1SBJA

Nmr structure of the mg2+-loaded c terminal domain of cardiac troponin c bound to the n terminal domain of cardiac troponin i
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
81
structure length
81
Chain Sequence
MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Mg2+-loaded C-lobe of cardiac troponin C bound to the N-domain of cardiac troponin I: comparison with the Ca2+-loaded structure.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Contractile protein, structural protein
molecule keywords Troponin C, slow skeletal and cardiac muscles
total genus 16
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2004-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1sbjA00
5HKWA 4MZJA 3GK2A 1DJXA 2WCFA 1BOCA 3NSOA 1C07A 1YURA 3TUYB 1PSRA 2LHIA 1SCVA 1XK4A 2SCPA 3DF0A 2RGIA 3VRRA 5I2QA 4HRHA 4GGFA 3FWCA 2F2OA 2EC6C 2NCPA 5I2LA 1NX0A 1OE9B 5ER4X 3PSRA 4YGEB 1F70A 2ZNEA 1M39A 2LCPA 1QV0A 3LL8B 1PVAA 1SY9A 2JT0A 2KAYA 2LVVA 2JULA 5D69A 4ZCVA 2Y4QA 4YI9A 3TDIA 4E68A 3IF7A 1KK7Y 1JSAA 1SL7A 2KFGA 3NXAA 1XFXO 1EH2A 2E6WA 1JFJA 3TS5B 4A4BA 2LMVA 1G8IA 1H8BA 2M29A 3VRPA 3DVKA 1J7QA 1CM1A 2Q4UA 1S5GZ 1SMGA 2JOJA 3CWGA 4NDBA 2BL0B 1XK4C 1NX1A 3EVVA 1NCYA 4GFTA 1RECA 1HT9A 3BUNB 3SIAA 2MAZA 4DCKA 1XVJA 2M8UA 4M2PA 1CLBA 4PE1A 4Q04A 2L98A 1QX2A 1QIWA 4DUQA 2KAVA 2JQ6A 2LC5A 3VRQA 1GGZA 1LA3A 2I94A 4PDZA 1R2UA 3CS1A 1B1GA 2K7BA 2K0JA 2LE9B 3AAJA 1BJFA 1V1FA 3CR4X 4WQ3A 1MWNA 2K61A 2KYCA 1M45A 2CXJA 3I5HC 3M0WA 1MHOA 1EG3A 1KFUL 3A8RA 1BR4B 2MA2A 2OS8C 2CBLA 5FYXA 3TUYC 1ZACA 2LLTA 4QJ5B 1OOJA 3LK1A 2I18A 2KQ6A 3NSIA 1RROA 2PVBA 3D0YB 1XFVO 1XA5A 2EHBA 1RFJA 1NYAA 5HYDA 1K94A 1UP5A 4GNKB 1H4BA 2GGMA 1CFDA 2JWWA 2JXCA 1EJ3A 2BCAA 3ZWHA 1CMGA 2PRUA 2BECA 2NLNA 1ZMZA 1IJ5A 2OPOA 2M1UA 2V53A 4WRIA 2NZ0A 2M7LA 2BKIB 4QJ3B 4YI8A 3RM1A 3BXKA 2M7NA 2NXQA 1F4OA 3CR2A 2K7OA 1C7WA 1K8UA 4CPVA 2LM5A 4N5XA 3IQOA 1OZSA 2PALA 2JRFA 1QVIZ 1IGVA 3JVTC 1N2DA 1SCMC 5AXIA 5CSIA 1PALA 1LXFC 3EK7A 1BODA 3TS5C 1KSMA 1BF5A 1A29A 1X02A 1S26D 1UHJA 1HQVA 1YUTA 1PULA 1QX5B 1AJ4A 3H4SE 1TN4A 2FCEA 3JTDC 2HF5A 1U5IB 2ZRTA 1TNXA 3JTDB 5DKNA 5ER5A 1K9PA 1TTXA 1WRZA 2K2FA 3QRXA 4AQJA 2KSPA 1K93D 4YGAA 4QJ4B 2KYFA 3K21A 1F4QA 3I5GB 3JVTB 1AHRA 1ALWA 3A4UB 3KHEA 3SG7A 3CZTX 2LUXA 2EGDA 4JQ0D 3E3RA 5PALA 4PHKA 2FJUB 1W7IB 1XFYO 4ORAB 4U8DA 1DT7B 4PE4A 3WHUB 1F8HA 2Y1MA 3OP0A 1LA0A 2MLEC 3SJSA 4M2QA 2JNFA 2IS9A 1RWYA 3KPXA 3PM8A 2ZKMX 1YRTB 1NX3A 5G08A 4ORBB 5HKZA 1RK9A 3DF0B 2H2KA 3OX6A 1TRFA 1WLZA 2L51A 1AUIB 1UHNA 1U5IA 4DIRA 1CDPA 1SBJA 2R2IA 1D1OA 2L4IA 4MZLA 1XYDA 5KSZA 2KI4C 4M2OA 2AUCA 1RTP1 1B8LA 1PVBA 2M3WA 2KQYA 2BCXA 2HETA 5D7FA 1TCOB 4HRGA 4PE0A 2WORA 3HX4A 2M0RA 1IQ3A 5J3XA 1B8CA 1EL4A 1IRJA 1KFXS 1MUXA 1OZOA 1SKTA 2LUCA 5HLOA 1JWDA 3CGAA 3TDZA 1IH0A 1KFUS 1TNPA 4OR9B 4CIDA 1TOPA 1N65A 2M9GA 1L2OC 4FTGA 2L5XB 4MBEA 4N1GA 1WDCB 3WHTB 4AOMA 2OTGC 2H61A 3DVEA 2JT8A 4MEWA 3BYAA 1KFXL 1JC2A 1NCZA 2LVKA 3EKHA 1DJGA 3EVRA 1QS7A 1QXPA 2LLUA 2F8PA 1NSHA 4MRYA 2CTNA 1QIVA 4D1EA 2COLB 2KFFA 1NWDA 1E8AA 1QLSA 1XO5A 2ZN8A 2I2RE 1FPWA 2LLSA 1UHKA 1FBVA 4HSZA 1DJIA 1KSOA 1YUUA 1JFKA 3I5IB 2KNEA 2BE4A 2ZRSA 1CDNA 4OV2A 1MXLC 2K7CA 2F2PA 3PALA 3PFVA 3PN7B 2LAPA 1BMOA 3BUXB 3EKJA 3WXAA 3PATA 1EG4A 1CNPA 1UHIA 4JPZB 1CFFA 4PCWA 2F3ZA 2LMTA 1CFPA 1S3PA 4P5OE 1UHHA 1FW4A 3FWBA 5JJGA 1DTLA 1AP4A 1TCFA 1K9UA 2M49B 3I5HB 2OTGB 3I5IC 4ETOA 4BY5A 2NCOA 3KO0A 5I8NA 2KI6D 1G33A 2LVIA 1KK7Z 3VRNA 1MF8B 3TDUA 3O4YA 3SG5A 5AFPA 1K90D 1VRKA 2EC6B 1IG5A 2MRDA 1AJ5A 4YGCB 1PK0D 2KBMA 4OCIA 1M31A 2JPTA 1QLKA 1YX7A 2G9BA 1B9AA 1BR1B 4ICBA 1J1DA 2E30A 5HLVA 3AKAA 2BE6A 3ZNIA 1GGWA 1YX8A 3LLEA 1BU3A 4NQGA 1JF0A 4AQIA 2CCMA 1YR5A 5IBWA 1TNWA 2Y1NA 1MR8A 1SR6B 1XFZO 2ZNDA 4YBHB 1QASA 3BUWB 3FS7A 2BL0C 4PHMA 2KHNA 4MRXA 4MVFA 4DRWA 1A75A 3SIBA 4WQ2A 5B8IB 1IKUA 1DF0B 1CMFA 1DJHA 1KCYA 1IWQA 3NSLA 2JZIA 2OS8B 2KFHA 1Y1AA 1XFUO 2JU0A 1B47A 4I5NB 3O2PA 1J7OA 4GBAA 1PRWA 1L2OB 2MJWB 5DKQA 1KQMB 1A03A 2L0PA 4A4CA 4CFRA 4GAOA 1SCMB 2KDHA 1CLLA 1A4PA 3I5GC 1BG1A 1A2XA 2QPTA 3BUMB 1CFCA 2KBIA 2Y5IA 3VROA 1IQ5A 3BOWA 1WRKA 1LKJA 2O5GA 5AEQA 3EK4A 1SPYA 1BLQA 3SG6A 3CLNA 2JTTA 4DS7A 1IJ6A 4P2YB 1S1EA 1SW8A 1Y1XA 1J55A 2HQ8A 1S6CA 1OMDA 1CLMA 1UWOA 1ZOTB 1M46A 4GGFC 1KK8C 1ZFSA 1NIWA 1SL8A 1GQMA 1CM4A 1QTXA 1S36A 1W7JB 3KF9A 5AANA 4C0LA 1KQMC 2TN4A 1KWOC 1K96A 2L4HA 1KWOB 1YRUB 3C1VA 4PE7A 1OQPA 3WNXB 5JOLA 1S6IA 1SRAA 1RJVA 2ZN9A 3GK4X 4UPGA 2WOSA 3GK1A 1DGUA 5I2OA 4CFQA 4MSPA 2LP3A 1B7TY 3PN7C 4XYNA 4GGNA 2JT3A 4TNCA 3I5FB 2PASA 2KI4B 2LP2A 2QACA 4JWQA 3AAKA 4XJKA 2SASA 1V1GA 2ISDA 2PSRA 1OMVA 1MXEA 4GUKA 3SG4A 4F0ZB 1CB1A 2CT9A 3BOWB 1NPQA 3PLFB 2DOQA 2D8NA 1OMRA 5HKYA 4MZKA 2WC8A 4I5KA 5TNCA 1PSBA 3ICBA 5KTYA 3NSKA 1YVLA 1DGVA 1LVCD 3O78A 3OX5A 1ODBA 5CSNA 1JBAA 3I5FC 1F71A 3D10A 1C7VA 4CLNA 5K89A 1FF1A 1FI5A 2PMYA 3O6BA 4YRUA 1DVIA 2LHLA 2P6BB 4PALA 5GQQC 1ZUZA 1Q80A 2G2BA 4XJKB 4PHJA 1XFWO 2MHHA 2KAXA 1M63B 1UUSA 4ZCUA 1S5GY 2JXLA 1QV1A 4IL1A 1YTZC 2LMUA 5CSJA 2ZFDA 4HREE 1DJWA 1NUBA 4BY4A 1B8RA 4NDDA 2F3YA 2JTZA 3DVMA 1TIZA 4GPLB 1QATA 1Y0VH 2BBNA 3DD4A 1CDLA 3SG2A 3OB1B 2F33A 3VGOA 3OB2B 1TNQA 4C0JA 3FIAA 2A4JA 1K9KA 2VRGA 4MN0A 1J1EA 2WCEA 1SK6D 1AK8A 1GJYA 1KK8B 2BKHB 4YGBB 1J7RA 2L2EA 2M97A 4FQOA 1J7PA 2CNPA 1LINA 4I5LB 2AAOA 1ALVA 3IQQA 2KI6C 1OSAA 2WCBA 1NCXA 3TZ1A 5KU1A 1F54A 3D0YA 2K8MB 3OHMB 1K2HA 3SG3A 5AERA 2B1UA 3MSEB 1N0YA 3F45A 1G4YR 1SL9A 1CDMA 4L9MA 1DMOA 1YUSA 4MLWA 2LNKA 1KQVA 1UURA 2BBMA 3KEVA 2HPSA 4I5JA 3EVUA 4R1EA 1NX2A 4ORCB 2GGZA 2K2AA 1A75B 1EXRA 1QX7A 5DKRA 1DF0A 1WY9A 2MLFC 4NDCA 4C0KA 5CPVA 2KGRA 2JC2A 2L50A 1NP8A 2FCDA 1MQ1A 3BQ3A 2K7DA 1YVHA 2M1KB 1R6PA 1JF2A 5BPJA 5CSFA 3CR5X 1SR6C 2HQWA 2LANA 1Y6WA 1DJZA 2H61C 3LCPC 2Q91A 4YGDB 2KOTA 1L7ZA 1SYMA 2I7AA 2AMIA 2GV5A 1F55A 1QVIY 1QJTA 4PHNA 2KGBC 1FI6A 2LVJA 1WDCC 1CTRA 1BT6A 4OKHA 1DJYA 3DVJA 3CTNA 3EK8A 3AKBA 1AVSA 2MBXA 2WNDA 1SNLA 3HCMA 5F6TA 1S6JA 1B4CA 1WRLA 2FOTA 1CKKA 1B7TZ 3BUOB 3LK0A 1WLMA 1Y1UA 4USLA 3GOFA 3RLZA 2LV7A 2O60A 2BCBA 1JUOA 4OVNF 1K95A 4N1FA 2JNXA
chains in the Genus database with same CATH superfamily
1W9ZA 3Q8IA 5HKWA 4MZJA 3GK2A 1DJXA 2WCFA 1BOCA 3NSOA 3OBVA 1YURA 3TUYB 1C07A 2WC5A 1PSRA 2LHIA 1SCVA 1XK4A 2SCPA 3DF0A 2RGIA 3VRRA 5I2QA 4HRHA 4GGFA 3DZTA 3FWCA 2F2OA 2EC6C 2NCPA 5DICA 1NX0A 1OE9B 5ER4X 3PSRA 4YGEB 5I2LA 1F70A 2ZNEA 3NHTA 3S0GA 1M39A 2LCPA 1QV0A 3DXLA 1T14A 1XFRA 3LL8B 4INWA 1PVAA 1SY9A 2JT0A 2WC6A 2KAYA 2LVVA 2JULA 5D69A 4ZCVA 2Y4QA 4YI9A 3D76A 3TDIA 4E68A 3IF7A 1KK7Y 1JSAA 1SL7A 2KFGA 3NXAA 1XFXO 1EH2A 2E6WA 1JFJA 3TS5B 4A4BA 2LMVA 1G8IA 1H8BA 2M29A 3VRPA 2WCLA 3DVKA 3PM2A 3IVTA 1J7QA 1CM1A 2Q4UA 1S5GZ 1OOIX 1SMGA 2JOJA 3CWGA 4NDBA 2BL0B 1XK4C 1NX1A 3EVVA 1NCYA 1TUZA 1RECA 1HT9A 3BUNB 4GFTA 3SIAA 2MAZA 4DCKA 1XVJA 2M8UA 4M2PA 1CLBA 4PE1A 4Q04A 2L98A 1QX2A 3S0EA 3V2LA 1QIWA 3SS4A 4DUQA 2KAVA 2JQ6A 2LC5A 3VRQA 3R1PA 1GGZA 1LA3A 2P71A 3EG5B 2I94A 4PDZA 5HL1A 1R2UA 2GTEA 3CS1A 2QDIA 1B1GA 2K7BA 2K0JA 3BFHA 3D77A 2LE9B 2QEBA 3AAJA 1BJFA 1V1FA 3CR4X 4WQ3A 1MWNA 2K61A 2KYCA 1M45A 2CXJA 3I5HC 2L2CA 3M0WA 1MHOA 1EG3A 1IIOA 1KFUL 3A8RA 1BR4B 2MA2A 2OS8C 2CBLA 5FYXA 3TUYC 2P70A 1ZACA 2LLTA 3SS5A 4QJ5B 1OOJA 3LK1A 4KYNA 3S0DA 2I18A 2KQ6A 3NSIA 1RROA 1TUJA 2PVBA 3D0YB 1XFVO 1XA5A 2EHBA 1RFJA 1NYAA 5HYDA 1K94A 1UP5A 4GNKB 1H4BA 2GGMA 1CFDA 3FE8A 2JWWA 2QEHA 2JXCA 1EJ3A 2BCAA 3ZWHA 1CMGA 2PRUA 2BECA 2NLNA 1ZMZA 3CYZA 3L47A 1IJ5A 2OPOA 2KPHA 2M1UA 2V53A 2NZ0A 3NHIA 2BKIB 4QJ3B 4WRIA 4YI8A 2M7LA 3BXKA 3RM1A 2M7NA 2NXQA 1F4OA 3CR2A 2K7OA 1C7WA 1K8UA 4CPVA 3CABA 2LM5A 4N5XA 3IQOA 1OZSA 2PALA 2JRFA 1QVIZ 1IGVA 3JVTC 1N2DA 1SCMC 5AXIA 5CSIA 1PALA 1LXFC 3EK7A 2WCHA 1BODA 3TS5C 1KSMA 1BF5A 1A29A 1X02A 1S26D 1UHJA 1QWVA 1HQVA 1YUTA 1PULA 1QX5B 1AJ4A 3H4SE 1TN4A 2FCEA 3JTDC 2HF5A 1U5IB 2ZRTA 1TNXA 3JTDB 5DKNA 5ER5A 1K9PA 1TTXA 3B87A 1WRZA 2K2FA 3QRXA 4AQJA 2KSPA 4FQTA 1K93D 4YGAA 4QJ4B 2KYFA 3K21A 1F4QA 3I5GB 3JVTB 1AHRA 4OZDA 1ALWA 3A4UB 3KHEA 3SG7A 3CZTX 3OGNA 2LUXA 2BAPA 2EGDA 4JQ0D 3E3RA 5PALA 4PHKA 2FJUB 1W7IB 1XFYO 1ORGA 2KLDA 4ORAB 4U8DA 1DT7B 4PE4A 3WHUB 1F8HA 2Y1MA 3OP0A 1LA0A 2MLEC 3SJSA 4M2QA 2JNFA 2IS9A 1RWYA 3KPXA 3PM8A 2ZKMX 1YRTB 1NX3A 5G08A 4ORBB 5HKZA 1RK9A 3DF0B 2H2KA 3OX6A 1TRFA 1WLZA 2L51A 1AUIB 1UHNA 1U5IA 4DIRA 1CDPA 1SBJA 2R2IA 1D1OA 2L4IA 4MZLA 1XYDA 5KSZA 2KI4C 4M2OA 1DQEA 1RTP1 2AUCA 2BNXA 1B8LA 3B86A 1PVBA 2M3WA 2KQYA 2BCXA 2HETA 5D7FA 1TCOB 4HRGA 4PE0A 2WORA 3HX4A 2WCKA 2M0RA 1IQ3A 5J3XA 1B8CA 1EL4A 1IRJA 1KFXS 1MUXA 1OZOA 1SKTA 2LUCA 3CDNA 3DYEA 5HLOA 2KLEA 1JWDA 3CGAA 1TWOA 3TDZA 1IH0A 1KFUS 1TNPA 4OR9B 4CIDA 1TOPA 1N65A 2M9GA 1L2OC 4FTGA 2L5XB 4MBEA 4N1GA 1WDCB 1Z2CB 3WHTB 3BFAA 3FE6A 4AOMA 2OTGC 2H61A 3DVEA 2JT8A 2K60A 3BYAA 1KFXL 4JKTA 4MEWA 1JC2A 1NCZA 2LVKA 3EKHA 1DJGA 3EVRA 1QS7A 1QXPA 2LLUA 3CZ1A 2F8PA 1NSHA 4MRYA 2CTNA 1QIVA 2H8VA 3S0BA 4D1EA 2COLB 2KFFA 3CZ0A 1NWDA 1E8AA 1QLSA 1XO5A 2ZN8A 2I2RE 1FPWA 2LLSA 1UHKA 1FBVA 4HSZA 1DJIA 1KSOA 1YUUA 1JFKA 3I5IB 2KNEA 1OOGA 2BE4A 2ZRSA 1CDNA 4OV2A 1MXLC 2K7CA 2F2PA 3K1EA 3PALA 3PFVA 3PN7B 2LAPA 1BMOA 3BUXB 3EKJA 3WXAA 3PATA 1EG4A 1CNPA 1UHIA 4JPZB 3S0FA 4PCWA 2F3ZA 1CFFA 2LMTA 1CFPA 1S3PA 4P5OE 1UHHA 3UO9A 1FW4A 3FWBA 5JJGA 1DTLA 1LS8A 1TCFA 1AP4A 1K9UA 2M49B 3I5HB 2OTGB 3I5IC 4ETOA 4BY5A 2NCOA 3KO0A 5I8NA 3BJHA 2KI6D 1G33A 2LVIA 1KK7Z 3VRNA 1MF8B 3TDUA 3B6XA 3O4YA 3SG5A 4IJ7A 5AFPA 1K90D 1VRKA 2EC6B 1IG5A 2MRDA 1AJ5A 1DEKA 4YGCB 4F7FA 1PK0D 2KBMA 4OCIA 1M31A 3BFBA 2JPTA 3B7AA 1QLKA 1YX7A 2G9BA 2QEVA 1B9AA 5FI2A 1BR1B 3O4XA 4ICBA 1J1DA 2E30A 5HLVA 3AKAA 2BE6A 3SS3A 3ZNIA 1GGWA 1YX8A 2PQLA 3LLEA 2PYQA 1BU3A 4NQGA 1DELA 1JF0A 3UNWA 4AQIA 2CCMA 1YR5A 5IBWA 1TNWA 2Y1NA 1MR8A 1SR6B 1XFZO 2ZNDA 4YBHB 1QASA 3BUWB 3FS7A 2BL0C 3DY9A 4PHMA 2KHNA 4MRXA 4MVFA 4DRWA 3R72A 1Z4HA 1A75A 3SIBA 4WQ2A 5B8IB 1IKUA 1DF0B 1CMFA 1DJHA 1KCYA 1IWQA 3NSLA 2JZIA 2OS8B 2KFHA 1Y1AA 4JD9A 1XFUO 2JU0A 1B47A 4I5NB 3O2PA 1J7OA 4GBAA 1PRWA 1L2OB 2MJWB 5DKQA 1KQMB 1A03A 2L0PA 4A4CA 4CFRA 3S0AA 4GAOA 1SCMB 2KDHA 1CLLA 1A4PA 3I5GC 1BG1A 1A2XA 2QPTA 3BUMB 1CFCA 2KBIA 2Y5IA 3VROA 1IQ5A 3BOWA 1WRKA 1LKJA 2O5GA 5AEQA 3EK4A 1SPYA 1BLQA 3SG6A 1P28A 3CLNA 2JTTA 4DS7A 1IJ6A 4P2YB 1S1EA 1SW8A 1Y1XA 1J55A 2HQ8A 1S6CA 3FE9A 1OMDA 1CLMA 1UWOA 1ZOTB 3RZSA 1M46A 2ERBA 4GGFC 1KK8C 1ZFSA 1NIWA 1SL8A 1GQMA 1CM4A 1QTXA 1S36A 1W7JB 3KF9A 5AANA 4C0LA 1KQMC 2TN4A 1KWOC 1OOHA 1K96A 2L4HA 1KWOB 1YRUB 3C1VA 4PE7A 1OQPA 3WNXB 5JOLA 1S6IA 1SRAA 1RJVA 2ZN9A 3GK4X 4UPGA 2WOSA 3GK1A 1DGUA 5I94A 3D74A 5I2OA 4CFQA 4MSPA 2LP3A 1B7TY 3PN7C 4XYNA 4GGNA 2JT3A 4TNCA 3I5FB 2PASA 2KI4B 2LP2A 2QACA 2WCMA 3AAKA 3D78A 2SASA 4JWQA 4XJKA 1V1GA 2ISDA 2PSRA 1OMVA 1GM0A 1MXEA 3N7HA 4GUKA 3SG4A 4F0ZB 1CB1A 2CT9A 3L4LA 3BOWB 1NPQA 3PLFB 2DOQA 2D8NA 1OMRA 1SSEB 5HKYA 4MZKA 2WC8A 4I5KA 5TNCA 1PSBA 3ICBA 5KTYA 3NSKA 1YVLA 3B88A 4PT1A 1DGVA 1LVCD 3O78A 3OX5A 1ODBA 5CSNA 3VB1A 1JBAA 3I5FC 1F71A 3D10A 1C7VA 3CZ2A 4CLNA 5K89A 1FF1A 1FI5A 2PMYA 3O6BA 4YRUA 1DVIA 2LHLA 2P6BB 1C3ZA 4PALA 5GQQC 1ZUZA 1Q80A 2G2BA 1OOFA 4XJKB 4PHJA 1XFWO 2MHHA 2KAXA 1M63B 1UUSA 3NGVA 4ZCUA 2L5YA 1S5GY 2JXLA 5FI6A 1QV1A 4IL1A 1YTZC 2LMUA 5CSJA 2ZFDA 4HREE 1DJWA 1NUBA 4BY4A 1B8RA 4NDDA 1DC1A 2F3YA 2JTZA 3DVMA 1TIZA 4GPLB 1QATA 1Y0VH 2BBNA 3DD4A 1CDLA 3SG2A 3OB1B 2F33A 3VGOA 3OB2B 4INXA 5EL2A 1TNQA 4C0JA 3D73A 3FIAA 2A4JA 1K9KA 2VRGA 4MN0A 1J1EA 2WCEA 1SK6D 1AK8A 1GJYA 1KK8B 2BKHB 3R1OA 1J7RA 2L2EA 2QEOA 4YGBB 5D3OA 2M97A 4FQOA 1J7PA 2CNPA 1LINA 4I5LB 2AAOA 1ALVA 3IQQA 2KI6C 1OSAA 2WCBA 1NCXA 3TZ1A 5KU1A 1F54A 3D0YA 2K8MB 3OHMB 1K2HA 3SG3A 5AERA 2B1UA 3MSEB 1N0YA 3F45A 1G4YR 1SL9A 1CDMA 4L9MA 3D75A 1DMOA 1YUSA 4MLWA 2LNKA 1KQVA 1C3YA 1UURA 2BBMA 3KEVA 2HPSA 4I5JA 3EVUA 4R1EA 1NX2A 4ORCB 2GGZA 2K2AA 3L4AA 1A75B 1EXRA 1QX7A 5DKRA 1DF0A 1WY9A 2MLFC 4NDCA 4C0KA 5CPVA 2KGRA 1OW4A 2JC2A 2L50A 1NP8A 3PJIA 2FCDA 1MQ1A 5FI7A 3BQ3A 4N1FA 2K7DA 1YVHA 2FJYA 2M1KB 1R6PA 1JF2A 5BPJA 5CSFA 3CR5X 2WCJA 1SR6C 2HQWA 2LANA 1Y6WA 1DJZA 2H61C 3LCPC 3R1VA 2Q91A 4YGDB 2KOTA 1L7ZA 1SYMA 2I7AA 2AMIA 2GV5A 1F55A 1QVIY 1QJTA 4PHNA 2KGBC 1FI6A 2LVJA 1WDCC 1CTRA 1BT6A 4OKHA 1DJYA 3DVJA 3CTNA 3EK8A 3AKBA 1AVSA 2JPOA 3QMEA 2MBXA 2WNDA 1SNLA 3HCMA 5F6TA 1S6JA 1B4CA 1WRLA 2FOTA 1CKKA 1B7TZ 3BUOB 3LK0A 1WLMA 1Y1UA 4USLA 3GOFA 3RLZA 2LV7A 2O60A 2BCBA 1JUOA 4OVNF 1K95A 2YGUA 2JNXA
chains in the Genus database with same CATH topology
5HKWA 4MZJA 3GK2A 1DJXA 2WCFA 1BOCA 3NSOA 1C07A 1YURA 3TUYB 1PSRA 2LHIA 1SCVA 1XK4A 2SCPA 3DF0A 2RGIA 3VRRA 5I2QA 4HRHA 4GGFA 3FWCA 2F2OA 2EC6C 2NCPA 5I2LA 1NX0A 1OE9B 5ER4X 3PSRA 4YGEB 1F70A 2ZNEA 1M39A 2LCPA 1QV0A 3LL8B 1PVAA 1SY9A 2JT0A 2KAYA 2LVVA 2JULA 5D69A 4ZCVA 2Y4QA 4YI9A 3TDIA 4E68A 3IF7A 1KK7Y 1JSAA 1SL7A 2KFGA 3NXAA 1XFXO 1EH2A 2E6WA 1JFJA 3TS5B 4A4BA 2LMVA 1G8IA 1H8BA 2M29A 3VRPA 3DVKA 1J7QA 1CM1A 2Q4UA 1S5GZ 1SMGA 2JOJA 3CWGA 4NDBA 2BL0B 1XK4C 1NX1A 3EVVA 1NCYA 4GFTA 1RECA 1HT9A 3BUNB 3SIAA 2MAZA 4DCKA 1XVJA 2M8UA 4M2PA 1CLBA 4PE1A 4Q04A 2L98A 1QX2A 1QIWA 4DUQA 2KAVA 2JQ6A 2LC5A 3VRQA 1GGZA 1LA3A 2I94A 4PDZA 1R2UA 3CS1A 1B1GA 2K7BA 2K0JA 2LE9B 3AAJA 1BJFA 1V1FA 3CR4X 4WQ3A 1MWNA 2K61A 2KYCA 1M45A 2CXJA 3I5HC 3M0WA 1MHOA 1EG3A 1KFUL 3A8RA 1BR4B 2MA2A 2OS8C 2CBLA 5FYXA 3TUYC 1ZACA 2LLTA 4QJ5B 1OOJA 3LK1A 2I18A 2KQ6A 3NSIA 1RROA 2PVBA 3D0YB 1XFVO 1XA5A 2EHBA 1RFJA 1NYAA 5HYDA 1K94A 1UP5A 4GNKB 1H4BA 2GGMA 1CFDA 2JWWA 2JXCA 1EJ3A 2BCAA 3ZWHA 1CMGA 2PRUA 2BECA 2NLNA 1ZMZA 1IJ5A 2OPOA 2M1UA 2V53A 4WRIA 2NZ0A 2M7LA 2BKIB 4QJ3B 4YI8A 3RM1A 3BXKA 2M7NA 2NXQA 1F4OA 3CR2A 2K7OA 1C7WA 1K8UA 4CPVA 2LM5A 4N5XA 3IQOA 1OZSA 2PALA 2JRFA 1QVIZ 1IGVA 3JVTC 1N2DA 1SCMC 5AXIA 5CSIA 1PALA 1LXFC 3EK7A 1BODA 3TS5C 1KSMA 1BF5A 1A29A 1X02A 1S26D 1UHJA 1HQVA 1YUTA 1PULA 1QX5B 1AJ4A 3H4SE 1TN4A 2FCEA 3JTDC 2HF5A 1U5IB 2ZRTA 1TNXA 3JTDB 5DKNA 5ER5A 1K9PA 1TTXA 1WRZA 2K2FA 3QRXA 4AQJA 2KSPA 1K93D 4YGAA 4QJ4B 2KYFA 3K21A 1F4QA 3I5GB 3JVTB 1AHRA 1ALWA 3A4UB 3KHEA 3SG7A 3CZTX 2LUXA 2EGDA 4JQ0D 3E3RA 5PALA 4PHKA 2FJUB 1W7IB 1XFYO 4ORAB 4U8DA 1DT7B 4PE4A 3WHUB 1F8HA 2Y1MA 3OP0A 1LA0A 2MLEC 3SJSA 4M2QA 2JNFA 2IS9A 1RWYA 3KPXA 3PM8A 2ZKMX 1YRTB 1NX3A 5G08A 4ORBB 5HKZA 1RK9A 3DF0B 2H2KA 3OX6A 1TRFA 1WLZA 2L51A 1AUIB 1UHNA 1U5IA 4DIRA 1CDPA 1SBJA 2R2IA 1D1OA 2L4IA 4MZLA 1XYDA 5KSZA 2KI4C 4M2OA 2AUCA 1RTP1 1B8LA 1PVBA 2M3WA 2KQYA 2BCXA 2HETA 5D7FA 1TCOB 4HRGA 4PE0A 2WORA 3HX4A 2M0RA 1IQ3A 5J3XA 1B8CA 1EL4A 1IRJA 1KFXS 1MUXA 1OZOA 1SKTA 2LUCA 5HLOA 1JWDA 3CGAA 3TDZA 1IH0A 1KFUS 1TNPA 4OR9B 4CIDA 1TOPA 1N65A 2M9GA 1L2OC 4FTGA 2L5XB 4MBEA 4N1GA 1WDCB 3WHTB 4AOMA 2OTGC 2H61A 3DVEA 2JT8A 4MEWA 3BYAA 1KFXL 1JC2A 1NCZA 2LVKA 3EKHA 1DJGA 3EVRA 1QS7A 1QXPA 2LLUA 2F8PA 1NSHA 4MRYA 2CTNA 1QIVA 4D1EA 2COLB 2KFFA 1NWDA 1E8AA 1QLSA 1XO5A 2ZN8A 2I2RE 1FPWA 2LLSA 1UHKA 1FBVA 4HSZA 1DJIA 1KSOA 1YUUA 1JFKA 3I5IB 2KNEA 2BE4A 2ZRSA 1CDNA 4OV2A 1MXLC 2K7CA 2F2PA 3PALA 3PFVA 3PN7B 2LAPA 1BMOA 3BUXB 3EKJA 3WXAA 3PATA 1EG4A 1CNPA 1UHIA 4JPZB 1CFFA 4PCWA 2F3ZA 2LMTA 1CFPA 1S3PA 4P5OE 1UHHA 1FW4A 3FWBA 5JJGA 1DTLA 1AP4A 1TCFA 1K9UA 2M49B 3I5HB 2OTGB 3I5IC 4ETOA 4BY5A 2NCOA 3KO0A 5I8NA 2KI6D 1G33A 2LVIA 1KK7Z 3VRNA 1MF8B 3TDUA 3O4YA 3SG5A 5AFPA 1K90D 1VRKA 2EC6B 1IG5A 2MRDA 1AJ5A 4YGCB 1PK0D 2KBMA 4OCIA 1M31A 2JPTA 1QLKA 1YX7A 2G9BA 1B9AA 1BR1B 4ICBA 1J1DA 2E30A 5HLVA 3AKAA 2BE6A 3ZNIA 1GGWA 1YX8A 3LLEA 1BU3A 4NQGA 1JF0A 4AQIA 2CCMA 1YR5A 5IBWA 1TNWA 2Y1NA 1MR8A 1SR6B 1XFZO 2ZNDA 4YBHB 1QASA 3BUWB 3FS7A 2BL0C 4PHMA 2KHNA 4MRXA 4MVFA 4DRWA 1A75A 3SIBA 4WQ2A 5B8IB 1IKUA 1DF0B 1CMFA 1DJHA 1KCYA 1IWQA 3NSLA 2JZIA 2OS8B 2KFHA 1Y1AA 1XFUO 2JU0A 1B47A 4I5NB 3O2PA 1J7OA 4GBAA 1PRWA 1L2OB 2MJWB 5DKQA 1KQMB 1A03A 2L0PA 4A4CA 4CFRA 4GAOA 1SCMB 2KDHA 1CLLA 1A4PA 3I5GC 1BG1A 1A2XA 2QPTA 3BUMB 1CFCA 2KBIA 2Y5IA 3VROA 1IQ5A 3BOWA 1WRKA 1LKJA 2O5GA 5AEQA 3EK4A 1SPYA 1BLQA 3SG6A 3CLNA 2JTTA 4DS7A 1IJ6A 4P2YB 1S1EA 1SW8A 1Y1XA 1J55A 2HQ8A 1S6CA 1OMDA 1CLMA 1UWOA 1ZOTB 1M46A 4GGFC 1KK8C 1ZFSA 1NIWA 1SL8A 1GQMA 1CM4A 1QTXA 1S36A 1W7JB 3KF9A 5AANA 4C0LA 1KQMC 2TN4A 1KWOC 1K96A 2L4HA 1KWOB 1YRUB 3C1VA 4PE7A 1OQPA 3WNXB 5JOLA 1S6IA 1SRAA 1RJVA 2ZN9A 3GK4X 4UPGA 2WOSA 3GK1A 1DGUA 5I2OA 4CFQA 4MSPA 2LP3A 1B7TY 3PN7C 4XYNA 4GGNA 2JT3A 4TNCA 3I5FB 2PASA 2KI4B 2LP2A 2QACA 4JWQA 3AAKA 4XJKA 2SASA 1V1GA 2ISDA 2PSRA 1OMVA 1MXEA 4GUKA 3SG4A 4F0ZB 1CB1A 2CT9A 3BOWB 1NPQA 3PLFB 2DOQA 2D8NA 1OMRA 5HKYA 4MZKA 2WC8A 4I5KA 5TNCA 1PSBA 3ICBA 5KTYA 3NSKA 1YVLA 1DGVA 1LVCD 3O78A 3OX5A 1ODBA 5CSNA 1JBAA 3I5FC 1F71A 3D10A 1C7VA 4CLNA 5K89A 1FF1A 1FI5A 2PMYA 3O6BA 4YRUA 1DVIA 2LHLA 2P6BB 4PALA 5GQQC 1ZUZA 1Q80A 2G2BA 4XJKB 4PHJA 1XFWO 2MHHA 2KAXA 1M63B 1UUSA 4ZCUA 1S5GY 2JXLA 1QV1A 4IL1A 1YTZC 2LMUA 5CSJA 2ZFDA 4HREE 1DJWA 1NUBA 4BY4A 1B8RA 4NDDA 2F3YA 2JTZA 3DVMA 1TIZA 4GPLB 1QATA 1Y0VH 2BBNA 3DD4A 1CDLA 3SG2A 3OB1B 2F33A 3VGOA 3OB2B 1TNQA 4C0JA 3FIAA 2A4JA 1K9KA 2VRGA 4MN0A 1J1EA 2WCEA 1SK6D 1AK8A 1GJYA 1KK8B 2BKHB 4YGBB 1J7RA 2L2EA 2M97A 4FQOA 1J7PA 2CNPA 1LINA 4I5LB 2AAOA 1ALVA 3IQQA 2KI6C 1OSAA 2WCBA 1NCXA 3TZ1A 5KU1A 1F54A 3D0YA 2K8MB 3OHMB 1K2HA 3SG3A 5AERA 2B1UA 3MSEB 1N0YA 3F45A 1G4YR 1SL9A 1CDMA 4L9MA 1DMOA 1YUSA 4MLWA 2LNKA 1KQVA 1UURA 2BBMA 3KEVA 2HPSA 4I5JA 3EVUA 4R1EA 1NX2A 4ORCB 2GGZA 2K2AA 1A75B 1EXRA 1QX7A 5DKRA 1DF0A 1WY9A 2MLFC 4NDCA 4C0KA 5CPVA 2KGRA 2JC2A 2L50A 1NP8A 2FCDA 1MQ1A 3BQ3A 2K7DA 1YVHA 2M1KB 1R6PA 1JF2A 5BPJA 5CSFA 3CR5X 1SR6C 2HQWA 2LANA 1Y6WA 1DJZA 2H61C 3LCPC 2Q91A 4YGDB 2KOTA 1L7ZA 1SYMA 2I7AA 2AMIA 2GV5A 1F55A 1QVIY 1QJTA 4PHNA 2KGBC 1FI6A 2LVJA 1WDCC 1CTRA 1BT6A 4OKHA 1DJYA 3DVJA 3CTNA 3EK8A 3AKBA 1AVSA 2MBXA 2WNDA 1SNLA 3HCMA 5F6TA 1S6JA 1B4CA 1WRLA 2FOTA 1CKKA 1B7TZ 3BUOB 3LK0A 1WLMA 1Y1UA 4USLA 3GOFA 3RLZA 2LV7A 2O60A 2BCBA 1JUOA 4OVNF 1K95A 4N1FA 2JNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HKW A;  4MZJ A;  3GK2 A;  1DJX A;  2WCF A;  1BOC A;  3NSO A;  1C07 A;  1YUR A;  3TUY B;  1PSR A;  2LHI A;  1SCV A;  1XK4 A;  2SCP A;  3DF0 A;  2RGI A;  3VRR A;  5I2Q A;  4HRH A;  4GGF A;  3FWC A;  2F2O A;  2EC6 C;  2NCP A;  5I2L A;  1NX0 A;  1OE9 B;  5ER4 X;  3PSR A;  4YGE B;  1F70 A;  2ZNE A;  1M39 A;  2LCP A;  1QV0 A;  3LL8 B;  1PVA A;  1SY9 A;  2JT0 A;  2KAY A;  2LVV A;  2JUL A;  5D69 A;  4ZCV A;  2Y4Q A;  4YI9 A;  3TDI A;  4E68 A;  3IF7 A;  1KK7 Y;  1JSA A;  1SL7 A;  2KFG A;  3NXA A;  1XFX O;  1EH2 A;  2E6W A;  1JFJ A;  3TS5 B;  4A4B A;  2LMV A;  1G8I A;  1H8B A;  2M29 A;  3VRP A;  3DVK A;  1J7Q A;  1CM1 A;  2Q4U A;  1S5G Z;  1SMG A;  2JOJ A;  3CWG A;  4NDB A;  2BL0 B;  1XK4 C;  1NX1 A;  3EVV A;  1NCY A;  4GFT A;  1REC A;  1HT9 A;  3BUN B;  3SIA A;  2MAZ A;  4DCK A;  1XVJ A;  2M8U A;  4M2P A;  1CLB A;  4PE1 A;  4Q04 A;  2L98 A;  1QX2 A;  1QIW A;  4DUQ A;  2KAV A;  2JQ6 A;  2LC5 A;  3VRQ A;  1GGZ A;  1LA3 A;  2I94 A;  4PDZ A;  1R2U A;  3CS1 A;  1B1G A;  2K7B A;  2K0J A;  2LE9 B;  3AAJ A;  1BJF A;  1V1F A;  3CR4 X;  4WQ3 A;  1MWN A;  2K61 A;  2KYC A;  1M45 A;  2CXJ A;  3I5H C;  3M0W A;  1MHO A;  1EG3 A;  1KFU L;  3A8R A;  1BR4 B;  2MA2 A;  2OS8 C;  2CBL A;  5FYX A;  3TUY C;  1ZAC A;  2LLT A;  4QJ5 B;  1OOJ A;  3LK1 A;  2I18 A;  2KQ6 A;  3NSI A;  1RRO A;  2PVB A;  3D0Y B;  1XFV O;  1XA5 A;  2EHB A;  1RFJ A;  1NYA A;  5HYD A;  1K94 A;  1UP5 A;  4GNK B;  1H4B A;  2GGM A;  1CFD A;  2JWW A;  2JXC A;  1EJ3 A;  2BCA A;  3ZWH A;  1CMG A;  2PRU A;  2BEC A;  2NLN A;  1ZMZ A;  1IJ5 A;  2OPO A;  2M1U A;  2V53 A;  4WRI A;  2NZ0 A;  2M7L A;  2BKI B;  4QJ3 B;  4YI8 A;  3RM1 A;  3BXK A;  2M7N A;  2NXQ A;  1F4O A;  3CR2 A;  2K7O A;  1C7W A;  1K8U A;  4CPV A;  2LM5 A;  4N5X A;  3IQO A;  1OZS A;  2PAL A;  2JRF A;  1QVI Z;  1IGV A;  3JVT C;  1N2D A;  1SCM C;  5AXI A;  5CSI A;  1PAL A;  1LXF C;  3EK7 A;  1BOD A;  3TS5 C;  1KSM A;  1BF5 A;  1A29 A;  1X02 A;  1S26 D;  1UHJ A;  1HQV A;  1YUT A;  1PUL A;  1QX5 B;  1AJ4 A;  3H4S E;  1TN4 A;  2FCE A;  3JTD C;  2HF5 A;  1U5I B;  2ZRT A;  1TNX A;  3JTD B;  5DKN A;  5ER5 A;  1K9P A;  1TTX A;  1WRZ A;  2K2F A;  3QRX A;  4AQJ A;  2KSP A;  1K93 D;  4YGA A;  4QJ4 B;  2KYF A;  3K21 A;  1F4Q A;  3I5G B;  3JVT B;  1AHR A;  1ALW A;  3A4U B;  3KHE A;  3SG7 A;  3CZT X;  2LUX A;  2EGD A;  4JQ0 D;  3E3R A;  5PAL A;  4PHK A;  2FJU B;  1W7I B;  1XFY O;  4ORA B;  4U8D A;  1DT7 B;  4PE4 A;  3WHU B;  1F8H A;  2Y1M A;  3OP0 A;  1LA0 A;  2MLE C;  3SJS A;  4M2Q A;  2JNF A;  2IS9 A;  1RWY A;  3KPX A;  3PM8 A;  2ZKM X;  1YRT B;  1NX3 A;  5G08 A;  4ORB B;  5HKZ A;  1RK9 A;  3DF0 B;  2H2K A;  3OX6 A;  1TRF A;  1WLZ A;  2L51 A;  1AUI B;  1UHN A;  1U5I A;  4DIR A;  1CDP A;  1SBJ A;  2R2I A;  1D1O A;  2L4I A;  4MZL A;  1XYD A;  5KSZ A;  2KI4 C;  4M2O A;  2AUC A;  1RTP 1;  1B8L A;  1PVB A;  2M3W A;  2KQY A;  2BCX A;  2HET A;  5D7F A;  1TCO B;  4HRG A;  4PE0 A;  2WOR A;  3HX4 A;  2M0R A;  1IQ3 A;  5J3X A;  1B8C A;  1EL4 A;  1IRJ A;  1KFX S;  1MUX A;  1OZO A;  1SKT A;  2LUC A;  5HLO A;  1JWD A;  3CGA A;  3TDZ A;  1IH0 A;  1KFU S;  1TNP A;  4OR9 B;  4CID A;  1TOP A;  1N65 A;  2M9G A;  1L2O C;  4FTG A;  2L5X B;  4MBE A;  4N1G A;  1WDC B;  3WHT B;  4AOM A;  2OTG C;  2H61 A;  3DVE A;  2JT8 A;  4MEW A;  3BYA A;  1KFX L;  1JC2 A;  1NCZ A;  2LVK A;  3EKH A;  1DJG A;  3EVR A;  1QS7 A;  1QXP A;  2LLU A;  2F8P A;  1NSH A;  4MRY A;  2CTN A;  1QIV A;  4D1E A;  2COL B;  2KFF A;  1NWD A;  1E8A A;  1QLS A;  1XO5 A;  2ZN8 A;  2I2R E;  1FPW A;  2LLS A;  1UHK A;  1FBV A;  4HSZ A;  1DJI A;  1KSO A;  1YUU A;  1JFK A;  3I5I B;  2KNE A;  2BE4 A;  2ZRS A;  1CDN A;  4OV2 A;  1MXL C;  2K7C A;  2F2P A;  3PAL A;  3PFV A;  3PN7 B;  2LAP A;  1BMO A;  3BUX B;  3EKJ A;  3WXA A;  3PAT A;  1EG4 A;  1CNP A;  1UHI A;  4JPZ B;  1CFF A;  4PCW A;  2F3Z A;  2LMT A;  1CFP A;  1S3P A;  4P5O E;  1UHH A;  1FW4 A;  3FWB A;  5JJG A;  1DTL A;  1AP4 A;  1TCF A;  1K9U A;  2M49 B;  3I5H B;  2OTG B;  3I5I C;  4ETO A;  4BY5 A;  2NCO A;  3KO0 A;  5I8N A;  2KI6 D;  1G33 A;  2LVI A;  1KK7 Z;  3VRN A;  1MF8 B;  3TDU A;  3O4Y A;  3SG5 A;  5AFP A;  1K90 D;  1VRK A;  2EC6 B;  1IG5 A;  2MRD A;  1AJ5 A;  4YGC B;  1PK0 D;  2KBM A;  4OCI A;  1M31 A;  2JPT A;  1QLK A;  1YX7 A;  2G9B A;  1B9A A;  1BR1 B;  4ICB A;  1J1D A;  2E30 A;  5HLV A;  3AKA A;  2BE6 A;  3ZNI A;  1GGW A;  1YX8 A;  3LLE A;  1BU3 A;  4NQG A;  1JF0 A;  4AQI A;  2CCM A;  1YR5 A;  5IBW A;  1TNW A;  2Y1N A;  1MR8 A;  1SR6 B;  1XFZ O;  2ZND A;  4YBH B;  1QAS A;  3BUW B;  3FS7 A;  2BL0 C;  4PHM A;  2KHN A;  4MRX A;  4MVF A;  4DRW A;  1A75 A;  3SIB A;  4WQ2 A;  5B8I B;  1IKU A;  1DF0 B;  1CMF A;  1DJH A;  1KCY A;  1IWQ A;  3NSL A;  2JZI A;  2OS8 B;  2KFH A;  1Y1A A;  1XFU O;  2JU0 A;  1B47 A;  4I5N B;  3O2P A;  1J7O A;  4GBA A;  1PRW A;  1L2O B;  2MJW B;  5DKQ A;  1KQM B;  1A03 A;  2L0P A;  4A4C A;  4CFR A;  4GAO A;  1SCM B;  2KDH A;  1CLL A;  1A4P A;  3I5G C;  1BG1 A;  1A2X A;  2QPT A;  3BUM B;  1CFC A;  2KBI A;  2Y5I A;  3VRO A;  1IQ5 A;  3BOW A;  1WRK A;  1LKJ A;  2O5G A;  5AEQ A;  3EK4 A;  1SPY A;  1BLQ A;  3SG6 A;  3CLN A;  2JTT A;  4DS7 A;  1IJ6 A;  4P2Y B;  1S1E A;  1SW8 A;  1Y1X A;  1J55 A;  2HQ8 A;  1S6C A;  1OMD A;  1CLM A;  1UWO A;  1ZOT B;  1M46 A;  4GGF C;  1KK8 C;  1ZFS A;  1NIW A;  1SL8 A;  1GQM A;  1CM4 A;  1QTX A;  1S36 A;  1W7J B;  3KF9 A;  5AAN A;  4C0L A;  1KQM C;  2TN4 A;  1KWO C;  1K96 A;  2L4H A;  1KWO B;  1YRU B;  3C1V A;  4PE7 A;  1OQP A;  3WNX B;  5JOL A;  1S6I A;  1SRA A;  1RJV A;  2ZN9 A;  3GK4 X;  4UPG A;  2WOS A;  3GK1 A;  1DGU A;  5I2O A;  4CFQ A;  4MSP A;  2LP3 A;  1B7T Y;  3PN7 C;  4XYN A;  4GGN A;  2JT3 A;  4TNC A;  3I5F B;  2PAS A;  2KI4 B;  2LP2 A;  2QAC A;  4JWQ A;  3AAK A;  4XJK A;  2SAS A;  1V1G A;  2ISD A;  2PSR A;  1OMV A;  1MXE A;  4GUK A;  3SG4 A;  4F0Z B;  1CB1 A;  2CT9 A;  3BOW B;  1NPQ A;  3PLF B;  2DOQ A;  2D8N A;  1OMR A;  5HKY A;  4MZK A;  2WC8 A;  4I5K A;  5TNC A;  1PSB A;  3ICB A;  5KTY A;  3NSK A;  1YVL A;  1DGV A;  1LVC D;  3O78 A;  3OX5 A;  1ODB A;  5CSN A;  1JBA A;  3I5F C;  1F71 A;  3D10 A;  1C7V A;  4CLN A;  5K89 A;  1FF1 A;  1FI5 A;  2PMY A;  3O6B A;  4YRU A;  1DVI A;  2LHL A;  2P6B B;  4PAL A;  5GQQ C;  1ZUZ A;  1Q80 A;  2G2B A;  4XJK B;  4PHJ A;  1XFW O;  2MHH A;  2KAX A;  1M63 B;  1UUS A;  4ZCU A;  1S5G Y;  2JXL A;  1QV1 A;  4IL1 A;  1YTZ C;  2LMU A;  5CSJ A;  2ZFD A;  4HRE E;  1DJW A;  1NUB A;  4BY4 A;  1B8R A;  4NDD A;  2F3Y A;  2JTZ A;  3DVM A;  1TIZ A;  4GPL B;  1QAT A;  1Y0V H;  2BBN A;  3DD4 A;  1CDL A;  3SG2 A;  3OB1 B;  2F33 A;  3VGO A;  3OB2 B;  1TNQ A;  4C0J A;  3FIA A;  2A4J A;  1K9K A;  2VRG A;  4MN0 A;  1J1E A;  2WCE A;  1SK6 D;  1AK8 A;  1GJY A;  1KK8 B;  2BKH B;  4YGB B;  1J7R A;  2L2E A;  2M97 A;  4FQO A;  1J7P A;  2CNP A;  1LIN A;  4I5L B;  2AAO A;  1ALV A;  3IQQ A;  2KI6 C;  1OSA A;  2WCB A;  1NCX A;  3TZ1 A;  5KU1 A;  1F54 A;  3D0Y A;  2K8M B;  3OHM B;  1K2H A;  3SG3 A;  5AER A;  2B1U A;  3MSE B;  1N0Y A;  3F45 A;  1G4Y R;  1SL9 A;  1CDM A;  4L9M A;  1DMO A;  1YUS A;  4MLW A;  2LNK A;  1KQV A;  1UUR A;  2BBM A;  3KEV A;  2HPS A;  4I5J A;  3EVU A;  4R1E A;  1NX2 A;  4ORC B;  2GGZ A;  2K2A A;  1A75 B;  1EXR A;  1QX7 A;  5DKR A;  1DF0 A;  1WY9 A;  2MLF C;  4NDC A;  4C0K A;  5CPV A;  2KGR A;  2JC2 A;  2L50 A;  1NP8 A;  2FCD A;  1MQ1 A;  3BQ3 A;  2K7D A;  1YVH A;  2M1K B;  1R6P A;  1JF2 A;  5BPJ A;  5CSF A;  3CR5 X;  1SR6 C;  2HQW A;  2LAN A;  1Y6W A;  1DJZ A;  2H61 C;  3LCP C;  2Q91 A;  4YGD B;  2KOT A;  1L7Z A;  1SYM A;  2I7A A;  2AMI A;  2GV5 A;  1F55 A;  1QVI Y;  1QJT A;  4PHN A;  2KGB C;  1FI6 A;  2LVJ A;  1WDC C;  1CTR A;  1BT6 A;  4OKH A;  1DJY A;  3DVJ A;  3CTN A;  3EK8 A;  3AKB A;  1AVS A;  2MBX A;  2WND A;  1SNL A;  3HCM A;  5F6T A;  1S6J A;  1B4C A;  1WRL A;  2FOT A;  1CKK A;  1B7T Z;  3BUO B;  3LK0 A;  1WLM A;  1Y1U A;  4USL A;  3GOF A;  3RLZ A;  2LV7 A;  2O60 A;  2BCB A;  1JUO A;  4OVN F;  1K95 A;  4N1F A;  2JNX A; 
#chains in the Genus database with same CATH topology
 1W9Z A;  3Q8I A;  5HKW A;  4MZJ A;  3GK2 A;  1DJX A;  2WCF A;  1BOC A;  3NSO A;  3OBV A;  1YUR A;  3TUY B;  1C07 A;  2WC5 A;  1PSR A;  2LHI A;  1SCV A;  1XK4 A;  2SCP A;  3DF0 A;  2RGI A;  3VRR A;  5I2Q A;  4HRH A;  4GGF A;  3DZT A;  3FWC A;  2F2O A;  2EC6 C;  2NCP A;  5DIC A;  1NX0 A;  1OE9 B;  5ER4 X;  3PSR A;  4YGE B;  5I2L A;  1F70 A;  2ZNE A;  3NHT A;  3S0G A;  1M39 A;  2LCP A;  1QV0 A;  3DXL A;  1T14 A;  1XFR A;  3LL8 B;  4INW A;  1PVA A;  1SY9 A;  2JT0 A;  2WC6 A;  2KAY A;  2LVV A;  2JUL A;  5D69 A;  4ZCV A;  2Y4Q A;  4YI9 A;  3D76 A;  3TDI A;  4E68 A;  3IF7 A;  1KK7 Y;  1JSA A;  1SL7 A;  2KFG A;  3NXA A;  1XFX O;  1EH2 A;  2E6W A;  1JFJ A;  3TS5 B;  4A4B A;  2LMV A;  1G8I A;  1H8B A;  2M29 A;  3VRP A;  2WCL A;  3DVK A;  3PM2 A;  3IVT A;  1J7Q A;  1CM1 A;  2Q4U A;  1S5G Z;  1OOI X;  1SMG A;  2JOJ A;  3CWG A;  4NDB A;  2BL0 B;  1XK4 C;  1NX1 A;  3EVV A;  1NCY A;  1TUZ A;  1REC A;  1HT9 A;  3BUN B;  4GFT A;  3SIA A;  2MAZ A;  4DCK A;  1XVJ A;  2M8U A;  4M2P A;  1CLB A;  4PE1 A;  4Q04 A;  2L98 A;  1QX2 A;  3S0E A;  3V2L A;  1QIW A;  3SS4 A;  4DUQ A;  2KAV A;  2JQ6 A;  2LC5 A;  3VRQ A;  3R1P A;  1GGZ A;  1LA3 A;  2P71 A;  3EG5 B;  2I94 A;  4PDZ A;  5HL1 A;  1R2U A;  2GTE A;  3CS1 A;  2QDI A;  1B1G A;  2K7B A;  2K0J A;  3BFH A;  3D77 A;  2LE9 B;  2QEB A;  3AAJ A;  1BJF A;  1V1F A;  3CR4 X;  4WQ3 A;  1MWN A;  2K61 A;  2KYC A;  1M45 A;  2CXJ A;  3I5H C;  2L2C A;  3M0W A;  1MHO A;  1EG3 A;  1IIO A;  1KFU L;  3A8R A;  1BR4 B;  2MA2 A;  2OS8 C;  2CBL A;  5FYX A;  3TUY C;  2P70 A;  1ZAC A;  2LLT A;  3SS5 A;  4QJ5 B;  1OOJ A;  3LK1 A;  4KYN A;  3S0D A;  2I18 A;  2KQ6 A;  3NSI A;  1RRO A;  1TUJ A;  2PVB A;  3D0Y B;  1XFV O;  1XA5 A;  2EHB A;  1RFJ A;  1NYA A;  5HYD A;  1K94 A;  1UP5 A;  4GNK B;  1H4B A;  2GGM A;  1CFD A;  3FE8 A;  2JWW A;  2QEH A;  2JXC A;  1EJ3 A;  2BCA A;  3ZWH A;  1CMG A;  2PRU A;  2BEC A;  2NLN A;  1ZMZ A;  3CYZ A;  3L47 A;  1IJ5 A;  2OPO A;  2KPH A;  2M1U A;  2V53 A;  2NZ0 A;  3NHI A;  2BKI B;  4QJ3 B;  4WRI A;  4YI8 A;  2M7L A;  3BXK A;  3RM1 A;  2M7N A;  2NXQ A;  1F4O A;  3CR2 A;  2K7O A;  1C7W A;  1K8U A;  4CPV A;  3CAB A;  2LM5 A;  4N5X A;  3IQO A;  1OZS A;  2PAL A;  2JRF A;  1QVI Z;  1IGV A;  3JVT C;  1N2D A;  1SCM C;  5AXI A;  5CSI A;  1PAL A;  1LXF C;  3EK7 A;  2WCH A;  1BOD A;  3TS5 C;  1KSM A;  1BF5 A;  1A29 A;  1X02 A;  1S26 D;  1UHJ A;  1QWV A;  1HQV A;  1YUT A;  1PUL A;  1QX5 B;  1AJ4 A;  3H4S E;  1TN4 A;  2FCE A;  3JTD C;  2HF5 A;  1U5I B;  2ZRT A;  1TNX A;  3JTD B;  5DKN A;  5ER5 A;  1K9P A;  1TTX A;  3B87 A;  1WRZ A;  2K2F A;  3QRX A;  4AQJ A;  2KSP A;  4FQT A;  1K93 D;  4YGA A;  4QJ4 B;  2KYF A;  3K21 A;  1F4Q A;  3I5G B;  3JVT B;  1AHR A;  4OZD A;  1ALW A;  3A4U B;  3KHE A;  3SG7 A;  3CZT X;  3OGN A;  2LUX A;  2BAP A;  2EGD A;  4JQ0 D;  3E3R A;  5PAL A;  4PHK A;  2FJU B;  1W7I B;  1XFY O;  1ORG A;  2KLD A;  4ORA B;  4U8D A;  1DT7 B;  4PE4 A;  3WHU B;  1F8H A;  2Y1M A;  3OP0 A;  1LA0 A;  2MLE C;  3SJS A;  4M2Q A;  2JNF A;  2IS9 A;  1RWY A;  3KPX A;  3PM8 A;  2ZKM X;  1YRT B;  1NX3 A;  5G08 A;  4ORB B;  5HKZ A;  1RK9 A;  3DF0 B;  2H2K A;  3OX6 A;  1TRF A;  1WLZ A;  2L51 A;  1AUI B;  1UHN A;  1U5I A;  4DIR A;  1CDP A;  1SBJ A;  2R2I A;  1D1O A;  2L4I A;  4MZL A;  1XYD A;  5KSZ A;  2KI4 C;  4M2O A;  1DQE A;  1RTP 1;  2AUC A;  2BNX A;  1B8L A;  3B86 A;  1PVB A;  2M3W A;  2KQY A;  2BCX A;  2HET A;  5D7F A;  1TCO B;  4HRG A;  4PE0 A;  2WOR A;  3HX4 A;  2WCK A;  2M0R A;  1IQ3 A;  5J3X A;  1B8C A;  1EL4 A;  1IRJ A;  1KFX S;  1MUX A;  1OZO A;  1SKT A;  2LUC A;  3CDN A;  3DYE A;  5HLO A;  2KLE A;  1JWD A;  3CGA A;  1TWO A;  3TDZ A;  1IH0 A;  1KFU S;  1TNP A;  4OR9 B;  4CID A;  1TOP A;  1N65 A;  2M9G A;  1L2O C;  4FTG A;  2L5X B;  4MBE A;  4N1G A;  1WDC B;  1Z2C B;  3WHT B;  3BFA A;  3FE6 A;  4AOM A;  2OTG C;  2H61 A;  3DVE A;  2JT8 A;  2K60 A;  3BYA A;  1KFX L;  4JKT A;  4MEW A;  1JC2 A;  1NCZ A;  2LVK A;  3EKH A;  1DJG A;  3EVR A;  1QS7 A;  1QXP A;  2LLU A;  3CZ1 A;  2F8P A;  1NSH A;  4MRY A;  2CTN A;  1QIV A;  2H8V A;  3S0B A;  4D1E A;  2COL B;  2KFF A;  3CZ0 A;  1NWD A;  1E8A A;  1QLS A;  1XO5 A;  2ZN8 A;  2I2R E;  1FPW A;  2LLS A;  1UHK A;  1FBV A;  4HSZ A;  1DJI A;  1KSO A;  1YUU A;  1JFK A;  3I5I B;  2KNE A;  1OOG A;  2BE4 A;  2ZRS A;  1CDN A;  4OV2 A;  1MXL C;  2K7C A;  2F2P A;  3K1E A;  3PAL A;  3PFV A;  3PN7 B;  2LAP A;  1BMO A;  3BUX B;  3EKJ A;  3WXA A;  3PAT A;  1EG4 A;  1CNP A;  1UHI A;  4JPZ B;  3S0F A;  4PCW A;  2F3Z A;  1CFF A;  2LMT A;  1CFP A;  1S3P A;  4P5O E;  1UHH A;  3UO9 A;  1FW4 A;  3FWB A;  5JJG A;  1DTL A;  1LS8 A;  1TCF A;  1AP4 A;  1K9U A;  2M49 B;  3I5H B;  2OTG B;  3I5I C;  4ETO A;  4BY5 A;  2NCO A;  3KO0 A;  5I8N A;  3BJH A;  2KI6 D;  1G33 A;  2LVI A;  1KK7 Z;  3VRN A;  1MF8 B;  3TDU A;  3B6X A;  3O4Y A;  3SG5 A;  4IJ7 A;  5AFP A;  1K90 D;  1VRK A;  2EC6 B;  1IG5 A;  2MRD A;  1AJ5 A;  1DEK A;  4YGC B;  4F7F A;  1PK0 D;  2KBM A;  4OCI A;  1M31 A;  3BFB A;  2JPT A;  3B7A A;  1QLK A;  1YX7 A;  2G9B A;  2QEV A;  1B9A A;  5FI2 A;  1BR1 B;  3O4X A;  4ICB A;  1J1D A;  2E30 A;  5HLV A;  3AKA A;  2BE6 A;  3SS3 A;  3ZNI A;  1GGW A;  1YX8 A;  2PQL A;  3LLE A;  2PYQ A;  1BU3 A;  4NQG A;  1DEL A;  1JF0 A;  3UNW A;  4AQI A;  2CCM A;  1YR5 A;  5IBW A;  1TNW A;  2Y1N A;  1MR8 A;  1SR6 B;  1XFZ O;  2ZND A;  4YBH B;  1QAS A;  3BUW B;  3FS7 A;  2BL0 C;  3DY9 A;  4PHM A;  2KHN A;  4MRX A;  4MVF A;  4DRW A;  3R72 A;  1Z4H A;  1A75 A;  3SIB A;  4WQ2 A;  5B8I B;  1IKU A;  1DF0 B;  1CMF A;  1DJH A;  1KCY A;  1IWQ A;  3NSL A;  2JZI A;  2OS8 B;  2KFH A;  1Y1A A;  4JD9 A;  1XFU O;  2JU0 A;  1B47 A;  4I5N B;  3O2P A;  1J7O A;  4GBA A;  1PRW A;  1L2O B;  2MJW B;  5DKQ A;  1KQM B;  1A03 A;  2L0P A;  4A4C A;  4CFR A;  3S0A A;  4GAO A;  1SCM B;  2KDH A;  1CLL A;  1A4P A;  3I5G C;  1BG1 A;  1A2X A;  2QPT A;  3BUM B;  1CFC A;  2KBI A;  2Y5I A;  3VRO A;  1IQ5 A;  3BOW A;  1WRK A;  1LKJ A;  2O5G A;  5AEQ A;  3EK4 A;  1SPY A;  1BLQ A;  3SG6 A;  1P28 A;  3CLN A;  2JTT A;  4DS7 A;  1IJ6 A;  4P2Y B;  1S1E A;  1SW8 A;  1Y1X A;  1J55 A;  2HQ8 A;  1S6C A;  3FE9 A;  1OMD A;  1CLM A;  1UWO A;  1ZOT B;  3RZS A;  1M46 A;  2ERB A;  4GGF C;  1KK8 C;  1ZFS A;  1NIW A;  1SL8 A;  1GQM A;  1CM4 A;  1QTX A;  1S36 A;  1W7J B;  3KF9 A;  5AAN A;  4C0L A;  1KQM C;  2TN4 A;  1KWO C;  1OOH A;  1K96 A;  2L4H A;  1KWO B;  1YRU B;  3C1V A;  4PE7 A;  1OQP A;  3WNX B;  5JOL A;  1S6I A;  1SRA A;  1RJV A;  2ZN9 A;  3GK4 X;  4UPG A;  2WOS A;  3GK1 A;  1DGU A;  5I94 A;  3D74 A;  5I2O A;  4CFQ A;  4MSP A;  2LP3 A;  1B7T Y;  3PN7 C;  4XYN A;  4GGN A;  2JT3 A;  4TNC A;  3I5F B;  2PAS A;  2KI4 B;  2LP2 A;  2QAC A;  2WCM A;  3AAK A;  3D78 A;  2SAS A;  4JWQ A;  4XJK A;  1V1G A;  2ISD A;  2PSR A;  1OMV A;  1GM0 A;  1MXE A;  3N7H A;  4GUK A;  3SG4 A;  4F0Z B;  1CB1 A;  2CT9 A;  3L4L A;  3BOW B;  1NPQ A;  3PLF B;  2DOQ A;  2D8N A;  1OMR A;  1SSE B;  5HKY A;  4MZK A;  2WC8 A;  4I5K A;  5TNC A;  1PSB A;  3ICB A;  5KTY A;  3NSK A;  1YVL A;  3B88 A;  4PT1 A;  1DGV A;  1LVC D;  3O78 A;  3OX5 A;  1ODB A;  5CSN A;  3VB1 A;  1JBA A;  3I5F C;  1F71 A;  3D10 A;  1C7V A;  3CZ2 A;  4CLN A;  5K89 A;  1FF1 A;  1FI5 A;  2PMY A;  3O6B A;  4YRU A;  1DVI A;  2LHL A;  2P6B B;  1C3Z A;  4PAL A;  5GQQ C;  1ZUZ A;  1Q80 A;  2G2B A;  1OOF A;  4XJK B;  4PHJ A;  1XFW O;  2MHH A;  2KAX A;  1M63 B;  1UUS A;  3NGV A;  4ZCU A;  2L5Y A;  1S5G Y;  2JXL A;  5FI6 A;  1QV1 A;  4IL1 A;  1YTZ C;  2LMU A;  5CSJ A;  2ZFD A;  4HRE E;  1DJW A;  1NUB A;  4BY4 A;  1B8R A;  4NDD A;  1DC1 A;  2F3Y A;  2JTZ A;  3DVM A;  1TIZ A;  4GPL B;  1QAT A;  1Y0V H;  2BBN A;  3DD4 A;  1CDL A;  3SG2 A;  3OB1 B;  2F33 A;  3VGO A;  3OB2 B;  4INX A;  5EL2 A;  1TNQ A;  4C0J A;  3D73 A;  3FIA A;  2A4J A;  1K9K A;  2VRG A;  4MN0 A;  1J1E A;  2WCE A;  1SK6 D;  1AK8 A;  1GJY A;  1KK8 B;  2BKH B;  3R1O A;  1J7R A;  2L2E A;  2QEO A;  4YGB B;  5D3O A;  2M97 A;  4FQO A;  1J7P A;  2CNP A;  1LIN A;  4I5L B;  2AAO A;  1ALV A;  3IQQ A;  2KI6 C;  1OSA A;  2WCB A;  1NCX A;  3TZ1 A;  5KU1 A;  1F54 A;  3D0Y A;  2K8M B;  3OHM B;  1K2H A;  3SG3 A;  5AER A;  2B1U A;  3MSE B;  1N0Y A;  3F45 A;  1G4Y R;  1SL9 A;  1CDM A;  4L9M A;  3D75 A;  1DMO A;  1YUS A;  4MLW A;  2LNK A;  1KQV A;  1C3Y A;  1UUR A;  2BBM A;  3KEV A;  2HPS A;  4I5J A;  3EVU A;  4R1E A;  1NX2 A;  4ORC B;  2GGZ A;  2K2A A;  3L4A A;  1A75 B;  1EXR A;  1QX7 A;  5DKR A;  1DF0 A;  1WY9 A;  2MLF C;  4NDC A;  4C0K A;  5CPV A;  2KGR A;  1OW4 A;  2JC2 A;  2L50 A;  1NP8 A;  3PJI A;  2FCD A;  1MQ1 A;  5FI7 A;  3BQ3 A;  4N1F A;  2K7D A;  1YVH A;  2FJY A;  2M1K B;  1R6P A;  1JF2 A;  5BPJ A;  5CSF A;  3CR5 X;  2WCJ A;  1SR6 C;  2HQW A;  2LAN A;  1Y6W A;  1DJZ A;  2H61 C;  3LCP C;  3R1V A;  2Q91 A;  4YGD B;  2KOT A;  1L7Z A;  1SYM A;  2I7A A;  2AMI A;  2GV5 A;  1F55 A;  1QVI Y;  1QJT A;  4PHN A;  2KGB C;  1FI6 A;  2LVJ A;  1WDC C;  1CTR A;  1BT6 A;  4OKH A;  1DJY A;  3DVJ A;  3CTN A;  3EK8 A;  3AKB A;  1AVS A;  2JPO A;  3QME A;  2MBX A;  2WND A;  1SNL A;  3HCM A;  5F6T A;  1S6J A;  1B4C A;  1WRL A;  2FOT A;  1CKK A;  1B7T Z;  3BUO B;  3LK0 A;  1WLM A;  1Y1U A;  4USL A;  3GOF A;  3RLZ A;  2LV7 A;  2O60 A;  2BCB A;  1JUO A;  4OVN F;  1K95 A;  2YGU A;  2JNX A; 
#chains in the Genus database with same CATH homology
 5HKW A;  4MZJ A;  3GK2 A;  1DJX A;  2WCF A;  1BOC A;  3NSO A;  1C07 A;  1YUR A;  3TUY B;  1PSR A;  2LHI A;  1SCV A;  1XK4 A;  2SCP A;  3DF0 A;  2RGI A;  3VRR A;  5I2Q A;  4HRH A;  4GGF A;  3FWC A;  2F2O A;  2EC6 C;  2NCP A;  5I2L A;  1NX0 A;  1OE9 B;  5ER4 X;  3PSR A;  4YGE B;  1F70 A;  2ZNE A;  1M39 A;  2LCP A;  1QV0 A;  3LL8 B;  1PVA A;  1SY9 A;  2JT0 A;  2KAY A;  2LVV A;  2JUL A;  5D69 A;  4ZCV A;  2Y4Q A;  4YI9 A;  3TDI A;  4E68 A;  3IF7 A;  1KK7 Y;  1JSA A;  1SL7 A;  2KFG A;  3NXA A;  1XFX O;  1EH2 A;  2E6W A;  1JFJ A;  3TS5 B;  4A4B A;  2LMV A;  1G8I A;  1H8B A;  2M29 A;  3VRP A;  3DVK A;  1J7Q A;  1CM1 A;  2Q4U A;  1S5G Z;  1SMG A;  2JOJ A;  3CWG A;  4NDB A;  2BL0 B;  1XK4 C;  1NX1 A;  3EVV A;  1NCY A;  4GFT A;  1REC A;  1HT9 A;  3BUN B;  3SIA A;  2MAZ A;  4DCK A;  1XVJ A;  2M8U A;  4M2P A;  1CLB A;  4PE1 A;  4Q04 A;  2L98 A;  1QX2 A;  1QIW A;  4DUQ A;  2KAV A;  2JQ6 A;  2LC5 A;  3VRQ A;  1GGZ A;  1LA3 A;  2I94 A;  4PDZ A;  1R2U A;  3CS1 A;  1B1G A;  2K7B A;  2K0J A;  2LE9 B;  3AAJ A;  1BJF A;  1V1F A;  3CR4 X;  4WQ3 A;  1MWN A;  2K61 A;  2KYC A;  1M45 A;  2CXJ A;  3I5H C;  3M0W A;  1MHO A;  1EG3 A;  1KFU L;  3A8R A;  1BR4 B;  2MA2 A;  2OS8 C;  2CBL A;  5FYX A;  3TUY C;  1ZAC A;  2LLT A;  4QJ5 B;  1OOJ A;  3LK1 A;  2I18 A;  2KQ6 A;  3NSI A;  1RRO A;  2PVB A;  3D0Y B;  1XFV O;  1XA5 A;  2EHB A;  1RFJ A;  1NYA A;  5HYD A;  1K94 A;  1UP5 A;  4GNK B;  1H4B A;  2GGM A;  1CFD A;  2JWW A;  2JXC A;  1EJ3 A;  2BCA A;  3ZWH A;  1CMG A;  2PRU A;  2BEC A;  2NLN A;  1ZMZ A;  1IJ5 A;  2OPO A;  2M1U A;  2V53 A;  4WRI A;  2NZ0 A;  2M7L A;  2BKI B;  4QJ3 B;  4YI8 A;  3RM1 A;  3BXK A;  2M7N A;  2NXQ A;  1F4O A;  3CR2 A;  2K7O A;  1C7W A;  1K8U A;  4CPV A;  2LM5 A;  4N5X A;  3IQO A;  1OZS A;  2PAL A;  2JRF A;  1QVI Z;  1IGV A;  3JVT C;  1N2D A;  1SCM C;  5AXI A;  5CSI A;  1PAL A;  1LXF C;  3EK7 A;  1BOD A;  3TS5 C;  1KSM A;  1BF5 A;  1A29 A;  1X02 A;  1S26 D;  1UHJ A;  1HQV A;  1YUT A;  1PUL A;  1QX5 B;  1AJ4 A;  3H4S E;  1TN4 A;  2FCE A;  3JTD C;  2HF5 A;  1U5I B;  2ZRT A;  1TNX A;  3JTD B;  5DKN A;  5ER5 A;  1K9P A;  1TTX A;  1WRZ A;  2K2F A;  3QRX A;  4AQJ A;  2KSP A;  1K93 D;  4YGA A;  4QJ4 B;  2KYF A;  3K21 A;  1F4Q A;  3I5G B;  3JVT B;  1AHR A;  1ALW A;  3A4U B;  3KHE A;  3SG7 A;  3CZT X;  2LUX A;  2EGD A;  4JQ0 D;  3E3R A;  5PAL A;  4PHK A;  2FJU B;  1W7I B;  1XFY O;  4ORA B;  4U8D A;  1DT7 B;  4PE4 A;  3WHU B;  1F8H A;  2Y1M A;  3OP0 A;  1LA0 A;  2MLE C;  3SJS A;  4M2Q A;  2JNF A;  2IS9 A;  1RWY A;  3KPX A;  3PM8 A;  2ZKM X;  1YRT B;  1NX3 A;  5G08 A;  4ORB B;  5HKZ A;  1RK9 A;  3DF0 B;  2H2K A;  3OX6 A;  1TRF A;  1WLZ A;  2L51 A;  1AUI B;  1UHN A;  1U5I A;  4DIR A;  1CDP A;  1SBJ A;  2R2I A;  1D1O A;  2L4I A;  4MZL A;  1XYD A;  5KSZ A;  2KI4 C;  4M2O A;  2AUC A;  1RTP 1;  1B8L A;  1PVB A;  2M3W A;  2KQY A;  2BCX A;  2HET A;  5D7F A;  1TCO B;  4HRG A;  4PE0 A;  2WOR A;  3HX4 A;  2M0R A;  1IQ3 A;  5J3X A;  1B8C A;  1EL4 A;  1IRJ A;  1KFX S;  1MUX A;  1OZO A;  1SKT A;  2LUC A;  5HLO A;  1JWD A;  3CGA A;  3TDZ A;  1IH0 A;  1KFU S;  1TNP A;  4OR9 B;  4CID A;  1TOP A;  1N65 A;  2M9G A;  1L2O C;  4FTG A;  2L5X B;  4MBE A;  4N1G A;  1WDC B;  3WHT B;  4AOM A;  2OTG C;  2H61 A;  3DVE A;  2JT8 A;  4MEW A;  3BYA A;  1KFX L;  1JC2 A;  1NCZ A;  2LVK A;  3EKH A;  1DJG A;  3EVR A;  1QS7 A;  1QXP A;  2LLU A;  2F8P A;  1NSH A;  4MRY A;  2CTN A;  1QIV A;  4D1E A;  2COL B;  2KFF A;  1NWD A;  1E8A A;  1QLS A;  1XO5 A;  2ZN8 A;  2I2R E;  1FPW A;  2LLS A;  1UHK A;  1FBV A;  4HSZ A;  1DJI A;  1KSO A;  1YUU A;  1JFK A;  3I5I B;  2KNE A;  2BE4 A;  2ZRS A;  1CDN A;  4OV2 A;  1MXL C;  2K7C A;  2F2P A;  3PAL A;  3PFV A;  3PN7 B;  2LAP A;  1BMO A;  3BUX B;  3EKJ A;  3WXA A;  3PAT A;  1EG4 A;  1CNP A;  1UHI A;  4JPZ B;  1CFF A;  4PCW A;  2F3Z A;  2LMT A;  1CFP A;  1S3P A;  4P5O E;  1UHH A;  1FW4 A;  3FWB A;  5JJG A;  1DTL A;  1AP4 A;  1TCF A;  1K9U A;  2M49 B;  3I5H B;  2OTG B;  3I5I C;  4ETO A;  4BY5 A;  2NCO A;  3KO0 A;  5I8N A;  2KI6 D;  1G33 A;  2LVI A;  1KK7 Z;  3VRN A;  1MF8 B;  3TDU A;  3O4Y A;  3SG5 A;  5AFP A;  1K90 D;  1VRK A;  2EC6 B;  1IG5 A;  2MRD A;  1AJ5 A;  4YGC B;  1PK0 D;  2KBM A;  4OCI A;  1M31 A;  2JPT A;  1QLK A;  1YX7 A;  2G9B A;  1B9A A;  1BR1 B;  4ICB A;  1J1D A;  2E30 A;  5HLV A;  3AKA A;  2BE6 A;  3ZNI A;  1GGW A;  1YX8 A;  3LLE A;  1BU3 A;  4NQG A;  1JF0 A;  4AQI A;  2CCM A;  1YR5 A;  5IBW A;  1TNW A;  2Y1N A;  1MR8 A;  1SR6 B;  1XFZ O;  2ZND A;  4YBH B;  1QAS A;  3BUW B;  3FS7 A;  2BL0 C;  4PHM A;  2KHN A;  4MRX A;  4MVF A;  4DRW A;  1A75 A;  3SIB A;  4WQ2 A;  5B8I B;  1IKU A;  1DF0 B;  1CMF A;  1DJH A;  1KCY A;  1IWQ A;  3NSL A;  2JZI A;  2OS8 B;  2KFH A;  1Y1A A;  1XFU O;  2JU0 A;  1B47 A;  4I5N B;  3O2P A;  1J7O A;  4GBA A;  1PRW A;  1L2O B;  2MJW B;  5DKQ A;  1KQM B;  1A03 A;  2L0P A;  4A4C A;  4CFR A;  4GAO A;  1SCM B;  2KDH A;  1CLL A;  1A4P A;  3I5G C;  1BG1 A;  1A2X A;  2QPT A;  3BUM B;  1CFC A;  2KBI A;  2Y5I A;  3VRO A;  1IQ5 A;  3BOW A;  1WRK A;  1LKJ A;  2O5G A;  5AEQ A;  3EK4 A;  1SPY A;  1BLQ A;  3SG6 A;  3CLN A;  2JTT A;  4DS7 A;  1IJ6 A;  4P2Y B;  1S1E A;  1SW8 A;  1Y1X A;  1J55 A;  2HQ8 A;  1S6C A;  1OMD A;  1CLM A;  1UWO A;  1ZOT B;  1M46 A;  4GGF C;  1KK8 C;  1ZFS A;  1NIW A;  1SL8 A;  1GQM A;  1CM4 A;  1QTX A;  1S36 A;  1W7J B;  3KF9 A;  5AAN A;  4C0L A;  1KQM C;  2TN4 A;  1KWO C;  1K96 A;  2L4H A;  1KWO B;  1YRU B;  3C1V A;  4PE7 A;  1OQP A;  3WNX B;  5JOL A;  1S6I A;  1SRA A;  1RJV A;  2ZN9 A;  3GK4 X;  4UPG A;  2WOS A;  3GK1 A;  1DGU A;  5I2O A;  4CFQ A;  4MSP A;  2LP3 A;  1B7T Y;  3PN7 C;  4XYN A;  4GGN A;  2JT3 A;  4TNC A;  3I5F B;  2PAS A;  2KI4 B;  2LP2 A;  2QAC A;  4JWQ A;  3AAK A;  4XJK A;  2SAS A;  1V1G A;  2ISD A;  2PSR A;  1OMV A;  1MXE A;  4GUK A;  3SG4 A;  4F0Z B;  1CB1 A;  2CT9 A;  3BOW B;  1NPQ A;  3PLF B;  2DOQ A;  2D8N A;  1OMR A;  5HKY A;  4MZK A;  2WC8 A;  4I5K A;  5TNC A;  1PSB A;  3ICB A;  5KTY A;  3NSK A;  1YVL A;  1DGV A;  1LVC D;  3O78 A;  3OX5 A;  1ODB A;  5CSN A;  1JBA A;  3I5F C;  1F71 A;  3D10 A;  1C7V A;  4CLN A;  5K89 A;  1FF1 A;  1FI5 A;  2PMY A;  3O6B A;  4YRU A;  1DVI A;  2LHL A;  2P6B B;  4PAL A;  5GQQ C;  1ZUZ A;  1Q80 A;  2G2B A;  4XJK B;  4PHJ A;  1XFW O;  2MHH A;  2KAX A;  1M63 B;  1UUS A;  4ZCU A;  1S5G Y;  2JXL A;  1QV1 A;  4IL1 A;  1YTZ C;  2LMU A;  5CSJ A;  2ZFD A;  4HRE E;  1DJW A;  1NUB A;  4BY4 A;  1B8R A;  4NDD A;  2F3Y A;  2JTZ A;  3DVM A;  1TIZ A;  4GPL B;  1QAT A;  1Y0V H;  2BBN A;  3DD4 A;  1CDL A;  3SG2 A;  3OB1 B;  2F33 A;  3VGO A;  3OB2 B;  1TNQ A;  4C0J A;  3FIA A;  2A4J A;  1K9K A;  2VRG A;  4MN0 A;  1J1E A;  2WCE A;  1SK6 D;  1AK8 A;  1GJY A;  1KK8 B;  2BKH B;  4YGB B;  1J7R A;  2L2E A;  2M97 A;  4FQO A;  1J7P A;  2CNP A;  1LIN A;  4I5L B;  2AAO A;  1ALV A;  3IQQ A;  2KI6 C;  1OSA A;  2WCB A;  1NCX A;  3TZ1 A;  5KU1 A;  1F54 A;  3D0Y A;  2K8M B;  3OHM B;  1K2H A;  3SG3 A;  5AER A;  2B1U A;  3MSE B;  1N0Y A;  3F45 A;  1G4Y R;  1SL9 A;  1CDM A;  4L9M A;  1DMO A;  1YUS A;  4MLW A;  2LNK A;  1KQV A;  1UUR A;  2BBM A;  3KEV A;  2HPS A;  4I5J A;  3EVU A;  4R1E A;  1NX2 A;  4ORC B;  2GGZ A;  2K2A A;  1A75 B;  1EXR A;  1QX7 A;  5DKR A;  1DF0 A;  1WY9 A;  2MLF C;  4NDC A;  4C0K A;  5CPV A;  2KGR A;  2JC2 A;  2L50 A;  1NP8 A;  2FCD A;  1MQ1 A;  3BQ3 A;  2K7D A;  1YVH A;  2M1K B;  1R6P A;  1JF2 A;  5BPJ A;  5CSF A;  3CR5 X;  1SR6 C;  2HQW A;  2LAN A;  1Y6W A;  1DJZ A;  2H61 C;  3LCP C;  2Q91 A;  4YGD B;  2KOT A;  1L7Z A;  1SYM A;  2I7A A;  2AMI A;  2GV5 A;  1F55 A;  1QVI Y;  1QJT A;  4PHN A;  2KGB C;  1FI6 A;  2LVJ A;  1WDC C;  1CTR A;  1BT6 A;  4OKH A;  1DJY A;  3DVJ A;  3CTN A;  3EK8 A;  3AKB A;  1AVS A;  2MBX A;  2WND A;  1SNL A;  3HCM A;  5F6T A;  1S6J A;  1B4C A;  1WRL A;  2FOT A;  1CKK A;  1B7T Z;  3BUO B;  3LK0 A;  1WLM A;  1Y1U A;  4USL A;  3GOF A;  3RLZ A;  2LV7 A;  2O60 A;  2BCB A;  1JUO A;  4OVN F;  1K95 A;  4N1F A;  2JNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...