1UHHA

Crystal structure of cp-aequorin
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
191
structure length
191
Chain Sequence
ANSKLTSDFDNPRWIGRHKHMFNFLDVNHNGKISLDEMVYKASDIVINNLGATPEQAKRHKDAVEAFFGGAGMKYGVETDWPAYIEGWKKLATDELEKYAKNEPTLIRIWGDALFDIVDKDQNGAITLDEWKAYTKAAGIIQSSEDCEETFRVCDIDESGQLDVDEMTRQHLGFWYTMDPACEKLYGGAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Luminescent protein
molecule keywords Aequorin 2
publication title The crystal structures of semi-synthetic aequorins
pubmed doi rcsb
source organism Aequorea victoria
total genus 68
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1uhhA00
1K9KA 1C07A 2DOQA 3IQOA 1DJZA 5HKZA 3SG2A 3BUXB 1QLSA 2CBLA 2ZN8A 5AERA 2BL0B 1K94A 1NYAA 3OHMB 4JWQA 2JT3A 2JXLA 1K93D 1MWNA 2BKIB 4XYNA 3WNXB 1BODA 3VRPA 4GUKA 1L2OB 2LVKA 3NSIA 2NLNA 1DF0A 4GPLB 2K7BA 3EVRA 2Y5IA 2QPTA 1SK6D 2EGDA 4R1EA 2WCFA 5DKRA 4YGDB 3RM1A 2LAPA 1PVBA 4P5OE 1NUBA 1ALVA 1SL9A 3BXKA 1S6CA 2F3YA 3I5IC 1F70A 5ER5A 4A4BA 1TCOB 1GQMA 4WRIA 1CFPA 4M2OA 5CSJA 1NX0A 2HQ8A 1ALWA 2AMIA 3I5FB 1YTZC 2KAVA 1WDCC 5HKYA 2M3WA 5CSFA 1DGVA 2FOTA 1QX7A 3LLEA 4PE7A 1X02A 1SCVA 3FWBA 2LMTA 1U5IA 4PHMA 4C0KA 1IH0A 2JTTA 1KQMB 1WRZA 2VRGA 3SG6A 1CMGA 3O2PA 1XFWO 3KF9A 3HX4A 3WHUB 1XFZO 2G9BA 4CIDA 1N0YA 2K2AA 1LA0A 3A8RA 2KI4C 2ISDA 4UPGA 2M9GA 1WDCB 1YX8A 2PMYA 3DF0B 1KK8B 2AAOA 2K8MB 3DVJA 2HF5A 2LE9B 1SKTA 4NDBA 5CSIA 1AUIB 1ZUZA 1DJWA 3GK4X 3JTDC 3CR5X 1KK7Z 4MLWA 1GGWA 2I2RE 2L4IA 3CTNA 4N1GA 4FQOA 2F2OA 5DKNA 1YUUA 3CZTX 1UUSA 2M0RA 2H61A 4E68A 1F55A 4P2YB 3IQQA 1S6IA 2PRUA 2ZNEA 3WHTB 4IL1A 1RTP1 4MEWA 3CS1A 1AHRA 1CM4A 5J3XA 2NCOA 1R6PA 5AANA 3BOWB 3JTDB 1IQ5A 1QATA 4DCKA 4XJKB 2V53A 1ZOTB 4ICBA 3EVVA 2EC6B 1JBAA 2ZFDA 5ER4X 4QJ4B 1S6JA 1ZACA 4DUQA 1BMOA 2MLEC 1AJ4A 1JC2A 3ZNIA 1SW8A 2WC8A 4M2PA 1WLZA 1QVIY 4OKHA 2AUCA 1NSHA 1KSMA 1NX1A 3OB1B 4ORBB 3EK4A 1GGZA 1K96A 2CT9A 2Y1MA 1XFUO 2WCEA 2L5XB 2BCBA 3I5GB 3M0WA 3O78A 1C7VA 2M7NA 2KGRA 3AAKA 1JUOA 2M1KB 1K9UA 1HQVA 1EG3A 2F2PA 1J7RA 1KWOC 2JNXA 1K9PA 1RECA 2CNPA 1GJYA 1OMVA 3BUMB 1QLKA 1K95A 5I2LA 3ICBA 1EJ3A 2F8PA 2K0JA 4OCIA 1JFJA 1L2OC 4NDCA 1XFYO 1EL4A 5PALA 1ZFSA 3A4UB 1G8IA 2SASA 3DF0A 4Q04A 4I5NB 1TNXA 4AOMA 2BCXA 2I94A 1RJVA 1SPYA 2K2FA 1BR1B 1UWOA 5D69A 2PALA 2KFGA 3CGAA 1BLQA 3KPXA 1FI5A 1KWOB 1KQVA 1K8UA 3FS7A 2QACA 5HKWA 2JQ6A 1J55A 4QJ3B 1RWYA 4CFQA 1Y0VH 2KBIA 1MUXA 1CFCA 4JQ0D 2OPOA 3I5FC 1YRUB 5HLOA 2JTZA 2BBMA 1OOJA 3NXAA 3HCMA 3TS5C 1DJIA 5HLVA 2LVVA 1SMGA 2GV5A 2R2IA 3DVMA 4PHKA 3DVEA 4MZKA 1J7OA 3BOWA 2BE6A 1KQMC 4OVNF 1M46A 2MAZA 1A4PA 5AFPA 4XJKA 2L4HA 3LL8B 4AQIA 1OSAA 1QS7A 2M29A 2Y4QA 1KK7Y 2JNFA 2JOJA 4GGNA 2GGMA 2MBXA 2L98A 4ORCB 1KFUL 1KK8C 5CPVA 1SR6B 1IKUA 1A29A 4N1FA 2F33A 4N5XA 3TS5B 1SCMC 1PALA 2OTGC 1M31A 3VGOA 1UURA 1OMRA 2JPTA 1LINA 1NWDA 2KAXA 4DIRA 4OR9B 5AXIA 2O60A 5D7FA 1BT6A 1B47A 1W7JB 2KDHA 1DJGA 1OZSA 3D10A 3GOFA 2LHIA 1IGVA 4YRUA 1J7QA 1CDNA 4L9MA 3TDIA 2KSPA 1RK9A 1UP5A 3KO0A 2KI6C 2LUCA 2K61A 3PLFB 2WNDA 1KFXS 1XVJA 1WRKA 1C7WA 1B7TZ 1M63B 2H2KA 1DMOA 1NCYA 1F54A 1OQPA 1PULA 2BECA 3OP0A 1SCMB 1SL8A 1PK0D 1OE9B 1WLMA 2OTGB 2NCPA 2JU0A 1TCFA 1IJ6A 5I2OA 4C0LA 1H4BA 2B1UA 4AQJA 1K2HA 2KOTA 2MRDA 2LANA 1QXPA 2LMUA 2EC6C 3DVKA 4YGAA 1CKKA 4ETOA 1TIZA 3CR4X 2BE4A 2MLFC 3MSEB 4MSPA 2LM5A 4CPVA 1DT7B 2KHNA 3I5HB 2FJUB 1PSBA 2KNEA 1FW4A 1FPWA 2CCMA 1B1GA 2FCDA 1QASA 1YUTA 1UHNA 1J1DA 3PM8A 3JVTC 2IS9A 4PE1A 1NP8A 3ZWHA 4PALA 1YVHA 1H8BA 5I8NA 3I5GC 1NX3A 2LVIA 2Y1NA 1Y1AA 1FBVA 1CMFA 3WXAA 4GNKB 1QIVA 1XK4C 3CWGA 4MBEA 4MZJA 3BUOB 2M97A 3PALA 1DGUA 2L2EA 2JRFA 3JVTB 1XYDA 2KFFA 1QV1A 3BQ3A 3F45A 2K7CA 2MHHA 1JSAA 2LC5A 1V1FA 1Y1UA 1B8LA 1VRKA 1DVIA 2KYCA 1QIWA 4HRHA 1JFKA 1HT9A 4MRXA 4WQ2A 3KEVA 4GGFC 5HYDA 3O6BA 1AK8A 5G08A 3C1VA 1S1EA 3PATA 1E8AA 3AKAA 3GK2A 1M45A 2LV7A 1BR4B 4NQGA 3NSOA 3SIBA 4USLA 1KSOA 2ZRTA 3CR2A 1YURA 5KTYA 1IG5A 3VRQA 2M7LA 1EXRA 1XO5A 3OX6A 4QJ5B 3LCPC 1MF8B 1ODBA 3BUWB 3FIAA 2KFHA 1F4QA 1B8RA 2MJWB 3GK1A 1LVCD 3PN7C 4I5LB 4D1EA 2PSRA 1B4CA 1IWQA 1WY9A 1MXEA 1Y6WA 1DJYA 1YR5A 5KU1A 1TTXA 1PVAA 1SY9A 3OX5A 2HPSA 1TNQA 3LK0A 3EKHA 2WORA 1CDPA 1LXFC 1AP4A 1TOPA 4I5JA 1J7PA 5F6TA 3D0YB 1SR6C 4YI8A 2JT8A 2KGBC 2LVJA 5BPJA 2BCAA 2M1UA 2LCPA 3IF7A 3AAJA 1UHIA 1NIWA 1NCZA 1NX2A 1CDMA 1B7TY 3PN7B 1QTXA 2NXQA 5FYXA 4PCWA 2HQWA 2I18A 4YI9A 3SJSA 3PSRA 1LA3A 1YUSA 1DJHA 1S5GZ 1MXLC 2LP2A 3SIAA 1D1OA 2HETA 1QX2A 2ZN9A 1UHJA 3BUNB 1B8CA 2FCEA 3FWCA 3NSLA 1JF0A 1NCXA 1M39A 1UHKA 4PHJA 2OS8B 2KBMA 2M49B 4MN0A 3NSKA 1L7ZA 1J1EA 2KAYA 2KQYA 3DD4A 1ZMZA 1CLMA 4HRGA 1SYMA 1XK4A 2LHLA 2K7DA 1BG1A 4MZLA 2MA2A 2PASA 1Y1XA 3VRRA 3VRNA 3I5HC 1EH2A 4ORAB 4CFRA 1QV0A 2E30A 1TNWA 1PSRA 1OZOA 4YGEB 2JXCA 5B8IB 2Q4UA 4DS7A 2I7AA 2JT0A 3EK7A 3RLZA 2NZ0A 2ZRSA 1A03A 2E6WA 2TN4A 1JWDA 1V1GA 2ZKMX 3CLNA 4C0JA 5K89A 4PHNA 4CLNA 2ZNDA 1UHHA 2G2BA 5JOLA 1QX5B 4HSZA 4GGFA 4JPZB 2JZIA 2SCPA 3I5IB 2L51A 3BYAA 1RFJA 2Q91A 1SNLA 3E3RA 4TNCA 1A75B 1MHOA 1FI6A 4M2QA 2WCBA 5CSNA 2CXJA 1YX7A 4WQ3A 2COLB 1RROA 3LK1A 4OV2A 2LUXA 3D0YA 3OB2B 5I2QA 1LKJA 1SL7A 2KQ6A 1S26D 1BOCA 2RGIA 5AEQA 1CLBA 4MRYA 3AKBA 4FTGA 4YGCB 1CDLA 1CFDA 2KI6D 2LMVA 1EG4A 4PE4A 5DKQA 2BBNA 1BJFA 3K21A 1SBJA 1IRJA 1G4YR 1PRWA 2K7OA 1AVSA 2KI4B 1DF0B 2BKHB 1XFVO 2LP3A 1OMDA 3SG3A 1IQ3A 4BY5A 1XA5A 3O4YA 1DJXA 1W7IB 3TUYC 1CTRA 1F71A 1CNPA 2L50A 1MR8A 4MVFA 2CTNA 1N2DA 2O5GA 2WOSA 1KCYA 2LNKA 2EHBA 3SG5A 1G33A 3TDUA 1CLLA 1S36A 1TNPA 1S3PA 3EKJA 2F3ZA 3PFVA 3QRXA 4YBHB 1SRAA 2D8NA 1Q80A 2A4JA 2GGZA 1KFUS 1CB1A 5KSZA 1NPQA 1KFXL 4F0ZB 1YVLA 1DTLA 1S5GY 1BU3A 1R2UA 1U5IB 2JC2A 2JWWA 1CM1A 1BF5A 4PDZA 4U8DA 3TUYB 1A2XA 2PVBA 2JULA 4A4CA 5IBWA 1FF1A 1F8HA 1YRTB 2LLUA 3SG4A 1CFFA 3SG7A 1F4OA 2H61C 4GAOA 5JJGA 1IJ5A 2BL0C 3H4SE 3EK8A 1AJ5A 4PE0A 1TN4A 2L0PA 1WRLA 2LLTA 1XFXO 3TZ1A 4GFTA 3KHEA 1A75A 1MQ1A 5GQQC 4NDDA 2M8UA 4DRWA 4HREE 1N65A 1QJTA 4GBAA 5TNCA 1B9AA 2KYFA 4BY4A 3EVUA 1K90D 4ZCVA 1TRFA 2OS8C 2P6BB 4ZCUA 4YGBB 3VROA 2LLSA 1JF2A 1QVIZ 4I5KA 3TDZA
chains in the Genus database with same CATH superfamily
1K9KA 1C07A 2DOQA 3IQOA 1DJZA 5HKZA 3SG2A 3BUXB 1QLSA 2CBLA 2ZN8A 5AERA 2WCJA 3BFHA 2BL0B 1K94A 1NYAA 1SSEB 2JPOA 3OHMB 4JWQA 2JT3A 2JXLA 1K93D 1MWNA 2BKIB 4XYNA 3WNXB 1BODA 3VRPA 4GUKA 1L2OB 2LVKA 3NSIA 2NLNA 1DF0A 4GPLB 2K7BA 3EVRA 2Y5IA 5DICA 2QPTA 3UNWA 1SK6D 2EGDA 4R1EA 2WCFA 5DKRA 4YGDB 3RM1A 2LAPA 1PVBA 1XFRA 2ERBA 4P5OE 1NUBA 1ALVA 1SL9A 3BXKA 1S6CA 2F3YA 3D75A 3I5IC 1F70A 5ER5A 4A4BA 1TCOB 1GQMA 4WRIA 1CFPA 4M2OA 3RZSA 5CSJA 1NX0A 2HQ8A 1ALWA 2AMIA 3I5FB 1YTZC 2KAVA 5FI7A 1WDCC 3NHIA 5HKYA 2M3WA 5CSFA 1DGVA 2FOTA 1QX7A 3CYZA 3LLEA 1X02A 1SCVA 4PE7A 3FWBA 2LMTA 1U5IA 4PHMA 3L4AA 4C0KA 1IH0A 2JTTA 1KQMB 1WRZA 2VRGA 2WCMA 3SG6A 1CMGA 2WCKA 3O2PA 1XFWO 2L2CA 3KF9A 3R72A 3HX4A 3WHUB 1XFZO 2G9BA 4CIDA 1N0YA 1DQEA 2K2AA 3B6XA 1LA0A 3A8RA 2KI4C 2ISDA 4UPGA 2M9GA 1WDCB 1YX8A 2PMYA 3DF0B 1KK8B 2AAOA 2K8MB 3DVJA 3Q8IA 2HF5A 2LE9B 1SKTA 4NDBA 5CSIA 1AUIB 1ZUZA 3QMEA 1DJWA 3GK4X 3JTDC 3CR5X 1KK7Z 4MLWA 3S0AA 1GGWA 2QEOA 2I2RE 2L4IA 3CTNA 4N1GA 4FQOA 2F2OA 5DKNA 1DELA 1YUUA 2KPHA 3CZTX 1UUSA 2M0RA 2H61A 4E68A 1F55A 4P2YB 3IQQA 1S6IA 2PRUA 2ZNEA 3WHTB 4IL1A 1RTP1 4MEWA 3CS1A 1AHRA 1CM4A 5J3XA 2NCOA 1R6PA 5HL1A 3D73A 2KLDA 5AANA 3BOWB 3JTDB 1IQ5A 1QATA 4DCKA 4XJKB 2V53A 1ZOTB 4ICBA 3EVVA 2EC6B 1JBAA 2ZFDA 5ER4X 4QJ4B 3CZ0A 1S6JA 1ZACA 4DUQA 1BMOA 2MLEC 1AJ4A 1JC2A 3ZNIA 1SW8A 2WC8A 4M2PA 1WLZA 1QVIY 4OKHA 2AUCA 1NSHA 1KSMA 1NX1A 3OB1B 3B87A 4ORBB 3EK4A 1GGZA 1K96A 2CT9A 2Y1MA 1XFUO 2WCEA 2L5XB 2BCBA 3I5GB 3M0WA 3O78A 1C7VA 2M7NA 2KGRA 3AAKA 1JUOA 2WCHA 2M1KB 1K9UA 1HQVA 1EG3A 2F2PA 3D77A 1J7RA 1KWOC 2JNXA 1K9PA 1RECA 2CNPA 1GJYA 1OMVA 3BUMB 3S0GA 1QLKA 3S0DA 1K95A 5I2LA 3ICBA 1EJ3A 2F8PA 2K0JA 4OCIA 1JFJA 1L2OC 4NDCA 1XFYO 1EL4A 3L47A 5PALA 1ZFSA 3A4UB 1G8IA 2SASA 3DF0A 4Q04A 4I5NB 1TNXA 1LS8A 3O4XA 4AOMA 2BCXA 2I94A 1RJVA 1SPYA 2K2FA 1BR1B 1UWOA 5D69A 2PALA 2KFGA 3CGAA 1BLQA 3KPXA 1FI5A 1DEKA 1KWOB 1KQVA 1K8UA 3FS7A 2QACA 5HKWA 2JQ6A 1J55A 4QJ3B 1RWYA 1OOGA 2QEHA 4CFQA 1Y0VH 2KBIA 1MUXA 1CFCA 4JQ0D 2OPOA 3I5FC 1YRUB 5HLOA 1W9ZA 2BBMA 2JTZA 1OOJA 3NXAA 3HCMA 2P70A 3TS5C 1DJIA 5HLVA 3FE8A 2LVVA 1SMGA 2GV5A 2R2IA 3DVMA 4PHKA 3S0BA 3DVEA 4MZKA 1J7OA 3BOWA 2BE6A 1KQMC 4OVNF 1M46A 2MAZA 1A4PA 5AFPA 4XJKA 2L4HA 3LL8B 2L5YA 4AQIA 1OSAA 1QS7A 2FJYA 2M29A 2Y4QA 3CZ1A 2KLEA 1KK7Y 2JNFA 2JOJA 2PYQA 3CZ2A 4GGNA 2GGMA 1IIOA 2MBXA 2L98A 4ORCB 1KFUL 1KK8C 5CPVA 3SS5A 1SR6B 1IKUA 1A29A 4N1FA 2F33A 4N5XA 3TS5B 1SCMC 1PALA 2OTGC 1M31A 3VGOA 1UURA 1OMRA 2JPTA 1LINA 1NWDA 2KAXA 4DIRA 4OR9B 5AXIA 2O60A 5D7FA 1BT6A 1B47A 1QWVA 1W7JB 2KDHA 1DJGA 1OZSA 3D10A 3GOFA 3SS3A 1T14A 1IGVA 2LHIA 4YRUA 1CDNA 4L9MA 1J7QA 3TDIA 2KSPA 1RK9A 1UP5A 3KO0A 2KI6C 2LUCA 2K61A 3BJHA 3PLFB 4FQTA 2WNDA 1KFXS 1XVJA 1WRKA 1C7WA 1B7TZ 1M63B 2H2KA 2YGUA 1DMOA 1NCYA 1F54A 1OQPA 1PULA 2BECA 3OP0A 1SCMB 1SL8A 1PK0D 1OE9B 1WLMA 2OTGB 2WC5A 2NCPA 3OGNA 2JU0A 1TCFA 1IJ6A 2PQLA 5I2OA 4C0LA 1H4BA 2B1UA 4AQJA 1K2HA 2KOTA 2MRDA 2LANA 1QXPA 2LMUA 2EC6C 3DVKA 4YGAA 1CKKA 4ETOA 1TIZA 3CR4X 2BE4A 2MLFC 3V2LA 3MSEB 3R1VA 4MSPA 2LM5A 4CPVA 1DT7B 2KHNA 3I5HB 1OW4A 1PSBA 2FJUB 2KNEA 1FW4A 1FPWA 2CCMA 1B1GA 2BNXA 1QASA 1YUTA 1UHNA 1J1DA 2FCDA 3JVTC 2IS9A 3PM8A 1NP8A 4PE1A 3ZWHA 4PALA 1YVHA 1H8BA 5I8NA 3I5GC 1C3ZA 1NX3A 2LVIA 2Y1NA 1Y1AA 1FBVA 1CMFA 3WXAA 4GNKB 3D76A 1QIVA 1XK4C 3CWGA 4MBEA 4MZJA 2K60A 3BUOB 2M97A 3PALA 1DGUA 2L2EA 1GM0A 2JRFA 3JVTB 1XYDA 2KFFA 1QV1A 3BQ3A 3F45A 2K7CA 2MHHA 1JSAA 2GTEA 2LC5A 1V1FA 1Y1UA 1B8LA 1VRKA 1DVIA 2H8VA 2KYCA 1QIWA 4HRHA 3R1PA 1JFKA 1HT9A 3DYEA 4MRXA 4WQ2A 3KEVA 4GGFC 5HYDA 3O6BA 1AK8A 5G08A 4IJ7A 3C1VA 1S1EA 3PATA 4INXA 1E8AA 3PJIA 3AKAA 3GK2A 1M45A 2LV7A 1BR4B 4NQGA 3NSOA 5EL2A 3SIBA 4USLA 1KSOA 2ZRTA 3CR2A 1YURA 5KTYA 1IG5A 3VRQA 2M7LA 1EXRA 1XO5A 3OX6A 4QJ5B 3LCPC 1MF8B 1ODBA 3BUWB 3D78A 3FIAA 2KFHA 3B88A 1F4QA 1B8RA 2MJWB 3GK1A 1LVCD 3PN7C 4I5LB 4D1EA 2PSRA 1B4CA 1IWQA 1WY9A 1MXEA 1Y6WA 1DJYA 1YR5A 5KU1A 1TTXA 1PVAA 1SY9A 3OX5A 2HPSA 1TNQA 3LK0A 3EKHA 3FE6A 2WORA 1CDPA 1LXFC 5FI6A 1AP4A 1TOPA 4I5JA 1J7PA 5F6TA 3D0YB 1SR6C 3VROA 5FI2A 4YI8A 2JT8A 2KGBC 2LVJA 5BPJA 2BCAA 2M1UA 2LCPA 3IF7A 3AAJA 1UHIA 1NIWA 1NCZA 1NX2A 1CDMA 1B7TY 4PT1A 3PN7B 1OOFA 1QTXA 2NXQA 5FYXA 4PCWA 1P28A 2HQWA 2I18A 4YI9A 3SJSA 3FE9A 3PSRA 1LA3A 1YUSA 1DJHA 1S5GZ 1MXLC 2LP2A 3SIAA 1D1OA 2HETA 1QX2A 2ZN9A 1UHJA 3BUNB 2WC6A 1B8CA 2FCEA 3FWCA 3NSLA 4JKTA 1JF0A 1NCXA 1M39A 1UHKA 3DXLA 4PHJA 2OS8B 2KBMA 2M49B 3NHTA 3OBVA 4MN0A 3NSKA 1L7ZA 1J1EA 2KAYA 2KQYA 3DD4A 1TUJA 1ZMZA 1CLMA 4HRGA 1SYMA 3K1EA 1XK4A 2LHLA 1Z4HA 2K7DA 1BG1A 4MZLA 2MA2A 2PASA 1Y1XA 3VRRA 3VRNA 3I5HC 1EH2A 4ORAB 4CFRA 1QV0A 2E30A 1TNWA 1PSRA 1OZOA 4YGEB 2JXCA 5B8IB 2Q4UA 4DS7A 3L4LA 2I7AA 2JT0A 3EK7A 3BFAA 3RLZA 2NZ0A 2ZRSA 1A03A 2E6WA 2TN4A 1JWDA 1V1GA 2ZKMX 3CLNA 4C0JA 5K89A 4PHNA 4CLNA 3B7AA 2ZNDA 1UHHA 1OOIX 2G2BA 3DY9A 5JOLA 2BAPA 1QX5B 4HSZA 4GGFA 4JPZB 2JZIA 2SCPA 3I5IB 3S0FA 2L51A 3BYAA 1RFJA 2Q91A 4INWA 2QEVA 1SNLA 1TUZA 3E3RA 4TNCA 1A75B 1MHOA 3CABA 1FI6A 4M2QA 2WCBA 5CSNA 2CXJA 1YX7A 3D74A 4WQ3A 2COLB 1RROA 3LK1A 2WCLA 4OV2A 2LUXA 3D0YA 3OB2B 5I2QA 1LKJA 1SL7A 2KQ6A 4JD9A 1S26D 3VB1A 1BOCA 2QDIA 2RGIA 5AEQA 1CLBA 4MRYA 3AKBA 4FTGA 4F7FA 4YGCB 1CDLA 1CFDA 2KI6D 2LMVA 1EG4A 4PE4A 5DKQA 3UO9A 2BBNA 1BJFA 3K21A 1SBJA 1IRJA 1G4YR 1PRWA 2K7OA 1AVSA 2KI4B 1DF0B 2BKHB 3R1OA 1XFVO 2LP3A 1OMDA 3SG3A 1ORGA 1IQ3A 4BY5A 2P71A 1XA5A 3O4YA 1DJXA 1W7IB 3TUYC 1CTRA 5I94A 1CNPA 2L50A 1F71A 3IVTA 1MR8A 4MVFA 3B86A 2CTNA 1N2DA 2O5GA 2WOSA 1KCYA 1TWOA 2LNKA 2EHBA 3SG5A 1G33A 3TDUA 1CLLA 1S36A 1TNPA 1S3PA 3EG5B 3EKJA 3N7HA 3S0EA 2F3ZA 3PFVA 3DZTA 3QRXA 4YBHB 1DC1A 1SRAA 2D8NA 1Q80A 2A4JA 2GGZA 1KFUS 1CB1A 5KSZA 1NPQA 1KFXL 4KYNA 4F0ZB 5D3OA 1YVLA 1DTLA 1S5GY 1BU3A 1R2UA 1U5IB 2JC2A 2JWWA 3SS4A 1CM1A 1BF5A 4PDZA 4U8DA 3TUYB 1A2XA 2PVBA 2JULA 3NGVA 4A4CA 5IBWA 1FF1A 1F8HA 1YRTB 2LLUA 3SG4A 1CFFA 3SG7A 1F4OA 2H61C 4GAOA 1OOHA 5JJGA 1IJ5A 2BL0C 3H4SE 3EK8A 1AJ5A 4PE0A 1TN4A 2L0PA 1WRLA 2LLTA 1XFXO 3TZ1A 4GFTA 3KHEA 1A75A 1MQ1A 5GQQC 4NDDA 2M8UA 4DRWA 4HREE 1N65A 1QJTA 4GBAA 5TNCA 4OZDA 1B9AA 2KYFA 3CDNA 3PM2A 3EVUA 1K90D 4BY4A 4ZCVA 1TRFA 2OS8C 2P6BB 1Z2CB 4ZCUA 4YGBB 3BFBA 1C3YA 2QEBA 2LLSA 1JF2A 1QVIZ 4I5KA 3TDZA
chains in the Genus database with same CATH topology
1K9KA 1C07A 2DOQA 3IQOA 1DJZA 5HKZA 3SG2A 3BUXB 1QLSA 2CBLA 2ZN8A 5AERA 2BL0B 1K94A 1NYAA 3OHMB 4JWQA 2JT3A 2JXLA 1K93D 1MWNA 2BKIB 4XYNA 3WNXB 1BODA 3VRPA 4GUKA 1L2OB 2LVKA 3NSIA 2NLNA 1DF0A 4GPLB 2K7BA 3EVRA 2Y5IA 2QPTA 1SK6D 2EGDA 4R1EA 2WCFA 5DKRA 4YGDB 3RM1A 2LAPA 1PVBA 4P5OE 1NUBA 1ALVA 1SL9A 3BXKA 1S6CA 2F3YA 3I5IC 1F70A 5ER5A 4A4BA 1TCOB 1GQMA 4WRIA 1CFPA 4M2OA 5CSJA 1NX0A 2HQ8A 1ALWA 2AMIA 3I5FB 1YTZC 2KAVA 1WDCC 5HKYA 2M3WA 5CSFA 1DGVA 2FOTA 1QX7A 3LLEA 4PE7A 1X02A 1SCVA 3FWBA 2LMTA 1U5IA 4PHMA 4C0KA 1IH0A 2JTTA 1KQMB 1WRZA 2VRGA 3SG6A 1CMGA 3O2PA 1XFWO 3KF9A 3HX4A 3WHUB 1XFZO 2G9BA 4CIDA 1N0YA 2K2AA 1LA0A 3A8RA 2KI4C 2ISDA 4UPGA 2M9GA 1WDCB 1YX8A 2PMYA 3DF0B 1KK8B 2AAOA 2K8MB 3DVJA 2HF5A 2LE9B 1SKTA 4NDBA 5CSIA 1AUIB 1ZUZA 1DJWA 3GK4X 3JTDC 3CR5X 1KK7Z 4MLWA 1GGWA 2I2RE 2L4IA 3CTNA 4N1GA 4FQOA 2F2OA 5DKNA 1YUUA 3CZTX 1UUSA 2M0RA 2H61A 4E68A 1F55A 4P2YB 3IQQA 1S6IA 2PRUA 2ZNEA 3WHTB 4IL1A 1RTP1 4MEWA 3CS1A 1AHRA 1CM4A 5J3XA 2NCOA 1R6PA 5AANA 3BOWB 3JTDB 1IQ5A 1QATA 4DCKA 4XJKB 2V53A 1ZOTB 4ICBA 3EVVA 2EC6B 1JBAA 2ZFDA 5ER4X 4QJ4B 1S6JA 1ZACA 4DUQA 1BMOA 2MLEC 1AJ4A 1JC2A 3ZNIA 1SW8A 2WC8A 4M2PA 1WLZA 1QVIY 4OKHA 2AUCA 1NSHA 1KSMA 1NX1A 3OB1B 4ORBB 3EK4A 1GGZA 1K96A 2CT9A 2Y1MA 1XFUO 2WCEA 2L5XB 2BCBA 3I5GB 3M0WA 3O78A 1C7VA 2M7NA 2KGRA 3AAKA 1JUOA 2M1KB 1K9UA 1HQVA 1EG3A 2F2PA 1J7RA 1KWOC 2JNXA 1K9PA 1RECA 2CNPA 1GJYA 1OMVA 3BUMB 1QLKA 1K95A 5I2LA 3ICBA 1EJ3A 2F8PA 2K0JA 4OCIA 1JFJA 1L2OC 4NDCA 1XFYO 1EL4A 5PALA 1ZFSA 3A4UB 1G8IA 2SASA 3DF0A 4Q04A 4I5NB 1TNXA 4AOMA 2BCXA 2I94A 1RJVA 1SPYA 2K2FA 1BR1B 1UWOA 5D69A 2PALA 2KFGA 3CGAA 1BLQA 3KPXA 1FI5A 1KWOB 1KQVA 1K8UA 3FS7A 2QACA 5HKWA 2JQ6A 1J55A 4QJ3B 1RWYA 4CFQA 1Y0VH 2KBIA 1MUXA 1CFCA 4JQ0D 2OPOA 3I5FC 1YRUB 5HLOA 2JTZA 2BBMA 1OOJA 3NXAA 3HCMA 3TS5C 1DJIA 5HLVA 2LVVA 1SMGA 2GV5A 2R2IA 3DVMA 4PHKA 3DVEA 4MZKA 1J7OA 3BOWA 2BE6A 1KQMC 4OVNF 1M46A 2MAZA 1A4PA 5AFPA 4XJKA 2L4HA 3LL8B 4AQIA 1OSAA 1QS7A 2M29A 2Y4QA 1KK7Y 2JNFA 2JOJA 4GGNA 2GGMA 2MBXA 2L98A 4ORCB 1KFUL 1KK8C 5CPVA 1SR6B 1IKUA 1A29A 4N1FA 2F33A 4N5XA 3TS5B 1SCMC 1PALA 2OTGC 1M31A 3VGOA 1UURA 1OMRA 2JPTA 1LINA 1NWDA 2KAXA 4DIRA 4OR9B 5AXIA 2O60A 5D7FA 1BT6A 1B47A 1W7JB 2KDHA 1DJGA 1OZSA 3D10A 3GOFA 2LHIA 1IGVA 4YRUA 1J7QA 1CDNA 4L9MA 3TDIA 2KSPA 1RK9A 1UP5A 3KO0A 2KI6C 2LUCA 2K61A 3PLFB 2WNDA 1KFXS 1XVJA 1WRKA 1C7WA 1B7TZ 1M63B 2H2KA 1DMOA 1NCYA 1F54A 1OQPA 1PULA 2BECA 3OP0A 1SCMB 1SL8A 1PK0D 1OE9B 1WLMA 2OTGB 2NCPA 2JU0A 1TCFA 1IJ6A 5I2OA 4C0LA 1H4BA 2B1UA 4AQJA 1K2HA 2KOTA 2MRDA 2LANA 1QXPA 2LMUA 2EC6C 3DVKA 4YGAA 1CKKA 4ETOA 1TIZA 3CR4X 2BE4A 2MLFC 3MSEB 4MSPA 2LM5A 4CPVA 1DT7B 2KHNA 3I5HB 2FJUB 1PSBA 2KNEA 1FW4A 1FPWA 2CCMA 1B1GA 2FCDA 1QASA 1YUTA 1UHNA 1J1DA 3PM8A 3JVTC 2IS9A 4PE1A 1NP8A 3ZWHA 4PALA 1YVHA 1H8BA 5I8NA 3I5GC 1NX3A 2LVIA 2Y1NA 1Y1AA 1FBVA 1CMFA 3WXAA 4GNKB 1QIVA 1XK4C 3CWGA 4MBEA 4MZJA 3BUOB 2M97A 3PALA 1DGUA 2L2EA 2JRFA 3JVTB 1XYDA 2KFFA 1QV1A 3BQ3A 3F45A 2K7CA 2MHHA 1JSAA 2LC5A 1V1FA 1Y1UA 1B8LA 1VRKA 1DVIA 2KYCA 1QIWA 4HRHA 1JFKA 1HT9A 4MRXA 4WQ2A 3KEVA 4GGFC 5HYDA 3O6BA 1AK8A 5G08A 3C1VA 1S1EA 3PATA 1E8AA 3AKAA 3GK2A 1M45A 2LV7A 1BR4B 4NQGA 3NSOA 3SIBA 4USLA 1KSOA 2ZRTA 3CR2A 1YURA 5KTYA 1IG5A 3VRQA 2M7LA 1EXRA 1XO5A 3OX6A 4QJ5B 3LCPC 1MF8B 1ODBA 3BUWB 3FIAA 2KFHA 1F4QA 1B8RA 2MJWB 3GK1A 1LVCD 3PN7C 4I5LB 4D1EA 2PSRA 1B4CA 1IWQA 1WY9A 1MXEA 1Y6WA 1DJYA 1YR5A 5KU1A 1TTXA 1PVAA 1SY9A 3OX5A 2HPSA 1TNQA 3LK0A 3EKHA 2WORA 1CDPA 1LXFC 1AP4A 1TOPA 4I5JA 1J7PA 5F6TA 3D0YB 1SR6C 4YI8A 2JT8A 2KGBC 2LVJA 5BPJA 2BCAA 2M1UA 2LCPA 3IF7A 3AAJA 1UHIA 1NIWA 1NCZA 1NX2A 1CDMA 1B7TY 3PN7B 1QTXA 2NXQA 5FYXA 4PCWA 2HQWA 2I18A 4YI9A 3SJSA 3PSRA 1LA3A 1YUSA 1DJHA 1S5GZ 1MXLC 2LP2A 3SIAA 1D1OA 2HETA 1QX2A 2ZN9A 1UHJA 3BUNB 1B8CA 2FCEA 3FWCA 3NSLA 1JF0A 1NCXA 1M39A 1UHKA 4PHJA 2OS8B 2KBMA 2M49B 4MN0A 3NSKA 1L7ZA 1J1EA 2KAYA 2KQYA 3DD4A 1ZMZA 1CLMA 4HRGA 1SYMA 1XK4A 2LHLA 2K7DA 1BG1A 4MZLA 2MA2A 2PASA 1Y1XA 3VRRA 3VRNA 3I5HC 1EH2A 4ORAB 4CFRA 1QV0A 2E30A 1TNWA 1PSRA 1OZOA 4YGEB 2JXCA 5B8IB 2Q4UA 4DS7A 2I7AA 2JT0A 3EK7A 3RLZA 2NZ0A 2ZRSA 1A03A 2E6WA 2TN4A 1JWDA 1V1GA 2ZKMX 3CLNA 4C0JA 5K89A 4PHNA 4CLNA 2ZNDA 1UHHA 2G2BA 5JOLA 1QX5B 4HSZA 4GGFA 4JPZB 2JZIA 2SCPA 3I5IB 2L51A 3BYAA 1RFJA 2Q91A 1SNLA 3E3RA 4TNCA 1A75B 1MHOA 1FI6A 4M2QA 2WCBA 5CSNA 2CXJA 1YX7A 4WQ3A 2COLB 1RROA 3LK1A 4OV2A 2LUXA 3D0YA 3OB2B 5I2QA 1LKJA 1SL7A 2KQ6A 1S26D 1BOCA 2RGIA 5AEQA 1CLBA 4MRYA 3AKBA 4FTGA 4YGCB 1CDLA 1CFDA 2KI6D 2LMVA 1EG4A 4PE4A 5DKQA 2BBNA 1BJFA 3K21A 1SBJA 1IRJA 1G4YR 1PRWA 2K7OA 1AVSA 2KI4B 1DF0B 2BKHB 1XFVO 2LP3A 1OMDA 3SG3A 1IQ3A 4BY5A 1XA5A 3O4YA 1DJXA 1W7IB 3TUYC 1CTRA 1F71A 1CNPA 2L50A 1MR8A 4MVFA 2CTNA 1N2DA 2O5GA 2WOSA 1KCYA 2LNKA 2EHBA 3SG5A 1G33A 3TDUA 1CLLA 1S36A 1TNPA 1S3PA 3EKJA 2F3ZA 3PFVA 3QRXA 4YBHB 1SRAA 2D8NA 1Q80A 2A4JA 2GGZA 1KFUS 1CB1A 5KSZA 1NPQA 1KFXL 4F0ZB 1YVLA 1DTLA 1S5GY 1BU3A 1R2UA 1U5IB 2JC2A 2JWWA 1CM1A 1BF5A 4PDZA 4U8DA 3TUYB 1A2XA 2PVBA 2JULA 4A4CA 5IBWA 1FF1A 1F8HA 1YRTB 2LLUA 3SG4A 1CFFA 3SG7A 1F4OA 2H61C 4GAOA 5JJGA 1IJ5A 2BL0C 3H4SE 3EK8A 1AJ5A 4PE0A 1TN4A 2L0PA 1WRLA 2LLTA 1XFXO 3TZ1A 4GFTA 3KHEA 1A75A 1MQ1A 5GQQC 4NDDA 2M8UA 4DRWA 4HREE 1N65A 1QJTA 4GBAA 5TNCA 1B9AA 2KYFA 4BY4A 3EVUA 1K90D 4ZCVA 1TRFA 2OS8C 2P6BB 4ZCUA 4YGBB 3VROA 2LLSA 1JF2A 1QVIZ 4I5KA 3TDZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9K A;  1C07 A;  2DOQ A;  3IQO A;  1DJZ A;  5HKZ A;  3SG2 A;  3BUX B;  1QLS A;  2CBL A;  2ZN8 A;  5AER A;  2BL0 B;  1K94 A;  1NYA A;  3OHM B;  4JWQ A;  2JT3 A;  2JXL A;  1K93 D;  1MWN A;  2BKI B;  4XYN A;  3WNX B;  1BOD A;  3VRP A;  4GUK A;  1L2O B;  2LVK A;  3NSI A;  2NLN A;  1DF0 A;  4GPL B;  2K7B A;  3EVR A;  2Y5I A;  2QPT A;  1SK6 D;  2EGD A;  4R1E A;  2WCF A;  5DKR A;  4YGD B;  3RM1 A;  2LAP A;  1PVB A;  4P5O E;  1NUB A;  1ALV A;  1SL9 A;  3BXK A;  1S6C A;  2F3Y A;  3I5I C;  1F70 A;  5ER5 A;  4A4B A;  1TCO B;  1GQM A;  4WRI A;  1CFP A;  4M2O A;  5CSJ A;  1NX0 A;  2HQ8 A;  1ALW A;  2AMI A;  3I5F B;  1YTZ C;  2KAV A;  1WDC C;  5HKY A;  2M3W A;  5CSF A;  1DGV A;  2FOT A;  1QX7 A;  3LLE A;  4PE7 A;  1X02 A;  1SCV A;  3FWB A;  2LMT A;  1U5I A;  4PHM A;  4C0K A;  1IH0 A;  2JTT A;  1KQM B;  1WRZ A;  2VRG A;  3SG6 A;  1CMG A;  3O2P A;  1XFW O;  3KF9 A;  3HX4 A;  3WHU B;  1XFZ O;  2G9B A;  4CID A;  1N0Y A;  2K2A A;  1LA0 A;  3A8R A;  2KI4 C;  2ISD A;  4UPG A;  2M9G A;  1WDC B;  1YX8 A;  2PMY A;  3DF0 B;  1KK8 B;  2AAO A;  2K8M B;  3DVJ A;  2HF5 A;  2LE9 B;  1SKT A;  4NDB A;  5CSI A;  1AUI B;  1ZUZ A;  1DJW A;  3GK4 X;  3JTD C;  3CR5 X;  1KK7 Z;  4MLW A;  1GGW A;  2I2R E;  2L4I A;  3CTN A;  4N1G A;  4FQO A;  2F2O A;  5DKN A;  1YUU A;  3CZT X;  1UUS A;  2M0R A;  2H61 A;  4E68 A;  1F55 A;  4P2Y B;  3IQQ A;  1S6I A;  2PRU A;  2ZNE A;  3WHT B;  4IL1 A;  1RTP 1;  4MEW A;  3CS1 A;  1AHR A;  1CM4 A;  5J3X A;  2NCO A;  1R6P A;  5AAN A;  3BOW B;  3JTD B;  1IQ5 A;  1QAT A;  4DCK A;  4XJK B;  2V53 A;  1ZOT B;  4ICB A;  3EVV A;  2EC6 B;  1JBA A;  2ZFD A;  5ER4 X;  4QJ4 B;  1S6J A;  1ZAC A;  4DUQ A;  1BMO A;  2MLE C;  1AJ4 A;  1JC2 A;  3ZNI A;  1SW8 A;  2WC8 A;  4M2P A;  1WLZ A;  1QVI Y;  4OKH A;  2AUC A;  1NSH A;  1KSM A;  1NX1 A;  3OB1 B;  4ORB B;  3EK4 A;  1GGZ A;  1K96 A;  2CT9 A;  2Y1M A;  1XFU O;  2WCE A;  2L5X B;  2BCB A;  3I5G B;  3M0W A;  3O78 A;  1C7V A;  2M7N A;  2KGR A;  3AAK A;  1JUO A;  2M1K B;  1K9U A;  1HQV A;  1EG3 A;  2F2P A;  1J7R A;  1KWO C;  2JNX A;  1K9P A;  1REC A;  2CNP A;  1GJY A;  1OMV A;  3BUM B;  1QLK A;  1K95 A;  5I2L A;  3ICB A;  1EJ3 A;  2F8P A;  2K0J A;  4OCI A;  1JFJ A;  1L2O C;  4NDC A;  1XFY O;  1EL4 A;  5PAL A;  1ZFS A;  3A4U B;  1G8I A;  2SAS A;  3DF0 A;  4Q04 A;  4I5N B;  1TNX A;  4AOM A;  2BCX A;  2I94 A;  1RJV A;  1SPY A;  2K2F A;  1BR1 B;  1UWO A;  5D69 A;  2PAL A;  2KFG A;  3CGA A;  1BLQ A;  3KPX A;  1FI5 A;  1KWO B;  1KQV A;  1K8U A;  3FS7 A;  2QAC A;  5HKW A;  2JQ6 A;  1J55 A;  4QJ3 B;  1RWY A;  4CFQ A;  1Y0V H;  2KBI A;  1MUX A;  1CFC A;  4JQ0 D;  2OPO A;  3I5F C;  1YRU B;  5HLO A;  2JTZ A;  2BBM A;  1OOJ A;  3NXA A;  3HCM A;  3TS5 C;  1DJI A;  5HLV A;  2LVV A;  1SMG A;  2GV5 A;  2R2I A;  3DVM A;  4PHK A;  3DVE A;  4MZK A;  1J7O A;  3BOW A;  2BE6 A;  1KQM C;  4OVN F;  1M46 A;  2MAZ A;  1A4P A;  5AFP A;  4XJK A;  2L4H A;  3LL8 B;  4AQI A;  1OSA A;  1QS7 A;  2M29 A;  2Y4Q A;  1KK7 Y;  2JNF A;  2JOJ A;  4GGN A;  2GGM A;  2MBX A;  2L98 A;  4ORC B;  1KFU L;  1KK8 C;  5CPV A;  1SR6 B;  1IKU A;  1A29 A;  4N1F A;  2F33 A;  4N5X A;  3TS5 B;  1SCM C;  1PAL A;  2OTG C;  1M31 A;  3VGO A;  1UUR A;  1OMR A;  2JPT A;  1LIN A;  1NWD A;  2KAX A;  4DIR A;  4OR9 B;  5AXI A;  2O60 A;  5D7F A;  1BT6 A;  1B47 A;  1W7J B;  2KDH A;  1DJG A;  1OZS A;  3D10 A;  3GOF A;  2LHI A;  1IGV A;  4YRU A;  1J7Q A;  1CDN A;  4L9M A;  3TDI A;  2KSP A;  1RK9 A;  1UP5 A;  3KO0 A;  2KI6 C;  2LUC A;  2K61 A;  3PLF B;  2WND A;  1KFX S;  1XVJ A;  1WRK A;  1C7W A;  1B7T Z;  1M63 B;  2H2K A;  1DMO A;  1NCY A;  1F54 A;  1OQP A;  1PUL A;  2BEC A;  3OP0 A;  1SCM B;  1SL8 A;  1PK0 D;  1OE9 B;  1WLM A;  2OTG B;  2NCP A;  2JU0 A;  1TCF A;  1IJ6 A;  5I2O A;  4C0L A;  1H4B A;  2B1U A;  4AQJ A;  1K2H A;  2KOT A;  2MRD A;  2LAN A;  1QXP A;  2LMU A;  2EC6 C;  3DVK A;  4YGA A;  1CKK A;  4ETO A;  1TIZ A;  3CR4 X;  2BE4 A;  2MLF C;  3MSE B;  4MSP A;  2LM5 A;  4CPV A;  1DT7 B;  2KHN A;  3I5H B;  2FJU B;  1PSB A;  2KNE A;  1FW4 A;  1FPW A;  2CCM A;  1B1G A;  2FCD A;  1QAS A;  1YUT A;  1UHN A;  1J1D A;  3PM8 A;  3JVT C;  2IS9 A;  4PE1 A;  1NP8 A;  3ZWH A;  4PAL A;  1YVH A;  1H8B A;  5I8N A;  3I5G C;  1NX3 A;  2LVI A;  2Y1N A;  1Y1A A;  1FBV A;  1CMF A;  3WXA A;  4GNK B;  1QIV A;  1XK4 C;  3CWG A;  4MBE A;  4MZJ A;  3BUO B;  2M97 A;  3PAL A;  1DGU A;  2L2E A;  2JRF A;  3JVT B;  1XYD A;  2KFF A;  1QV1 A;  3BQ3 A;  3F45 A;  2K7C A;  2MHH A;  1JSA A;  2LC5 A;  1V1F A;  1Y1U A;  1B8L A;  1VRK A;  1DVI A;  2KYC A;  1QIW A;  4HRH A;  1JFK A;  1HT9 A;  4MRX A;  4WQ2 A;  3KEV A;  4GGF C;  5HYD A;  3O6B A;  1AK8 A;  5G08 A;  3C1V A;  1S1E A;  3PAT A;  1E8A A;  3AKA A;  3GK2 A;  1M45 A;  2LV7 A;  1BR4 B;  4NQG A;  3NSO A;  3SIB A;  4USL A;  1KSO A;  2ZRT A;  3CR2 A;  1YUR A;  5KTY A;  1IG5 A;  3VRQ A;  2M7L A;  1EXR A;  1XO5 A;  3OX6 A;  4QJ5 B;  3LCP C;  1MF8 B;  1ODB A;  3BUW B;  3FIA A;  2KFH A;  1F4Q A;  1B8R A;  2MJW B;  3GK1 A;  1LVC D;  3PN7 C;  4I5L B;  4D1E A;  2PSR A;  1B4C A;  1IWQ A;  1WY9 A;  1MXE A;  1Y6W A;  1DJY A;  1YR5 A;  5KU1 A;  1TTX A;  1PVA A;  1SY9 A;  3OX5 A;  2HPS A;  1TNQ A;  3LK0 A;  3EKH A;  2WOR A;  1CDP A;  1LXF C;  1AP4 A;  1TOP A;  4I5J A;  1J7P A;  5F6T A;  3D0Y B;  1SR6 C;  4YI8 A;  2JT8 A;  2KGB C;  2LVJ A;  5BPJ A;  2BCA A;  2M1U A;  2LCP A;  3IF7 A;  3AAJ A;  1UHI A;  1NIW A;  1NCZ A;  1NX2 A;  1CDM A;  1B7T Y;  3PN7 B;  1QTX A;  2NXQ A;  5FYX A;  4PCW A;  2HQW A;  2I18 A;  4YI9 A;  3SJS A;  3PSR A;  1LA3 A;  1YUS A;  1DJH A;  1S5G Z;  1MXL C;  2LP2 A;  3SIA A;  1D1O A;  2HET A;  1QX2 A;  2ZN9 A;  1UHJ A;  3BUN B;  1B8C A;  2FCE A;  3FWC A;  3NSL A;  1JF0 A;  1NCX A;  1M39 A;  1UHK A;  4PHJ A;  2OS8 B;  2KBM A;  2M49 B;  4MN0 A;  3NSK A;  1L7Z A;  1J1E A;  2KAY A;  2KQY A;  3DD4 A;  1ZMZ A;  1CLM A;  4HRG A;  1SYM A;  1XK4 A;  2LHL A;  2K7D A;  1BG1 A;  4MZL A;  2MA2 A;  2PAS A;  1Y1X A;  3VRR A;  3VRN A;  3I5H C;  1EH2 A;  4ORA B;  4CFR A;  1QV0 A;  2E30 A;  1TNW A;  1PSR A;  1OZO A;  4YGE B;  2JXC A;  5B8I B;  2Q4U A;  4DS7 A;  2I7A A;  2JT0 A;  3EK7 A;  3RLZ A;  2NZ0 A;  2ZRS A;  1A03 A;  2E6W A;  2TN4 A;  1JWD A;  1V1G A;  2ZKM X;  3CLN A;  4C0J A;  5K89 A;  4PHN A;  4CLN A;  2ZND A;  1UHH A;  2G2B A;  5JOL A;  1QX5 B;  4HSZ A;  4GGF A;  4JPZ B;  2JZI A;  2SCP A;  3I5I B;  2L51 A;  3BYA A;  1RFJ A;  2Q91 A;  1SNL A;  3E3R A;  4TNC A;  1A75 B;  1MHO A;  1FI6 A;  4M2Q A;  2WCB A;  5CSN A;  2CXJ A;  1YX7 A;  4WQ3 A;  2COL B;  1RRO A;  3LK1 A;  4OV2 A;  2LUX A;  3D0Y A;  3OB2 B;  5I2Q A;  1LKJ A;  1SL7 A;  2KQ6 A;  1S26 D;  1BOC A;  2RGI A;  5AEQ A;  1CLB A;  4MRY A;  3AKB A;  4FTG A;  4YGC B;  1CDL A;  1CFD A;  2KI6 D;  2LMV A;  1EG4 A;  4PE4 A;  5DKQ A;  2BBN A;  1BJF A;  3K21 A;  1SBJ A;  1IRJ A;  1G4Y R;  1PRW A;  2K7O A;  1AVS A;  2KI4 B;  1DF0 B;  2BKH B;  1XFV O;  2LP3 A;  1OMD A;  3SG3 A;  1IQ3 A;  4BY5 A;  1XA5 A;  3O4Y A;  1DJX A;  1W7I B;  3TUY C;  1CTR A;  1F71 A;  1CNP A;  2L50 A;  1MR8 A;  4MVF A;  2CTN A;  1N2D A;  2O5G A;  2WOS A;  1KCY A;  2LNK A;  2EHB A;  3SG5 A;  1G33 A;  3TDU A;  1CLL A;  1S36 A;  1TNP A;  1S3P A;  3EKJ A;  2F3Z A;  3PFV A;  3QRX A;  4YBH B;  1SRA A;  2D8N A;  1Q80 A;  2A4J A;  2GGZ A;  1KFU S;  1CB1 A;  5KSZ A;  1NPQ A;  1KFX L;  4F0Z B;  1YVL A;  1DTL A;  1S5G Y;  1BU3 A;  1R2U A;  1U5I B;  2JC2 A;  2JWW A;  1CM1 A;  1BF5 A;  4PDZ A;  4U8D A;  3TUY B;  1A2X A;  2PVB A;  2JUL A;  4A4C A;  5IBW A;  1FF1 A;  1F8H A;  1YRT B;  2LLU A;  3SG4 A;  1CFF A;  3SG7 A;  1F4O A;  2H61 C;  4GAO A;  5JJG A;  1IJ5 A;  2BL0 C;  3H4S E;  3EK8 A;  1AJ5 A;  4PE0 A;  1TN4 A;  2L0P A;  1WRL A;  2LLT A;  1XFX O;  3TZ1 A;  4GFT A;  3KHE A;  1A75 A;  1MQ1 A;  5GQQ C;  4NDD A;  2M8U A;  4DRW A;  4HRE E;  1N65 A;  1QJT A;  4GBA A;  5TNC A;  1B9A A;  2KYF A;  4BY4 A;  3EVU A;  1K90 D;  4ZCV A;  1TRF A;  2OS8 C;  2P6B B;  4ZCU A;  4YGB B;  3VRO A;  2LLS A;  1JF2 A;  1QVI Z;  4I5K A;  3TDZ A; 
#chains in the Genus database with same CATH topology
 1K9K A;  1C07 A;  2DOQ A;  3IQO A;  1DJZ A;  5HKZ A;  3SG2 A;  3BUX B;  1QLS A;  2CBL A;  2ZN8 A;  5AER A;  2WCJ A;  3BFH A;  2BL0 B;  1K94 A;  1NYA A;  1SSE B;  2JPO A;  3OHM B;  4JWQ A;  2JT3 A;  2JXL A;  1K93 D;  1MWN A;  2BKI B;  4XYN A;  3WNX B;  1BOD A;  3VRP A;  4GUK A;  1L2O B;  2LVK A;  3NSI A;  2NLN A;  1DF0 A;  4GPL B;  2K7B A;  3EVR A;  2Y5I A;  5DIC A;  2QPT A;  3UNW A;  1SK6 D;  2EGD A;  4R1E A;  2WCF A;  5DKR A;  4YGD B;  3RM1 A;  2LAP A;  1PVB A;  1XFR A;  2ERB A;  4P5O E;  1NUB A;  1ALV A;  1SL9 A;  3BXK A;  1S6C A;  2F3Y A;  3D75 A;  3I5I C;  1F70 A;  5ER5 A;  4A4B A;  1TCO B;  1GQM A;  4WRI A;  1CFP A;  4M2O A;  3RZS A;  5CSJ A;  1NX0 A;  2HQ8 A;  1ALW A;  2AMI A;  3I5F B;  1YTZ C;  2KAV A;  5FI7 A;  1WDC C;  3NHI A;  5HKY A;  2M3W A;  5CSF A;  1DGV A;  2FOT A;  1QX7 A;  3CYZ A;  3LLE A;  1X02 A;  1SCV A;  4PE7 A;  3FWB A;  2LMT A;  1U5I A;  4PHM A;  3L4A A;  4C0K A;  1IH0 A;  2JTT A;  1KQM B;  1WRZ A;  2VRG A;  2WCM A;  3SG6 A;  1CMG A;  2WCK A;  3O2P A;  1XFW O;  2L2C A;  3KF9 A;  3R72 A;  3HX4 A;  3WHU B;  1XFZ O;  2G9B A;  4CID A;  1N0Y A;  1DQE A;  2K2A A;  3B6X A;  1LA0 A;  3A8R A;  2KI4 C;  2ISD A;  4UPG A;  2M9G A;  1WDC B;  1YX8 A;  2PMY A;  3DF0 B;  1KK8 B;  2AAO A;  2K8M B;  3DVJ A;  3Q8I A;  2HF5 A;  2LE9 B;  1SKT A;  4NDB A;  5CSI A;  1AUI B;  1ZUZ A;  3QME A;  1DJW A;  3GK4 X;  3JTD C;  3CR5 X;  1KK7 Z;  4MLW A;  3S0A A;  1GGW A;  2QEO A;  2I2R E;  2L4I A;  3CTN A;  4N1G A;  4FQO A;  2F2O A;  5DKN A;  1DEL A;  1YUU A;  2KPH A;  3CZT X;  1UUS A;  2M0R A;  2H61 A;  4E68 A;  1F55 A;  4P2Y B;  3IQQ A;  1S6I A;  2PRU A;  2ZNE A;  3WHT B;  4IL1 A;  1RTP 1;  4MEW A;  3CS1 A;  1AHR A;  1CM4 A;  5J3X A;  2NCO A;  1R6P A;  5HL1 A;  3D73 A;  2KLD A;  5AAN A;  3BOW B;  3JTD B;  1IQ5 A;  1QAT A;  4DCK A;  4XJK B;  2V53 A;  1ZOT B;  4ICB A;  3EVV A;  2EC6 B;  1JBA A;  2ZFD A;  5ER4 X;  4QJ4 B;  3CZ0 A;  1S6J A;  1ZAC A;  4DUQ A;  1BMO A;  2MLE C;  1AJ4 A;  1JC2 A;  3ZNI A;  1SW8 A;  2WC8 A;  4M2P A;  1WLZ A;  1QVI Y;  4OKH A;  2AUC A;  1NSH A;  1KSM A;  1NX1 A;  3OB1 B;  3B87 A;  4ORB B;  3EK4 A;  1GGZ A;  1K96 A;  2CT9 A;  2Y1M A;  1XFU O;  2WCE A;  2L5X B;  2BCB A;  3I5G B;  3M0W A;  3O78 A;  1C7V A;  2M7N A;  2KGR A;  3AAK A;  1JUO A;  2WCH A;  2M1K B;  1K9U A;  1HQV A;  1EG3 A;  2F2P A;  3D77 A;  1J7R A;  1KWO C;  2JNX A;  1K9P A;  1REC A;  2CNP A;  1GJY A;  1OMV A;  3BUM B;  3S0G A;  1QLK A;  3S0D A;  1K95 A;  5I2L A;  3ICB A;  1EJ3 A;  2F8P A;  2K0J A;  4OCI A;  1JFJ A;  1L2O C;  4NDC A;  1XFY O;  1EL4 A;  3L47 A;  5PAL A;  1ZFS A;  3A4U B;  1G8I A;  2SAS A;  3DF0 A;  4Q04 A;  4I5N B;  1TNX A;  1LS8 A;  3O4X A;  4AOM A;  2BCX A;  2I94 A;  1RJV A;  1SPY A;  2K2F A;  1BR1 B;  1UWO A;  5D69 A;  2PAL A;  2KFG A;  3CGA A;  1BLQ A;  3KPX A;  1FI5 A;  1DEK A;  1KWO B;  1KQV A;  1K8U A;  3FS7 A;  2QAC A;  5HKW A;  2JQ6 A;  1J55 A;  4QJ3 B;  1RWY A;  1OOG A;  2QEH A;  4CFQ A;  1Y0V H;  2KBI A;  1MUX A;  1CFC A;  4JQ0 D;  2OPO A;  3I5F C;  1YRU B;  5HLO A;  1W9Z A;  2BBM A;  2JTZ A;  1OOJ A;  3NXA A;  3HCM A;  2P70 A;  3TS5 C;  1DJI A;  5HLV A;  3FE8 A;  2LVV A;  1SMG A;  2GV5 A;  2R2I A;  3DVM A;  4PHK A;  3S0B A;  3DVE A;  4MZK A;  1J7O A;  3BOW A;  2BE6 A;  1KQM C;  4OVN F;  1M46 A;  2MAZ A;  1A4P A;  5AFP A;  4XJK A;  2L4H A;  3LL8 B;  2L5Y A;  4AQI A;  1OSA A;  1QS7 A;  2FJY A;  2M29 A;  2Y4Q A;  3CZ1 A;  2KLE A;  1KK7 Y;  2JNF A;  2JOJ A;  2PYQ A;  3CZ2 A;  4GGN A;  2GGM A;  1IIO A;  2MBX A;  2L98 A;  4ORC B;  1KFU L;  1KK8 C;  5CPV A;  3SS5 A;  1SR6 B;  1IKU A;  1A29 A;  4N1F A;  2F33 A;  4N5X A;  3TS5 B;  1SCM C;  1PAL A;  2OTG C;  1M31 A;  3VGO A;  1UUR A;  1OMR A;  2JPT A;  1LIN A;  1NWD A;  2KAX A;  4DIR A;  4OR9 B;  5AXI A;  2O60 A;  5D7F A;  1BT6 A;  1B47 A;  1QWV A;  1W7J B;  2KDH A;  1DJG A;  1OZS A;  3D10 A;  3GOF A;  3SS3 A;  1T14 A;  1IGV A;  2LHI A;  4YRU A;  1CDN A;  4L9M A;  1J7Q A;  3TDI A;  2KSP A;  1RK9 A;  1UP5 A;  3KO0 A;  2KI6 C;  2LUC A;  2K61 A;  3BJH A;  3PLF B;  4FQT A;  2WND A;  1KFX S;  1XVJ A;  1WRK A;  1C7W A;  1B7T Z;  1M63 B;  2H2K A;  2YGU A;  1DMO A;  1NCY A;  1F54 A;  1OQP A;  1PUL A;  2BEC A;  3OP0 A;  1SCM B;  1SL8 A;  1PK0 D;  1OE9 B;  1WLM A;  2OTG B;  2WC5 A;  2NCP A;  3OGN A;  2JU0 A;  1TCF A;  1IJ6 A;  2PQL A;  5I2O A;  4C0L A;  1H4B A;  2B1U A;  4AQJ A;  1K2H A;  2KOT A;  2MRD A;  2LAN A;  1QXP A;  2LMU A;  2EC6 C;  3DVK A;  4YGA A;  1CKK A;  4ETO A;  1TIZ A;  3CR4 X;  2BE4 A;  2MLF C;  3V2L A;  3MSE B;  3R1V A;  4MSP A;  2LM5 A;  4CPV A;  1DT7 B;  2KHN A;  3I5H B;  1OW4 A;  1PSB A;  2FJU B;  2KNE A;  1FW4 A;  1FPW A;  2CCM A;  1B1G A;  2BNX A;  1QAS A;  1YUT A;  1UHN A;  1J1D A;  2FCD A;  3JVT C;  2IS9 A;  3PM8 A;  1NP8 A;  4PE1 A;  3ZWH A;  4PAL A;  1YVH A;  1H8B A;  5I8N A;  3I5G C;  1C3Z A;  1NX3 A;  2LVI A;  2Y1N A;  1Y1A A;  1FBV A;  1CMF A;  3WXA A;  4GNK B;  3D76 A;  1QIV A;  1XK4 C;  3CWG A;  4MBE A;  4MZJ A;  2K60 A;  3BUO B;  2M97 A;  3PAL A;  1DGU A;  2L2E A;  1GM0 A;  2JRF A;  3JVT B;  1XYD A;  2KFF A;  1QV1 A;  3BQ3 A;  3F45 A;  2K7C A;  2MHH A;  1JSA A;  2GTE A;  2LC5 A;  1V1F A;  1Y1U A;  1B8L A;  1VRK A;  1DVI A;  2H8V A;  2KYC A;  1QIW A;  4HRH A;  3R1P A;  1JFK A;  1HT9 A;  3DYE A;  4MRX A;  4WQ2 A;  3KEV A;  4GGF C;  5HYD A;  3O6B A;  1AK8 A;  5G08 A;  4IJ7 A;  3C1V A;  1S1E A;  3PAT A;  4INX A;  1E8A A;  3PJI A;  3AKA A;  3GK2 A;  1M45 A;  2LV7 A;  1BR4 B;  4NQG A;  3NSO A;  5EL2 A;  3SIB A;  4USL A;  1KSO A;  2ZRT A;  3CR2 A;  1YUR A;  5KTY A;  1IG5 A;  3VRQ A;  2M7L A;  1EXR A;  1XO5 A;  3OX6 A;  4QJ5 B;  3LCP C;  1MF8 B;  1ODB A;  3BUW B;  3D78 A;  3FIA A;  2KFH A;  3B88 A;  1F4Q A;  1B8R A;  2MJW B;  3GK1 A;  1LVC D;  3PN7 C;  4I5L B;  4D1E A;  2PSR A;  1B4C A;  1IWQ A;  1WY9 A;  1MXE A;  1Y6W A;  1DJY A;  1YR5 A;  5KU1 A;  1TTX A;  1PVA A;  1SY9 A;  3OX5 A;  2HPS A;  1TNQ A;  3LK0 A;  3EKH A;  3FE6 A;  2WOR A;  1CDP A;  1LXF C;  5FI6 A;  1AP4 A;  1TOP A;  4I5J A;  1J7P A;  5F6T A;  3D0Y B;  1SR6 C;  3VRO A;  5FI2 A;  4YI8 A;  2JT8 A;  2KGB C;  2LVJ A;  5BPJ A;  2BCA A;  2M1U A;  2LCP A;  3IF7 A;  3AAJ A;  1UHI A;  1NIW A;  1NCZ A;  1NX2 A;  1CDM A;  1B7T Y;  4PT1 A;  3PN7 B;  1OOF A;  1QTX A;  2NXQ A;  5FYX A;  4PCW A;  1P28 A;  2HQW A;  2I18 A;  4YI9 A;  3SJS A;  3FE9 A;  3PSR A;  1LA3 A;  1YUS A;  1DJH A;  1S5G Z;  1MXL C;  2LP2 A;  3SIA A;  1D1O A;  2HET A;  1QX2 A;  2ZN9 A;  1UHJ A;  3BUN B;  2WC6 A;  1B8C A;  2FCE A;  3FWC A;  3NSL A;  4JKT A;  1JF0 A;  1NCX A;  1M39 A;  1UHK A;  3DXL A;  4PHJ A;  2OS8 B;  2KBM A;  2M49 B;  3NHT A;  3OBV A;  4MN0 A;  3NSK A;  1L7Z A;  1J1E A;  2KAY A;  2KQY A;  3DD4 A;  1TUJ A;  1ZMZ A;  1CLM A;  4HRG A;  1SYM A;  3K1E A;  1XK4 A;  2LHL A;  1Z4H A;  2K7D A;  1BG1 A;  4MZL A;  2MA2 A;  2PAS A;  1Y1X A;  3VRR A;  3VRN A;  3I5H C;  1EH2 A;  4ORA B;  4CFR A;  1QV0 A;  2E30 A;  1TNW A;  1PSR A;  1OZO A;  4YGE B;  2JXC A;  5B8I B;  2Q4U A;  4DS7 A;  3L4L A;  2I7A A;  2JT0 A;  3EK7 A;  3BFA A;  3RLZ A;  2NZ0 A;  2ZRS A;  1A03 A;  2E6W A;  2TN4 A;  1JWD A;  1V1G A;  2ZKM X;  3CLN A;  4C0J A;  5K89 A;  4PHN A;  4CLN A;  3B7A A;  2ZND A;  1UHH A;  1OOI X;  2G2B A;  3DY9 A;  5JOL A;  2BAP A;  1QX5 B;  4HSZ A;  4GGF A;  4JPZ B;  2JZI A;  2SCP A;  3I5I B;  3S0F A;  2L51 A;  3BYA A;  1RFJ A;  2Q91 A;  4INW A;  2QEV A;  1SNL A;  1TUZ A;  3E3R A;  4TNC A;  1A75 B;  1MHO A;  3CAB A;  1FI6 A;  4M2Q A;  2WCB A;  5CSN A;  2CXJ A;  1YX7 A;  3D74 A;  4WQ3 A;  2COL B;  1RRO A;  3LK1 A;  2WCL A;  4OV2 A;  2LUX A;  3D0Y A;  3OB2 B;  5I2Q A;  1LKJ A;  1SL7 A;  2KQ6 A;  4JD9 A;  1S26 D;  3VB1 A;  1BOC A;  2QDI A;  2RGI A;  5AEQ A;  1CLB A;  4MRY A;  3AKB A;  4FTG A;  4F7F A;  4YGC B;  1CDL A;  1CFD A;  2KI6 D;  2LMV A;  1EG4 A;  4PE4 A;  5DKQ A;  3UO9 A;  2BBN A;  1BJF A;  3K21 A;  1SBJ A;  1IRJ A;  1G4Y R;  1PRW A;  2K7O A;  1AVS A;  2KI4 B;  1DF0 B;  2BKH B;  3R1O A;  1XFV O;  2LP3 A;  1OMD A;  3SG3 A;  1ORG A;  1IQ3 A;  4BY5 A;  2P71 A;  1XA5 A;  3O4Y A;  1DJX A;  1W7I B;  3TUY C;  1CTR A;  5I94 A;  1CNP A;  2L50 A;  1F71 A;  3IVT A;  1MR8 A;  4MVF A;  3B86 A;  2CTN A;  1N2D A;  2O5G A;  2WOS A;  1KCY A;  1TWO A;  2LNK A;  2EHB A;  3SG5 A;  1G33 A;  3TDU A;  1CLL A;  1S36 A;  1TNP A;  1S3P A;  3EG5 B;  3EKJ A;  3N7H A;  3S0E A;  2F3Z A;  3PFV A;  3DZT A;  3QRX A;  4YBH B;  1DC1 A;  1SRA A;  2D8N A;  1Q80 A;  2A4J A;  2GGZ A;  1KFU S;  1CB1 A;  5KSZ A;  1NPQ A;  1KFX L;  4KYN A;  4F0Z B;  5D3O A;  1YVL A;  1DTL A;  1S5G Y;  1BU3 A;  1R2U A;  1U5I B;  2JC2 A;  2JWW A;  3SS4 A;  1CM1 A;  1BF5 A;  4PDZ A;  4U8D A;  3TUY B;  1A2X A;  2PVB A;  2JUL A;  3NGV A;  4A4C A;  5IBW A;  1FF1 A;  1F8H A;  1YRT B;  2LLU A;  3SG4 A;  1CFF A;  3SG7 A;  1F4O A;  2H61 C;  4GAO A;  1OOH A;  5JJG A;  1IJ5 A;  2BL0 C;  3H4S E;  3EK8 A;  1AJ5 A;  4PE0 A;  1TN4 A;  2L0P A;  1WRL A;  2LLT A;  1XFX O;  3TZ1 A;  4GFT A;  3KHE A;  1A75 A;  1MQ1 A;  5GQQ C;  4NDD A;  2M8U A;  4DRW A;  4HRE E;  1N65 A;  1QJT A;  4GBA A;  5TNC A;  4OZD A;  1B9A A;  2KYF A;  3CDN A;  3PM2 A;  3EVU A;  1K90 D;  4BY4 A;  4ZCV A;  1TRF A;  2OS8 C;  2P6B B;  1Z2C B;  4ZCU A;  4YGB B;  3BFB A;  1C3Y A;  2QEB A;  2LLS A;  1JF2 A;  1QVI Z;  4I5K A;  3TDZ A; 
#chains in the Genus database with same CATH homology
 1K9K A;  1C07 A;  2DOQ A;  3IQO A;  1DJZ A;  5HKZ A;  3SG2 A;  3BUX B;  1QLS A;  2CBL A;  2ZN8 A;  5AER A;  2BL0 B;  1K94 A;  1NYA A;  3OHM B;  4JWQ A;  2JT3 A;  2JXL A;  1K93 D;  1MWN A;  2BKI B;  4XYN A;  3WNX B;  1BOD A;  3VRP A;  4GUK A;  1L2O B;  2LVK A;  3NSI A;  2NLN A;  1DF0 A;  4GPL B;  2K7B A;  3EVR A;  2Y5I A;  2QPT A;  1SK6 D;  2EGD A;  4R1E A;  2WCF A;  5DKR A;  4YGD B;  3RM1 A;  2LAP A;  1PVB A;  4P5O E;  1NUB A;  1ALV A;  1SL9 A;  3BXK A;  1S6C A;  2F3Y A;  3I5I C;  1F70 A;  5ER5 A;  4A4B A;  1TCO B;  1GQM A;  4WRI A;  1CFP A;  4M2O A;  5CSJ A;  1NX0 A;  2HQ8 A;  1ALW A;  2AMI A;  3I5F B;  1YTZ C;  2KAV A;  1WDC C;  5HKY A;  2M3W A;  5CSF A;  1DGV A;  2FOT A;  1QX7 A;  3LLE A;  4PE7 A;  1X02 A;  1SCV A;  3FWB A;  2LMT A;  1U5I A;  4PHM A;  4C0K A;  1IH0 A;  2JTT A;  1KQM B;  1WRZ A;  2VRG A;  3SG6 A;  1CMG A;  3O2P A;  1XFW O;  3KF9 A;  3HX4 A;  3WHU B;  1XFZ O;  2G9B A;  4CID A;  1N0Y A;  2K2A A;  1LA0 A;  3A8R A;  2KI4 C;  2ISD A;  4UPG A;  2M9G A;  1WDC B;  1YX8 A;  2PMY A;  3DF0 B;  1KK8 B;  2AAO A;  2K8M B;  3DVJ A;  2HF5 A;  2LE9 B;  1SKT A;  4NDB A;  5CSI A;  1AUI B;  1ZUZ A;  1DJW A;  3GK4 X;  3JTD C;  3CR5 X;  1KK7 Z;  4MLW A;  1GGW A;  2I2R E;  2L4I A;  3CTN A;  4N1G A;  4FQO A;  2F2O A;  5DKN A;  1YUU A;  3CZT X;  1UUS A;  2M0R A;  2H61 A;  4E68 A;  1F55 A;  4P2Y B;  3IQQ A;  1S6I A;  2PRU A;  2ZNE A;  3WHT B;  4IL1 A;  1RTP 1;  4MEW A;  3CS1 A;  1AHR A;  1CM4 A;  5J3X A;  2NCO A;  1R6P A;  5AAN A;  3BOW B;  3JTD B;  1IQ5 A;  1QAT A;  4DCK A;  4XJK B;  2V53 A;  1ZOT B;  4ICB A;  3EVV A;  2EC6 B;  1JBA A;  2ZFD A;  5ER4 X;  4QJ4 B;  1S6J A;  1ZAC A;  4DUQ A;  1BMO A;  2MLE C;  1AJ4 A;  1JC2 A;  3ZNI A;  1SW8 A;  2WC8 A;  4M2P A;  1WLZ A;  1QVI Y;  4OKH A;  2AUC A;  1NSH A;  1KSM A;  1NX1 A;  3OB1 B;  4ORB B;  3EK4 A;  1GGZ A;  1K96 A;  2CT9 A;  2Y1M A;  1XFU O;  2WCE A;  2L5X B;  2BCB A;  3I5G B;  3M0W A;  3O78 A;  1C7V A;  2M7N A;  2KGR A;  3AAK A;  1JUO A;  2M1K B;  1K9U A;  1HQV A;  1EG3 A;  2F2P A;  1J7R A;  1KWO C;  2JNX A;  1K9P A;  1REC A;  2CNP A;  1GJY A;  1OMV A;  3BUM B;  1QLK A;  1K95 A;  5I2L A;  3ICB A;  1EJ3 A;  2F8P A;  2K0J A;  4OCI A;  1JFJ A;  1L2O C;  4NDC A;  1XFY O;  1EL4 A;  5PAL A;  1ZFS A;  3A4U B;  1G8I A;  2SAS A;  3DF0 A;  4Q04 A;  4I5N B;  1TNX A;  4AOM A;  2BCX A;  2I94 A;  1RJV A;  1SPY A;  2K2F A;  1BR1 B;  1UWO A;  5D69 A;  2PAL A;  2KFG A;  3CGA A;  1BLQ A;  3KPX A;  1FI5 A;  1KWO B;  1KQV A;  1K8U A;  3FS7 A;  2QAC A;  5HKW A;  2JQ6 A;  1J55 A;  4QJ3 B;  1RWY A;  4CFQ A;  1Y0V H;  2KBI A;  1MUX A;  1CFC A;  4JQ0 D;  2OPO A;  3I5F C;  1YRU B;  5HLO A;  2JTZ A;  2BBM A;  1OOJ A;  3NXA A;  3HCM A;  3TS5 C;  1DJI A;  5HLV A;  2LVV A;  1SMG A;  2GV5 A;  2R2I A;  3DVM A;  4PHK A;  3DVE A;  4MZK A;  1J7O A;  3BOW A;  2BE6 A;  1KQM C;  4OVN F;  1M46 A;  2MAZ A;  1A4P A;  5AFP A;  4XJK A;  2L4H A;  3LL8 B;  4AQI A;  1OSA A;  1QS7 A;  2M29 A;  2Y4Q A;  1KK7 Y;  2JNF A;  2JOJ A;  4GGN A;  2GGM A;  2MBX A;  2L98 A;  4ORC B;  1KFU L;  1KK8 C;  5CPV A;  1SR6 B;  1IKU A;  1A29 A;  4N1F A;  2F33 A;  4N5X A;  3TS5 B;  1SCM C;  1PAL A;  2OTG C;  1M31 A;  3VGO A;  1UUR A;  1OMR A;  2JPT A;  1LIN A;  1NWD A;  2KAX A;  4DIR A;  4OR9 B;  5AXI A;  2O60 A;  5D7F A;  1BT6 A;  1B47 A;  1W7J B;  2KDH A;  1DJG A;  1OZS A;  3D10 A;  3GOF A;  2LHI A;  1IGV A;  4YRU A;  1J7Q A;  1CDN A;  4L9M A;  3TDI A;  2KSP A;  1RK9 A;  1UP5 A;  3KO0 A;  2KI6 C;  2LUC A;  2K61 A;  3PLF B;  2WND A;  1KFX S;  1XVJ A;  1WRK A;  1C7W A;  1B7T Z;  1M63 B;  2H2K A;  1DMO A;  1NCY A;  1F54 A;  1OQP A;  1PUL A;  2BEC A;  3OP0 A;  1SCM B;  1SL8 A;  1PK0 D;  1OE9 B;  1WLM A;  2OTG B;  2NCP A;  2JU0 A;  1TCF A;  1IJ6 A;  5I2O A;  4C0L A;  1H4B A;  2B1U A;  4AQJ A;  1K2H A;  2KOT A;  2MRD A;  2LAN A;  1QXP A;  2LMU A;  2EC6 C;  3DVK A;  4YGA A;  1CKK A;  4ETO A;  1TIZ A;  3CR4 X;  2BE4 A;  2MLF C;  3MSE B;  4MSP A;  2LM5 A;  4CPV A;  1DT7 B;  2KHN A;  3I5H B;  2FJU B;  1PSB A;  2KNE A;  1FW4 A;  1FPW A;  2CCM A;  1B1G A;  2FCD A;  1QAS A;  1YUT A;  1UHN A;  1J1D A;  3PM8 A;  3JVT C;  2IS9 A;  4PE1 A;  1NP8 A;  3ZWH A;  4PAL A;  1YVH A;  1H8B A;  5I8N A;  3I5G C;  1NX3 A;  2LVI A;  2Y1N A;  1Y1A A;  1FBV A;  1CMF A;  3WXA A;  4GNK B;  1QIV A;  1XK4 C;  3CWG A;  4MBE A;  4MZJ A;  3BUO B;  2M97 A;  3PAL A;  1DGU A;  2L2E A;  2JRF A;  3JVT B;  1XYD A;  2KFF A;  1QV1 A;  3BQ3 A;  3F45 A;  2K7C A;  2MHH A;  1JSA A;  2LC5 A;  1V1F A;  1Y1U A;  1B8L A;  1VRK A;  1DVI A;  2KYC A;  1QIW A;  4HRH A;  1JFK A;  1HT9 A;  4MRX A;  4WQ2 A;  3KEV A;  4GGF C;  5HYD A;  3O6B A;  1AK8 A;  5G08 A;  3C1V A;  1S1E A;  3PAT A;  1E8A A;  3AKA A;  3GK2 A;  1M45 A;  2LV7 A;  1BR4 B;  4NQG A;  3NSO A;  3SIB A;  4USL A;  1KSO A;  2ZRT A;  3CR2 A;  1YUR A;  5KTY A;  1IG5 A;  3VRQ A;  2M7L A;  1EXR A;  1XO5 A;  3OX6 A;  4QJ5 B;  3LCP C;  1MF8 B;  1ODB A;  3BUW B;  3FIA A;  2KFH A;  1F4Q A;  1B8R A;  2MJW B;  3GK1 A;  1LVC D;  3PN7 C;  4I5L B;  4D1E A;  2PSR A;  1B4C A;  1IWQ A;  1WY9 A;  1MXE A;  1Y6W A;  1DJY A;  1YR5 A;  5KU1 A;  1TTX A;  1PVA A;  1SY9 A;  3OX5 A;  2HPS A;  1TNQ A;  3LK0 A;  3EKH A;  2WOR A;  1CDP A;  1LXF C;  1AP4 A;  1TOP A;  4I5J A;  1J7P A;  5F6T A;  3D0Y B;  1SR6 C;  4YI8 A;  2JT8 A;  2KGB C;  2LVJ A;  5BPJ A;  2BCA A;  2M1U A;  2LCP A;  3IF7 A;  3AAJ A;  1UHI A;  1NIW A;  1NCZ A;  1NX2 A;  1CDM A;  1B7T Y;  3PN7 B;  1QTX A;  2NXQ A;  5FYX A;  4PCW A;  2HQW A;  2I18 A;  4YI9 A;  3SJS A;  3PSR A;  1LA3 A;  1YUS A;  1DJH A;  1S5G Z;  1MXL C;  2LP2 A;  3SIA A;  1D1O A;  2HET A;  1QX2 A;  2ZN9 A;  1UHJ A;  3BUN B;  1B8C A;  2FCE A;  3FWC A;  3NSL A;  1JF0 A;  1NCX A;  1M39 A;  1UHK A;  4PHJ A;  2OS8 B;  2KBM A;  2M49 B;  4MN0 A;  3NSK A;  1L7Z A;  1J1E A;  2KAY A;  2KQY A;  3DD4 A;  1ZMZ A;  1CLM A;  4HRG A;  1SYM A;  1XK4 A;  2LHL A;  2K7D A;  1BG1 A;  4MZL A;  2MA2 A;  2PAS A;  1Y1X A;  3VRR A;  3VRN A;  3I5H C;  1EH2 A;  4ORA B;  4CFR A;  1QV0 A;  2E30 A;  1TNW A;  1PSR A;  1OZO A;  4YGE B;  2JXC A;  5B8I B;  2Q4U A;  4DS7 A;  2I7A A;  2JT0 A;  3EK7 A;  3RLZ A;  2NZ0 A;  2ZRS A;  1A03 A;  2E6W A;  2TN4 A;  1JWD A;  1V1G A;  2ZKM X;  3CLN A;  4C0J A;  5K89 A;  4PHN A;  4CLN A;  2ZND A;  1UHH A;  2G2B A;  5JOL A;  1QX5 B;  4HSZ A;  4GGF A;  4JPZ B;  2JZI A;  2SCP A;  3I5I B;  2L51 A;  3BYA A;  1RFJ A;  2Q91 A;  1SNL A;  3E3R A;  4TNC A;  1A75 B;  1MHO A;  1FI6 A;  4M2Q A;  2WCB A;  5CSN A;  2CXJ A;  1YX7 A;  4WQ3 A;  2COL B;  1RRO A;  3LK1 A;  4OV2 A;  2LUX A;  3D0Y A;  3OB2 B;  5I2Q A;  1LKJ A;  1SL7 A;  2KQ6 A;  1S26 D;  1BOC A;  2RGI A;  5AEQ A;  1CLB A;  4MRY A;  3AKB A;  4FTG A;  4YGC B;  1CDL A;  1CFD A;  2KI6 D;  2LMV A;  1EG4 A;  4PE4 A;  5DKQ A;  2BBN A;  1BJF A;  3K21 A;  1SBJ A;  1IRJ A;  1G4Y R;  1PRW A;  2K7O A;  1AVS A;  2KI4 B;  1DF0 B;  2BKH B;  1XFV O;  2LP3 A;  1OMD A;  3SG3 A;  1IQ3 A;  4BY5 A;  1XA5 A;  3O4Y A;  1DJX A;  1W7I B;  3TUY C;  1CTR A;  1F71 A;  1CNP A;  2L50 A;  1MR8 A;  4MVF A;  2CTN A;  1N2D A;  2O5G A;  2WOS A;  1KCY A;  2LNK A;  2EHB A;  3SG5 A;  1G33 A;  3TDU A;  1CLL A;  1S36 A;  1TNP A;  1S3P A;  3EKJ A;  2F3Z A;  3PFV A;  3QRX A;  4YBH B;  1SRA A;  2D8N A;  1Q80 A;  2A4J A;  2GGZ A;  1KFU S;  1CB1 A;  5KSZ A;  1NPQ A;  1KFX L;  4F0Z B;  1YVL A;  1DTL A;  1S5G Y;  1BU3 A;  1R2U A;  1U5I B;  2JC2 A;  2JWW A;  1CM1 A;  1BF5 A;  4PDZ A;  4U8D A;  3TUY B;  1A2X A;  2PVB A;  2JUL A;  4A4C A;  5IBW A;  1FF1 A;  1F8H A;  1YRT B;  2LLU A;  3SG4 A;  1CFF A;  3SG7 A;  1F4O A;  2H61 C;  4GAO A;  5JJG A;  1IJ5 A;  2BL0 C;  3H4S E;  3EK8 A;  1AJ5 A;  4PE0 A;  1TN4 A;  2L0P A;  1WRL A;  2LLT A;  1XFX O;  3TZ1 A;  4GFT A;  3KHE A;  1A75 A;  1MQ1 A;  5GQQ C;  4NDD A;  2M8U A;  4DRW A;  4HRE E;  1N65 A;  1QJT A;  4GBA A;  5TNC A;  1B9A A;  2KYF A;  4BY4 A;  3EVU A;  1K90 D;  4ZCV A;  1TRF A;  2OS8 C;  2P6B B;  4ZCU A;  4YGB B;  3VRO A;  2LLS A;  1JF2 A;  1QVI Z;  4I5K A;  3TDZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...