1UHHA

Crystal structure of cp-aequorin
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
191
structure length
191
Chain Sequence
ANSKLTSDFDNPRWIGRHKHMFNFLDVNHNGKISLDEMVYKASDIVINNLGATPEQAKRHKDAVEAFFGGAGMKYGVETDWPAYIEGWKKLATDELEKYAKNEPTLIRIWGDALFDIVDKDQNGAITLDEWKAYTKAAGIIQSSEDCEETFRVCDIDESGQLDVDEMTRQHLGFWYTMDPACEKLYGGAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aequorin 2
publication title The crystal structures of semi-synthetic aequorins
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Luminescent protein
total genus 68
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1uhhA00
1YX7A 1AJ4A 1JSAA 2M7LA 1PSBA 3GK4X 1NCYA 1ZFSA 2JU0A 1JFJA 3H4SE 3I5FB 1CMFA 1YUSA 4PALA 4HREE 4MRYA 2PRUA 4MSPA 1OMVA 3I5GC 3VRPA 3KO0A 4WQ2A 1KQVA 3I5IB 4MBEA 4XJKA 3PFVA 1OZOA 2SCPA 2A4JA 2KQYA 3MSEB 2BCBA 1CFFA 2LVJA 3WHUB 1IQ3A 1KFXS 2M0RA 4N1FA 1YVHA 1JC2A 1EJ3A 2BE4A 2AUCA 1MWNA 1FW4A 1IWQA 1M63B 2Y1MA 1OE9B 1W7IB 1D1OA 1J55A 4OKHA 1RFJA 2FCEA 2OS8B 2PSRA 1PK0D 1SL8A 1QLSA 1SRAA 4P2YB 1SCVA 2I18A 2JC2A 2KGRA 2KAYA 2KFGA 5ER5A 4QJ4B 1KK8C 4AQJA 2G2BA 1CM1A 2L4IA 1WRKA 4M2QA 3OX6A 2H61A 1K94A 2KI4B 1NX1A 2K2AA 5D7FA 2COLB 2R2IA 5CSIA 3VRNA 1JFKA 1S6IA 5JOLA 4CIDA 3JTDB 4GGFA 3KF9A 5AFPA 1SY9A 4N1GA 2E6WA 5HKZA 4A4BA 2BCXA 1OZSA 1QVIZ 1G8IA 1Q80A 3HX4A 2JNFA 1N2DA 1LKJA 4ICBA 4MVFA 3RM1A 3CZTX 1WLMA 4BY5A 2M8UA 5I8NA 3DVJA 1MHOA 1XFXO 3BUWB 4MEWA 1K9KA 2I2RE 1BR1B 1SW8A 1QX7A 1S26D 1TCOB 4I5LB 1K9PA 2CBLA 1QIWA 3SG4A 1A4PA 3I5GB 1RWYA 1BOCA 2KOTA 1DJZA 4M2OA 1DT7B 1L7ZA 4PCWA 1CFCA 1NUBA 2K61A 1ODBA 3FWBA 2LMUA 3I5FC 3SG7A 4CFQA 2PMYA 1J7QA 1A75A 1K93D 1CDNA 2LHLA 1DMOA 5I2QA 3DVMA 2EGDA 4ORBB 1B4CA 2M1KB 1QLKA 2RGIA 3BUXB 1DJHA 2JNXA 1M31A 1XFVO 1NX0A 1XFZO 4YGAA 4FQOA 3SG5A 5KSZA 4IL1A 1BG1A 2KYCA 1F4QA 1V1FA 1R6PA 1FF1A 2IS9A 5I2OA 4YI8A 4DUQA 1L2OC 1YURA 1K95A 4OR9B 4YGEB 2ZN8A 3BYAA 4FTGA 2LVIA 3D0YB 3OX5A 5HYDA 2PASA 2KAVA 1UWOA 2LVKA 2SASA 2WC8A 5KTYA 1IGVA 2V53A 1YX8A 2LLUA 1KSMA 1AVSA 1EXRA 2PALA 5KU1A 3F45A 4YBHB 3K21A 5DKNA 2I94A 2HQ8A 4XJKB 4DRWA 1UHNA 3EK4A 1Y1XA 3LCPC 4YGDB 1KQMB 2M7NA 3JTDC 2PVBA 5HLOA 2QPTA 3KPXA 2CT9A 1ZOTB 2ZRSA 3DD4A 1NCZA 4C0KA 2NZ0A 1QXPA 1U5IA 3TZ1A 4GUKA 1Y6WA 4ETOA 2MAZA 2KAXA 2WCEA 1XO5A 1UURA 3EKHA 1S5GZ 1LXFC 1DVIA 2JQ6A 1YUTA 1XYDA 1JUOA 1G4YR 1FBVA 1QVIY 2L4HA 4GFTA 1W7JB 2Y1NA 1MXEA 4MLWA 1FPWA 3ZNIA 4PE7A 1CFDA 2MBXA 4AOMA 1KK7Y 1SCMB 4P5OE 1J1EA 2F3ZA 1NCXA 1PRWA 1M46A 2JZIA 4NDBA 2BECA 2LP2A 5DKQA 1L2OB 4A4CA 4AQIA 2WCFA 2LMVA 1IJ6A 2FOTA 2K7DA 1CLLA 5D69A 1RK9A 3O6BA 1UHHA 3OB2B 4F0ZB 4UPGA 2LAPA 2ZKMX 2F2OA 1RTP1 1SYMA 2KYFA 1QX5B 1NYAA 1YR5A 1A29A 1YTZC 1F55A 3D10A 2JXLA 1TNXA 1S6JA 4WQ3A 2MA2A 3CR2A 1Y1UA 4MZJA 4D1EA 1KFUL 3WNXB 3TUYC 3VRRA 2BKHB 1JF0A 1SBJA 1EG4A 3BOWA 2KQ6A 1B7TY 1JBAA 1G33A 2KNEA 1SK6D 4USLA 4MN0A 2WOSA 4JPZB 1RROA 1XFWO 3PATA 4ORAB 2CCMA 1UHIA 1BT6A 1ZUZA 1DJIA 2KBIA 1KQMC 2L51A 2K0JA 2D8NA 3VRQA 2M49B 3BXKA 1LINA 1TNWA 3VROA 1E8AA 4PHMA 3OHMB 4DCKA 2JT8A 3AAJA 4PE0A 4C0JA 2VRGA 2B1UA 4OCIA 1EH2A 1ALVA 2JTTA 1RECA 1CLMA 1QX2A 1QASA 1ZMZA 2O60A 3WHTB 2BCAA 1NX3A 3O4YA 1CDLA 4N5XA 1OQPA 4OV2A 1QJTA 5F6TA 5CPVA 2NCPA 1TTXA 3GK2A 2I7AA 3SJSA 1YRTB 1J7PA 2MLFC 4HSZA 3CLNA 2HF5A 4ZCVA 3TDUA 1AHRA 2M29A 1PVAA 3A4UB 1IRJA 1F54A 1XA5A 3EK8A 2H61C 4TNCA 1S3PA 1TIZA 2HETA 1IKUA 1SCMC 3AKBA 2Y5IA 1S5GY 2CNPA 2ZRTA 4GGFC 5TNCA 3GOFA 1BMOA 4BY4A 4YRUA 1WY9A 2LNKA 3O2PA 1WRLA 3OP0A 4C0LA 2LUXA 4PHJA 1U5IB 1BODA 1DJGA 3KEVA 3QRXA 1CM4A 4ZCUA 3TUYB 3BUMB 1XFYO 1LA0A 1TOPA 3AKAA 4CPVA 3EKJA 2BBNA 1Y1AA 3GK1A 1N65A 1AP4A 1YUUA 4I5KA 5G08A 2JXCA 1PALA 2KI6C 4I5JA 1UHKA 1CKKA 4GGNA 1SL9A 1H4BA 3DVEA 1KFXL 1EG3A 2DOQA 1V1GA 3M0WA 2ZNEA 2GGMA 5I2LA 3PM8A 2K7OA 5K89A 3WXAA 5GQQC 2LV7A 3IQQA 2LMTA 5PALA 1IG5A 5BPJA 3HCMA 2HPSA 4DIRA 2JPTA 5CSFA 2BBMA 1TRFA 4OVNF 2K7CA 2MJWB 2P6BB 5AXIA 1YRUB 3SG3A 1SR6C 1M45A 1PVBA 2KHNA 4XYNA 1J1DA 3I5HC 5J3XA 1A03A 5ER4X 4WRIA 3VGOA 1AUIB 2ZNDA 3CR4X 1QS7A 4PHKA 2TN4A 3SG2A 2K8MB 4GNKB 1VRKA 3ICBA 3IF7A 1M39A 1PSRA 4YGBB 2WCBA 1NSHA 1SL7A 1R2UA 1OOJA 4GBAA 1CFPA 1CDPA 2WNDA 3DF0A 4YI9A 2KSPA 1OMRA 4GPLB 5DKRA 2NXQA 5AANA 3CWGA 2FJUB 2L50A 1S36A 1BU3A 2EHBA 2OPOA 2WORA 4M2PA 3KHEA 1BLQA 2JT3A 2LCPA 2JT0A 1WRZA 1Y0VH 3TDZA 2M97A 3FS7A 2JTZA 1B47A 2KFFA 2JRFA 1KSOA 1K8UA 3BOWB 3BUNB 2H2KA 3EK7A 1QATA 2E30A 1XK4A 1LA3A 2BE6A 2NCOA 3LK1A 1CLBA 1KCYA 1F4OA 3PLFB 1IH0A 3E3RA 4PE1A 5CSJA 2LLTA 2KGBC 5B8IB 3NSKA 1CB1A 2LC5A 1KWOC 4HRGA 1UHJA 5CSNA 5HKWA 5AERA 1B9AA 2AAOA 3CS1A 3NSOA 1H8BA 2KBMA 1MUXA 1ZACA 2JWWA 1QV1A 1DF0A 1YVLA 4QJ3B 1CMGA 4YGCB 1QV0A 1C7VA 1QIVA 3TS5C 1WLZA 2Q91A 1A75B 2F2PA 2MRDA 3PALA 1F71A 2LM5A 1IQ5A 5FYXA 3JVTC 2GV5A 2MHHA 3NSLA 3PN7B 1GQMA 2EC6B 1X02A 1F70A 4NDCA 1WDCC 2KI6D 1SR6B 3A8RA 4JQ0D 3ZWHA 3I5HB 1BR4B 1B8CA 1ALWA 3SG6A 1GGWA 4MRXA 3LL8B 2M1UA 1OMDA 5AEQA 1NIWA 4MZLA 3BUOB 1MR8A 2LP3A 1BF5A 4U8DA 3NXAA 1K2HA 1EL4A 1XK4C 2OTGB 3O78A 4R1EA 1DGUA 1UUSA 1SMGA 2L5XB 1UP5A 2BL0B 1MF8B 3SIBA 3CTNA 1DTLA 1LVCD 1B8RA 1FI6A 3OB1B 2FCDA 3TDIA 1CTRA 4GAOA 5IBWA 4I5NB 1N0YA 1KK7Z 1TNQA 1MXLC 1SNLA 2ZFDA 1K90D 1K9UA 1NWDA 3CGAA 2O5GA 3LLEA 3FIAA 4L9MA 1OSAA 2Y4QA 1GGZA 3RLZA 2M3WA 4PDZA 1HT9A 1RJVA 1KWOB 1J7OA 1KFUS 2LVVA 1B8LA 1BJFA 1AJ5A 2F33A 1JF2A 2CTNA 2MLEC 1AK8A 3AAKA 5HKYA 4PE4A 3NSIA 2G9BA 4E68A 2K2FA 2BKIB 2KFHA 3I5IC 2F3YA 4HRHA 1S6CA 1CNPA 2NLNA 1DJXA 1GJYA 1NP8A 3TS5B 1QTXA 1XVJA 2LLSA 2ZN9A 3LK0A 2F8PA 4CLNA 4ORCB 3DVKA 3IQOA 3JVTB 4MZKA 1CDMA 2AMIA 1FI5A 1B7TZ 1DJYA 1KK8B 2LHIA 4NQGA 4NDDA 5HLVA 2LE9B 3DF0B 1WDCB 2JULA 2CXJA 2OS8C 2L0PA 2ISDA 1TNPA 4PHNA 3CR5X 1DJWA 1MQ1A 1PULA 2Q4UA 1K96A 3PN7C 2EC6C 1IJ5A 2M9GA 1NPQA 3PSRA 3SIAA 2QACA 3EVRA 3BQ3A 2K7BA 5JJGA 1XFUO 4DS7A 1SKTA 2KI4C 4CFRA 1F8HA 1HQVA 1SPYA 1S1EA 1B1GA 1C7WA 3EVUA 1TCFA 2L98A 2KDHA 1TN4A 1J7RA 2JOJA 3EVVA 3FWCA 4JWQA 4QJ5B 2GGZA 2OTGC 1C07A 4Q04A 3D0YA 2HQWA 2BL0C 1A2XA 1DGVA 1NX2A 1DF0B 2L2EA 2LUCA 1JWDA 2LANA 3C1VA
chains in the Genus database with same CATH superfamily
1YX7A 1AJ4A 1JSAA 2M7LA 1PSBA 3GK4X 1NCYA 1ZFSA 2JU0A 1JFJA 3H4SE 3I5FB 1CMFA 1YUSA 3L4LA 4PALA 4HREE 4MRYA 2PRUA 4MSPA 1OMVA 3I5GC 3VRPA 2L5YA 3KO0A 4WQ2A 3S0AA 1KQVA 3I5IB 4MBEA 4XJKA 3PFVA 1OZOA 2SCPA 2WCMA 2A4JA 2KQYA 3MSEB 4PT1A 2BCBA 1CFFA 2LVJA 3WHUB 1IQ3A 1KFXS 2M0RA 3DXLA 1YVHA 4N1FA 1JC2A 1EJ3A 2BE4A 2AUCA 1MWNA 5EL2A 1FW4A 1IWQA 1M63B 2Y1MA 1OE9B 1W7IB 1D1OA 1J55A 4OKHA 1RFJA 2FCEA 2OS8B 1C3ZA 2QDIA 2PSRA 3UNWA 1PK0D 1SL8A 1QLSA 1ORGA 3NHTA 1SRAA 4P2YB 1SCVA 2I18A 2JC2A 2KGRA 1Z4HA 2KAYA 2KFGA 5ER5A 4QJ4B 1KK8C 1T14A 4AQJA 2G2BA 1CM1A 2L4IA 1WRKA 4M2QA 3OX6A 3BFBA 2H61A 1K94A 2KI4B 3R1PA 1NX1A 2K2AA 5D7FA 1TWOA 2COLB 2R2IA 5CSIA 3VRNA 4OZDA 1JFKA 1S6IA 5JOLA 4CIDA 3JTDB 4GGFA 3KF9A 5AFPA 1SY9A 4N1GA 2E6WA 5HKZA 4A4BA 2BCXA 1OZSA 1QVIZ 3DYEA 1G8IA 1Q80A 3HX4A 2JNFA 1N2DA 1LS8A 1LKJA 4ICBA 4MVFA 3RM1A 3CZTX 3DZTA 1WLMA 4BY5A 2M8UA 5I8NA 3DVJA 1MHOA 1XFXO 3BUWB 4MEWA 1K9KA 2I2RE 1BR1B 1SW8A 1QX7A 1S26D 3B86A 1TCOB 4I5LB 1K9PA 2JPOA 2CBLA 1QIWA 3SG4A 1A4PA 4JKTA 3I5GB 3CZ0A 1RWYA 1BOCA 2KOTA 1DJZA 5HL1A 4M2OA 1DT7B 1L7ZA 4PCWA 1CFCA 1NUBA 2K61A 1ODBA 3FWBA 2LMUA 3I5FC 3OBVA 3SG7A 4CFQA 2PMYA 2WC5A 1J7QA 1A75A 1K93D 1CDNA 2LHLA 1DMOA 5I2QA 3DVMA 2EGDA 4ORBB 1B4CA 2M1KB 1QLKA 2RGIA 3BUXB 1DJHA 2JNXA 1M31A 1XFVO 1NX0A 1XFZO 4YGAA 4FQOA 3SG5A 5KSZA 4IL1A 1BG1A 3D75A 2KYCA 1GM0A 1F4QA 1V1FA 1R6PA 1FF1A 2IS9A 5I2OA 4YI8A 4DUQA 1L2OC 1YURA 3EG5B 3DY9A 1K95A 1OOGA 4OR9B 2ZN8A 3BYAA 4FTGA 4YGEB 3CDNA 2LVIA 3D0YB 3OX5A 5HYDA 3B87A 2PASA 2PYQA 2KAVA 1UWOA 2LVKA 2SASA 2WC8A 5KTYA 1IGVA 2V53A 1YX8A 3UO9A 2LLUA 1KSMA 1AVSA 1EXRA 2PALA 5KU1A 3F45A 4YBHB 3K21A 3N7HA 5DKNA 2I94A 2HQ8A 4KYNA 4XJKB 3R1OA 1UHNA 2PQLA 3EK4A 4DRWA 1Y1XA 3LCPC 4YGDB 1KQMB 2M7NA 3JTDC 2K60A 1TUZA 2PVBA 5HLOA 2QPTA 3KPXA 2CT9A 1ZOTB 2ZRSA 3DD4A 1C3YA 1NCZA 4C0KA 2NZ0A 1QXPA 1U5IA 3D77A 3TZ1A 3D73A 3NHIA 4GUKA 1Y6WA 4ETOA 2MAZA 2KAXA 2WCEA 1XO5A 1UURA 3EKHA 1S5GZ 1LXFC 1DVIA 2JQ6A 1YUTA 1XYDA 1JUOA 1G4YR 1FBVA 1QVIY 2L4HA 4GFTA 5FI6A 1W7JB 2Y1NA 1MXEA 4MLWA 1FPWA 3ZNIA 2QEBA 2KLDA 4PE7A 1CFDA 2MBXA 4AOMA 1KK7Y 1SCMB 4P5OE 1J1EA 2F3ZA 1NCXA 1PRWA 1M46A 2JZIA 4NDBA 2BECA 2LP2A 5DKQA 1L2OB 4A4CA 4AQIA 1Z2CB 2WCFA 2LMVA 1IJ6A 2FOTA 2P71A 1SSEB 2K7DA 1CLLA 5D69A 1RK9A 3O6BA 1UHHA 3OB2B 3QMEA 4F0ZB 4UPGA 2LAPA 2ZKMX 3CYZA 2F2OA 1RTP1 5D3OA 1SYMA 2KYFA 1QX5B 1NYAA 1YR5A 1A29A 1YTZC 1F55A 3D10A 2JXLA 1TNXA 1S6JA 4WQ3A 2MA2A 3CR2A 1Y1UA 4MZJA 4D1EA 5I94A 1KFUL 3WNXB 3TUYC 3VRRA 3B6XA 2BKHB 1OW4A 1JF0A 1SBJA 1EG4A 3BOWA 2KQ6A 1B7TY 1JBAA 2QEHA 1G33A 2KNEA 1SK6D 4USLA 4MN0A 2WOSA 4JPZB 1RROA 1XFWO 3PATA 4ORAB 2CCMA 1UHIA 1BT6A 1ZUZA 1DJIA 2KBIA 1KQMC 2L51A 3K1EA 2K0JA 2D8NA 3VRQA 2M49B 3BXKA 1LINA 1TNWA 3VROA 3B88A 1E8AA 4PHMA 3OHMB 4DCKA 2JT8A 3AAJA 4PE0A 4C0JA 2VRGA 2B1UA 4OCIA 1EH2A 1ALVA 2JTTA 1RECA 1CLMA 1QX2A 1QASA 1ZMZA 2O60A 3WHTB 2WCLA 2BCAA 1NX3A 3O4YA 1CDLA 4FQTA 1OQPA 4N5XA 4OV2A 3S0BA 1QJTA 5F6TA 5CPVA 3D74A 2NCPA 1TTXA 3GK2A 2I7AA 3OGNA 1YRTB 3SJSA 3SS4A 1J7PA 2MLFC 1DELA 3CLNA 2HF5A 4HSZA 3L4AA 4ZCVA 2BAPA 3TDUA 1AHRA 2M29A 1PVAA 3A4UB 1IRJA 1F54A 1XA5A 3EK8A 2H61C 4TNCA 1S3PA 1TIZA 2HETA 1IKUA 1SCMC 3AKBA 2Y5IA 1S5GY 2ERBA 2CNPA 2WCKA 2ZRTA 4GGFC 1CFPA 5TNCA 3GOFA 1BMOA 1DQEA 3S0DA 4BY4A 4YRUA 1WY9A 2LNKA 3O2PA 1WRLA 3OP0A 4C0LA 2LUXA 4PHJA 1U5IB 1BODA 1DJGA 3KEVA 3QRXA 1CM4A 3PJIA 4ZCUA 3TUYB 3BUMB 1XFYO 1LA0A 3CZ2A 1TOPA 3AKAA 3NGVA 4CPVA 3EKJA 2BBNA 1DEKA 1Y1AA 1N65A 3GK1A 1AP4A 1YUUA 4I5KA 5G08A 2JXCA 1PALA 2KI6C 4I5JA 1UHKA 2GTEA 4GGNA 1CKKA 3CABA 3S0GA 1SL9A 1H4BA 3DVEA 1KFXL 1EG3A 2DOQA 1V1GA 2WCJA 3FE8A 2ZNEA 3M0WA 1DC1A 2GGMA 5I2LA 3PM8A 4F7FA 2K7OA 3IVTA 1P28A 5K89A 3O4XA 3WXAA 5GQQC 3PM2A 1W9ZA 2LV7A 2QEVA 2LMTA 3IQQA 1IG5A 5PALA 5BPJA 3HCMA 2HPSA 4DIRA 2JPTA 5CSFA 2BBMA 1TRFA 4OVNF 2K7CA 2MJWB 2P6BB 5AXIA 1YRUB 3SG3A 1SR6C 1M45A 3VB1A 1PVBA 2KHNA 3Q8IA 4XYNA 1J1DA 3I5HC 5J3XA 1A03A 5ER4X 4WRIA 3VGOA 1AUIB 2ZNDA 3CR4X 1QS7A 4PHKA 2TN4A 3SG2A 2K8MB 4GNKB 1VRKA 3ICBA 3IF7A 1M39A 1PSRA 4YGBB 2WCBA 1NSHA 1SL7A 4INWA 1R2UA 1OOJA 4GBAA 1OOHA 1CDPA 2WNDA 3DF0A 4YI9A 2KSPA 1OMRA 4GPLB 5DKRA 2NXQA 5AANA 3CWGA 2FJUB 2L50A 1S36A 1BU3A 2EHBA 2OPOA 2WORA 3FE9A 4M2PA 3KHEA 5FI2A 1BLQA 2JT3A 2LCPA 2JT0A 1WRZA 1Y0VH 2KLEA 3TDZA 1XFRA 2M97A 3FS7A 1IIOA 2BNXA 2JTZA 1B47A 2KFFA 2JRFA 1KSOA 1K8UA 3BOWB 3BJHA 3BUNB 2H2KA 3EK7A 1QATA 2E30A 1XK4A 1LA3A 2BE6A 2NCOA 3LK1A 1CLBA 1KCYA 1F4OA 1OOIX 3PLFB 1IH0A 3E3RA 4PE1A 5CSJA 2LLTA 2KGBC 5B8IB 3NSKA 1CB1A 2LC5A 1KWOC 4HRGA 1UHJA 5CSNA 5HKWA 5AERA 1B9AA 2AAOA 3CS1A 3BFHA 3NSOA 1H8BA 2KBMA 3RZSA 1MUXA 5FI7A 1ZACA 2JWWA 1QV1A 1DF0A 1YVLA 4QJ3B 1CMGA 4YGCB 1QV0A 1C7VA 1QIVA 3TS5C 1WLZA 2Q91A 1A75B 2F2PA 2MRDA 2WCHA 3PALA 2LM5A 1F71A 3B7AA 1IQ5A 5FYXA 3JVTC 2GV5A 2MHHA 3NSLA 3PN7B 1GQMA 2EC6B 1X02A 1F70A 4NDCA 1WDCC 3SS5A 2KI6D 1SR6B 3A8RA 4JQ0D 3ZWHA 3I5HB 1BR4B 1B8CA 1ALWA 3SG6A 1GGWA 4MRXA 1QWVA 3LL8B 2M1UA 5DICA 1OMDA 5AEQA 1NIWA 4MZLA 3BUOB 1MR8A 2LP3A 4INXA 1BF5A 4U8DA 3NXAA 3S0FA 1K2HA 1EL4A 1XK4C 2OTGB 3O78A 4R1EA 1DGUA 1UUSA 1SMGA 2L5XB 1UP5A 2BL0B 2WC6A 1MF8B 3SIBA 3CTNA 1DTLA 1LVCD 1B8RA 1FI6A 2L2CA 2FCDA 3OB1B 3TDIA 1CTRA 4GAOA 5IBWA 4I5NB 3V2LA 1N0YA 1KK7Z 1TNQA 1MXLC 3D76A 1SNLA 2ZFDA 1K90D 1K9UA 1NWDA 2QEOA 2O5GA 3CGAA 3FIAA 3LLEA 1OSAA 4L9MA 2Y4QA 3L47A 1GGZA 3RLZA 2M3WA 4PDZA 1HT9A 1RJVA 1KWOB 1J7OA 1KFUS 2LVVA 1B8LA 1BJFA 1AJ5A 2F33A 1JF2A 2CTNA 2MLEC 1AK8A 3AAKA 5HKYA 3CZ1A 4PE4A 3NSIA 2G9BA 4E68A 2K2FA 2BKIB 2KFHA 3I5IC 2F3YA 4HRHA 1S6CA 4IJ7A 1CNPA 2NLNA 1DJXA 1GJYA 1NP8A 1OOFA 3TS5B 3R72A 2YGUA 1QTXA 1XVJA 2LLSA 2ZN9A 3LK0A 2F8PA 4JD9A 4CLNA 4ORCB 3DVKA 3IQOA 3BFAA 3JVTB 4MZKA 1CDMA 2AMIA 1FI5A 1TUJA 1B7TZ 1DJYA 1KK8B 2LHIA 4NQGA 4NDDA 5HLVA 2LE9B 3DF0B 1WDCB 3SS3A 2JULA 2CXJA 2OS8C 2L0PA 2ISDA 1TNPA 4PHNA 3CR5X 1DJWA 1MQ1A 1PULA 2Q4UA 1K96A 3PN7C 2EC6C 1IJ5A 2M9GA 1NPQA 3PSRA 3SIAA 2FJYA 2QACA 3EVRA 3BQ3A 2K7BA 2P70A 5JJGA 1XFUO 4DS7A 1SKTA 2KI4C 4CFRA 2H8VA 1F8HA 1HQVA 1SPYA 1S1EA 3FE6A 1B1GA 1C7WA 3EVUA 3D78A 1TCFA 2L98A 2KDHA 2KPHA 1TN4A 1J7RA 2JOJA 3EVVA 3FWCA 4JWQA 4QJ5B 2GGZA 2OTGC 1C07A 4Q04A 3D0YA 2HQWA 3S0EA 2BL0C 1A2XA 1DGVA 1NX2A 1DF0B 2L2EA 2LUCA 3R1VA 1JWDA 2LANA 3C1VA
chains in the Genus database with same CATH topology
1YX7A 1AJ4A 1JSAA 2M7LA 1PSBA 3GK4X 1NCYA 1ZFSA 2JU0A 1JFJA 3H4SE 3I5FB 1CMFA 1YUSA 4PALA 4HREE 4MRYA 2PRUA 4MSPA 1OMVA 3I5GC 3VRPA 3KO0A 4WQ2A 1KQVA 3I5IB 4MBEA 4XJKA 3PFVA 1OZOA 2SCPA 2A4JA 2KQYA 3MSEB 2BCBA 1CFFA 2LVJA 3WHUB 1IQ3A 1KFXS 2M0RA 4N1FA 1YVHA 1JC2A 1EJ3A 2BE4A 2AUCA 1MWNA 1FW4A 1IWQA 1M63B 2Y1MA 1OE9B 1W7IB 1D1OA 1J55A 4OKHA 1RFJA 2FCEA 2OS8B 2PSRA 1PK0D 1SL8A 1QLSA 1SRAA 4P2YB 1SCVA 2I18A 2JC2A 2KGRA 2KAYA 2KFGA 5ER5A 4QJ4B 1KK8C 4AQJA 2G2BA 1CM1A 2L4IA 1WRKA 4M2QA 3OX6A 2H61A 1K94A 2KI4B 1NX1A 2K2AA 5D7FA 2COLB 2R2IA 5CSIA 3VRNA 1JFKA 1S6IA 5JOLA 4CIDA 3JTDB 4GGFA 3KF9A 5AFPA 1SY9A 4N1GA 2E6WA 5HKZA 4A4BA 2BCXA 1OZSA 1QVIZ 1G8IA 1Q80A 3HX4A 2JNFA 1N2DA 1LKJA 4ICBA 4MVFA 3RM1A 3CZTX 1WLMA 4BY5A 2M8UA 5I8NA 3DVJA 1MHOA 1XFXO 3BUWB 4MEWA 1K9KA 2I2RE 1BR1B 1SW8A 1QX7A 1S26D 1TCOB 4I5LB 1K9PA 2CBLA 1QIWA 3SG4A 1A4PA 3I5GB 1RWYA 1BOCA 2KOTA 1DJZA 4M2OA 1DT7B 1L7ZA 4PCWA 1CFCA 1NUBA 2K61A 1ODBA 3FWBA 2LMUA 3I5FC 3SG7A 4CFQA 2PMYA 1J7QA 1A75A 1K93D 1CDNA 2LHLA 1DMOA 5I2QA 3DVMA 2EGDA 4ORBB 1B4CA 2M1KB 1QLKA 2RGIA 3BUXB 1DJHA 2JNXA 1M31A 1XFVO 1NX0A 1XFZO 4YGAA 4FQOA 3SG5A 5KSZA 4IL1A 1BG1A 2KYCA 1F4QA 1V1FA 1R6PA 1FF1A 2IS9A 5I2OA 4YI8A 4DUQA 1L2OC 1YURA 1K95A 4OR9B 4YGEB 2ZN8A 3BYAA 4FTGA 2LVIA 3D0YB 3OX5A 5HYDA 2PASA 2KAVA 1UWOA 2LVKA 2SASA 2WC8A 5KTYA 1IGVA 2V53A 1YX8A 2LLUA 1KSMA 1AVSA 1EXRA 2PALA 5KU1A 3F45A 4YBHB 3K21A 5DKNA 2I94A 2HQ8A 4XJKB 4DRWA 1UHNA 3EK4A 1Y1XA 3LCPC 4YGDB 1KQMB 2M7NA 3JTDC 2PVBA 5HLOA 2QPTA 3KPXA 2CT9A 1ZOTB 2ZRSA 3DD4A 1NCZA 4C0KA 2NZ0A 1QXPA 1U5IA 3TZ1A 4GUKA 1Y6WA 4ETOA 2MAZA 2KAXA 2WCEA 1XO5A 1UURA 3EKHA 1S5GZ 1LXFC 1DVIA 2JQ6A 1YUTA 1XYDA 1JUOA 1G4YR 1FBVA 1QVIY 2L4HA 4GFTA 1W7JB 2Y1NA 1MXEA 4MLWA 1FPWA 3ZNIA 4PE7A 1CFDA 2MBXA 4AOMA 1KK7Y 1SCMB 4P5OE 1J1EA 2F3ZA 1NCXA 1PRWA 1M46A 2JZIA 4NDBA 2BECA 2LP2A 5DKQA 1L2OB 4A4CA 4AQIA 2WCFA 2LMVA 1IJ6A 2FOTA 2K7DA 1CLLA 5D69A 1RK9A 3O6BA 1UHHA 3OB2B 4F0ZB 4UPGA 2LAPA 2ZKMX 2F2OA 1RTP1 1SYMA 2KYFA 1QX5B 1NYAA 1YR5A 1A29A 1YTZC 1F55A 3D10A 2JXLA 1TNXA 1S6JA 4WQ3A 2MA2A 3CR2A 1Y1UA 4MZJA 4D1EA 1KFUL 3WNXB 3TUYC 3VRRA 2BKHB 1JF0A 1SBJA 1EG4A 3BOWA 2KQ6A 1B7TY 1JBAA 1G33A 2KNEA 1SK6D 4USLA 4MN0A 2WOSA 4JPZB 1RROA 1XFWO 3PATA 4ORAB 2CCMA 1UHIA 1BT6A 1ZUZA 1DJIA 2KBIA 1KQMC 2L51A 2K0JA 2D8NA 3VRQA 2M49B 3BXKA 1LINA 1TNWA 3VROA 1E8AA 4PHMA 3OHMB 4DCKA 2JT8A 3AAJA 4PE0A 4C0JA 2VRGA 2B1UA 4OCIA 1EH2A 1ALVA 2JTTA 1RECA 1CLMA 1QX2A 1QASA 1ZMZA 2O60A 3WHTB 2BCAA 1NX3A 3O4YA 1CDLA 4N5XA 1OQPA 4OV2A 1QJTA 5F6TA 5CPVA 2NCPA 1TTXA 3GK2A 2I7AA 3SJSA 1YRTB 1J7PA 2MLFC 4HSZA 3CLNA 2HF5A 4ZCVA 3TDUA 1AHRA 2M29A 1PVAA 3A4UB 1IRJA 1F54A 1XA5A 3EK8A 2H61C 4TNCA 1S3PA 1TIZA 2HETA 1IKUA 1SCMC 3AKBA 2Y5IA 1S5GY 2CNPA 2ZRTA 4GGFC 5TNCA 3GOFA 1BMOA 4BY4A 4YRUA 1WY9A 2LNKA 3O2PA 1WRLA 3OP0A 4C0LA 2LUXA 4PHJA 1U5IB 1BODA 1DJGA 3KEVA 3QRXA 1CM4A 4ZCUA 3TUYB 3BUMB 1XFYO 1LA0A 1TOPA 3AKAA 4CPVA 3EKJA 2BBNA 1Y1AA 3GK1A 1N65A 1AP4A 1YUUA 4I5KA 5G08A 2JXCA 1PALA 2KI6C 4I5JA 1UHKA 1CKKA 4GGNA 1SL9A 1H4BA 3DVEA 1KFXL 1EG3A 2DOQA 1V1GA 3M0WA 2ZNEA 2GGMA 5I2LA 3PM8A 2K7OA 5K89A 3WXAA 5GQQC 2LV7A 3IQQA 2LMTA 5PALA 1IG5A 5BPJA 3HCMA 2HPSA 4DIRA 2JPTA 5CSFA 2BBMA 1TRFA 4OVNF 2K7CA 2MJWB 2P6BB 5AXIA 1YRUB 3SG3A 1SR6C 1M45A 1PVBA 2KHNA 4XYNA 1J1DA 3I5HC 5J3XA 1A03A 5ER4X 4WRIA 3VGOA 1AUIB 2ZNDA 3CR4X 1QS7A 4PHKA 2TN4A 3SG2A 2K8MB 4GNKB 1VRKA 3ICBA 3IF7A 1M39A 1PSRA 4YGBB 2WCBA 1NSHA 1SL7A 1R2UA 1OOJA 4GBAA 1CFPA 1CDPA 2WNDA 3DF0A 4YI9A 2KSPA 1OMRA 4GPLB 5DKRA 2NXQA 5AANA 3CWGA 2FJUB 2L50A 1S36A 1BU3A 2EHBA 2OPOA 2WORA 4M2PA 3KHEA 1BLQA 2JT3A 2LCPA 2JT0A 1WRZA 1Y0VH 3TDZA 2M97A 3FS7A 2JTZA 1B47A 2KFFA 2JRFA 1KSOA 1K8UA 3BOWB 3BUNB 2H2KA 3EK7A 1QATA 2E30A 1XK4A 1LA3A 2BE6A 2NCOA 3LK1A 1CLBA 1KCYA 1F4OA 3PLFB 1IH0A 3E3RA 4PE1A 5CSJA 2LLTA 2KGBC 5B8IB 3NSKA 1CB1A 2LC5A 1KWOC 4HRGA 1UHJA 5CSNA 5HKWA 5AERA 1B9AA 2AAOA 3CS1A 3NSOA 1H8BA 2KBMA 1MUXA 1ZACA 2JWWA 1QV1A 1DF0A 1YVLA 4QJ3B 1CMGA 4YGCB 1QV0A 1C7VA 1QIVA 3TS5C 1WLZA 2Q91A 1A75B 2F2PA 2MRDA 3PALA 1F71A 2LM5A 1IQ5A 5FYXA 3JVTC 2GV5A 2MHHA 3NSLA 3PN7B 1GQMA 2EC6B 1X02A 1F70A 4NDCA 1WDCC 2KI6D 1SR6B 3A8RA 4JQ0D 3ZWHA 3I5HB 1BR4B 1B8CA 1ALWA 3SG6A 1GGWA 4MRXA 3LL8B 2M1UA 1OMDA 5AEQA 1NIWA 4MZLA 3BUOB 1MR8A 2LP3A 1BF5A 4U8DA 3NXAA 1K2HA 1EL4A 1XK4C 2OTGB 3O78A 4R1EA 1DGUA 1UUSA 1SMGA 2L5XB 1UP5A 2BL0B 1MF8B 3SIBA 3CTNA 1DTLA 1LVCD 1B8RA 1FI6A 3OB1B 2FCDA 3TDIA 1CTRA 4GAOA 5IBWA 4I5NB 1N0YA 1KK7Z 1TNQA 1MXLC 1SNLA 2ZFDA 1K90D 1K9UA 1NWDA 3CGAA 2O5GA 3LLEA 3FIAA 4L9MA 1OSAA 2Y4QA 1GGZA 3RLZA 2M3WA 4PDZA 1HT9A 1RJVA 1KWOB 1J7OA 1KFUS 2LVVA 1B8LA 1BJFA 1AJ5A 2F33A 1JF2A 2CTNA 2MLEC 1AK8A 3AAKA 5HKYA 4PE4A 3NSIA 2G9BA 4E68A 2K2FA 2BKIB 2KFHA 3I5IC 2F3YA 4HRHA 1S6CA 1CNPA 2NLNA 1DJXA 1GJYA 1NP8A 3TS5B 1QTXA 1XVJA 2LLSA 2ZN9A 3LK0A 2F8PA 4CLNA 4ORCB 3DVKA 3IQOA 3JVTB 4MZKA 1CDMA 2AMIA 1FI5A 1B7TZ 1DJYA 1KK8B 2LHIA 4NQGA 4NDDA 5HLVA 2LE9B 3DF0B 1WDCB 2JULA 2CXJA 2OS8C 2L0PA 2ISDA 1TNPA 4PHNA 3CR5X 1DJWA 1MQ1A 1PULA 2Q4UA 1K96A 3PN7C 2EC6C 1IJ5A 2M9GA 1NPQA 3PSRA 3SIAA 2QACA 3EVRA 3BQ3A 2K7BA 5JJGA 1XFUO 4DS7A 1SKTA 2KI4C 4CFRA 1F8HA 1HQVA 1SPYA 1S1EA 1B1GA 1C7WA 3EVUA 1TCFA 2L98A 2KDHA 1TN4A 1J7RA 2JOJA 3EVVA 3FWCA 4JWQA 4QJ5B 2GGZA 2OTGC 1C07A 4Q04A 3D0YA 2HQWA 2BL0C 1A2XA 1DGVA 1NX2A 1DF0B 2L2EA 2LUCA 1JWDA 2LANA 3C1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YX7 A;  1AJ4 A;  1JSA A;  2M7L A;  1PSB A;  3GK4 X;  1NCY A;  1ZFS A;  2JU0 A;  1JFJ A;  3H4S E;  3I5F B;  1CMF A;  1YUS A;  4PAL A;  4HRE E;  4MRY A;  2PRU A;  4MSP A;  1OMV A;  3I5G C;  3VRP A;  3KO0 A;  4WQ2 A;  1KQV A;  3I5I B;  4MBE A;  4XJK A;  3PFV A;  1OZO A;  2SCP A;  2A4J A;  2KQY A;  3MSE B;  2BCB A;  1CFF A;  2LVJ A;  3WHU B;  1IQ3 A;  1KFX S;  2M0R A;  4N1F A;  1YVH A;  1JC2 A;  1EJ3 A;  2BE4 A;  2AUC A;  1MWN A;  1FW4 A;  1IWQ A;  1M63 B;  2Y1M A;  1OE9 B;  1W7I B;  1D1O A;  1J55 A;  4OKH A;  1RFJ A;  2FCE A;  2OS8 B;  2PSR A;  1PK0 D;  1SL8 A;  1QLS A;  1SRA A;  4P2Y B;  1SCV A;  2I18 A;  2JC2 A;  2KGR A;  2KAY A;  2KFG A;  5ER5 A;  4QJ4 B;  1KK8 C;  4AQJ A;  2G2B A;  1CM1 A;  2L4I A;  1WRK A;  4M2Q A;  3OX6 A;  2H61 A;  1K94 A;  2KI4 B;  1NX1 A;  2K2A A;  5D7F A;  2COL B;  2R2I A;  5CSI A;  3VRN A;  1JFK A;  1S6I A;  5JOL A;  4CID A;  3JTD B;  4GGF A;  3KF9 A;  5AFP A;  1SY9 A;  4N1G A;  2E6W A;  5HKZ A;  4A4B A;  2BCX A;  1OZS A;  1QVI Z;  1G8I A;  1Q80 A;  3HX4 A;  2JNF A;  1N2D A;  1LKJ A;  4ICB A;  4MVF A;  3RM1 A;  3CZT X;  1WLM A;  4BY5 A;  2M8U A;  5I8N A;  3DVJ A;  1MHO A;  1XFX O;  3BUW B;  4MEW A;  1K9K A;  2I2R E;  1BR1 B;  1SW8 A;  1QX7 A;  1S26 D;  1TCO B;  4I5L B;  1K9P A;  2CBL A;  1QIW A;  3SG4 A;  1A4P A;  3I5G B;  1RWY A;  1BOC A;  2KOT A;  1DJZ A;  4M2O A;  1DT7 B;  1L7Z A;  4PCW A;  1CFC A;  1NUB A;  2K61 A;  1ODB A;  3FWB A;  2LMU A;  3I5F C;  3SG7 A;  4CFQ A;  2PMY A;  1J7Q A;  1A75 A;  1K93 D;  1CDN A;  2LHL A;  1DMO A;  5I2Q A;  3DVM A;  2EGD A;  4ORB B;  1B4C A;  2M1K B;  1QLK A;  2RGI A;  3BUX B;  1DJH A;  2JNX A;  1M31 A;  1XFV O;  1NX0 A;  1XFZ O;  4YGA A;  4FQO A;  3SG5 A;  5KSZ A;  4IL1 A;  1BG1 A;  2KYC A;  1F4Q A;  1V1F A;  1R6P A;  1FF1 A;  2IS9 A;  5I2O A;  4YI8 A;  4DUQ A;  1L2O C;  1YUR A;  1K95 A;  4OR9 B;  4YGE B;  2ZN8 A;  3BYA A;  4FTG A;  2LVI A;  3D0Y B;  3OX5 A;  5HYD A;  2PAS A;  2KAV A;  1UWO A;  2LVK A;  2SAS A;  2WC8 A;  5KTY A;  1IGV A;  2V53 A;  1YX8 A;  2LLU A;  1KSM A;  1AVS A;  1EXR A;  2PAL A;  5KU1 A;  3F45 A;  4YBH B;  3K21 A;  5DKN A;  2I94 A;  2HQ8 A;  4XJK B;  4DRW A;  1UHN A;  3EK4 A;  1Y1X A;  3LCP C;  4YGD B;  1KQM B;  2M7N A;  3JTD C;  2PVB A;  5HLO A;  2QPT A;  3KPX A;  2CT9 A;  1ZOT B;  2ZRS A;  3DD4 A;  1NCZ A;  4C0K A;  2NZ0 A;  1QXP A;  1U5I A;  3TZ1 A;  4GUK A;  1Y6W A;  4ETO A;  2MAZ A;  2KAX A;  2WCE A;  1XO5 A;  1UUR A;  3EKH A;  1S5G Z;  1LXF C;  1DVI A;  2JQ6 A;  1YUT A;  1XYD A;  1JUO A;  1G4Y R;  1FBV A;  1QVI Y;  2L4H A;  4GFT A;  1W7J B;  2Y1N A;  1MXE A;  4MLW A;  1FPW A;  3ZNI A;  4PE7 A;  1CFD A;  2MBX A;  4AOM A;  1KK7 Y;  1SCM B;  4P5O E;  1J1E A;  2F3Z A;  1NCX A;  1PRW A;  1M46 A;  2JZI A;  4NDB A;  2BEC A;  2LP2 A;  5DKQ A;  1L2O B;  4A4C A;  4AQI A;  2WCF A;  2LMV A;  1IJ6 A;  2FOT A;  2K7D A;  1CLL A;  5D69 A;  1RK9 A;  3O6B A;  1UHH A;  3OB2 B;  4F0Z B;  4UPG A;  2LAP A;  2ZKM X;  2F2O A;  1RTP 1;  1SYM A;  2KYF A;  1QX5 B;  1NYA A;  1YR5 A;  1A29 A;  1YTZ C;  1F55 A;  3D10 A;  2JXL A;  1TNX A;  1S6J A;  4WQ3 A;  2MA2 A;  3CR2 A;  1Y1U A;  4MZJ A;  4D1E A;  1KFU L;  3WNX B;  3TUY C;  3VRR A;  2BKH B;  1JF0 A;  1SBJ A;  1EG4 A;  3BOW A;  2KQ6 A;  1B7T Y;  1JBA A;  1G33 A;  2KNE A;  1SK6 D;  4USL A;  4MN0 A;  2WOS A;  4JPZ B;  1RRO A;  1XFW O;  3PAT A;  4ORA B;  2CCM A;  1UHI A;  1BT6 A;  1ZUZ A;  1DJI A;  2KBI A;  1KQM C;  2L51 A;  2K0J A;  2D8N A;  3VRQ A;  2M49 B;  3BXK A;  1LIN A;  1TNW A;  3VRO A;  1E8A A;  4PHM A;  3OHM B;  4DCK A;  2JT8 A;  3AAJ A;  4PE0 A;  4C0J A;  2VRG A;  2B1U A;  4OCI A;  1EH2 A;  1ALV A;  2JTT A;  1REC A;  1CLM A;  1QX2 A;  1QAS A;  1ZMZ A;  2O60 A;  3WHT B;  2BCA A;  1NX3 A;  3O4Y A;  1CDL A;  4N5X A;  1OQP A;  4OV2 A;  1QJT A;  5F6T A;  5CPV A;  2NCP A;  1TTX A;  3GK2 A;  2I7A A;  3SJS A;  1YRT B;  1J7P A;  2MLF C;  4HSZ A;  3CLN A;  2HF5 A;  4ZCV A;  3TDU A;  1AHR A;  2M29 A;  1PVA A;  3A4U B;  1IRJ A;  1F54 A;  1XA5 A;  3EK8 A;  2H61 C;  4TNC A;  1S3P A;  1TIZ A;  2HET A;  1IKU A;  1SCM C;  3AKB A;  2Y5I A;  1S5G Y;  2CNP A;  2ZRT A;  4GGF C;  5TNC A;  3GOF A;  1BMO A;  4BY4 A;  4YRU A;  1WY9 A;  2LNK A;  3O2P A;  1WRL A;  3OP0 A;  4C0L A;  2LUX A;  4PHJ A;  1U5I B;  1BOD A;  1DJG A;  3KEV A;  3QRX A;  1CM4 A;  4ZCU A;  3TUY B;  3BUM B;  1XFY O;  1LA0 A;  1TOP A;  3AKA A;  4CPV A;  3EKJ A;  2BBN A;  1Y1A A;  3GK1 A;  1N65 A;  1AP4 A;  1YUU A;  4I5K A;  5G08 A;  2JXC A;  1PAL A;  2KI6 C;  4I5J A;  1UHK A;  1CKK A;  4GGN A;  1SL9 A;  1H4B A;  3DVE A;  1KFX L;  1EG3 A;  2DOQ A;  1V1G A;  3M0W A;  2ZNE A;  2GGM A;  5I2L A;  3PM8 A;  2K7O A;  5K89 A;  3WXA A;  5GQQ C;  2LV7 A;  3IQQ A;  2LMT A;  5PAL A;  1IG5 A;  5BPJ A;  3HCM A;  2HPS A;  4DIR A;  2JPT A;  5CSF A;  2BBM A;  1TRF A;  4OVN F;  2K7C A;  2MJW B;  2P6B B;  5AXI A;  1YRU B;  3SG3 A;  1SR6 C;  1M45 A;  1PVB A;  2KHN A;  4XYN A;  1J1D A;  3I5H C;  5J3X A;  1A03 A;  5ER4 X;  4WRI A;  3VGO A;  1AUI B;  2ZND A;  3CR4 X;  1QS7 A;  4PHK A;  2TN4 A;  3SG2 A;  2K8M B;  4GNK B;  1VRK A;  3ICB A;  3IF7 A;  1M39 A;  1PSR A;  4YGB B;  2WCB A;  1NSH A;  1SL7 A;  1R2U A;  1OOJ A;  4GBA A;  1CFP A;  1CDP A;  2WND A;  3DF0 A;  4YI9 A;  2KSP A;  1OMR A;  4GPL B;  5DKR A;  2NXQ A;  5AAN A;  3CWG A;  2FJU B;  2L50 A;  1S36 A;  1BU3 A;  2EHB A;  2OPO A;  2WOR A;  4M2P A;  3KHE A;  1BLQ A;  2JT3 A;  2LCP A;  2JT0 A;  1WRZ A;  1Y0V H;  3TDZ A;  2M97 A;  3FS7 A;  2JTZ A;  1B47 A;  2KFF A;  2JRF A;  1KSO A;  1K8U A;  3BOW B;  3BUN B;  2H2K A;  3EK7 A;  1QAT A;  2E30 A;  1XK4 A;  1LA3 A;  2BE6 A;  2NCO A;  3LK1 A;  1CLB A;  1KCY A;  1F4O A;  3PLF B;  1IH0 A;  3E3R A;  4PE1 A;  5CSJ A;  2LLT A;  2KGB C;  5B8I B;  3NSK A;  1CB1 A;  2LC5 A;  1KWO C;  4HRG A;  1UHJ A;  5CSN A;  5HKW A;  5AER A;  1B9A A;  2AAO A;  3CS1 A;  3NSO A;  1H8B A;  2KBM A;  1MUX A;  1ZAC A;  2JWW A;  1QV1 A;  1DF0 A;  1YVL A;  4QJ3 B;  1CMG A;  4YGC B;  1QV0 A;  1C7V A;  1QIV A;  3TS5 C;  1WLZ A;  2Q91 A;  1A75 B;  2F2P A;  2MRD A;  3PAL A;  1F71 A;  2LM5 A;  1IQ5 A;  5FYX A;  3JVT C;  2GV5 A;  2MHH A;  3NSL A;  3PN7 B;  1GQM A;  2EC6 B;  1X02 A;  1F70 A;  4NDC A;  1WDC C;  2KI6 D;  1SR6 B;  3A8R A;  4JQ0 D;  3ZWH A;  3I5H B;  1BR4 B;  1B8C A;  1ALW A;  3SG6 A;  1GGW A;  4MRX A;  3LL8 B;  2M1U A;  1OMD A;  5AEQ A;  1NIW A;  4MZL A;  3BUO B;  1MR8 A;  2LP3 A;  1BF5 A;  4U8D A;  3NXA A;  1K2H A;  1EL4 A;  1XK4 C;  2OTG B;  3O78 A;  4R1E A;  1DGU A;  1UUS A;  1SMG A;  2L5X B;  1UP5 A;  2BL0 B;  1MF8 B;  3SIB A;  3CTN A;  1DTL A;  1LVC D;  1B8R A;  1FI6 A;  3OB1 B;  2FCD A;  3TDI A;  1CTR A;  4GAO A;  5IBW A;  4I5N B;  1N0Y A;  1KK7 Z;  1TNQ A;  1MXL C;  1SNL A;  2ZFD A;  1K90 D;  1K9U A;  1NWD A;  3CGA A;  2O5G A;  3LLE A;  3FIA A;  4L9M A;  1OSA A;  2Y4Q A;  1GGZ A;  3RLZ A;  2M3W A;  4PDZ A;  1HT9 A;  1RJV A;  1KWO B;  1J7O A;  1KFU S;  2LVV A;  1B8L A;  1BJF A;  1AJ5 A;  2F33 A;  1JF2 A;  2CTN A;  2MLE C;  1AK8 A;  3AAK A;  5HKY A;  4PE4 A;  3NSI A;  2G9B A;  4E68 A;  2K2F A;  2BKI B;  2KFH A;  3I5I C;  2F3Y A;  4HRH A;  1S6C A;  1CNP A;  2NLN A;  1DJX A;  1GJY A;  1NP8 A;  3TS5 B;  1QTX A;  1XVJ A;  2LLS A;  2ZN9 A;  3LK0 A;  2F8P A;  4CLN A;  4ORC B;  3DVK A;  3IQO A;  3JVT B;  4MZK A;  1CDM A;  2AMI A;  1FI5 A;  1B7T Z;  1DJY A;  1KK8 B;  2LHI A;  4NQG A;  4NDD A;  5HLV A;  2LE9 B;  3DF0 B;  1WDC B;  2JUL A;  2CXJ A;  2OS8 C;  2L0P A;  2ISD A;  1TNP A;  4PHN A;  3CR5 X;  1DJW A;  1MQ1 A;  1PUL A;  2Q4U A;  1K96 A;  3PN7 C;  2EC6 C;  1IJ5 A;  2M9G A;  1NPQ A;  3PSR A;  3SIA A;  2QAC A;  3EVR A;  3BQ3 A;  2K7B A;  5JJG A;  1XFU O;  4DS7 A;  1SKT A;  2KI4 C;  4CFR A;  1F8H A;  1HQV A;  1SPY A;  1S1E A;  1B1G A;  1C7W A;  3EVU A;  1TCF A;  2L98 A;  2KDH A;  1TN4 A;  1J7R A;  2JOJ A;  3EVV A;  3FWC A;  4JWQ A;  4QJ5 B;  2GGZ A;  2OTG C;  1C07 A;  4Q04 A;  3D0Y A;  2HQW A;  2BL0 C;  1A2X A;  1DGV A;  1NX2 A;  1DF0 B;  2L2E A;  2LUC A;  1JWD A;  2LAN A;  3C1V A; 
#chains in the Genus database with same CATH topology
 1YX7 A;  1AJ4 A;  1JSA A;  2M7L A;  1PSB A;  3GK4 X;  1NCY A;  1ZFS A;  2JU0 A;  1JFJ A;  3H4S E;  3I5F B;  1CMF A;  1YUS A;  3L4L A;  4PAL A;  4HRE E;  4MRY A;  2PRU A;  4MSP A;  1OMV A;  3I5G C;  3VRP A;  2L5Y A;  3KO0 A;  4WQ2 A;  3S0A A;  1KQV A;  3I5I B;  4MBE A;  4XJK A;  3PFV A;  1OZO A;  2SCP A;  2WCM A;  2A4J A;  2KQY A;  3MSE B;  4PT1 A;  2BCB A;  1CFF A;  2LVJ A;  3WHU B;  1IQ3 A;  1KFX S;  2M0R A;  3DXL A;  1YVH A;  4N1F A;  1JC2 A;  1EJ3 A;  2BE4 A;  2AUC A;  1MWN A;  5EL2 A;  1FW4 A;  1IWQ A;  1M63 B;  2Y1M A;  1OE9 B;  1W7I B;  1D1O A;  1J55 A;  4OKH A;  1RFJ A;  2FCE A;  2OS8 B;  1C3Z A;  2QDI A;  2PSR A;  3UNW A;  1PK0 D;  1SL8 A;  1QLS A;  1ORG A;  3NHT A;  1SRA A;  4P2Y B;  1SCV A;  2I18 A;  2JC2 A;  2KGR A;  1Z4H A;  2KAY A;  2KFG A;  5ER5 A;  4QJ4 B;  1KK8 C;  1T14 A;  4AQJ A;  2G2B A;  1CM1 A;  2L4I A;  1WRK A;  4M2Q A;  3OX6 A;  3BFB A;  2H61 A;  1K94 A;  2KI4 B;  3R1P A;  1NX1 A;  2K2A A;  5D7F A;  1TWO A;  2COL B;  2R2I A;  5CSI A;  3VRN A;  4OZD A;  1JFK A;  1S6I A;  5JOL A;  4CID A;  3JTD B;  4GGF A;  3KF9 A;  5AFP A;  1SY9 A;  4N1G A;  2E6W A;  5HKZ A;  4A4B A;  2BCX A;  1OZS A;  1QVI Z;  3DYE A;  1G8I A;  1Q80 A;  3HX4 A;  2JNF A;  1N2D A;  1LS8 A;  1LKJ A;  4ICB A;  4MVF A;  3RM1 A;  3CZT X;  3DZT A;  1WLM A;  4BY5 A;  2M8U A;  5I8N A;  3DVJ A;  1MHO A;  1XFX O;  3BUW B;  4MEW A;  1K9K A;  2I2R E;  1BR1 B;  1SW8 A;  1QX7 A;  1S26 D;  3B86 A;  1TCO B;  4I5L B;  1K9P A;  2JPO A;  2CBL A;  1QIW A;  3SG4 A;  1A4P A;  4JKT A;  3I5G B;  3CZ0 A;  1RWY A;  1BOC A;  2KOT A;  1DJZ A;  5HL1 A;  4M2O A;  1DT7 B;  1L7Z A;  4PCW A;  1CFC A;  1NUB A;  2K61 A;  1ODB A;  3FWB A;  2LMU A;  3I5F C;  3OBV A;  3SG7 A;  4CFQ A;  2PMY A;  2WC5 A;  1J7Q A;  1A75 A;  1K93 D;  1CDN A;  2LHL A;  1DMO A;  5I2Q A;  3DVM A;  2EGD A;  4ORB B;  1B4C A;  2M1K B;  1QLK A;  2RGI A;  3BUX B;  1DJH A;  2JNX A;  1M31 A;  1XFV O;  1NX0 A;  1XFZ O;  4YGA A;  4FQO A;  3SG5 A;  5KSZ A;  4IL1 A;  1BG1 A;  3D75 A;  2KYC A;  1GM0 A;  1F4Q A;  1V1F A;  1R6P A;  1FF1 A;  2IS9 A;  5I2O A;  4YI8 A;  4DUQ A;  1L2O C;  1YUR A;  3EG5 B;  3DY9 A;  1K95 A;  1OOG A;  4OR9 B;  2ZN8 A;  3BYA A;  4FTG A;  4YGE B;  3CDN A;  2LVI A;  3D0Y B;  3OX5 A;  5HYD A;  3B87 A;  2PAS A;  2PYQ A;  2KAV A;  1UWO A;  2LVK A;  2SAS A;  2WC8 A;  5KTY A;  1IGV A;  2V53 A;  1YX8 A;  3UO9 A;  2LLU A;  1KSM A;  1AVS A;  1EXR A;  2PAL A;  5KU1 A;  3F45 A;  4YBH B;  3K21 A;  3N7H A;  5DKN A;  2I94 A;  2HQ8 A;  4KYN A;  4XJK B;  3R1O A;  1UHN A;  2PQL A;  3EK4 A;  4DRW A;  1Y1X A;  3LCP C;  4YGD B;  1KQM B;  2M7N A;  3JTD C;  2K60 A;  1TUZ A;  2PVB A;  5HLO A;  2QPT A;  3KPX A;  2CT9 A;  1ZOT B;  2ZRS A;  3DD4 A;  1C3Y A;  1NCZ A;  4C0K A;  2NZ0 A;  1QXP A;  1U5I A;  3D77 A;  3TZ1 A;  3D73 A;  3NHI A;  4GUK A;  1Y6W A;  4ETO A;  2MAZ A;  2KAX A;  2WCE A;  1XO5 A;  1UUR A;  3EKH A;  1S5G Z;  1LXF C;  1DVI A;  2JQ6 A;  1YUT A;  1XYD A;  1JUO A;  1G4Y R;  1FBV A;  1QVI Y;  2L4H A;  4GFT A;  5FI6 A;  1W7J B;  2Y1N A;  1MXE A;  4MLW A;  1FPW A;  3ZNI A;  2QEB A;  2KLD A;  4PE7 A;  1CFD A;  2MBX A;  4AOM A;  1KK7 Y;  1SCM B;  4P5O E;  1J1E A;  2F3Z A;  1NCX A;  1PRW A;  1M46 A;  2JZI A;  4NDB A;  2BEC A;  2LP2 A;  5DKQ A;  1L2O B;  4A4C A;  4AQI A;  1Z2C B;  2WCF A;  2LMV A;  1IJ6 A;  2FOT A;  2P71 A;  1SSE B;  2K7D A;  1CLL A;  5D69 A;  1RK9 A;  3O6B A;  1UHH A;  3OB2 B;  3QME A;  4F0Z B;  4UPG A;  2LAP A;  2ZKM X;  3CYZ A;  2F2O A;  1RTP 1;  5D3O A;  1SYM A;  2KYF A;  1QX5 B;  1NYA A;  1YR5 A;  1A29 A;  1YTZ C;  1F55 A;  3D10 A;  2JXL A;  1TNX A;  1S6J A;  4WQ3 A;  2MA2 A;  3CR2 A;  1Y1U A;  4MZJ A;  4D1E A;  5I94 A;  1KFU L;  3WNX B;  3TUY C;  3VRR A;  3B6X A;  2BKH B;  1OW4 A;  1JF0 A;  1SBJ A;  1EG4 A;  3BOW A;  2KQ6 A;  1B7T Y;  1JBA A;  2QEH A;  1G33 A;  2KNE A;  1SK6 D;  4USL A;  4MN0 A;  2WOS A;  4JPZ B;  1RRO A;  1XFW O;  3PAT A;  4ORA B;  2CCM A;  1UHI A;  1BT6 A;  1ZUZ A;  1DJI A;  2KBI A;  1KQM C;  2L51 A;  3K1E A;  2K0J A;  2D8N A;  3VRQ A;  2M49 B;  3BXK A;  1LIN A;  1TNW A;  3VRO A;  3B88 A;  1E8A A;  4PHM A;  3OHM B;  4DCK A;  2JT8 A;  3AAJ A;  4PE0 A;  4C0J A;  2VRG A;  2B1U A;  4OCI A;  1EH2 A;  1ALV A;  2JTT A;  1REC A;  1CLM A;  1QX2 A;  1QAS A;  1ZMZ A;  2O60 A;  3WHT B;  2WCL A;  2BCA A;  1NX3 A;  3O4Y A;  1CDL A;  4FQT A;  1OQP A;  4N5X A;  4OV2 A;  3S0B A;  1QJT A;  5F6T A;  5CPV A;  3D74 A;  2NCP A;  1TTX A;  3GK2 A;  2I7A A;  3OGN A;  1YRT B;  3SJS A;  3SS4 A;  1J7P A;  2MLF C;  1DEL A;  3CLN A;  2HF5 A;  4HSZ A;  3L4A A;  4ZCV A;  2BAP A;  3TDU A;  1AHR A;  2M29 A;  1PVA A;  3A4U B;  1IRJ A;  1F54 A;  1XA5 A;  3EK8 A;  2H61 C;  4TNC A;  1S3P A;  1TIZ A;  2HET A;  1IKU A;  1SCM C;  3AKB A;  2Y5I A;  1S5G Y;  2ERB A;  2CNP A;  2WCK A;  2ZRT A;  4GGF C;  1CFP A;  5TNC A;  3GOF A;  1BMO A;  1DQE A;  3S0D A;  4BY4 A;  4YRU A;  1WY9 A;  2LNK A;  3O2P A;  1WRL A;  3OP0 A;  4C0L A;  2LUX A;  4PHJ A;  1U5I B;  1BOD A;  1DJG A;  3KEV A;  3QRX A;  1CM4 A;  3PJI A;  4ZCU A;  3TUY B;  3BUM B;  1XFY O;  1LA0 A;  3CZ2 A;  1TOP A;  3AKA A;  3NGV A;  4CPV A;  3EKJ A;  2BBN A;  1DEK A;  1Y1A A;  1N65 A;  3GK1 A;  1AP4 A;  1YUU A;  4I5K A;  5G08 A;  2JXC A;  1PAL A;  2KI6 C;  4I5J A;  1UHK A;  2GTE A;  4GGN A;  1CKK A;  3CAB A;  3S0G A;  1SL9 A;  1H4B A;  3DVE A;  1KFX L;  1EG3 A;  2DOQ A;  1V1G A;  2WCJ A;  3FE8 A;  2ZNE A;  3M0W A;  1DC1 A;  2GGM A;  5I2L A;  3PM8 A;  4F7F A;  2K7O A;  3IVT A;  1P28 A;  5K89 A;  3O4X A;  3WXA A;  5GQQ C;  3PM2 A;  1W9Z A;  2LV7 A;  2QEV A;  2LMT A;  3IQQ A;  1IG5 A;  5PAL A;  5BPJ A;  3HCM A;  2HPS A;  4DIR A;  2JPT A;  5CSF A;  2BBM A;  1TRF A;  4OVN F;  2K7C A;  2MJW B;  2P6B B;  5AXI A;  1YRU B;  3SG3 A;  1SR6 C;  1M45 A;  3VB1 A;  1PVB A;  2KHN A;  3Q8I A;  4XYN A;  1J1D A;  3I5H C;  5J3X A;  1A03 A;  5ER4 X;  4WRI A;  3VGO A;  1AUI B;  2ZND A;  3CR4 X;  1QS7 A;  4PHK A;  2TN4 A;  3SG2 A;  2K8M B;  4GNK B;  1VRK A;  3ICB A;  3IF7 A;  1M39 A;  1PSR A;  4YGB B;  2WCB A;  1NSH A;  1SL7 A;  4INW A;  1R2U A;  1OOJ A;  4GBA A;  1OOH A;  1CDP A;  2WND A;  3DF0 A;  4YI9 A;  2KSP A;  1OMR A;  4GPL B;  5DKR A;  2NXQ A;  5AAN A;  3CWG A;  2FJU B;  2L50 A;  1S36 A;  1BU3 A;  2EHB A;  2OPO A;  2WOR A;  3FE9 A;  4M2P A;  3KHE A;  5FI2 A;  1BLQ A;  2JT3 A;  2LCP A;  2JT0 A;  1WRZ A;  1Y0V H;  2KLE A;  3TDZ A;  1XFR A;  2M97 A;  3FS7 A;  1IIO A;  2BNX A;  2JTZ A;  1B47 A;  2KFF A;  2JRF A;  1KSO A;  1K8U A;  3BOW B;  3BJH A;  3BUN B;  2H2K A;  3EK7 A;  1QAT A;  2E30 A;  1XK4 A;  1LA3 A;  2BE6 A;  2NCO A;  3LK1 A;  1CLB A;  1KCY A;  1F4O A;  1OOI X;  3PLF B;  1IH0 A;  3E3R A;  4PE1 A;  5CSJ A;  2LLT A;  2KGB C;  5B8I B;  3NSK A;  1CB1 A;  2LC5 A;  1KWO C;  4HRG A;  1UHJ A;  5CSN A;  5HKW A;  5AER A;  1B9A A;  2AAO A;  3CS1 A;  3BFH A;  3NSO A;  1H8B A;  2KBM A;  3RZS A;  1MUX A;  5FI7 A;  1ZAC A;  2JWW A;  1QV1 A;  1DF0 A;  1YVL A;  4QJ3 B;  1CMG A;  4YGC B;  1QV0 A;  1C7V A;  1QIV A;  3TS5 C;  1WLZ A;  2Q91 A;  1A75 B;  2F2P A;  2MRD A;  2WCH A;  3PAL A;  2LM5 A;  1F71 A;  3B7A A;  1IQ5 A;  5FYX A;  3JVT C;  2GV5 A;  2MHH A;  3NSL A;  3PN7 B;  1GQM A;  2EC6 B;  1X02 A;  1F70 A;  4NDC A;  1WDC C;  3SS5 A;  2KI6 D;  1SR6 B;  3A8R A;  4JQ0 D;  3ZWH A;  3I5H B;  1BR4 B;  1B8C A;  1ALW A;  3SG6 A;  1GGW A;  4MRX A;  1QWV A;  3LL8 B;  2M1U A;  5DIC A;  1OMD A;  5AEQ A;  1NIW A;  4MZL A;  3BUO B;  1MR8 A;  2LP3 A;  4INX A;  1BF5 A;  4U8D A;  3NXA A;  3S0F A;  1K2H A;  1EL4 A;  1XK4 C;  2OTG B;  3O78 A;  4R1E A;  1DGU A;  1UUS A;  1SMG A;  2L5X B;  1UP5 A;  2BL0 B;  2WC6 A;  1MF8 B;  3SIB A;  3CTN A;  1DTL A;  1LVC D;  1B8R A;  1FI6 A;  2L2C A;  2FCD A;  3OB1 B;  3TDI A;  1CTR A;  4GAO A;  5IBW A;  4I5N B;  3V2L A;  1N0Y A;  1KK7 Z;  1TNQ A;  1MXL C;  3D76 A;  1SNL A;  2ZFD A;  1K90 D;  1K9U A;  1NWD A;  2QEO A;  2O5G A;  3CGA A;  3FIA A;  3LLE A;  1OSA A;  4L9M A;  2Y4Q A;  3L47 A;  1GGZ A;  3RLZ A;  2M3W A;  4PDZ A;  1HT9 A;  1RJV A;  1KWO B;  1J7O A;  1KFU S;  2LVV A;  1B8L A;  1BJF A;  1AJ5 A;  2F33 A;  1JF2 A;  2CTN A;  2MLE C;  1AK8 A;  3AAK A;  5HKY A;  3CZ1 A;  4PE4 A;  3NSI A;  2G9B A;  4E68 A;  2K2F A;  2BKI B;  2KFH A;  3I5I C;  2F3Y A;  4HRH A;  1S6C A;  4IJ7 A;  1CNP A;  2NLN A;  1DJX A;  1GJY A;  1NP8 A;  1OOF A;  3TS5 B;  3R72 A;  2YGU A;  1QTX A;  1XVJ A;  2LLS A;  2ZN9 A;  3LK0 A;  2F8P A;  4JD9 A;  4CLN A;  4ORC B;  3DVK A;  3IQO A;  3BFA A;  3JVT B;  4MZK A;  1CDM A;  2AMI A;  1FI5 A;  1TUJ A;  1B7T Z;  1DJY A;  1KK8 B;  2LHI A;  4NQG A;  4NDD A;  5HLV A;  2LE9 B;  3DF0 B;  1WDC B;  3SS3 A;  2JUL A;  2CXJ A;  2OS8 C;  2L0P A;  2ISD A;  1TNP A;  4PHN A;  3CR5 X;  1DJW A;  1MQ1 A;  1PUL A;  2Q4U A;  1K96 A;  3PN7 C;  2EC6 C;  1IJ5 A;  2M9G A;  1NPQ A;  3PSR A;  3SIA A;  2FJY A;  2QAC A;  3EVR A;  3BQ3 A;  2K7B A;  2P70 A;  5JJG A;  1XFU O;  4DS7 A;  1SKT A;  2KI4 C;  4CFR A;  2H8V A;  1F8H A;  1HQV A;  1SPY A;  1S1E A;  3FE6 A;  1B1G A;  1C7W A;  3EVU A;  3D78 A;  1TCF A;  2L98 A;  2KDH A;  2KPH A;  1TN4 A;  1J7R A;  2JOJ A;  3EVV A;  3FWC A;  4JWQ A;  4QJ5 B;  2GGZ A;  2OTG C;  1C07 A;  4Q04 A;  3D0Y A;  2HQW A;  3S0E A;  2BL0 C;  1A2X A;  1DGV A;  1NX2 A;  1DF0 B;  2L2E A;  2LUC A;  3R1V A;  1JWD A;  2LAN A;  3C1V A; 
#chains in the Genus database with same CATH homology
 1YX7 A;  1AJ4 A;  1JSA A;  2M7L A;  1PSB A;  3GK4 X;  1NCY A;  1ZFS A;  2JU0 A;  1JFJ A;  3H4S E;  3I5F B;  1CMF A;  1YUS A;  4PAL A;  4HRE E;  4MRY A;  2PRU A;  4MSP A;  1OMV A;  3I5G C;  3VRP A;  3KO0 A;  4WQ2 A;  1KQV A;  3I5I B;  4MBE A;  4XJK A;  3PFV A;  1OZO A;  2SCP A;  2A4J A;  2KQY A;  3MSE B;  2BCB A;  1CFF A;  2LVJ A;  3WHU B;  1IQ3 A;  1KFX S;  2M0R A;  4N1F A;  1YVH A;  1JC2 A;  1EJ3 A;  2BE4 A;  2AUC A;  1MWN A;  1FW4 A;  1IWQ A;  1M63 B;  2Y1M A;  1OE9 B;  1W7I B;  1D1O A;  1J55 A;  4OKH A;  1RFJ A;  2FCE A;  2OS8 B;  2PSR A;  1PK0 D;  1SL8 A;  1QLS A;  1SRA A;  4P2Y B;  1SCV A;  2I18 A;  2JC2 A;  2KGR A;  2KAY A;  2KFG A;  5ER5 A;  4QJ4 B;  1KK8 C;  4AQJ A;  2G2B A;  1CM1 A;  2L4I A;  1WRK A;  4M2Q A;  3OX6 A;  2H61 A;  1K94 A;  2KI4 B;  1NX1 A;  2K2A A;  5D7F A;  2COL B;  2R2I A;  5CSI A;  3VRN A;  1JFK A;  1S6I A;  5JOL A;  4CID A;  3JTD B;  4GGF A;  3KF9 A;  5AFP A;  1SY9 A;  4N1G A;  2E6W A;  5HKZ A;  4A4B A;  2BCX A;  1OZS A;  1QVI Z;  1G8I A;  1Q80 A;  3HX4 A;  2JNF A;  1N2D A;  1LKJ A;  4ICB A;  4MVF A;  3RM1 A;  3CZT X;  1WLM A;  4BY5 A;  2M8U A;  5I8N A;  3DVJ A;  1MHO A;  1XFX O;  3BUW B;  4MEW A;  1K9K A;  2I2R E;  1BR1 B;  1SW8 A;  1QX7 A;  1S26 D;  1TCO B;  4I5L B;  1K9P A;  2CBL A;  1QIW A;  3SG4 A;  1A4P A;  3I5G B;  1RWY A;  1BOC A;  2KOT A;  1DJZ A;  4M2O A;  1DT7 B;  1L7Z A;  4PCW A;  1CFC A;  1NUB A;  2K61 A;  1ODB A;  3FWB A;  2LMU A;  3I5F C;  3SG7 A;  4CFQ A;  2PMY A;  1J7Q A;  1A75 A;  1K93 D;  1CDN A;  2LHL A;  1DMO A;  5I2Q A;  3DVM A;  2EGD A;  4ORB B;  1B4C A;  2M1K B;  1QLK A;  2RGI A;  3BUX B;  1DJH A;  2JNX A;  1M31 A;  1XFV O;  1NX0 A;  1XFZ O;  4YGA A;  4FQO A;  3SG5 A;  5KSZ A;  4IL1 A;  1BG1 A;  2KYC A;  1F4Q A;  1V1F A;  1R6P A;  1FF1 A;  2IS9 A;  5I2O A;  4YI8 A;  4DUQ A;  1L2O C;  1YUR A;  1K95 A;  4OR9 B;  4YGE B;  2ZN8 A;  3BYA A;  4FTG A;  2LVI A;  3D0Y B;  3OX5 A;  5HYD A;  2PAS A;  2KAV A;  1UWO A;  2LVK A;  2SAS A;  2WC8 A;  5KTY A;  1IGV A;  2V53 A;  1YX8 A;  2LLU A;  1KSM A;  1AVS A;  1EXR A;  2PAL A;  5KU1 A;  3F45 A;  4YBH B;  3K21 A;  5DKN A;  2I94 A;  2HQ8 A;  4XJK B;  4DRW A;  1UHN A;  3EK4 A;  1Y1X A;  3LCP C;  4YGD B;  1KQM B;  2M7N A;  3JTD C;  2PVB A;  5HLO A;  2QPT A;  3KPX A;  2CT9 A;  1ZOT B;  2ZRS A;  3DD4 A;  1NCZ A;  4C0K A;  2NZ0 A;  1QXP A;  1U5I A;  3TZ1 A;  4GUK A;  1Y6W A;  4ETO A;  2MAZ A;  2KAX A;  2WCE A;  1XO5 A;  1UUR A;  3EKH A;  1S5G Z;  1LXF C;  1DVI A;  2JQ6 A;  1YUT A;  1XYD A;  1JUO A;  1G4Y R;  1FBV A;  1QVI Y;  2L4H A;  4GFT A;  1W7J B;  2Y1N A;  1MXE A;  4MLW A;  1FPW A;  3ZNI A;  4PE7 A;  1CFD A;  2MBX A;  4AOM A;  1KK7 Y;  1SCM B;  4P5O E;  1J1E A;  2F3Z A;  1NCX A;  1PRW A;  1M46 A;  2JZI A;  4NDB A;  2BEC A;  2LP2 A;  5DKQ A;  1L2O B;  4A4C A;  4AQI A;  2WCF A;  2LMV A;  1IJ6 A;  2FOT A;  2K7D A;  1CLL A;  5D69 A;  1RK9 A;  3O6B A;  1UHH A;  3OB2 B;  4F0Z B;  4UPG A;  2LAP A;  2ZKM X;  2F2O A;  1RTP 1;  1SYM A;  2KYF A;  1QX5 B;  1NYA A;  1YR5 A;  1A29 A;  1YTZ C;  1F55 A;  3D10 A;  2JXL A;  1TNX A;  1S6J A;  4WQ3 A;  2MA2 A;  3CR2 A;  1Y1U A;  4MZJ A;  4D1E A;  1KFU L;  3WNX B;  3TUY C;  3VRR A;  2BKH B;  1JF0 A;  1SBJ A;  1EG4 A;  3BOW A;  2KQ6 A;  1B7T Y;  1JBA A;  1G33 A;  2KNE A;  1SK6 D;  4USL A;  4MN0 A;  2WOS A;  4JPZ B;  1RRO A;  1XFW O;  3PAT A;  4ORA B;  2CCM A;  1UHI A;  1BT6 A;  1ZUZ A;  1DJI A;  2KBI A;  1KQM C;  2L51 A;  2K0J A;  2D8N A;  3VRQ A;  2M49 B;  3BXK A;  1LIN A;  1TNW A;  3VRO A;  1E8A A;  4PHM A;  3OHM B;  4DCK A;  2JT8 A;  3AAJ A;  4PE0 A;  4C0J A;  2VRG A;  2B1U A;  4OCI A;  1EH2 A;  1ALV A;  2JTT A;  1REC A;  1CLM A;  1QX2 A;  1QAS A;  1ZMZ A;  2O60 A;  3WHT B;  2BCA A;  1NX3 A;  3O4Y A;  1CDL A;  4N5X A;  1OQP A;  4OV2 A;  1QJT A;  5F6T A;  5CPV A;  2NCP A;  1TTX A;  3GK2 A;  2I7A A;  3SJS A;  1YRT B;  1J7P A;  2MLF C;  4HSZ A;  3CLN A;  2HF5 A;  4ZCV A;  3TDU A;  1AHR A;  2M29 A;  1PVA A;  3A4U B;  1IRJ A;  1F54 A;  1XA5 A;  3EK8 A;  2H61 C;  4TNC A;  1S3P A;  1TIZ A;  2HET A;  1IKU A;  1SCM C;  3AKB A;  2Y5I A;  1S5G Y;  2CNP A;  2ZRT A;  4GGF C;  5TNC A;  3GOF A;  1BMO A;  4BY4 A;  4YRU A;  1WY9 A;  2LNK A;  3O2P A;  1WRL A;  3OP0 A;  4C0L A;  2LUX A;  4PHJ A;  1U5I B;  1BOD A;  1DJG A;  3KEV A;  3QRX A;  1CM4 A;  4ZCU A;  3TUY B;  3BUM B;  1XFY O;  1LA0 A;  1TOP A;  3AKA A;  4CPV A;  3EKJ A;  2BBN A;  1Y1A A;  3GK1 A;  1N65 A;  1AP4 A;  1YUU A;  4I5K A;  5G08 A;  2JXC A;  1PAL A;  2KI6 C;  4I5J A;  1UHK A;  1CKK A;  4GGN A;  1SL9 A;  1H4B A;  3DVE A;  1KFX L;  1EG3 A;  2DOQ A;  1V1G A;  3M0W A;  2ZNE A;  2GGM A;  5I2L A;  3PM8 A;  2K7O A;  5K89 A;  3WXA A;  5GQQ C;  2LV7 A;  3IQQ A;  2LMT A;  5PAL A;  1IG5 A;  5BPJ A;  3HCM A;  2HPS A;  4DIR A;  2JPT A;  5CSF A;  2BBM A;  1TRF A;  4OVN F;  2K7C A;  2MJW B;  2P6B B;  5AXI A;  1YRU B;  3SG3 A;  1SR6 C;  1M45 A;  1PVB A;  2KHN A;  4XYN A;  1J1D A;  3I5H C;  5J3X A;  1A03 A;  5ER4 X;  4WRI A;  3VGO A;  1AUI B;  2ZND A;  3CR4 X;  1QS7 A;  4PHK A;  2TN4 A;  3SG2 A;  2K8M B;  4GNK B;  1VRK A;  3ICB A;  3IF7 A;  1M39 A;  1PSR A;  4YGB B;  2WCB A;  1NSH A;  1SL7 A;  1R2U A;  1OOJ A;  4GBA A;  1CFP A;  1CDP A;  2WND A;  3DF0 A;  4YI9 A;  2KSP A;  1OMR A;  4GPL B;  5DKR A;  2NXQ A;  5AAN A;  3CWG A;  2FJU B;  2L50 A;  1S36 A;  1BU3 A;  2EHB A;  2OPO A;  2WOR A;  4M2P A;  3KHE A;  1BLQ A;  2JT3 A;  2LCP A;  2JT0 A;  1WRZ A;  1Y0V H;  3TDZ A;  2M97 A;  3FS7 A;  2JTZ A;  1B47 A;  2KFF A;  2JRF A;  1KSO A;  1K8U A;  3BOW B;  3BUN B;  2H2K A;  3EK7 A;  1QAT A;  2E30 A;  1XK4 A;  1LA3 A;  2BE6 A;  2NCO A;  3LK1 A;  1CLB A;  1KCY A;  1F4O A;  3PLF B;  1IH0 A;  3E3R A;  4PE1 A;  5CSJ A;  2LLT A;  2KGB C;  5B8I B;  3NSK A;  1CB1 A;  2LC5 A;  1KWO C;  4HRG A;  1UHJ A;  5CSN A;  5HKW A;  5AER A;  1B9A A;  2AAO A;  3CS1 A;  3NSO A;  1H8B A;  2KBM A;  1MUX A;  1ZAC A;  2JWW A;  1QV1 A;  1DF0 A;  1YVL A;  4QJ3 B;  1CMG A;  4YGC B;  1QV0 A;  1C7V A;  1QIV A;  3TS5 C;  1WLZ A;  2Q91 A;  1A75 B;  2F2P A;  2MRD A;  3PAL A;  1F71 A;  2LM5 A;  1IQ5 A;  5FYX A;  3JVT C;  2GV5 A;  2MHH A;  3NSL A;  3PN7 B;  1GQM A;  2EC6 B;  1X02 A;  1F70 A;  4NDC A;  1WDC C;  2KI6 D;  1SR6 B;  3A8R A;  4JQ0 D;  3ZWH A;  3I5H B;  1BR4 B;  1B8C A;  1ALW A;  3SG6 A;  1GGW A;  4MRX A;  3LL8 B;  2M1U A;  1OMD A;  5AEQ A;  1NIW A;  4MZL A;  3BUO B;  1MR8 A;  2LP3 A;  1BF5 A;  4U8D A;  3NXA A;  1K2H A;  1EL4 A;  1XK4 C;  2OTG B;  3O78 A;  4R1E A;  1DGU A;  1UUS A;  1SMG A;  2L5X B;  1UP5 A;  2BL0 B;  1MF8 B;  3SIB A;  3CTN A;  1DTL A;  1LVC D;  1B8R A;  1FI6 A;  3OB1 B;  2FCD A;  3TDI A;  1CTR A;  4GAO A;  5IBW A;  4I5N B;  1N0Y A;  1KK7 Z;  1TNQ A;  1MXL C;  1SNL A;  2ZFD A;  1K90 D;  1K9U A;  1NWD A;  3CGA A;  2O5G A;  3LLE A;  3FIA A;  4L9M A;  1OSA A;  2Y4Q A;  1GGZ A;  3RLZ A;  2M3W A;  4PDZ A;  1HT9 A;  1RJV A;  1KWO B;  1J7O A;  1KFU S;  2LVV A;  1B8L A;  1BJF A;  1AJ5 A;  2F33 A;  1JF2 A;  2CTN A;  2MLE C;  1AK8 A;  3AAK A;  5HKY A;  4PE4 A;  3NSI A;  2G9B A;  4E68 A;  2K2F A;  2BKI B;  2KFH A;  3I5I C;  2F3Y A;  4HRH A;  1S6C A;  1CNP A;  2NLN A;  1DJX A;  1GJY A;  1NP8 A;  3TS5 B;  1QTX A;  1XVJ A;  2LLS A;  2ZN9 A;  3LK0 A;  2F8P A;  4CLN A;  4ORC B;  3DVK A;  3IQO A;  3JVT B;  4MZK A;  1CDM A;  2AMI A;  1FI5 A;  1B7T Z;  1DJY A;  1KK8 B;  2LHI A;  4NQG A;  4NDD A;  5HLV A;  2LE9 B;  3DF0 B;  1WDC B;  2JUL A;  2CXJ A;  2OS8 C;  2L0P A;  2ISD A;  1TNP A;  4PHN A;  3CR5 X;  1DJW A;  1MQ1 A;  1PUL A;  2Q4U A;  1K96 A;  3PN7 C;  2EC6 C;  1IJ5 A;  2M9G A;  1NPQ A;  3PSR A;  3SIA A;  2QAC A;  3EVR A;  3BQ3 A;  2K7B A;  5JJG A;  1XFU O;  4DS7 A;  1SKT A;  2KI4 C;  4CFR A;  1F8H A;  1HQV A;  1SPY A;  1S1E A;  1B1G A;  1C7W A;  3EVU A;  1TCF A;  2L98 A;  2KDH A;  1TN4 A;  1J7R A;  2JOJ A;  3EVV A;  3FWC A;  4JWQ A;  4QJ5 B;  2GGZ A;  2OTG C;  1C07 A;  4Q04 A;  3D0Y A;  2HQW A;  2BL0 C;  1A2X A;  1DGV A;  1NX2 A;  1DF0 B;  2L2E A;  2LUC A;  1JWD A;  2LAN A;  3C1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...