B;  3EK7 A;  2MA2 A;  2M7L A;  4UPG A;  2PRU A;  3BXK A;  4GGF C;  4YI8 A;  1MR8 A;  5AFP A;  4IL1 A;  1Y1U A;  1CLL A;  2FCE A;  5CSI A;  3EK4 A;  1U5I B;  3KF9 A;  5JJG A;  2G2B A;  2BEC A;  3SG3 A;  1M45 A;  2KSP A;  1D1O A;  5KTY A;  4JPZ B;  4BY4 A;  3VRP A;  1A75 B;  2JT3 A;  2KGR A;  1KK8 B;  3SG5 A;  1ALW A;  2Y4Q A;  4MLW A;  2K2F A;  4JWQ A;  4C0J A;  2JTT A;  5ER5 A;  1HQV A;  2NCP A;  2WOR A;  2KNE A;  3NSK A;  1SCM B;  2M97 A;  2R2I A;  1QTX A;  2LAN A;  3WNX B;  1SK6 D;  2PSR A;  2GV5 A;  4ICB A;  1YR5 A;  2CT9 A;  3BUN B;  5J3X A;  2H2K A;  1B1G A;  2KI6 C;  2Q91 A;  2M1K B;  1N65 A;  1XA5 A;  1EG4 A;  2JU0 A;  2ZND A;  4FQO A;  1RFJ A;  1NSH A;  1RWY A;  3PSR A;  5AEQ A;  2EC6 B;  2M0R A;  2KBM A;  1GJY A;  3NSO A;  1PK0 D;  3SG7 A;  1FPW A;  2KAV A;  2LM5 A;  1F4Q A;  4PHN A;  2K7D A;  2TN4 A;  1KFU L;  3BOW B;  3VRQ A;  2D8N A;  3DF0 B;  2L51 A;  2MBX A;  3LL8 B;  3VRO A;  1B7T Y;  1M39 A;  2LP2 A;  1MF8 B;  1IGV A;  3F45 A;  1M63 B;  1UUS A;  4PHK A;  2LP3 A;  1NPQ A;  4CFR A;  3I5F C;  3LK1 A;  2AAO A;  4HRG A;  1UHH A;  2KFH A;  2NLN A;  4P5O E;  1ODB A;  1KQV A;  1NX1 A;  1G8I A;  1X02 A;  5HLV A;  1DTL A;  2OTG B;  1NYA A;  2LMV A;  3DVM A;  3OP0 A;  3BYA A;  1S26 D;  1TOP A;  3PLF B;  3OB1 B;  4GFT A;  2CNP A;  1XO5 A;  1EH2 A;  2I94 A;  3CZT X;  1V1G A;  1DJY A;  3EVR A;  4GAO A;  1SRA A;  1SPY A;  1SCV A;  3BUX B;  2EC6 C;  4U8D A;  1B8C A;  1CB1 A;  2COL B;  3WXA A;  5AAN A;  3DF0 A;  2RGI A;  1VRK A;  1LKJ A;  2PAL A;  1DJG A;  1QX5 B;  4NDB A;  5FYX A;  3PAT A;  4HSZ A;  2M9G A;  5CPV A;  1NCX A;  1NX0 A;  1YVL A;  1UHI A;  1JF2 A;  3KHE A;  1CDL A;  1S5G Z;  3H4S E;  2MAZ A;  3KEV A;  1MXE A;  3CR2 A;  5D7F A;  4GUK A;  2F3Z A;  2QPT A;  1S3P A;  2BCB A;  1A2X A;  1WLM A;  1TRF A;  1ZMZ A;  1BOC A;  1CKK A;  1QS7 A;  3TS5 B;  1F4O A;  1XK4 C;  1ALV A;  1EL4 A;  2FOT A;  2B1U A;  2SCP A;  3LCP C;  2LE9 B;  4QJ5 B;  1JSA A;  3CTN A;  1NX3 A;  5KSZ A;  1UUR A;  1GGW A;  2CTN A;  1YX8 A;  2BE6 A;  1YRT B;  3E3R A;  4PE7 A;  4ZCV A;  1RRO A;  2LNK A;  2FCD A;  4CPV A;  2JQ6 A;  2LMT A;  1CNP A;  2KYC A;  2LVV A;  1SNL A;  4YGD B;  1QIV A;  1OZS A;  1DJZ A;  3PN7 B;  1CFP A;  3FIA A;  2AMI A;  2LAP A;  3GK4 X;  1NWD A;  1QXP A;  3TUY B;  2KDH A;  2BKH B;  1KWO B;  5HKY A;  3RM1 A;  1K93 D;  3I5I B;  1DJX A;  3AKA A;  1UP5 A;  1C07 A;  1SY9 A;  3EKH A;  2PAS A;  2MHH A;  1LVC D;  1KK8 C;  1AP4 A;  2KFG A;  4A4B A;  4C0L A;  4GNK B;  1TNQ A;  2KI4 B;  5IBW A;  1MQ1 A;  2JUL A;  1L2O B;  1OE9 B;  4GPL B;  4PHJ A;  1J7P A;  4GBA A;  3OHM B;  1KFU S;  3VGO A;  1F70 A;  3K21 A;  2BE4 A;  1WRK A;  1XFZ O;  1J55 A;  3HCM A;  1IKU A;  1DGV A;  1G33 A;  1QVI Y;  1TCF A;  2LLS A;  1CM4 A;  1YX7 A;  4OR9 B;  1GQM A;  2BL0 C;  1CLM A;  3CLN A;  3TDU A;  2NZ0 A;  3GOF A;  4P2Y B;  1OOJ A;  2M8U A;  1S1E A;  2Q4U A;  1PVA A;  4WQ2 A;  5DKQ A;  1FBV A;  1KK7 Z;  1JFK A;  2WCB A;  1NP8 A;  2H61 A;  3FS7 A;  1B47 A;  2WC8 A;  1ZOT B;  2F8P A;  2JT8 A;  1L7Z A;  1B8L A;  3I5G C;  1S6I A;  3LLE A;  1WDC B;  1QAT A;  2KQY A;  3JTD C;  4ORC B;  4ETO A;  2I7A A;  3IF7 A;  1QX7 A;  1XFV O;  1SMG A;  2F3Y A;  3C1V A;  3SIB A;  3KPX A;  1JF0 A;  1SL7 A;  1DMO A;  3TDI A;  1BR1 B;  1QV1 A;  1REC A;  2SAS A;  1DF0 A;  1S6C A;  4PDZ A;  3MSE B;  4YGA A;  1FI5 A;  1EJ3 A;  5HYD A;  2JT0 A;  4XJK B;  1QAS A;  2LUC A;  2ZN8 A;  2JWW A;  2I18 A;  4R1E A;  1AHR A;  1Y1A A;  1SW8 A;  4DS7 A;  3TDZ A;  2M3W A;  4PHM A;  1TNX A;  4DCK A;  2ZN9 A;  4CID A;  3CR5 X;  3PM8 A;  4OVN F;  4YI9 A;  1K2H A;  4L9M A;  1N2D A;  2LLT A;  4OV2 A;  1KFX L;  2L5X B;  3JVT C;  4PAL A;  1PVB A;  1SL9 A;  2JNX A;  2KYF A;  1CM1 A;  1SYM A;  2ZKM X;  2L0P A;  1AK8 A;  1M46 A;  2MLE C;  1H8B A;  1LA3 A;  2LLU A;  2L50 A;  5PAL A;  2CCM A;  3RLZ A;  1BMO A;  1WRZ A;  1WY9 A;  1GGZ A;  3M0W A;  3NSI A;  3SG4 A;  2LV7 A;  1BOD A;  1DF0 B;  1SR6 B;  1F8H A;  1AJ4 A;  1W7I B;  3OX5 A;  3BUW B;  4XYN A;  2I2R E;  3CWG A;  2K61 A;  4MZL A;  2CBL A;  2MJW B;  1KQM B;  1E8A A;  2WCF A;  4YGB B;  2ZRS A;  4M2P A;  1AUI B;  5D69 A;  5I2O A;  2QAC A;  1BLQ A;  1G4Y R;  2F2O A;  1IRJ A;  1QIW A;  4HRH A;  2ZFD A;  1CLB A;  4JQ0 D;  1Y1X A;  4F0Z B;  3DVJ A;  4PCW A;  4DUQ A;  2K0J A;  3TZ1 A;  2WCE A;  2L2E A;  2M29 A;  2WND A;  4MEW A;  1CFF A;  4AOM A;  1OMV A;  1YRU B;  2L4H A;  2JXL A;  3PAL A;  2L98 A;  1OMD A;  1Y0V H;  3A4U B;  4DRW A;  1A75 A;  2KGB C;  3I5H B;  1YVH A;  1R6P A;  2FJU B;  3SIA A;  1S5G Y;  5HKZ A;  1TNW A;  4WRI A;  1SL8 A;  5HKW A;  1CDM A;  1SKT A;  1MHO A;  1A03 A;  2MRD A;  2JNF A;  1DVI A;  4ORA B;  3FWB A;  1YUS A;  1BJF A;  2K7C A;  4N5X A;  3JTD B;  1K90 D;  1DGU A;  1Q80 A;  3D0Y B;  4PE1 A;  2KQ6 A;  1PUL A;  4C0K A;  1K95 A;  2EGD A;  4MBE A;  1K96 A;  1YTZ C;  3BUM B;  1JUO A;  1IWQ A;  3ZWH A;  1J7O A;  1F71 A;  3BUO B;  5B8I B;  1OMR A;  5G08 A;  2G9B A;  1NX2 A;  1R2U A;  3EVU A;  1QLS A;  3QRX A;  1IJ5 A;  2HET A;  4I5L B;  5ER4 X;  5K89 A;  2O60 A;  2K8M B;  5BPJ A;  2HQW A;  3CGA A;  1QX2 A;  1UHK A;  2HF5 A;  4N1F A;  5HLO A;  1MWN A;  2K7B A;  3GK2 A;  4NDC A;  1H4B A;  2JTZ A;  5DKR A;  4E68 A;  1XK4 A;  1JFJ A;  2BCA A;  1A29 A;  3LK0 A;  3OB2 B;  3NXA A;  1IQ3 A;  4MRY A;  2L4I A;  1AJ5 A;  4HRE E;  4CLN A;  1JWD A;  2OS8 C;  4I5K A;  1B8R A;  1UWO A;  1XFY O;  2JOJ A;  2Y5I A;  1A4P A;  1PRW A;  3BOW A;  2P6B B;  2AUC A;  4PE4 A;  1L2O C;  2LCP A;  3KO0 A;  1C7V A;  1JC2 A;  2E6W A;  2LHL A;  2GGZ A;  3OX6 A;  2F2P A;  1RJV A;  2PVB A;  2E30 A;  1NCZ A;  4FTG A;  1QJT A;  3CS1 A;  1XYD A;  1WRL A;  2KBI A;  4TNC A;  1DJW A;  1ZUZ A;  4AQJ A;  3D10 A;  3IQO A;  3EVV A;  5DKN A;  1F54 A;  1DJH A;  1PAL A;  1RTP 1;  2OPO A;  1OSA A;  2ZNE A;  1IH0 A;  2JXC A;  4PE0 A;  1TTX A;  1WLZ A;  3O6B A;  3TUY C;  1PSR A;  4CFQ A;  1BT6 A;  2LVK A;  4A4C A;  4NDD A;  1BG1 A;  3DVK A;  2NCO A;  5GQQ C;  1K8U A;  1W7J B;  3EKJ A;  3AAJ A;  1FW4 A;  4YGC B;  2ISD A;  2K7O A;  1K9P A;  1J1E A;  2KFF A;  1AVS A;  2DOQ A;  1SR6 C;  4QJ3 B;  4YGE B;  2A4J A;  5F6T A;  1J7R A;  2LVI A;  3O78 A;  1BR4 B;  1TNP A;  1BU3 A;  1QVI Z;  4M2O A;  5TNC A;  1EG3 A;  1RK9 A;  1ZAC A;  1Y6W A;  1K94 A;  2CXJ A;  2M49 B;  1MXL C;  5I8N A;  3I5H C;  2OS8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...