1XFUO

Crystal structure of anthrax edema factor (ef) truncation mutant, ef-delta 64 in complex with calmodulin
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
146
structure length
146
Chain Sequence
QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDQMIREADIDGDGQVNYEEFVQMMTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin-sensitive adenylate cyclase
publication title Calcium-independent calmodulin binding and two-metal-ion catalytic mechanism of anthrax edema factor.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Lyase/metal binding protein
total genus 32
structure length 146
sequence length 146
chains with identical sequence P, Q, R, S, T
ec nomenclature
pdb deposition date 2004-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xfuO02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xfuO01
2L0PA 3BOWA 1K95A 4I5LB 2ZN8A 1MHOA 1QV0A 2BBNA 2JC2A 2MRDA 1IG5A 3O6BA 4GPLB 1KSOA 1YUUA 4F0ZB 3VRPA 5AXIA 2LLUA 3SG5A 2WORA 3KO0A 2CTNA 1CDPA 2NLNA 5CPVA 4MRXA 1YRUB 1WLZA 4USLA 3WHTB 3OP0A 1KWOB 1RROA 1Y0VH 2KI6C 4PDZA 1KFXL 4PE1A 1CDNA 1UURA 2KAVA 1YUSA 4AOMA 4CPVA 3FWCA 2KI4B 1SCMC 1IGVA 2FCEA 2JT0A 1B1GA 1J7PA 3I5IB 3NSLA 1DF0A 4M2OA 2PASA 1CDLA 1YR5A 4OVNF 2LP3A 5HKZA 3GOFA 4N5XA 5B8IB 4GAOA 4ICBA 4GNKB 2EHBA 1MWNA 1U5IA 1QLKA 2PVBA 3WHUB 1XVJA 2OS8B 4TNCA 1F70A 2LM5A 3SIAA 2BCAA 1A2XA 3OHMB 5I8NA 3ZWHA 2KQYA 1CFFA 2PALA 1SY9A 1M45A 3H4SE 3MSEB 1F8HA 1S36A 2LUCA 1IKUA 2O5GA 3JVTC 3NSKA 1DTLA 1PSBA 1QX5B 3I5FB 1NCXA 1CKKA 2KI4C 3PATA 1CM1A 1XFZO 2H2KA 3I5IC 1SR6B 1M46A 1JFKA 2LE9B 1XFWO 2K8MB 5AANA 1CFCA 1C07A 1DMOA 1B8LA 2OS8C 4P5OE 1KK8B 2A4JA 3EKHA 1BU3A 1EG4A 5FYXA 1QIVA 2IS9A 2SCPA 2F2PA 2WOSA 5D69A 1OZSA 4DS7A 1SW8A 1YVHA 3HCMA 3WXAA 5HYDA 4BY5A 1PULA 1PRWA 2JULA 1TOPA 3I5FC 1GJYA 4QJ5B 2D8NA 2K2FA 2F33A 2LCPA 1SR6C 2G2BA 3PSRA 1YVLA 1NCYA 2GGZA 4NDCA 1MQ1A 1CNPA 4PHKA 4DCKA 1BLQA 2BE4A 4PHNA 4YBHB 3PM8A 2P6BB 4PCWA 1GGZA 3I5GB 3LCPC 3GK1A 1KK8C 2Y1NA 4NQGA 2AUCA 1UWOA 2LV7A 2WC8A 4I5JA 1CMGA 3LK1A 1SL9A 3TUYB 1HQVA 2BKIB 2MHHA 4JPZB 3BUMB 2PMYA 2ZNEA 3PFVA 2LLSA 1H8BA 1E8AA 1KCYA 4I5KA 2K7DA 2HQ8A 1XK4A 3BXKA 3BUWB 3OX6A 4MZJA 1AVSA 3SJSA 1DJIA 2BL0B 2JXCA 3BUOB 4UPGA 5I2QA 1SL7A 1ALVA 2KAXA 4ORCB 1CLMA 2EC6B 4HRHA 3EK7A 4C0JA 2Y4QA 4XJKA 1WLMA 2H61C 2MA2A 3ZNIA 1K96A 3SG4A 3LK0A 1V1GA 2JZIA 1NP8A 1S3PA 1B8CA 1TNQA 1WDCB 2KNEA 4A4CA 2CBLA 3OB2B 3BUXB 1TCFA 2PSRA 4GBAA 2K7OA 2WCFA 2LMUA 1AUIB 1XFXO 1UHKA 1EXRA 1QXPA 1S6CA 1WY9A 1XO5A 2I94A 3EVVA 3TDIA 1DGUA 4ETOA 2RGIA 1B8RA 2BL0C 2KHNA 3K21A 2BCXA 1PK0D 3BQ3A 4PE0A 2M0RA 3GK4X 3CR4X 4PHJA 2E30A 3VGOA 1ZUZA 2ZN9A 3SG2A 1JWDA 1PVBA 3I5HB 1RJVA 2M7NA 1CFDA 2FJUB 1BOCA 1WDCC 1F4QA 2JTZA 1QLSA 2NXQA 1MR8A 2KFFA 4MEWA 1K2HA 1IWQA 1UHNA 1QVIY 1QTXA 1DJZA 1A75A 1JBAA 1ALWA 1XYDA 3A8RA 3IQOA 1FPWA 1SBJA 4WRIA 1B9AA 4GGFA 1NIWA 3GK2A 4NDDA 5K89A 1WRLA 4WQ3A 3O2PA 3EK4A 2M9GA 4Q04A 1JUOA 1DT7B 2JRFA 4MN0A 1FI6A 1G33A 1SKTA 3D0YA 3I5HC 1LA3A 1S5GY 1K94A 2I2RE 3AAJA 3CGAA 2COLB 4MBEA 2HQWA 3DVKA 3D10A 2LC5A 2AMIA 1EL4A 1QVIZ 2K0JA 1OZOA 2BBMA 2JWWA 1OMRA 1RK9A 1Y1XA 2F8PA 1BF5A 1IRJA 1KK7Y 1KWOC 2BCBA 4N1FA 1YURA 2WCEA 2OPOA 3LL8B 3CS1A 4DIRA 3CLNA 1SYMA 1CM4A 3NSIA 5AERA 5D7FA 4XYNA 1TNPA 2KYFA 2VRGA 1S5GZ 1W7JB 2E6WA 2LMTA 5KSZA 1DJHA 2FOTA 2KGBC 2LVVA 2M1KB 4FQOA 4DUQA 4C0LA 1UHIA 3KPXA 4OKHA 3LLEA 5JOLA 2ZNDA 1LA0A 1BT6A 3EK8A 4MZLA 1CLBA 1NX2A 1KK7Z 2L5XB 1BR4B 1ZOTB 2JU0A 2JT3A 2CT9A 4PE7A 1SPYA 3VRRA 5IBWA 1AJ5A 1NX3A 4CIDA 1H4BA 2L2EA 1NWDA 3JTDB 5PALA 5G08A 4ZCUA 5J3XA 1TTXA 1OE9B 3TDUA 1M63B 3DVJA 1A03A 2Y1MA 3BOWB 4CFQA 4C0KA 1NPQA 2BKHB 4ZCVA 3DVMA 2M49B 4OCIA 3KF9A 1A4PA 4IL1A 4YGBB 1YRTB 1AJ4A 4JWQA 2K2AA 2QPTA 3CZTX 1DJWA 1QX2A 2KBIA 3VRQA 1TCOB 2I7AA 1ZACA 2QACA 2ISDA 3JTDC 5I2OA 2Q91A 2EGDA 1S26D 3AAKA 1PSRA 1CLLA 2K61A 2R2IA 2JXLA 4GFTA 1G8IA 4I5NB 1DF0B 2LLTA 1NX1A 1M31A 5JJGA 3OX5A 1J7OA 3PALA 1GGWA 1KFXS 2KOTA 1L2OB 1QATA 4PALA 5CSJA 3SG3A 1TNXA 2ZRTA 1PVAA 3I5GC 1R2UA 2KBMA 1U5IB 3O78A 1SK6D 1UUSA 2Y5IA 4GGNA 5F6TA 3HX4A 3KHEA 1K90D 3TUYC 2O60A 1X02A 2F3YA 4YGEB 4MSPA 1QIWA 2LAPA 4QJ4B 1RECA 3AKAA 2MAZA 3SIBA 3TZ1A 1B7TY 4CFRA 2NCPA 4YGCB 2EC6C 5GQQC 4HSZA 1JF0A 1DJGA 1BR1B 2CNPA 1DVIA 2ZRSA 1SNLA 5KU1A 1JFJA 1L7ZA 2DOQA 1L2OC 1MF8B 2L98A 4YI9A 4HREE 2SASA 3EVRA 4DRWA 1AK8A 1JSAA 2LP2A 1K8UA 1J1EA 2NZ0A 5ER5A 4OV2A 4D1EA 3NSOA 2OTGB 3CWGA 4L9MA 1AHRA 3RLZA 1NUBA 4P2YB 3SG7A 1IJ5A 1B7TZ 3NXAA 5I2LA 2LVKA 1TIZA 3DF0B 1VRKA 2LVIA 1M39A 1SCVA 1Y1UA 4ORBB 2PRUA 1EJ3A 2CCMA 2H61A 1DJYA 3CR2A 1BG1A 2G9BA 4N1GA 2M7LA 5AFPA 4AQIA 2MJWB 1LXFC 4GUKA 1BMOA 3ICBA 1J55A 1HT9A 1F54A 1LVCD 4MZKA 2JQ6A 2HF5A 4YGAA 2OTGC 3TDZA 2F3ZA 1CTRA 4YI8A 3BUNB 1CFPA 5DKRA 5HLOA 1NX0A 2LUXA 1ZFSA 3JVTB 1QS7A 1SL8A 5CSFA 1K9KA 1QASA 3VROA 1KFUS 2KAYA 1NCZA 3E3RA 1RTP1 1KSMA 1CMFA 1A29A 2LHIA 1ZMZA 4U8DA 2LVJA 1IQ3A 1WRKA 3BYAA 2CXJA 1NSHA 2JTTA 3IQQA 1K93D 2HPSA 4PHMA 4XJKB 3CTNA 2L50A 3O4YA 1UHHA 3FS7A 4QJ3B 3TS5B 2ZKMX 4R1EA 2L51A 1YUTA 2JNXA 2JPTA 2M1UA 1MUXA 1V1FA 1G4YR 2M97A 5DKQA 1IQ5A 5HLVA 2M8UA 4WQ2A 3VRNA 2KGRA 1IH0A 5CSIA 2MBXA 2M3WA 1FBVA 1S1EA 2GGMA 3QRXA 1SRAA 1XK4C 1FI5A 5TNCA 1MXLC 1F55A 1BODA 2KFHA 2B1UA 3RM1A 1PALA 1TNWA 1DJXA 3OB1B 4E68A 1UP5A 1K9UA 2M29A 3F45A 3TS5C 1UHJA 1C7WA 1KQMB 5AEQA 2K7CA 1NYAA 2JT8A 3PN7B 2AAOA 3IF7A 3EKJA 3M0WA 1F71A 2KDHA 1OMVA 3EVUA 1EG3A 3FIAA 5KTYA 2MLFC 2HETA 3WNXB 2L4HA 3DF0A 1FW4A 1RFJA 2BECA 4OR9B 1A75B 4FTGA 4YRUA 5HKYA 1R6PA 4A4BA 1LINA 1QX7A 1OOJA 2WCBA 2GV5A 4M2PA 4ORAB 1Q80A 1N2DA 1DGVA 3CR5X 1C7VA 3DVEA 2KYCA 5ER4X 1N65A 1QJTA 1XFUO 3FWBA 5HKWA 3D0YB 1F4OA 1GQMA 1KFUL 1KQMC 2L4IA 3PN7C 1B47A 2WNDA 4PE4A 1FF1A 1LKJA 1B4CA 2ZFDA 2KSPA 4NDBA 2F2OA 2TN4A 1KQVA 4M2QA 1XFVO 1D1OA 2MLEC 2K7BA 2JNFA 5CSNA 1Y1AA 1OMDA 1S6JA 1XFYO 1CB1A 1W7IB 1MXEA 5DKNA 3KEVA 3PLFB 1N0YA 1SMGA 4GGFC 1S6IA 4JQ0D 2KFGA 2JOJA 3AKBA 3A4UB 2Q4UA 3SG6A 1TN4A 2FCDA 1XA5A 1JC2A 1J1DA 1YX7A 1BJFA 4BY4A 1J7QA 1J7RA 1OSAA 1RWYA 1YTZC 1TRFA 1ODBA 2V53A 2I18A 1AP4A 1EH2A 2LHLA 4HRGA 1QV1A 1YX8A 2KI6D 4AQJA 1IJ6A 2LMVA 4MRYA 2LNKA 3DD4A 1JF2A 2NCOA 1CDMA 4CLNA 1Y6WA 2LANA 4MVFA 3C1VA 4MLWA 4YGDB 1SCMB 2BE6A 1WRZA 1OQPA 1K9PA 5BPJA 2KQ6A
chains in the Genus database with same CATH superfamily
2L0PA 3BOWA 1K95A 3PM2A 4I5LB 2ZN8A 1MHOA 1QV0A 2KLDA 2WC5A 2BBNA 2JC2A 2MRDA 1IG5A 3O6BA 4GPLB 1KSOA 1YUUA 4F0ZB 3VRPA 5AXIA 2LLUA 3SG5A 3CZ0A 2WORA 3KO0A 2CTNA 1CDPA 2NLNA 5CPVA 4MRXA 1YRUB 1WLZA 4USLA 3WHTB 3OP0A 1KWOB 1RROA 1Y0VH 2KI6C 4PDZA 1KFXL 4PE1A 3UNWA 1UURA 2KAVA 3S0AA 1CDNA 1YUSA 4AOMA 4CPVA 3FWCA 2KI4B 1SCMC 1IGVA 2FCEA 2JT0A 3OGNA 1B1GA 3I5IB 3NSLA 1DF0A 4M2OA 1J7PA 2PASA 1CDLA 1YR5A 3DXLA 2LP3A 4OVNF 5HKZA 3GOFA 4N5XA 5B8IB 4GAOA 4ICBA 4GNKB 2EHBA 1U5IA 1MWNA 1QLKA 1OOFA 2PVBA 3WHUB 4INWA 1XVJA 2OS8B 4KYNA 3R1OA 4TNCA 1F70A 2LM5A 4INXA 3QMEA 3SIAA 2BCAA 1A2XA 3OHMB 5CSFA 5I8NA 3ZWHA 2KQYA 3FE8A 1CFFA 2PALA 1SY9A 3O4XA 1M45A 3H4SE 3MSEB 1F8HA 1S36A 2LUCA 1IKUA 2O5GA 2QEOA 3JVTC 3NSKA 1DTLA 1PSBA 1QX5B 3I5FB 1NCXA 1CKKA 2BNXA 2KI4C 1CM1A 1XFZO 2WCKA 3PATA 5HL1A 2H2KA 1Z4HA 3I5IC 1SR6B 1M46A 1JFKA 2LE9B 1XFWO 2K8MB 5AANA 3SS3A 1CFCA 1C07A 1DMOA 1B8LA 2OS8C 4P5OE 1KK8B 2A4JA 1OW4A 1BU3A 3EKHA 1EG4A 5FYXA 1QIVA 2IS9A 2SCPA 2F2PA 2WOSA 5D69A 1OZSA 4DS7A 1SW8A 3BFAA 1YVHA 3HCMA 3WXAA 5HYDA 4BY5A 1PULA 1PRWA 2JULA 1TOPA 3I5FC 1GJYA 4JKTA 4QJ5B 2D8NA 2K2FA 2F33A 2LCPA 3B7AA 3D78A 1SR6C 2G2BA 3DYEA 1YVLA 3PSRA 1NCYA 2GGZA 4NDCA 1MQ1A 3IVTA 2WC6A 1CNPA 4PHKA 3NHIA 4DCKA 1BLQA 2BE4A 4PHNA 3VB1A 4YBHB 3PM8A 2P6BB 4PCWA 1GGZA 3I5GB 3LCPC 3GK1A 3S0BA 1KK8C 2Y1NA 4NQGA 2AUCA 1UWOA 2LV7A 2WC8A 4I5JA 1CMGA 3LK1A 1SL9A 3TUYB 3B6XA 1HQVA 2BKIB 2MHHA 3L4AA 4JPZB 3BUMB 2PMYA 2ZNEA 3PFVA 2LLSA 1H8BA 1E8AA 2L5YA 1KCYA 1TUJA 2K7DA 2HQ8A 1XK4A 3BJHA 3BUWB 2K60A 3BXKA 1QWVA 1AVSA 3OX6A 4MZJA 1DJIA 2BL0B 2JXCA 3BUOB 3SJSA 4UPGA 1SL7A 5I2QA 4PT1A 1ALVA 2KAXA 4ORCB 1CLMA 2EC6B 4HRHA 3EK7A 3PJIA 4C0JA 2Y4QA 4XJKA 1WLMA 2H61C 2MA2A 3ZNIA 1K96A 3SG4A 3LK0A 1V1GA 2JZIA 1NP8A 1S3PA 3K1EA 1B8CA 1TNQA 1WDCB 2KNEA 4A4CA 2CBLA 3OB2B 3BUXB 1TCFA 1DQEA 2PSRA 4GBAA 2K7OA 2WCFA 2LMUA 1AUIB 1XFXO 1DC1A 1UHKA 2KPHA 1EXRA 1QXPA 1S6CA 1WY9A 1XO5A 2I94A 3EVVA 3TDIA 1DGUA 4ETOA 2RGIA 1B8RA 2BL0C 2KHNA 3K21A 2BCXA 1PK0D 3BQ3A 4PE0A 2M0RA 3GK4X 3CR4X 4JD9A 4PHJA 2E30A 3VGOA 3R1VA 1ZUZA 2ZN9A 4FQTA 3SG2A 1PVBA 3I5HB 3SS5A 1JWDA 1OOHA 1RJVA 2M7NA 1CFDA 2FJUB 1BOCA 1WDCC 1F4QA 3D76A 2JTZA 1QLSA 4IJ7A 2NXQA 1MR8A 2KFFA 3NHTA 4MEWA 1K2HA 1IWQA 1UHNA 1QVIY 1QTXA 1DJZA 1A75A 3S0GA 1ALWA 1XYDA 3A8RA 3B87A 3S0FA 1JBAA 3IQOA 1FPWA 1SBJA 1SSEB 4WRIA 1B9AA 4GGFA 1NIWA 3GK2A 1TWOA 4NDDA 1WRLA 4WQ3A 5K89A 3O2PA 3EK4A 2M9GA 4Q04A 1JUOA 1DT7B 2JRFA 4MN0A 1FI6A 1G33A 1SKTA 2ERBA 3D0YA 3I5HC 1LA3A 1S5GY 1K94A 2I2RE 3AAJA 3CGAA 2COLB 4MBEA 2HQWA 3DVKA 4I5KA 3D10A 2LC5A 2AMIA 2P70A 1EL4A 5I94A 1QVIZ 2K0JA 1OOGA 1OOIX 1OZOA 2BBMA 2JWWA 2P71A 1OMRA 1RK9A 1Y1XA 2F8PA 1BF5A 1IRJA 1KK7Y 1KWOC 2BCBA 4N1FA 1YURA 2WCEA 2OPOA 3LL8B 3CS1A 4DIRA 3CLNA 1SYMA 1CM4A 3NSIA 5AERA 5D7FA 4XYNA 1TNPA 2KYFA 3CYZA 2VRGA 1S5GZ 1W7JB 2E6WA 2LMTA 3CABA 5KSZA 1DJHA 2FOTA 2KGBC 2LVVA 2M1KB 4FQOA 1GM0A 4DUQA 4C0LA 1UHIA 3KPXA 4OKHA 3LLEA 5JOLA 2ZNDA 1LA0A 1BT6A 3EK8A 4MZLA 2JPOA 1CLBA 1NX2A 1KK7Z 2L5XB 3R1PA 1BR4B 1ZOTB 2JU0A 2JT3A 2CT9A 4PE7A 1SPYA 3VRRA 3DY9A 5IBWA 1AJ5A 5FI7A 1NX3A 4CIDA 3Q8IA 1IIOA 1H4BA 2L2EA 2WCMA 1NWDA 3JTDB 5PALA 5G08A 4ZCUA 2FJYA 5J3XA 1TTXA 1OE9B 3TDUA 1M63B 3DVJA 3D75A 1A03A 2Y1MA 3BOWB 4CFQA 4C0KA 2QEVA 1NPQA 2BKHB 4ZCVA 1XFRA 3DVMA 5BPJA 2M49B 4OCIA 3KF9A 4OZDA 1A4PA 3N7HA 4IL1A 4YGBB 1YRTB 1AJ4A 4JWQA 2K2AA 2QPTA 3CZTX 1DJWA 3CDNA 1QX2A 2KBIA 2KLEA 3VRQA 1TCOB 2I7AA 1ZACA 2QACA 2ISDA 3JTDC 5I2OA 2Q91A 2EGDA 1S26D 3AAKA 1PSRA 1CLLA 2K61A 2R2IA 2JXLA 4GFTA 1G8IA 4I5NB 1DF0B 2LLTA 1NX1A 1M31A 5JJGA 3OX5A 1J7OA 3PALA 3EG5B 1GGWA 1KFXS 2KOTA 1L2OB 1QATA 4PALA 5CSJA 3SG3A 1TNXA 2ZRTA 1PVAA 3I5GC 1DELA 1R2UA 2KBMA 1U5IB 3O78A 1SK6D 1UUSA 2Y5IA 4GGNA 5F6TA 3HX4A 3KHEA 3B86A 1K90D 3TUYC 2O60A 1X02A 5EL2A 2F3YA 4YGEB 4MSPA 1QIWA 2LAPA 4QJ4B 1RECA 3AKAA 2MAZA 3SIBA 3TZ1A 1B7TY 4CFRA 3L4LA 2NCPA 4YGCB 2EC6C 3DZTA 5GQQC 4HSZA 1JF0A 1DJGA 1BR1B 1DVIA 2CNPA 2ZRSA 1SNLA 5KU1A 1JFJA 1L7ZA 2BAPA 2DOQA 1L2OC 1MF8B 2L98A 4YI9A 3FE9A 3SS4A 4HREE 1P28A 2SASA 3EVRA 4DRWA 1AK8A 3OBVA 1JSAA 2LP2A 1K8UA 1J1EA 2NZ0A 3D73A 4OV2A 5ER5A 3NSOA 4D1EA 2OTGB 3CWGA 4L9MA 1AHRA 3RLZA 1NUBA 3CZ1A 4P2YB 1IJ5A 1B7TZ 3SG7A 3NXAA 5I2LA 2LVKA 1TIZA 3DF0B 1VRKA 2LVIA 1M39A 1T14A 1SCVA 1Y1UA 4ORBB 2PRUA 1EJ3A 2CCMA 2H61A 1DJYA 3CR2A 1BG1A 2G9BA 4N1GA 2M7LA 5AFPA 4AQIA 2MJWB 1LXFC 4GUKA 1BMOA 1DEKA 1J55A 1C3ZA 1HT9A 3B88A 3ICBA 1F54A 1LVCD 4MZKA 2JQ6A 2HF5A 4YGAA 2OTGC 3TDZA 2F3ZA 1CTRA 3D74A 3BUNB 4YI8A 1CFPA 5DKRA 5HLOA 1NX0A 2LUXA 1ZFSA 3BFHA 1QS7A 1SL8A 3JVTB 1K9KA 1QASA 1Z2CB 3VROA 1KFUS 2KAYA 1NCZA 2WCJA 3E3RA 1RTP1 1KSMA 1CMFA 1A29A 3FE6A 2LHIA 3S0DA 1ZMZA 4U8DA 2LVJA 1IQ3A 4F7FA 1WRKA 3BYAA 2CXJA 1NSHA 2JTTA 3IQQA 1K93D 1LS8A 2HPSA 4PHMA 4XJKB 3CTNA 2L50A 3O4YA 1UHHA 3FS7A 4QJ3B 3TS5B 2ZKMX 3CZ2A 1TUZA 2QEHA 4R1EA 2L51A 1YUTA 2JNXA 2JPTA 2M1UA 1MUXA 1V1FA 1G4YR 2M97A 5DKQA 1IQ5A 3UO9A 5HLVA 2M8UA 4WQ2A 3VRNA 2KGRA 1IH0A 5CSIA 2MBXA 2M3WA 1FBVA 1S1EA 2GGMA 3QRXA 1SRAA 1XK4C 1W9ZA 5FI6A 1FI5A 2QEBA 1MXLC 5TNCA 2L2CA 1F55A 1BODA 2KFHA 2B1UA 3RM1A 1PALA 1TNWA 1DJXA 3OB1B 4E68A 1UP5A 1K9UA 2M29A 3F45A 3TS5C 1UHJA 1C7WA 1KQMB 5AEQA 2K7CA 1NYAA 2JT8A 3PN7B 2AAOA 3IF7A 3EKJA 3S0EA 3M0WA 1F71A 2KDHA 1OMVA 3EVUA 1EG3A 3FIAA 5KTYA 2MLFC 2HETA 3WNXB 2L4HA 3DF0A 1FW4A 1RFJA 2BECA 4OR9B 1A75B 4FTGA 4YRUA 5HKYA 1R6PA 2WCHA 4A4BA 1LINA 1QX7A 1OOJA 2WCBA 2GV5A 4M2PA 4ORAB 1Q80A 1N2DA 1DGVA 3CR5X 1C7VA 5D3OA 3DVEA 2KYCA 5ER4X 1N65A 1QJTA 1XFUO 3FWBA 5HKWA 2QDIA 3D0YB 1F4OA 1GQMA 1KFUL 1KQMC 2L4IA 3PN7C 1B47A 2WNDA 4PE4A 1FF1A 1LKJA 1B4CA 2ZFDA 2KSPA 4NDBA 2F2OA 2TN4A 1KQVA 4M2QA 1XFVO 2YGUA 1D1OA 2MLEC 2K7BA 2JNFA 5CSNA 1Y1AA 1OMDA 1S6JA 1XFYO 1CB1A 1W7IB 1MXEA 5DKNA 3KEVA 3PLFB 1N0YA 1SMGA 4GGFC 1S6IA 4JQ0D 2KFGA 2JOJA 3AKBA 3A4UB 2Q4UA 3SG6A 1TN4A 3BFBA 2FCDA 1XA5A 1JC2A 1J1DA 1YX7A 1BJFA 4BY4A 1J7QA 1J7RA 1OSAA 3D77A 1RWYA 1ORGA 1YTZC 2GTEA 1TRFA 1ODBA 3L47A 2V53A 2I18A 1AP4A 1EH2A 2LHLA 4HRGA 1QV1A 1YX8A 2KI6D 4AQJA 1IJ6A 2LMVA 2PYQA 4MRYA 3R72A 2LNKA 3DD4A 1JF2A 2NCOA 1CDMA 4CLNA 3RZSA 1Y6WA 2LANA 5FI2A 4MVFA 3C1VA 2PQLA 4MLWA 4YGDB 3V2LA 1SCMB 2BE6A 3NGVA 2WCLA 1WRZA 1OQPA 1K9PA 2H8VA 1C3YA 5DICA 2KQ6A
chains in the Genus database with same CATH topology
2L0PA 3BOWA 1K95A 4I5LB 2ZN8A 1MHOA 1QV0A 2BBNA 2JC2A 2MRDA 1IG5A 3O6BA 4GPLB 1KSOA 1YUUA 4F0ZB 3VRPA 5AXIA 2LLUA 3SG5A 2WORA 3KO0A 2CTNA 1CDPA 2NLNA 5CPVA 4MRXA 1YRUB 1WLZA 4USLA 3WHTB 3OP0A 1KWOB 1RROA 1Y0VH 2KI6C 4PDZA 1KFXL 4PE1A 1CDNA 1UURA 2KAVA 1YUSA 4AOMA 4CPVA 3FWCA 2KI4B 1SCMC 1IGVA 2FCEA 2JT0A 1B1GA 1J7PA 3I5IB 3NSLA 1DF0A 4M2OA 2PASA 1CDLA 1YR5A 4OVNF 2LP3A 5HKZA 3GOFA 4N5XA 5B8IB 4GAOA 4ICBA 4GNKB 2EHBA 1MWNA 1U5IA 1QLKA 2PVBA 3WHUB 1XVJA 2OS8B 4TNCA 1F70A 2LM5A 3SIAA 2BCAA 1A2XA 3OHMB 5I8NA 3ZWHA 2KQYA 1CFFA 2PALA 1SY9A 1M45A 3H4SE 3MSEB 1F8HA 1S36A 2LUCA 1IKUA 2O5GA 3JVTC 3NSKA 1DTLA 1PSBA 1QX5B 3I5FB 1NCXA 1CKKA 2KI4C 3PATA 1CM1A 1XFZO 2H2KA 3I5IC 1SR6B 1M46A 1JFKA 2LE9B 1XFWO 2K8MB 5AANA 1CFCA 1C07A 1DMOA 1B8LA 2OS8C 4P5OE 1KK8B 2A4JA 3EKHA 1BU3A 1EG4A 5FYXA 1QIVA 2IS9A 2SCPA 2F2PA 2WOSA 5D69A 1OZSA 4DS7A 1SW8A 1YVHA 3HCMA 3WXAA 5HYDA 4BY5A 1PULA 1PRWA 2JULA 1TOPA 3I5FC 1GJYA 4QJ5B 2D8NA 2K2FA 2F33A 2LCPA 1SR6C 2G2BA 3PSRA 1YVLA 1NCYA 2GGZA 4NDCA 1MQ1A 1CNPA 4PHKA 4DCKA 1BLQA 2BE4A 4PHNA 4YBHB 3PM8A 2P6BB 4PCWA 1GGZA 3I5GB 3LCPC 3GK1A 1KK8C 2Y1NA 4NQGA 2AUCA 1UWOA 2LV7A 2WC8A 4I5JA 1CMGA 3LK1A 1SL9A 3TUYB 1HQVA 2BKIB 2MHHA 4JPZB 3BUMB 2PMYA 2ZNEA 3PFVA 2LLSA 1H8BA 1E8AA 1KCYA 4I5KA 2K7DA 2HQ8A 1XK4A 3BXKA 3BUWB 3OX6A 4MZJA 1AVSA 3SJSA 1DJIA 2BL0B 2JXCA 3BUOB 4UPGA 5I2QA 1SL7A 1ALVA 2KAXA 4ORCB 1CLMA 2EC6B 4HRHA 3EK7A 4C0JA 2Y4QA 4XJKA 1WLMA 2H61C 2MA2A 3ZNIA 1K96A 3SG4A 3LK0A 1V1GA 2JZIA 1NP8A 1S3PA 1B8CA 1TNQA 1WDCB 2KNEA 4A4CA 2CBLA 3OB2B 3BUXB 1TCFA 2PSRA 4GBAA 2K7OA 2WCFA 2LMUA 1AUIB 1XFXO 1UHKA 1EXRA 1QXPA 1S6CA 1WY9A 1XO5A 2I94A 3EVVA 3TDIA 1DGUA 4ETOA 2RGIA 1B8RA 2BL0C 2KHNA 3K21A 2BCXA 1PK0D 3BQ3A 4PE0A 2M0RA 3GK4X 3CR4X 4PHJA 2E30A 3VGOA 1ZUZA 2ZN9A 3SG2A 1JWDA 1PVBA 3I5HB 1RJVA 2M7NA 1CFDA 2FJUB 1BOCA 1WDCC 1F4QA 2JTZA 1QLSA 2NXQA 1MR8A 2KFFA 4MEWA 1K2HA 1IWQA 1UHNA 1QVIY 1QTXA 1DJZA 1A75A 1JBAA 1ALWA 1XYDA 3A8RA 3IQOA 1FPWA 1SBJA 4WRIA 1B9AA 4GGFA 1NIWA 3GK2A 4NDDA 5K89A 1WRLA 4WQ3A 3O2PA 3EK4A 2M9GA 4Q04A 1JUOA 1DT7B 2JRFA 4MN0A 1FI6A 1G33A 1SKTA 3D0YA 3I5HC 1LA3A 1S5GY 1K94A 2I2RE 3AAJA 3CGAA 2COLB 4MBEA 2HQWA 3DVKA 3D10A 2LC5A 2AMIA 1EL4A 1QVIZ 2K0JA 1OZOA 2BBMA 2JWWA 1OMRA 1RK9A 1Y1XA 2F8PA 1BF5A 1IRJA 1KK7Y 1KWOC 2BCBA 4N1FA 1YURA 2WCEA 2OPOA 3LL8B 3CS1A 4DIRA 3CLNA 1SYMA 1CM4A 3NSIA 5AERA 5D7FA 4XYNA 1TNPA 2KYFA 2VRGA 1S5GZ 1W7JB 2E6WA 2LMTA 5KSZA 1DJHA 2FOTA 2KGBC 2LVVA 2M1KB 4FQOA 4DUQA 4C0LA 1UHIA 3KPXA 4OKHA 3LLEA 5JOLA 2ZNDA 1LA0A 1BT6A 3EK8A 4MZLA 1CLBA 1NX2A 1KK7Z 2L5XB 1BR4B 1ZOTB 2JU0A 2JT3A 2CT9A 4PE7A 1SPYA 3VRRA 5IBWA 1AJ5A 1NX3A 4CIDA 1H4BA 2L2EA 1NWDA 3JTDB 5PALA 5G08A 4ZCUA 5J3XA 1TTXA 1OE9B 3TDUA 1M63B 3DVJA 1A03A 2Y1MA 3BOWB 4CFQA 4C0KA 1NPQA 2BKHB 4ZCVA 3DVMA 2M49B 4OCIA 3KF9A 1A4PA 4IL1A 4YGBB 1YRTB 1AJ4A 4JWQA 2K2AA 2QPTA 3CZTX 1DJWA 1QX2A 2KBIA 3VRQA 1TCOB 2I7AA 1ZACA 2QACA 2ISDA 3JTDC 5I2OA 2Q91A 2EGDA 1S26D 3AAKA 1PSRA 1CLLA 2K61A 2R2IA 2JXLA 4GFTA 1G8IA 4I5NB 1DF0B 2LLTA 1NX1A 1M31A 5JJGA 3OX5A 1J7OA 3PALA 1GGWA 1KFXS 2KOTA 1L2OB 1QATA 4PALA 5CSJA 3SG3A 1TNXA 2ZRTA 1PVAA 3I5GC 1R2UA 2KBMA 1U5IB 3O78A 1SK6D 1UUSA 2Y5IA 4GGNA 5F6TA 3HX4A 3KHEA 1K90D 3TUYC 2O60A 1X02A 2F3YA 4YGEB 4MSPA 1QIWA 2LAPA 4QJ4B 1RECA 3AKAA 2MAZA 3SIBA 3TZ1A 1B7TY 4CFRA 2NCPA 4YGCB 2EC6C 5GQQC 4HSZA 1JF0A 1DJGA 1BR1B 2CNPA 1DVIA 2ZRSA 1SNLA 5KU1A 1JFJA 1L7ZA 2DOQA 1L2OC 1MF8B 2L98A 4YI9A 4HREE 2SASA 3EVRA 4DRWA 1AK8A 1JSAA 2LP2A 1K8UA 1J1EA 2NZ0A 5ER5A 4OV2A 4D1EA 3NSOA 2OTGB 3CWGA 4L9MA 1AHRA 3RLZA 1NUBA 4P2YB 3SG7A 1IJ5A 1B7TZ 3NXAA 5I2LA 2LVKA 1TIZA 3DF0B 1VRKA 2LVIA 1M39A 1SCVA 1Y1UA 4ORBB 2PRUA 1EJ3A 2CCMA 2H61A 1DJYA 3CR2A 1BG1A 2G9BA 4N1GA 2M7LA 5AFPA 4AQIA 2MJWB 1LXFC 4GUKA 1BMOA 3ICBA 1J55A 1HT9A 1F54A 1LVCD 4MZKA 2JQ6A 2HF5A 4YGAA 2OTGC 3TDZA 2F3ZA 1CTRA 4YI8A 3BUNB 1CFPA 5DKRA 5HLOA 1NX0A 2LUXA 1ZFSA 3JVTB 1QS7A 1SL8A 5CSFA 1K9KA 1QASA 3VROA 1KFUS 2KAYA 1NCZA 3E3RA 1RTP1 1KSMA 1CMFA 1A29A 2LHIA 1ZMZA 4U8DA 2LVJA 1IQ3A 1WRKA 3BYAA 2CXJA 1NSHA 2JTTA 3IQQA 1K93D 2HPSA 4PHMA 4XJKB 3CTNA 2L50A 3O4YA 1UHHA 3FS7A 4QJ3B 3TS5B 2ZKMX 4R1EA 2L51A 1YUTA 2JNXA 2JPTA 2M1UA 1MUXA 1V1FA 1G4YR 2M97A 5DKQA 1IQ5A 5HLVA 2M8UA 4WQ2A 3VRNA 2KGRA 1IH0A 5CSIA 2MBXA 2M3WA 1FBVA 1S1EA 2GGMA 3QRXA 1SRAA 1XK4C 1FI5A 5TNCA 1MXLC 1F55A 1BODA 2KFHA 2B1UA 3RM1A 1PALA 1TNWA 1DJXA 3OB1B 4E68A 1UP5A 1K9UA 2M29A 3F45A 3TS5C 1UHJA 1C7WA 1KQMB 5AEQA 2K7CA 1NYAA 2JT8A 3PN7B 2AAOA 3IF7A 3EKJA 3M0WA 1F71A 2KDHA 1OMVA 3EVUA 1EG3A 3FIAA 5KTYA 2MLFC 2HETA 3WNXB 2L4HA 3DF0A 1FW4A 1RFJA 2BECA 4OR9B 1A75B 4FTGA 4YRUA 5HKYA 1R6PA 4A4BA 1LINA 1QX7A 1OOJA 2WCBA 2GV5A 4M2PA 4ORAB 1Q80A 1N2DA 1DGVA 3CR5X 1C7VA 3DVEA 2KYCA 5ER4X 1N65A 1QJTA 1XFUO 3FWBA 5HKWA 3D0YB 1F4OA 1GQMA 1KFUL 1KQMC 2L4IA 3PN7C 1B47A 2WNDA 4PE4A 1FF1A 1LKJA 1B4CA 2ZFDA 2KSPA 4NDBA 2F2OA 2TN4A 1KQVA 4M2QA 1XFVO 1D1OA 2MLEC 2K7BA 2JNFA 5CSNA 1Y1AA 1OMDA 1S6JA 1XFYO 1CB1A 1W7IB 1MXEA 5DKNA 3KEVA 3PLFB 1N0YA 1SMGA 4GGFC 1S6IA 4JQ0D 2KFGA 2JOJA 3AKBA 3A4UB 2Q4UA 3SG6A 1TN4A 2FCDA 1XA5A 1JC2A 1J1DA 1YX7A 1BJFA 4BY4A 1J7QA 1J7RA 1OSAA 1RWYA 1YTZC 1TRFA 1ODBA 2V53A 2I18A 1AP4A 1EH2A 2LHLA 4HRGA 1QV1A 1YX8A 2KI6D 4AQJA 1IJ6A 2LMVA 4MRYA 2LNKA 3DD4A 1JF2A 2NCOA 1CDMA 4CLNA 1Y6WA 2LANA 4MVFA 3C1VA 4MLWA 4YGDB 1SCMB 2BE6A 1WRZA 1OQPA 1K9PA 5BPJA 2KQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L0P A;  3BOW A;  1K95 A;  4I5L B;  2ZN8 A;  1MHO A;  1QV0 A;  2BBN A;  2JC2 A;  2MRD A;  1IG5 A;  3O6B A;  4GPL B;  1KSO A;  1YUU A;  4F0Z B;  3VRP A;  5AXI A;  2LLU A;  3SG5 A;  2WOR A;  3KO0 A;  2CTN A;  1CDP A;  2NLN A;  5CPV A;  4MRX A;  1YRU B;  1WLZ A;  4USL A;  3WHT B;  3OP0 A;  1KWO B;  1RRO A;  1Y0V H;  2KI6 C;  4PDZ A;  1KFX L;  4PE1 A;  1CDN A;  1UUR A;  2KAV A;  1YUS A;  4AOM A;  4CPV A;  3FWC A;  2KI4 B;  1SCM C;  1IGV A;  2FCE A;  2JT0 A;  1B1G A;  1J7P A;  3I5I B;  3NSL A;  1DF0 A;  4M2O A;  2PAS A;  1CDL A;  1YR5 A;  4OVN F;  2LP3 A;  5HKZ A;  3GOF A;  4N5X A;  5B8I B;  4GAO A;  4ICB A;  4GNK B;  2EHB A;  1MWN A;  1U5I A;  1QLK A;  2PVB A;  3WHU B;  1XVJ A;  2OS8 B;  4TNC A;  1F70 A;  2LM5 A;  3SIA A;  2BCA A;  1A2X A;  3OHM B;  5I8N A;  3ZWH A;  2KQY A;  1CFF A;  2PAL A;  1SY9 A;  1M45 A;  3H4S E;  3MSE B;  1F8H A;  1S36 A;  2LUC A;  1IKU A;  2O5G A;  3JVT C;  3NSK A;  1DTL A;  1PSB A;  1QX5 B;  3I5F B;  1NCX A;  1CKK A;  2KI4 C;  3PAT A;  1CM1 A;  1XFZ O;  2H2K A;  3I5I C;  1SR6 B;  1M46 A;  1JFK A;  2LE9 B;  1XFW O;  2K8M B;  5AAN A;  1CFC A;  1C07 A;  1DMO A;  1B8L A;  2OS8 C;  4P5O E;  1KK8 B;  2A4J A;  3EKH A;  1BU3 A;  1EG4 A;  5FYX A;  1QIV A;  2IS9 A;  2SCP A;  2F2P A;  2WOS A;  5D69 A;  1OZS A;  4DS7 A;  1SW8 A;  1YVH A;  3HCM A;  3WXA A;  5HYD A;  4BY5 A;  1PUL A;  1PRW A;  2JUL A;  1TOP A;  3I5F C;  1GJY A;  4QJ5 B;  2D8N A;  2K2F A;  2F33 A;  2LCP A;  1SR6 C;  2G2B A;  3PSR A;  1YVL A;  1NCY A;  2GGZ A;  4NDC A;  1MQ1 A;  1CNP A;  4PHK A;  4DCK A;  1BLQ A;  2BE4 A;  4PHN A;  4YBH B;  3PM8 A;  2P6B B;  4PCW A;  1GGZ A;  3I5G B;  3LCP C;  3GK1 A;  1KK8 C;  2Y1N A;  4NQG A;  2AUC A;  1UWO A;  2LV7 A;  2WC8 A;  4I5J A;  1CMG A;  3LK1 A;  1SL9 A;  3TUY B;  1HQV A;  2BKI B;  2MHH A;  4JPZ B;  3BUM B;  2PMY A;  2ZNE A;  3PFV A;  2LLS A;  1H8B A;  1E8A A;  1KCY A;  4I5K A;  2K7D A;  2HQ8 A;  1XK4 A;  3BXK A;  3BUW B;  3OX6 A;  4MZJ A;  1AVS A;  3SJS A;  1DJI A;  2BL0 B;  2JXC A;  3BUO B;  4UPG A;  5I2Q A;  1SL7 A;  1ALV A;  2KAX A;  4ORC B;  1CLM A;  2EC6 B;  4HRH A;  3EK7 A;  4C0J A;  2Y4Q A;  4XJK A;  1WLM A;  2H61 C;  2MA2 A;  3ZNI A;  1K96 A;  3SG4 A;  3LK0 A;  1V1G A;  2JZI A;  1NP8 A;  1S3P A;  1B8C A;  1TNQ A;  1WDC B;  2KNE A;  4A4C A;  2CBL A;  3OB2 B;  3BUX B;  1TCF A;  2PSR A;  4GBA A;  2K7O A;  2WCF A;  2LMU A;  1AUI B;  1XFX O;  1UHK A;  1EXR A;  1QXP A;  1S6C A;  1WY9 A;  1XO5 A;  2I94 A;  3EVV A;  3TDI A;  1DGU A;  4ETO A;  2RGI A;  1B8R A;  2BL0 C;  2KHN A;  3K21 A;  2BCX A;  1PK0 D;  3BQ3 A;  4PE0 A;  2M0R A;  3GK4 X;  3CR4 X;  4PHJ A;  2E30 A;  3VGO A;  1ZUZ A;  2ZN9 A;  3SG2 A;  1JWD A;  1PVB A;  3I5H B;  1RJV A;  2M7N A;  1CFD A;  2FJU B;  1BOC A;  1WDC C;  1F4Q A;  2JTZ A;  1QLS A;  2NXQ A;  1MR8 A;  2KFF A;  4MEW A;  1K2H A;  1IWQ A;  1UHN A;  1QVI Y;  1QTX A;  1DJZ A;  1A75 A;  1JBA A;  1ALW A;  1XYD A;  3A8R A;  3IQO A;  1FPW A;  1SBJ A;  4WRI A;  1B9A A;  4GGF A;  1NIW A;  3GK2 A;  4NDD A;  5K89 A;  1WRL A;  4WQ3 A;  3O2P A;  3EK4 A;  2M9G A;  4Q04 A;  1JUO A;  1DT7 B;  2JRF A;  4MN0 A;  1FI6 A;  1G33 A;  1SKT A;  3D0Y A;  3I5H C;  1LA3 A;  1S5G Y;  1K94 A;  2I2R E;  3AAJ A;  3CGA A;  2COL B;  4MBE A;  2HQW A;  3DVK A;  3D10 A;  2LC5 A;  2AMI A;  1EL4 A;  1QVI Z;  2K0J A;  1OZO A;  2BBM A;  2JWW A;  1OMR A;  1RK9 A;  1Y1X A;  2F8P A;  1BF5 A;  1IRJ A;  1KK7 Y;  1KWO C;  2BCB A;  4N1F A;  1YUR A;  2WCE A;  2OPO A;  3LL8 B;  3CS1 A;  4DIR A;  3CLN A;  1SYM A;  1CM4 A;  3NSI A;  5AER A;  5D7F A;  4XYN A;  1TNP A;  2KYF A;  2VRG A;  1S5G Z;  1W7J B;  2E6W A;  2LMT A;  5KSZ A;  1DJH A;  2FOT A;  2KGB C;  2LVV A;  2M1K B;  4FQO A;  4DUQ A;  4C0L A;  1UHI A;  3KPX A;  4OKH A;  3LLE A;  5JOL A;  2ZND A;  1LA0 A;  1BT6 A;  3EK8 A;  4MZL A;  1CLB A;  1NX2 A;  1KK7 Z;  2L5X B;  1BR4 B;  1ZOT B;  2JU0 A;  2JT3 A;  2CT9 A;  4PE7 A;  1SPY A;  3VRR A;  5IBW A;  1AJ5 A;  1NX3 A;  4CID A;  1H4B A;  2L2E A;  1NWD A;  3JTD B;  5PAL A;  5G08 A;  4ZCU A;  5J3X A;  1TTX A;  1OE9 B;  3TDU A;  1M63 B;  3DVJ A;  1A03 A;  2Y1M A;  3BOW B;  4CFQ A;  4C0K A;  1NPQ A;  2BKH B;  4ZCV A;  3DVM A;  2M49 B;  4OCI A;  3KF9 A;  1A4P A;  4IL1 A;  4YGB B;  1YRT B;  1AJ4 A;  4JWQ A;  2K2A A;  2QPT A;  3CZT X;  1DJW A;  1QX2 A;  2KBI A;  3VRQ A;  1TCO B;  2I7A A;  1ZAC A;  2QAC A;  2ISD A;  3JTD C;  5I2O A;  2Q91 A;  2EGD A;  1S26 D;  3AAK A;  1PSR A;  1CLL A;  2K61 A;  2R2I A;  2JXL A;  4GFT A;  1G8I A;  4I5N B;  1DF0 B;  2LLT A;  1NX1 A;  1M31 A;  5JJG A;  3OX5 A;  1J7O A;  3PAL A;  1GGW A;  1KFX S;  2KOT A;  1L2O B;  1QAT A;  4PAL A;  5CSJ A;  3SG3 A;  1TNX A;  2ZRT A;  1PVA A;  3I5G C;  1R2U A;  2KBM A;  1U5I B;  3O78 A;  1SK6 D;  1UUS A;  2Y5I A;  4GGN A;  5F6T A;  3HX4 A;  3KHE A;  1K90 D;  3TUY C;  2O60 A;  1X02 A;  2F3Y A;  4YGE B;  4MSP A;  1QIW A;  2LAP A;  4QJ4 B;  1REC A;  3AKA A;  2MAZ A;  3SIB A;  3TZ1 A;  1B7T Y;  4CFR A;  2NCP A;  4YGC B;  2EC6 C;  5GQQ C;  4HSZ A;  1JF0 A;  1DJG A;  1BR1 B;  2CNP A;  1DVI A;  2ZRS A;  1SNL A;  5KU1 A;  1JFJ A;  1L7Z A;  2DOQ A;  1L2O C;  1MF8 B;  2L98 A;  4YI9 A;  4HRE E;  2SAS A;  3EVR A;  4DRW A;  1AK8 A;  1JSA A;  2LP2 A;  1K8U A;  1J1E A;  2NZ0 A;  5ER5 A;  4OV2 A;  4D1E A;  3NSO A;  2OTG B;  3CWG A;  4L9M A;  1AHR A;  3RLZ A;  1NUB A;  4P2Y B;  3SG7 A;  1IJ5 A;  1B7T Z;  3NXA A;  5I2L A;  2LVK A;  1TIZ A;  3DF0 B;  1VRK A;  2LVI A;  1M39 A;  1SCV A;  1Y1U A;  4ORB B;  2PRU A;  1EJ3 A;  2CCM A;  2H61 A;  1DJY A;  3CR2 A;  1BG1 A;  2G9B A;  4N1G A;  2M7L A;  5AFP A;  4AQI A;  2MJW B;  1LXF C;  4GUK A;  1BMO A;  3ICB A;  1J55 A;  1HT9 A;  1F54 A;  1LVC D;  4MZK A;  2JQ6 A;  2HF5 A;  4YGA A;  2OTG C;  3TDZ A;  2F3Z A;  1CTR A;  4YI8 A;  3BUN B;  1CFP A;  5DKR A;  5HLO A;  1NX0 A;  2LUX A;  1ZFS A;  3JVT B;  1QS7 A;  1SL8 A;  5CSF A;  1K9K A;  1QAS A;  3VRO A;  1KFU S;  2KAY A;  1NCZ A;  3E3R A;  1RTP 1;  1KSM A;  1CMF A;  1A29 A;  2LHI A;  1ZMZ A;  4U8D A;  2LVJ A;  1IQ3 A;  1WRK A;  3BYA A;  2CXJ A;  1NSH A;  2JTT A;  3IQQ A;  1K93 D;  2HPS A;  4PHM A;  4XJK B;  3CTN A;  2L50 A;  3O4Y A;  1UHH A;  3FS7 A;  4QJ3 B;  3TS5 B;  2ZKM X;  4R1E A;  2L51 A;  1YUT A;  2JNX A;  2JPT A;  2M1U A;  1MUX A;  1V1F A;  1G4Y R;  2M97 A;  5DKQ A;  1IQ5 A;  5HLV A;  2M8U A;  4WQ2 A;  3VRN A;  2KGR A;  1IH0 A;  5CSI A;  2MBX A;  2M3W A;  1FBV A;  1S1E A;  2GGM A;  3QRX A;  1SRA A;  1XK4 C;  1FI5 A;  5TNC A;  1MXL C;  1F55 A;  1BOD A;  2KFH A;  2B1U A;  3RM1 A;  1PAL A;  1TNW A;  1DJX A;  3OB1 B;  4E68 A;  1UP5 A;  1K9U A;  2M29 A;  3F45 A;  3TS5 C;  1UHJ A;  1C7W A;  1KQM B;  5AEQ A;  2K7C A;  1NYA A;  2JT8 A;  3PN7 B;  2AAO A;  3IF7 A;  3EKJ A;  3M0W A;  1F71 A;  2KDH A;  1OMV A;  3EVU A;  1EG3 A;  3FIA A;  5KTY A;  2MLF C;  2HET A;  3WNX B;  2L4H A;  3DF0 A;  1FW4 A;  1RFJ A;  2BEC A;  4OR9 B;  1A75 B;  4FTG A;  4YRU A;  5HKY A;  1R6P A;  4A4B A;  1LIN A;  1QX7 A;  1OOJ A;  2WCB A;  2GV5 A;  4M2P A;  4ORA B;  1Q80 A;  1N2D A;  1DGV A;  3CR5 X;  1C7V A;  3DVE A;  2KYC A;  5ER4 X;  1N65 A;  1QJT A;  1XFU O;  3FWB A;  5HKW A;  3D0Y B;  1F4O A;  1GQM A;  1KFU L;  1KQM C;  2L4I A;  3PN7 C;  1B47 A;  2WND A;  4PE4 A;  1FF1 A;  1LKJ A;  1B4C A;  2ZFD A;  2KSP A;  4NDB A;  2F2O A;  2TN4 A;  1KQV A;  4M2Q A;  1XFV O;  1D1O A;  2MLE C;  2K7B A;  2JNF A;  5CSN A;  1Y1A A;  1OMD A;  1S6J A;  1XFY O;  1CB1 A;  1W7I B;  1MXE A;  5DKN A;  3KEV A;  3PLF B;  1N0Y A;  1SMG A;  4GGF C;  1S6I A;  4JQ0 D;  2KFG A;  2JOJ A;  3AKB A;  3A4U B;  2Q4U A;  3SG6 A;  1TN4 A;  2FCD A;  1XA5 A;  1JC2 A;  1J1D A;  1YX7 A;  1BJF A;  4BY4 A;  1J7Q A;  1J7R A;  1OSA A;  1RWY A;  1YTZ C;  1TRF A;  1ODB A;  2V53 A;  2I18 A;  1AP4 A;  1EH2 A;  2LHL A;  4HRG A;  1QV1 A;  1YX8 A;  2KI6 D;  4AQJ A;  1IJ6 A;  2LMV A;  4MRY A;  2LNK A;  3DD4 A;  1JF2 A;  2NCO A;  1CDM A;  4CLN A;  1Y6W A;  2LAN A;  4MVF A;  3C1V A;  4MLW A;  4YGD B;  1SCM B;  2BE6 A;  1WRZ A;  1OQP A;  1K9P A;  5BPJ A;  2KQ6 A; 
#chains in the Genus database with same CATH topology
 2L0P A;  3BOW A;  1K95 A;  3PM2 A;  4I5L B;  2ZN8 A;  1MHO A;  1QV0 A;  2KLD A;  2WC5 A;  2BBN A;  2JC2 A;  2MRD A;  1IG5 A;  3O6B A;  4GPL B;  1KSO A;  1YUU A;  4F0Z B;  3VRP A;  5AXI A;  2LLU A;  3SG5 A;  3CZ0 A;  2WOR A;  3KO0 A;  2CTN A;  1CDP A;  2NLN A;  5CPV A;  4MRX A;  1YRU B;  1WLZ A;  4USL A;  3WHT B;  3OP0 A;  1KWO B;  1RRO A;  1Y0V H;  2KI6 C;  4PDZ A;  1KFX L;  4PE1 A;  3UNW A;  1UUR A;  2KAV A;  3S0A A;  1CDN A;  1YUS A;  4AOM A;  4CPV A;  3FWC A;  2KI4 B;  1SCM C;  1IGV A;  2FCE A;  2JT0 A;  3OGN A;  1B1G A;  3I5I B;  3NSL A;  1DF0 A;  4M2O A;  1J7P A;  2PAS A;  1CDL A;  1YR5 A;  3DXL A;  2LP3 A;  4OVN F;  5HKZ A;  3GOF A;  4N5X A;  5B8I B;  4GAO A;  4ICB A;  4GNK B;  2EHB A;  1U5I A;  1MWN A;  1QLK A;  1OOF A;  2PVB A;  3WHU B;  4INW A;  1XVJ A;  2OS8 B;  4KYN A;  3R1O A;  4TNC A;  1F70 A;  2LM5 A;  4INX A;  3QME A;  3SIA A;  2BCA A;  1A2X A;  3OHM B;  5CSF A;  5I8N A;  3ZWH A;  2KQY A;  3FE8 A;  1CFF A;  2PAL A;  1SY9 A;  3O4X A;  1M45 A;  3H4S E;  3MSE B;  1F8H A;  1S36 A;  2LUC A;  1IKU A;  2O5G A;  2QEO A;  3JVT C;  3NSK A;  1DTL A;  1PSB A;  1QX5 B;  3I5F B;  1NCX A;  1CKK A;  2BNX A;  2KI4 C;  1CM1 A;  1XFZ O;  2WCK A;  3PAT A;  5HL1 A;  2H2K A;  1Z4H A;  3I5I C;  1SR6 B;  1M46 A;  1JFK A;  2LE9 B;  1XFW O;  2K8M B;  5AAN A;  3SS3 A;  1CFC A;  1C07 A;  1DMO A;  1B8L A;  2OS8 C;  4P5O E;  1KK8 B;  2A4J A;  1OW4 A;  1BU3 A;  3EKH A;  1EG4 A;  5FYX A;  1QIV A;  2IS9 A;  2SCP A;  2F2P A;  2WOS A;  5D69 A;  1OZS A;  4DS7 A;  1SW8 A;  3BFA A;  1YVH A;  3HCM A;  3WXA A;  5HYD A;  4BY5 A;  1PUL A;  1PRW A;  2JUL A;  1TOP A;  3I5F C;  1GJY A;  4JKT A;  4QJ5 B;  2D8N A;  2K2F A;  2F33 A;  2LCP A;  3B7A A;  3D78 A;  1SR6 C;  2G2B A;  3DYE A;  1YVL A;  3PSR A;  1NCY A;  2GGZ A;  4NDC A;  1MQ1 A;  3IVT A;  2WC6 A;  1CNP A;  4PHK A;  3NHI A;  4DCK A;  1BLQ A;  2BE4 A;  4PHN A;  3VB1 A;  4YBH B;  3PM8 A;  2P6B B;  4PCW A;  1GGZ A;  3I5G B;  3LCP C;  3GK1 A;  3S0B A;  1KK8 C;  2Y1N A;  4NQG A;  2AUC A;  1UWO A;  2LV7 A;  2WC8 A;  4I5J A;  1CMG A;  3LK1 A;  1SL9 A;  3TUY B;  3B6X A;  1HQV A;  2BKI B;  2MHH A;  3L4A A;  4JPZ B;  3BUM B;  2PMY A;  2ZNE A;  3PFV A;  2LLS A;  1H8B A;  1E8A A;  2L5Y A;  1KCY A;  1TUJ A;  2K7D A;  2HQ8 A;  1XK4 A;  3BJH A;  3BUW B;  2K60 A;  3BXK A;  1QWV A;  1AVS A;  3OX6 A;  4MZJ A;  1DJI A;  2BL0 B;  2JXC A;  3BUO B;  3SJS A;  4UPG A;  1SL7 A;  5I2Q A;  4PT1 A;  1ALV A;  2KAX A;  4ORC B;  1CLM A;  2EC6 B;  4HRH A;  3EK7 A;  3PJI A;  4C0J A;  2Y4Q A;  4XJK A;  1WLM A;  2H61 C;  2MA2 A;  3ZNI A;  1K96 A;  3SG4 A;  3LK0 A;  1V1G A;  2JZI A;  1NP8 A;  1S3P A;  3K1E A;  1B8C A;  1TNQ A;  1WDC B;  2KNE A;  4A4C A;  2CBL A;  3OB2 B;  3BUX B;  1TCF A;  1DQE A;  2PSR A;  4GBA A;  2K7O A;  2WCF A;  2LMU A;  1AUI B;  1XFX O;  1DC1 A;  1UHK A;  2KPH A;  1EXR A;  1QXP A;  1S6C A;  1WY9 A;  1XO5 A;  2I94 A;  3EVV A;  3TDI A;  1DGU A;  4ETO A;  2RGI A;  1B8R A;  2BL0 C;  2KHN A;  3K21 A;  2BCX A;  1PK0 D;  3BQ3 A;  4PE0 A;  2M0R A;  3GK4 X;  3CR4 X;  4JD9 A;  4PHJ A;  2E30 A;  3VGO A;  3R1V A;  1ZUZ A;  2ZN9 A;  4FQT A;  3SG2 A;  1PVB A;  3I5H B;  3SS5 A;  1JWD A;  1OOH A;  1RJV A;  2M7N A;  1CFD A;  2FJU B;  1BOC A;  1WDC C;  1F4Q A;  3D76 A;  2JTZ A;  1QLS A;  4IJ7 A;  2NXQ A;  1MR8 A;  2KFF A;  3NHT A;  4MEW A;  1K2H A;  1IWQ A;  1UHN A;  1QVI Y;  1QTX A;  1DJZ A;  1A75 A;  3S0G A;  1ALW A;  1XYD A;  3A8R A;  3B87 A;  3S0F A;  1JBA A;  3IQO A;  1FPW A;  1SBJ A;  1SSE B;  4WRI A;  1B9A A;  4GGF A;  1NIW A;  3GK2 A;  1TWO A;  4NDD A;  1WRL A;  4WQ3 A;  5K89 A;  3O2P A;  3EK4 A;  2M9G A;  4Q04 A;  1JUO A;  1DT7 B;  2JRF A;  4MN0 A;  1FI6 A;  1G33 A;  1SKT A;  2ERB A;  3D0Y A;  3I5H C;  1LA3 A;  1S5G Y;  1K94 A;  2I2R E;  3AAJ A;  3CGA A;  2COL B;  4MBE A;  2HQW A;  3DVK A;  4I5K A;  3D10 A;  2LC5 A;  2AMI A;  2P70 A;  1EL4 A;  5I94 A;  1QVI Z;  2K0J A;  1OOG A;  1OOI X;  1OZO A;  2BBM A;  2JWW A;  2P71 A;  1OMR A;  1RK9 A;  1Y1X A;  2F8P A;  1BF5 A;  1IRJ A;  1KK7 Y;  1KWO C;  2BCB A;  4N1F A;  1YUR A;  2WCE A;  2OPO A;  3LL8 B;  3CS1 A;  4DIR A;  3CLN A;  1SYM A;  1CM4 A;  3NSI A;  5AER A;  5D7F A;  4XYN A;  1TNP A;  2KYF A;  3CYZ A;  2VRG A;  1S5G Z;  1W7J B;  2E6W A;  2LMT A;  3CAB A;  5KSZ A;  1DJH A;  2FOT A;  2KGB C;  2LVV A;  2M1K B;  4FQO A;  1GM0 A;  4DUQ A;  4C0L A;  1UHI A;  3KPX A;  4OKH A;  3LLE A;  5JOL A;  2ZND A;  1LA0 A;  1BT6 A;  3EK8 A;  4MZL A;  2JPO A;  1CLB A;  1NX2 A;  1KK7 Z;  2L5X B;  3R1P A;  1BR4 B;  1ZOT B;  2JU0 A;  2JT3 A;  2CT9 A;  4PE7 A;  1SPY A;  3VRR A;  3DY9 A;  5IBW A;  1AJ5 A;  5FI7 A;  1NX3 A;  4CID A;  3Q8I A;  1IIO A;  1H4B A;  2L2E A;  2WCM A;  1NWD A;  3JTD B;  5PAL A;  5G08 A;  4ZCU A;  2FJY A;  5J3X A;  1TTX A;  1OE9 B;  3TDU A;  1M63 B;  3DVJ A;  3D75 A;  1A03 A;  2Y1M A;  3BOW B;  4CFQ A;  4C0K A;  2QEV A;  1NPQ A;  2BKH B;  4ZCV A;  1XFR A;  3DVM A;  5BPJ A;  2M49 B;  4OCI A;  3KF9 A;  4OZD A;  1A4P A;  3N7H A;  4IL1 A;  4YGB B;  1YRT B;  1AJ4 A;  4JWQ A;  2K2A A;  2QPT A;  3CZT X;  1DJW A;  3CDN A;  1QX2 A;  2KBI A;  2KLE A;  3VRQ A;  1TCO B;  2I7A A;  1ZAC A;  2QAC A;  2ISD A;  3JTD C;  5I2O A;  2Q91 A;  2EGD A;  1S26 D;  3AAK A;  1PSR A;  1CLL A;  2K61 A;  2R2I A;  2JXL A;  4GFT A;  1G8I A;  4I5N B;  1DF0 B;  2LLT A;  1NX1 A;  1M31 A;  5JJG A;  3OX5 A;  1J7O A;  3PAL A;  3EG5 B;  1GGW A;  1KFX S;  2KOT A;  1L2O B;  1QAT A;  4PAL A;  5CSJ A;  3SG3 A;  1TNX A;  2ZRT A;  1PVA A;  3I5G C;  1DEL A;  1R2U A;  2KBM A;  1U5I B;  3O78 A;  1SK6 D;  1UUS A;  2Y5I A;  4GGN A;  5F6T A;  3HX4 A;  3KHE A;  3B86 A;  1K90 D;  3TUY C;  2O60 A;  1X02 A;  5EL2 A;  2F3Y A;  4YGE B;  4MSP A;  1QIW A;  2LAP A;  4QJ4 B;  1REC A;  3AKA A;  2MAZ A;  3SIB A;  3TZ1 A;  1B7T Y;  4CFR A;  3L4L A;  2NCP A;  4YGC B;  2EC6 C;  3DZT A;  5GQQ C;  4HSZ A;  1JF0 A;  1DJG A;  1BR1 B;  1DVI A;  2CNP A;  2ZRS A;  1SNL A;  5KU1 A;  1JFJ A;  1L7Z A;  2BAP A;  2DOQ A;  1L2O C;  1MF8 B;  2L98 A;  4YI9 A;  3FE9 A;  3SS4 A;  4HRE E;  1P28 A;  2SAS A;  3EVR A;  4DRW A;  1AK8 A;  3OBV A;  1JSA A;  2LP2 A;  1K8U A;  1J1E A;  2NZ0 A;  3D73 A;  4OV2 A;  5ER5 A;  3NSO A;  4D1E A;  2OTG B;  3CWG A;  4L9M A;  1AHR A;  3RLZ A;  1NUB A;  3CZ1 A;  4P2Y B;  1IJ5 A;  1B7T Z;  3SG7 A;  3NXA A;  5I2L A;  2LVK A;  1TIZ A;  3DF0 B;  1VRK A;  2LVI A;  1M39 A;  1T14 A;  1SCV A;  1Y1U A;  4ORB B;  2PRU A;  1EJ3 A;  2CCM A;  2H61 A;  1DJY A;  3CR2 A;  1BG1 A;  2G9B A;  4N1G A;  2M7L A;  5AFP A;  4AQI A;  2MJW B;  1LXF C;  4GUK A;  1BMO A;  1DEK A;  1J55 A;  1C3Z A;  1HT9 A;  3B88 A;  3ICB A;  1F54 A;  1LVC D;  4MZK A;  2JQ6 A;  2HF5 A;  4YGA A;  2OTG C;  3TDZ A;  2F3Z A;  1CTR A;  3D74 A;  3BUN B;  4YI8 A;  1CFP A;  5DKR A;  5HLO A;  1NX0 A;  2LUX A;  1ZFS A;  3BFH A;  1QS7 A;  1SL8 A;  3JVT B;  1K9K A;  1QAS A;  1Z2C B;  3VRO A;  1KFU S;  2KAY A;  1NCZ A;  2WCJ A;  3E3R A;  1RTP 1;  1KSM A;  1CMF A;  1A29 A;  3FE6 A;  2LHI A;  3S0D A;  1ZMZ A;  4U8D A;  2LVJ A;  1IQ3 A;  4F7F A;  1WRK A;  3BYA A;  2CXJ A;  1NSH A;  2JTT A;  3IQQ A;  1K93 D;  1LS8 A;  2HPS A;  4PHM A;  4XJK B;  3CTN A;  2L50 A;  3O4Y A;  1UHH A;  3FS7 A;  4QJ3 B;  3TS5 B;  2ZKM X;  3CZ2 A;  1TUZ A;  2QEH A;  4R1E A;  2L51 A;  1YUT A;  2JNX A;  2JPT A;  2M1U A;  1MUX A;  1V1F A;  1G4Y R;  2M97 A;  5DKQ A;  1IQ5 A;  3UO9 A;  5HLV A;  2M8U A;  4WQ2 A;  3VRN A;  2KGR A;  1IH0 A;  5CSI A;  2MBX A;  2M3W A;  1FBV A;  1S1E A;  2GGM A;  3QRX A;  1SRA A;  1XK4 C;  1W9Z A;  5FI6 A;  1FI5 A;  2QEB A;  1MXL C;  5TNC A;  2L2C A;  1F55 A;  1BOD A;  2KFH A;  2B1U A;  3RM1 A;  1PAL A;  1TNW A;  1DJX A;  3OB1 B;  4E68 A;  1UP5 A;  1K9U A;  2M29 A;  3F45 A;  3TS5 C;  1UHJ A;  1C7W A;  1KQM B;  5AEQ A;  2K7C A;  1NYA A;  2JT8 A;  3PN7 B;  2AAO A;  3IF7 A;  3EKJ A;  3S0E A;  3M0W A;  1F71 A;  2KDH A;  1OMV A;  3EVU A;  1EG3 A;  3FIA A;  5KTY A;  2MLF C;  2HET A;  3WNX B;  2L4H A;  3DF0 A;  1FW4 A;  1RFJ A;  2BEC A;  4OR9 B;  1A75 B;  4FTG A;  4YRU A;  5HKY A;  1R6P A;  2WCH A;  4A4B A;  1LIN A;  1QX7 A;  1OOJ A;  2WCB A;  2GV5 A;  4M2P A;  4ORA B;  1Q80 A;  1N2D A;  1DGV A;  3CR5 X;  1C7V A;  5D3O A;  3DVE A;  2KYC A;  5ER4 X;  1N65 A;  1QJT A;  1XFU O;  3FWB A;  5HKW A;  2QDI A;  3D0Y B;  1F4O A;  1GQM A;  1KFU L;  1KQM C;  2L4I A;  3PN7 C;  1B47 A;  2WND A;  4PE4 A;  1FF1 A;  1LKJ A;  1B4C A;  2ZFD A;  2KSP A;  4NDB A;  2F2O A;  2TN4 A;  1KQV A;  4M2Q A;  1XFV O;  2YGU A;  1D1O A;  2MLE C;  2K7B A;  2JNF A;  5CSN A;  1Y1A A;  1OMD A;  1S6J A;  1XFY O;  1CB1 A;  1W7I B;  1MXE A;  5DKN A;  3KEV A;  3PLF B;  1N0Y A;  1SMG A;  4GGF C;  1S6I A;  4JQ0 D;  2KFG A;  2JOJ A;  3AKB A;  3A4U B;  2Q4U A;  3SG6 A;  1TN4 A;  3BFB A;  2FCD A;  1XA5 A;  1JC2 A;  1J1D A;  1YX7 A;  1BJF A;  4BY4 A;  1J7Q A;  1J7R A;  1OSA A;  3D77 A;  1RWY A;  1ORG A;  1YTZ C;  2GTE A;  1TRF A;  1ODB A;  3L47 A;  2V53 A;  2I18 A;  1AP4 A;  1EH2 A;  2LHL A;  4HRG A;  1QV1 A;  1YX8 A;  2KI6 D;  4AQJ A;  1IJ6 A;  2LMV A;  2PYQ A;  4MRY A;  3R72 A;  2LNK A;  3DD4 A;  1JF2 A;  2NCO A;  1CDM A;  4CLN A;  3RZS A;  1Y6W A;  2LAN A;  5FI2 A;  4MVF A;  3C1V A;  2PQL A;  4MLW A;  4YGD B;  3V2L A;  1SCM B;  2BE6 A;  3NGV A;  2WCL A;  1WRZ A;  1OQP A;  1K9P A;  2H8V A;  1C3Y A;  5DIC A;  2KQ6 A; 
#chains in the Genus database with same CATH homology
 2L0P A;  3BOW A;  1K95 A;  4I5L B;  2ZN8 A;  1MHO A;  1QV0 A;  2BBN A;  2JC2 A;  2MRD A;  1IG5 A;  3O6B A;  4GPL B;  1KSO A;  1YUU A;  4F0Z B;  3VRP A;  5AXI A;  2LLU A;  3SG5 A;  2WOR A;  3KO0 A;  2CTN A;  1CDP A;  2NLN A;  5CPV A;  4MRX A;  1YRU B;  1WLZ A;  4USL A;  3WHT B;  3OP0 A;  1KWO B;  1RRO A;  1Y0V H;  2KI6 C;  4PDZ A;  1KFX L;  4PE1 A;  1CDN A;  1UUR A;  2KAV A;  1YUS A;  4AOM A;  4CPV A;  3FWC A;  2KI4 B;  1SCM C;  1IGV A;  2FCE A;  2JT0 A;  1B1G A;  1J7P A;  3I5I B;  3NSL A;  1DF0 A;  4M2O A;  2PAS A;  1CDL A;  1YR5 A;  4OVN F;  2LP3 A;  5HKZ A;  3GOF A;  4N5X A;  5B8I B;  4GAO A;  4ICB A;  4GNK B;  2EHB A;  1MWN A;  1U5I A;  1QLK A;  2PVB A;  3WHU B;  1XVJ A;  2OS8 B;  4TNC A;  1F70 A;  2LM5 A;  3SIA A;  2BCA A;  1A2X A;  3OHM B;  5I8N A;  3ZWH A;  2KQY A;  1CFF A;  2PAL A;  1SY9 A;  1M45 A;  3H4S E;  3MSE B;  1F8H A;  1S36 A;  2LUC A;  1IKU A;  2O5G A;  3JVT C;  3NSK A;  1DTL A;  1PSB A;  1QX5 B;  3I5F B;  1NCX A;  1CKK A;  2KI4 C;  3PAT A;  1CM1 A;  1XFZ O;  2H2K A;  3I5I C;  1SR6 B;  1M46 A;  1JFK A;  2LE9 B;  1XFW O;  2K8M B;  5AAN A;  1CFC A;  1C07 A;  1DMO A;  1B8L A;  2OS8 C;  4P5O E;  1KK8 B;  2A4J A;  3EKH A;  1BU3 A;  1EG4 A;  5FYX A;  1QIV A;  2IS9 A;  2SCP A;  2F2P A;  2WOS A;  5D69 A;  1OZS A;  4DS7 A;  1SW8 A;  1YVH A;  3HCM A;  3WXA A;  5HYD A;  4BY5 A;  1PUL A;  1PRW A;  2JUL A;  1TOP A;  3I5F C;  1GJY A;  4QJ5 B;  2D8N A;  2K2F A;  2F33 A;  2LCP A;  1SR6 C;  2G2B A;  3PSR A;  1YVL A;  1NCY A;  2GGZ A;  4NDC A;  1MQ1 A;  1CNP A;  4PHK A;  4DCK A;  1BLQ A;  2BE4 A;  4PHN A;  4YBH B;  3PM8 A;  2P6B B;  4PCW A;  1GGZ A;  3I5G B;  3LCP C;  3GK1 A;  1KK8 C;  2Y1N A;  4NQG A;  2AUC A;  1UWO A;  2LV7 A;  2WC8 A;  4I5J A;  1CMG A;  3LK1 A;  1SL9 A;  3TUY B;  1HQV A;  2BKI B;  2MHH A;  4JPZ B;  3BUM B;  2PMY A;  2ZNE A;  3PFV A;  2LLS A;  1H8B A;  1E8A A;  1KCY A;  4I5K A;  2K7D A;  2HQ8 A;  1XK4 A;  3BXK A;  3BUW B;  3OX6 A;  4MZJ A;  1AVS A;  3SJS A;  1DJI A;  2BL0 B;  2JXC A;  3BUO B;  4UPG A;  5I2Q A;  1SL7 A;  1ALV A;  2KAX A;  4ORC B;  1CLM A;  2EC6 B;  4HRH A;  3EK7 A;  4C0J A;  2Y4Q A;  4XJK A;  1WLM A;  2H61 C;  2MA2 A;  3ZNI A;  1K96 A;  3SG4 A;  3LK0 A;  1V1G A;  2JZI A;  1NP8 A;  1S3P A;  1B8C A;  1TNQ A;  1WDC B;  2KNE A;  4A4C A;  2CBL A;  3OB2 B;  3BUX B;  1TCF A;  2PSR A;  4GBA A;  2K7O A;  2WCF A;  2LMU A;  1AUI B;  1XFX O;  1UHK A;  1EXR A;  1QXP A;  1S6C A;  1WY9 A;  1XO5 A;  2I94 A;  3EVV A;  3TDI A;  1DGU A;  4ETO A;  2RGI A;  1B8R A;  2BL0 C;  2KHN A;  3K21 A;  2BCX A;  1PK0 D;  3BQ3 A;  4PE0 A;  2M0R A;  3GK4 X;  3CR4 X;  4PHJ A;  2E30 A;  3VGO A;  1ZUZ A;  2ZN9 A;  3SG2 A;  1JWD A;  1PVB A;  3I5H B;  1RJV A;  2M7N A;  1CFD A;  2FJU B;  1BOC A;  1WDC C;  1F4Q A;  2JTZ A;  1QLS A;  2NXQ A;  1MR8 A;  2KFF A;  4MEW A;  1K2H A;  1IWQ A;  1UHN A;  1QVI Y;  1QTX A;  1DJZ A;  1A75 A;  1JBA A;  1ALW A;  1XYD A;  3A8R A;  3IQO A;  1FPW A;  1SBJ A;  4WRI A;  1B9A A;  4GGF A;  1NIW A;  3GK2 A;  4NDD A;  5K89 A;  1WRL A;  4WQ3 A;  3O2P A;  3EK4 A;  2M9G A;  4Q04 A;  1JUO A;  1DT7 B;  2JRF A;  4MN0 A;  1FI6 A;  1G33 A;  1SKT A;  3D0Y A;  3I5H C;  1LA3 A;  1S5G Y;  1K94 A;  2I2R E;  3AAJ A;  3CGA A;  2COL B;  4MBE A;  2HQW A;  3DVK A;  3D10 A;  2LC5 A;  2AMI A;  1EL4 A;  1QVI Z;  2K0J A;  1OZO A;  2BBM A;  2JWW A;  1OMR A;  1RK9 A;  1Y1X A;  2F8P A;  1BF5 A;  1IRJ A;  1KK7 Y;  1KWO C;  2BCB A;  4N1F A;  1YUR A;  2WCE A;  2OPO A;  3LL8 B;  3CS1 A;  4DIR A;  3CLN A;  1SYM A;  1CM4 A;  3NSI A;  5AER A;  5D7F A;  4XYN A;  1TNP A;  2KYF A;  2VRG A;  1S5G Z;  1W7J B;  2E6W A;  2LMT A;  5KSZ A;  1DJH A;  2FOT A;  2KGB C;  2LVV A;  2M1K B;  4FQO A;  4DUQ A;  4C0L A;  1UHI A;  3KPX A;  4OKH A;  3LLE A;  5JOL A;  2ZND A;  1LA0 A;  1BT6 A;  3EK8 A;  4MZL A;  1CLB A;  1NX2 A;  1KK7 Z;  2L5X B;  1BR4 B;  1ZOT B;  2JU0 A;  2JT3 A;  2CT9 A;  4PE7 A;  1SPY A;  3VRR A;  5IBW A;  1AJ5 A;  1NX3 A;  4CID A;  1H4B A;  2L2E A;  1NWD A;  3JTD B;  5PAL A;  5G08 A;  4ZCU A;  5J3X A;  1TTX A;  1OE9 B;  3TDU A;  1M63 B;  3DVJ A;  1A03 A;  2Y1M A;  3BOW B;  4CFQ A;  4C0K A;  1NPQ A;  2BKH B;  4ZCV A;  3DVM A;  2M49 B;  4OCI A;  3KF9 A;  1A4P A;  4IL1 A;  4YGB B;  1YRT B;  1AJ4 A;  4JWQ A;  2K2A A;  2QPT A;  3CZT X;  1DJW A;  1QX2 A;  2KBI A;  3VRQ A;  1TCO B;  2I7A A;  1ZAC A;  2QAC A;  2ISD A;  3JTD C;  5I2O A;  2Q91 A;  2EGD A;  1S26 D;  3AAK A;  1PSR A;  1CLL A;  2K61 A;  2R2I A;  2JXL A;  4GFT A;  1G8I A;  4I5N B;  1DF0 B;  2LLT A;  1NX1 A;  1M31 A;  5JJG A;  3OX5 A;  1J7O A;  3PAL A;  1GGW A;  1KFX S;  2KOT A;  1L2O B;  1QAT A;  4PAL A;  5CSJ A;  3SG3 A;  1TNX A;  2ZRT A;  1PVA A;  3I5G C;  1R2U A;  2KBM A;  1U5I B;  3O78 A;  1SK6 D;  1UUS A;  2Y5I A;  4GGN A;  5F6T A;  3HX4 A;  3KHE A;  1K90 D;  3TUY C;  2O60 A;  1X02 A;  2F3Y A;  4YGE B;  4MSP A;  1QIW A;  2LAP A;  4QJ4 B;  1REC A;  3AKA A;  2MAZ A;  3SIB A;  3TZ1 A;  1B7T Y;  4CFR A;  2NCP A;  4YGC B;  2EC6 C;  5GQQ C;  4HSZ A;  1JF0 A;  1DJG A;  1BR1 B;  2CNP A;  1DVI A;  2ZRS A;  1SNL A;  5KU1 A;  1JFJ A;  1L7Z A;  2DOQ A;  1L2O C;  1MF8 B;  2L98 A;  4YI9 A;  4HRE E;  2SAS A;  3EVR A;  4DRW A;  1AK8 A;  1JSA A;  2LP2 A;  1K8U A;  1J1E A;  2NZ0 A;  5ER5 A;  4OV2 A;  4D1E A;  3NSO A;  2OTG B;  3CWG A;  4L9M A;  1AHR A;  3RLZ A;  1NUB A;  4P2Y B;  3SG7 A;  1IJ5 A;  1B7T Z;  3NXA A;  5I2L A;  2LVK A;  1TIZ A;  3DF0 B;  1VRK A;  2LVI A;  1M39 A;  1SCV A;  1Y1U A;  4ORB B;  2PRU A;  1EJ3 A;  2CCM A;  2H61 A;  1DJY A;  3CR2 A;  1BG1 A;  2G9B A;  4N1G A;  2M7L A;  5AFP A;  4AQI A;  2MJW B;  1LXF C;  4GUK A;  1BMO A;  3ICB A;  1J55 A;  1HT9 A;  1F54 A;  1LVC D;  4MZK A;  2JQ6 A;  2HF5 A;  4YGA A;  2OTG C;  3TDZ A;  2F3Z A;  1CTR A;  4YI8 A;  3BUN B;  1CFP A;  5DKR A;  5HLO A;  1NX0 A;  2LUX A;  1ZFS A;  3JVT B;  1QS7 A;  1SL8 A;  5CSF A;  1K9K A;  1QAS A;  3VRO A;  1KFU S;  2KAY A;  1NCZ A;  3E3R A;  1RTP 1;  1KSM A;  1CMF A;  1A29 A;  2LHI A;  1ZMZ A;  4U8D A;  2LVJ A;  1IQ3 A;  1WRK A;  3BYA A;  2CXJ A;  1NSH A;  2JTT A;  3IQQ A;  1K93 D;  2HPS A;  4PHM A;  4XJK B;  3CTN A;  2L50 A;  3O4Y A;  1UHH A;  3FS7 A;  4QJ3 B;  3TS5 B;  2ZKM X;  4R1E A;  2L51 A;  1YUT A;  2JNX A;  2JPT A;  2M1U A;  1MUX A;  1V1F A;  1G4Y R;  2M97 A;  5DKQ A;  1IQ5 A;  5HLV A;  2M8U A;  4WQ2 A;  3VRN A;  2KGR A;  1IH0 A;  5CSI A;  2MBX A;  2M3W A;  1FBV A;  1S1E A;  2GGM A;  3QRX A;  1SRA A;  1XK4 C;  1FI5 A;  5TNC A;  1MXL C;  1F55 A;  1BOD A;  2KFH A;  2B1U A;  3RM1 A;  1PAL A;  1TNW A;  1DJX A;  3OB1 B;  4E68 A;  1UP5 A;  1K9U A;  2M29 A;  3F45 A;  3TS5 C;  1UHJ A;  1C7W A;  1KQM B;  5AEQ A;  2K7C A;  1NYA A;  2JT8 A;  3PN7 B;  2AAO A;  3IF7 A;  3EKJ A;  3M0W A;  1F71 A;  2KDH A;  1OMV A;  3EVU A;  1EG3 A;  3FIA A;  5KTY A;  2MLF C;  2HET A;  3WNX B;  2L4H A;  3DF0 A;  1FW4 A;  1RFJ A;  2BEC A;  4OR9 B;  1A75 B;  4FTG A;  4YRU A;  5HKY A;  1R6P A;  4A4B A;  1LIN A;  1QX7 A;  1OOJ A;  2WCB A;  2GV5 A;  4M2P A;  4ORA B;  1Q80 A;  1N2D A;  1DGV A;  3CR5 X;  1C7V A;  3DVE A;  2KYC A;  5ER4 X;  1N65 A;  1QJT A;  1XFU O;  3FWB A;  5HKW A;  3D0Y B;  1F4O A;  1GQM A;  1KFU L;  1KQM C;  2L4I A;  3PN7 C;  1B47 A;  2WND A;  4PE4 A;  1FF1 A;  1LKJ A;  1B4C A;  2ZFD A;  2KSP A;  4NDB A;  2F2O A;  2TN4 A;  1KQV A;  4M2Q A;  1XFV O;  1D1O A;  2MLE C;  2K7B A;  2JNF A;  5CSN A;  1Y1A A;  1OMD A;  1S6J A;  1XFY O;  1CB1 A;  1W7I B;  1MXE A;  5DKN A;  3KEV A;  3PLF B;  1N0Y A;  1SMG A;  4GGF C;  1S6I A;  4JQ0 D;  2KFG A;  2JOJ A;  3AKB A;  3A4U B;  2Q4U A;  3SG6 A;  1TN4 A;  2FCD A;  1XA5 A;  1JC2 A;  1J1D A;  1YX7 A;  1BJF A;  4BY4 A;  1J7Q A;  1J7R A;  1OSA A;  1RWY A;  1YTZ C;  1TRF A;  1ODB A;  2V53 A;  2I18 A;  1AP4 A;  1EH2 A;  2LHL A;  4HRG A;  1QV1 A;  1YX8 A;  2KI6 D;  4AQJ A;  1IJ6 A;  2LMV A;  4MRY A;  2LNK A;  3DD4 A;  1JF2 A;  2NCO A;  1CDM A;  4CLN A;  1Y6W A;  2LAN A;  4MVF A;  3C1V A;  4MLW A;  4YGD B;  1SCM B;  2BE6 A;  1WRZ A;  1OQP A;  1K9P A;  5BPJ A;  2KQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...