1SBJA

Nmr structure of the mg2+-loaded c terminal domain of cardiac troponin c bound to the n terminal domain of cardiac troponin i
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
81
structure length
81
Chain Sequence
MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Troponin C, slow skeletal and cardiac muscles
publication title Structure of the Mg2+-loaded C-lobe of cardiac troponin C bound to the N-domain of cardiac troponin I: comparison with the Ca2+-loaded structure.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Contractile protein, structural protein
total genus 16
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2004-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1sbjA00
1EJ3A 1RECA 3GK4X 2BL0C 1XK4C 2BCAA 2LVKA 4MEWA 3BQ3A 2BECA 4PDZA 2EC6B 3FS7A 3NSOA 1LKJA 1UUSA 1Y0VH 1W7JB 3EVVA 3HCMA 4QJ5B 1AHRA 2MBXA 2LP3A 4JWQA 1SCMB 2JPTA 1BU3A 2VRGA 1Y6WA 1YX8A 1AK8A 2K0JA 3EKHA 1YVHA 2O60A 4YI8A 3TUYC 4A4BA 2Y5IA 3CS1A 3O2PA 2BKIB 3WXAA 5AANA 1RJVA 4HRGA 1DF0A 1CB1A 2AMIA 1QLSA 3DVMA 2ZNDA 1A75A 4GUKA 1QV0A 1XFWO 4BY4A 1DJIA 2KI4B 2CCMA 2PASA 1EG3A 2ZKMX 2H61A 2K7CA 3KF9A 1K9PA 3QRXA 1MUXA 2L51A 1M63B 3TDIA 1YX7A 1CLBA 1RWYA 4HSZA 3SIAA 5HKYA 3I5FB 2MLFC 1FPWA 1N65A 3EK8A 1J1DA 1YRUB 2P6BB 3I5GC 4ORCB 2LVVA 1B8RA 1LA0A 2KNEA 1CM4A 4L9MA 4NQGA 3C1VA 4M2OA 1DT7B 4I5JA 1WRLA 2HQWA 2GGZA 1IWQA 2JXCA 2WCFA 1V1GA 1J55A 3D0YA 2BCXA 2E6WA 4I5LB 1Y1AA 5BPJA 2COLB 2Q91A 3OB1B 4A4CA 4MZLA 2JT0A 4ORBB 5CSJA 4PE0A 3SG7A 2LP2A 4F0ZB 1CFFA 4CFRA 1PVBA 1FI6A 1OZOA 1SR6C 1HQVA 4PE7A 1MQ1A 1V1FA 2K2AA 2I2RE 3OX6A 4GPLB 1NYAA 2Y4QA 3PM8A 1DF0B 1NPQA 2CBLA 4DRWA 1JF0A 4MSPA 5I8NA 1TN4A 2ISDA 1K94A 3O78A 4GGNA 2JT3A 3BUXB 2BBMA 2WNDA 2K7DA 2PSRA 1PVAA 1SL8A 5FYXA 2Q4UA 1G8IA 1XK4A 4PHNA 3SG6A 1QVIY 3DVKA 3A4UB 1JUOA 4MLWA 1K90D 2KBMA 3WNXB 1JC2A 1R6PA 3I5HC 4C0LA 2KYFA 2D8NA 2SCPA 1FW4A 1NX1A 2A4JA 1S6IA 2LVJA 1KQVA 4GGFC 1KWOC 4CIDA 1YTZC 1B7TZ 4AQIA 1RK9A 4AQJA 1CDNA 4I5KA 5AERA 1UHNA 3ICBA 1QTXA 2JTZA 1QASA 1DJXA 2H2KA 2LHIA 1QLKA 3KHEA 3D0YB 1ZACA 3IQQA 5CSNA 3DF0A 1QIWA 2KDHA 1F55A 2LCPA 1J7RA 2I94A 1F4QA 1RROA 2KI6C 1BODA 2M97A 2MAZA 4USLA 1B8CA 1WDCC 1GGZA 4MRXA 3VRRA 4YRUA 1WY9A 2BCBA 1KCYA 1BR4B 3A8RA 3OHMB 3WHUB 4I5NB 4NDDA 2WCEA 4MN0A 3E3RA 5IBWA 2CT9A 1GQMA 5DKRA 3NXAA 2MA2A 2ZRSA 1TCOB 2KSPA 4GAOA 1S36A 1NCXA 2OS8B 3PN7C 1PALA 1XFXO 1QXPA 2ZN9A 2M49B 3VGOA 1R2UA 2FCEA 2CXJA 1CFCA 3SG3A 1MR8A 5HYDA 4WQ3A 2DOQA 2MLEC 1FBVA 2M8UA 1YRTB 3EK7A 2EHBA 1ALWA 2NXQA 1YVLA 1SCVA 3BXKA 4OV2A 4PHJA 1CMFA 1BLQA 3LL8B 1C7VA 4PHMA 2LANA 1D1OA 2LLSA 2OTGB 2LLTA 3BUWB 2E30A 2WORA 1YR5A 4GNKB 1DJWA 2HPSA 1JF2A 4PHKA 3I5IB 3FIAA 3KEVA 1XFZO 1XYDA 2M0RA 2KQ6A 3PFVA 1B47A 3BOWA 1RTP1 2QACA 3DF0B 3F45A 3GK2A 1M45A 3JVTB 2JNFA 1EG4A 1QX2A 3PALA 1KQMB 3VRPA 1Y1UA 5D69A 4N1GA 2KAVA 2M1UA 1S26D 1PK0D 2BKHB 2JZIA 3JTDB 3TDZA 3M0WA 1SMGA 3IF7A 4Q04A 1RFJA 1TRFA 1SK6D 1XFUO 4YI9A 1QX7A 2HETA 1G33A 4ZCUA 1IJ5A 1PRWA 3I5GB 2KHNA 1NX2A 1K93D 4GGFA 4GFTA 1X02A 1ZOTB 1S6CA 4JPZB 3RM1A 1WLMA 2ZRTA 3HX4A 2EC6C 1F54A 1MXLC 2BE6A 3AKAA 2M29A 5CSIA 2LMVA 2R2IA 1SCMC 1H8BA 1OMVA 1UP5A 2F2PA 1NCYA 1OZSA 1CKKA 1NUBA 1UHKA 3FWCA 3WHTB 2GGMA 1SW8A 1A4PA 3KO0A 4TNCA 1L2OC 1S5GY 1TNPA 1LINA 1SL9A 1QVIZ 3LCPC 3ZWHA 1TIZA 1SYMA 1KFXL 1OE9B 3BOWB 1IGVA 2KAXA 4OCIA 2HF5A 1F4OA 1K95A 2KI4C 1F8HA 3LK0A 2I18A 5AEQA 3MSEB 1CM1A 5CPVA 1CDPA 3ZNIA 2ZNEA 3DVEA 2M3WA 4HREE 1SRAA 2KQYA 2KFFA 2NZ0A 1W7IB 2L5XB 4M2QA 1A75B 2L0PA 2RGIA 2TN4A 1PSBA 1M39A 1S1EA 1YUSA 4DUQA 1AP4A 4YBHB 1BJFA 3CZTX 3KPXA 4MVFA 1E8AA 1KWOB 1KK7Z 2KYCA 3K21A 1C07A 3TS5B 1F70A 1KK8B 4ICBA 2CTNA 2ZN8A 2LMTA 2FJUB 3NSKA 1BT6A 1M31A 2F3ZA 5KSZA 2KFHA 3NSIA 1NX0A 2MJWB 3GOFA 2JRFA 4D1EA 2V53A 4YGCB 2PRUA 1KFUL 1S3PA 2F3YA 2JU0A 1SPYA 1C7WA 1SL7A 4ORAB 3VROA 1F71A 1DGVA 4JQ0D 1UWOA 1B8LA 1MXEA 1IJ6A 1NSHA 3IQOA 5F6TA 3SIBA 3OX5A 1JBAA 1BR1B 1N2DA 1XFYO 5ER5A 4DIRA 5HKWA 3CR2A 2F33A 1LA3A 4DCKA 4U8DA 4P2YB 2H61C 2NLNA 4IL1A 1M46A 3CTNA 5AXIA 5J3XA 3SJSA 2WC8A 2MRDA 2IS9A 1OMRA 1J7OA 1AJ5A 3TZ1A 2WCBA 3D10A 1AVSA 2G9BA 1CTRA 3CLNA 1UHHA 1B4CA 1CNPA 5JOLA 1TOPA 4FTGA 2BL0B 2K61A 1NWDA 1BG1A 1K9UA 2MHHA 1DJHA 1LVCD 4CLNA 1SBJA 1GGWA 1CLMA 4XJKA 2KFGA 1SNLA 2KAYA 4PALA 1SY9A 1YURA 5CSFA 3O4YA 1J7PA 1HT9A 1B7TY 1K8UA 2O5GA 2SASA 3DVJA 4N1FA 3TUYB 4C0KA 1BF5A 2KOTA 1ZMZA 4GBAA 4M2PA 5JJGA 4MZKA 2KBIA 2NCOA 1CMGA 1J7QA 1ZUZA 2L4HA 1WRZA 4BY5A 5K89A 1XA5A 2M7NA 1K9KA 1Y1XA 2KGRA 5DKNA 2JXLA 4UPGA 4OR9B 1KSOA 2JNXA 2F2OA 2EGDA 4P5OE 1IH0A 1CFDA 1J1EA 4PE4A 1MF8B 1S5GZ 1UURA 1PSRA 1YUTA 1PULA 3OB2B 2F8PA 1JWDA 4FQOA 5PALA 3AAKA 2FCDA 2LNKA 1IRJA 2OPOA 5AFPA 3SG5A 1S6JA 3CGAA 1B1GA 1KFXS 2OTGC 2PMYA 2NCPA 1L2OB 2JQ6A 2I7AA 4WRIA 3I5IC 1DVIA 2K7BA 3FWBA 4XJKB 4XYNA 1NP8A 1U5IA 4OVNF 5G08A 4PE1A 1DJZA 4MRYA 4YGEB 5I2LA 1OOJA 1TTXA 3LK1A 5I2OA 1MWNA 3OP0A 3JVTC 1QATA 5KTYA 1A03A 3CWGA 1KQMC 1SR6B 1A29A 2KGBC 4YGDB 2L50A 2LC5A 2K8MB 3PLFB 2M7LA 1B9AA 1QIVA 4WQ2A 1QS7A 1WRKA 2ZFDA 2LHLA 5TNCA 1L7ZA 3JTDC 4NDBA 3BUNB 1UHIA 4CFQA 2LLUA 3BYAA 1AJ4A 1DMOA 1XO5A 2QPTA 1BOCA 1OQPA 3EVRA 1EXRA 1Q80A 5D7FA 2WOSA 3VRQA 2JOJA 5B8IB 1TNWA 1JFJA 2AUCA 1KFUS 3I5FC 3I5HB 4CPVA 1H4BA 1FI5A 4AOMA 4ETOA 3SG2A 1JSAA 1JFKA 1AUIB 1LXFC 2LVIA 2LUCA 2LMUA 5ER4X 2CNPA 1CFPA 3BUOB 2PALA 1DJYA 1K96A 1IQ5A 3AKBA 2LUXA 1DGUA 1DTLA 1IG5A 1G4YR 1TCFA 1U5IB 4PCWA 3RLZA 3PSRA 1NIWA 1QX5B 1WDCB 4YGAA 2B1UA 3VRNA 1ODBA 4NDCA 1OMDA 2JWWA 1IQ3A 2GV5A 3O6BA 1MHOA 2G2BA 5DKQA 3BUMB 2K2FA 3PATA 2BBNA 1SKTA 2LV7A 3PN7B 1N0YA 1NCZA 2JC2A 2L4IA 1CDMA 5HLOA 3TS5C 1ALVA 1KK8C 2Y1NA 1CDLA 2BE4A 1XFVO 4MBEA 3CR4X 1TNXA 1BMOA 1TNQA 4N5XA 4ZCVA 2FOTA 1K2HA 1IKUA 2JULA 1QJTA 1KK7Y 4E68A 3EK4A 2LM5A 1ZFSA 3GK1A 5KU1A 2LE9B 1EH2A 1DJGA 2L2EA 4YGBB 1FF1A 3DD4A 1KSMA 4MZJA 4OKHA 4R1EA 1QV1A 2KI6D 1OSAA 2AAOA 2K7OA 2JT8A 2LAPA 1WLZA 1YUUA 3H4SE 4QJ3B 2Y1MA 2HQ8A 2JTTA 2PVBA 5HKZA 5GQQC 1A2XA 1EL4A 2M9GA 4QJ4B 1XVJA 4HRHA 3NSLA 3EVUA 1NX3A 3AAJA 1GJYA 1CLLA 3CR5X 5I2QA 5HLVA 2L98A 3SG4A 3LLEA 2M1KB 4C0JA 3EKJA 3TDUA 1UHJA 1VRKA 2OS8C 4DS7A
chains in the Genus database with same CATH superfamily
1EJ3A 1RECA 3GK4X 2BL0C 1XK4C 2BCAA 2LVKA 4MEWA 3BQ3A 2BECA 4PDZA 2EC6B 3FS7A 3NSOA 5I94A 1LKJA 1UUSA 1Y0VH 1W7JB 2K60A 3EVVA 3HCMA 4QJ5B 4IJ7A 1AHRA 2MBXA 2LP3A 4JWQA 1SCMB 3CZ1A 2JPTA 1BU3A 2VRGA 1Y6WA 3OBVA 1YX8A 1AK8A 2K0JA 3EKHA 1YVHA 2O60A 2WC6A 4YI8A 3TUYC 4A4BA 2Y5IA 3CS1A 3O2PA 2BKIB 3WXAA 5AANA 1RJVA 4HRGA 1DF0A 3S0GA 1CB1A 2AMIA 1QLSA 3DVMA 2ZNDA 1A75A 4GUKA 1QV0A 1XFWO 4BY4A 1DJIA 2KI4B 1OW4A 2CCMA 2PASA 4OZDA 1EG3A 2ZKMX 2H61A 2K7CA 3KF9A 3D77A 1K9PA 3QRXA 1MUXA 2L51A 1M63B 3TDIA 1YX7A 1CLBA 1RWYA 4HSZA 3SIAA 3N7HA 3I5FB 1Z4HA 5HKYA 2MLFC 1FPWA 1N65A 3EK8A 1J1DA 1YRUB 2P6BB 3I5GC 4ORCB 2LVVA 1B8RA 1LA0A 2KNEA 1CM4A 3PM2A 4L9MA 4NQGA 3C1VA 4M2OA 1DT7B 4I5JA 1IIOA 1C3YA 1WRLA 2HQWA 2GGZA 3R1OA 1IWQA 2JXCA 2WCFA 1V1GA 1J55A 3D0YA 2BCXA 2E6WA 3D74A 3CDNA 4I5LB 1Y1AA 5BPJA 2COLB 2Q91A 3OB1B 4A4CA 4MZLA 2JT0A 4ORBB 5CSJA 4PE0A 3SG7A 2LP2A 4F0ZB 1CFFA 4CFRA 1PVBA 3BFBA 3CYZA 1OZOA 1SR6C 1HQVA 4PE7A 1FI6A 1MQ1A 1V1FA 2K2AA 2I2RE 3OX6A 4GPLB 1NYAA 2Y4QA 3D73A 3PM8A 1DF0B 1NPQA 2CBLA 4DRWA 1JF0A 4MSPA 5I8NA 2WCKA 1TN4A 2ISDA 1K94A 3O78A 3QMEA 4GGNA 2JT3A 3BUXB 2BBMA 2WNDA 2K7DA 2PSRA 2L5YA 1PVAA 3BFHA 1QWVA 1SL8A 5FYXA 2Q4UA 1G8IA 4PT1A 1XK4A 4PHNA 3SG6A 1QVIY 5DICA 3DVKA 3A4UB 1JUOA 4MLWA 1K90D 2KBMA 3WNXB 1JC2A 1R6PA 3I5HC 3FE8A 2QEOA 4C0LA 2KYFA 2D8NA 3B6XA 2SCPA 1FW4A 1NX1A 2A4JA 1S6IA 2LVJA 1KQVA 4GGFC 1KWOC 4CIDA 1YTZC 1B7TZ 4AQIA 1RK9A 4AQJA 1P28A 1CDNA 4I5KA 5AERA 1UHNA 3ICBA 1QTXA 2JTZA 1QASA 4F7FA 1DELA 1DJXA 2H2KA 1QLKA 2LHIA 2P71A 3KHEA 3NHTA 3D0YB 1ZACA 3IQQA 5CSNA 3DF0A 1QIWA 2KDHA 1F55A 3B86A 2LCPA 1J7RA 2I94A 1F4QA 1RROA 2KI6C 1BODA 2M97A 2MAZA 4USLA 1B8CA 1WDCC 1GGZA 4MRXA 3VRRA 4YRUA 1WY9A 2BCBA 1KCYA 1BR4B 3A8RA 3OHMB 3WHUB 4I5NB 4NDDA 2WCEA 4MN0A 3E3RA 5IBWA 1SSEB 2CT9A 1OOHA 1GQMA 5DKRA 3NXAA 2MA2A 2ZRSA 1TCOB 2KSPA 4GAOA 1S36A 1NCXA 2OS8B 3PN7C 1PALA 1XFXO 1QXPA 2ZN9A 2WCMA 2M49B 3VGOA 1R2UA 2FCEA 1DEKA 2CXJA 1CFCA 3SG3A 1MR8A 5HYDA 4WQ3A 2DOQA 2MLEC 1FBVA 2M8UA 1YRTB 3EK7A 2EHBA 1ALWA 2NXQA 1YVLA 1SCVA 3BXKA 4OV2A 4PHJA 1CMFA 1BLQA 3LL8B 1C7VA 4PHMA 2LANA 1D1OA 2LLSA 2OTGB 2LLTA 3BUWB 2E30A 2WORA 1YR5A 4GNKB 1DJWA 2HPSA 1JF2A 4PHKA 3I5IB 3FIAA 1Z2CB 3KEVA 1XFZO 1XYDA 2M0RA 2KQ6A 3PFVA 1B47A 3BOWA 1RTP1 2QACA 3DF0B 3IVTA 3F45A 3GK2A 1M45A 3S0AA 3JVTB 2JNFA 1EG4A 1QX2A 3PALA 1KQMB 3SS4A 1Y1UA 3VRPA 5D69A 4N1GA 2H8VA 2KAVA 2M1UA 1S26D 1PK0D 2BKHB 3D75A 2JZIA 1DQEA 3JTDB 3TDZA 3M0WA 1SMGA 3IF7A 4Q04A 1RFJA 1TRFA 1SK6D 1XFUO 3D78A 5FI2A 4YI9A 1QX7A 2HETA 3B87A 1G33A 2KLEA 4ZCUA 1IJ5A 1PRWA 3I5GB 2KHNA 3R1VA 1NX2A 1K93D 4GGFA 4GFTA 1X02A 1ZOTB 1S6CA 4JPZB 3RM1A 1WLMA 2ZRTA 3HX4A 2EC6C 1F54A 1MXLC 2BE6A 3L4AA 3AKAA 2M29A 5CSIA 2LMVA 2PQLA 2R2IA 1SCMC 1H8BA 1OMVA 2YGUA 1UP5A 2F2PA 1NCYA 1OZSA 1CKKA 3CABA 1NUBA 1UHKA 3FWCA 3WHTB 2GGMA 1SW8A 2ERBA 1A4PA 3KO0A 4TNCA 1L2OC 1S5GY 1TNPA 1LINA 1SL9A 1QVIZ 3LCPC 3ZWHA 1TIZA 1SYMA 1KFXL 1OE9B 3BOWB 1TUJA 1IGVA 2KAXA 4OCIA 2HF5A 1F4OA 1K95A 2KI4C 1F8HA 4KYNA 3LK0A 2I18A 5AEQA 3MSEB 1CM1A 4FQTA 1CDPA 5CPVA 3ZNIA 2ZNEA 3DVEA 2M3WA 4HREE 1SRAA 2KQYA 2KFFA 2NZ0A 1W7IB 2L5XB 3R72A 4M2QA 1LS8A 1A75B 2L0PA 2RGIA 2QEHA 2TN4A 1PSBA 1M39A 1S1EA 1YUSA 4DUQA 4JKTA 1AP4A 4INXA 4YBHB 1BJFA 3CZTX 3KPXA 4MVFA 1E8AA 1KWOB 1KK7Z 2KYCA 3K21A 1C07A 3TS5B 1F70A 1KK8B 4ICBA 2CTNA 2ZN8A 2LMTA 2FJUB 3NSKA 1BT6A 1M31A 2F3ZA 3OGNA 2KFHA 3NSIA 5KSZA 1OOIX 1NX0A 2MJWB 3GOFA 2JRFA 4D1EA 2V53A 4YGCB 2PRUA 1KFUL 1S3PA 2F3YA 1C3ZA 2JU0A 1TUZA 2QEVA 1SPYA 1C7WA 1SL7A 2FJYA 4ORAB 3VROA 1F71A 1DGVA 4JQ0D 1UWOA 1B8LA 1MXEA 1IJ6A 1NSHA 3IQOA 5F6TA 3SIBA 3OX5A 1JBAA 1BR1B 1N2DA 1XFYO 2WC5A 5ER5A 4DIRA 5HKWA 3CR2A 2F33A 1LA3A 3L4LA 3L47A 1T14A 4DCKA 4U8DA 4P2YB 2H61C 5HL1A 2NLNA 4IL1A 1M46A 3CTNA 5AXIA 5J3XA 3DZTA 2WC8A 3D76A 3SJSA 2MRDA 1XFRA 2IS9A 1OMRA 1J7OA 1AJ5A 3O4XA 2QEBA 3TZ1A 2WCBA 3D10A 1AVSA 2G9BA 1CTRA 3CLNA 1UHHA 1B4CA 1CNPA 5JOLA 1TOPA 1W9ZA 4FTGA 2BL0B 2K61A 3EG5B 1NWDA 1BG1A 3CZ2A 1K9UA 2MHHA 1DJHA 1LVCD 3CZ0A 4CLNA 1SBJA 1GGWA 1CLMA 4XJKA 2KFGA 1SNLA 2KAYA 4PALA 1SY9A 1YURA 5CSFA 3O4YA 3K1EA 3SS5A 1J7PA 1HT9A 1B7TY 1K8UA 2O5GA 2SASA 3DVJA 2BNXA 4N1FA 3TUYB 4C0KA 2KOTA 1BF5A 1ZMZA 4GBAA 4M2PA 5JJGA 4MZKA 2KBIA 2NCOA 5D3OA 1CMGA 1ZUZA 1J7QA 2L4HA 1WRZA 4BY5A 5K89A 1XA5A 2M7NA 1K9KA 1Y1XA 2KGRA 2L2CA 5DKNA 2JXLA 2PYQA 4UPGA 3DXLA 4OR9B 1KSOA 2JNXA 2F2OA 3FE6A 2EGDA 4P5OE 3R1PA 1IH0A 1CFDA 1J1EA 4PE4A 1MF8B 1S5GZ 1UURA 1PSRA 1YUTA 1PULA 3OB2B 2F8PA 1JWDA 2GTEA 4FQOA 5PALA 3AAKA 2FCDA 2LNKA 1IRJA 2OPOA 5AFPA 3DYEA 3SG5A 1S6JA 3CGAA 1B1GA 1KFXS 2OTGC 2PMYA 2NCPA 1L2OB 2JQ6A 2I7AA 4WRIA 3I5IC 1DVIA 2K7BA 3FWBA 4XJKB 4XYNA 1NP8A 2KLDA 1U5IA 4OVNF 5G08A 4PE1A 1DJZA 4MRYA 4YGEB 5I2LA 1OOJA 1TTXA 3LK1A 5I2OA 1MWNA 3OP0A 3JVTC 1QATA 5KTYA 1A03A 3CWGA 1KQMC 1SR6B 1A29A 2KGBC 4YGDB 2L50A 2LC5A 2K8MB 3PLFB 2M7LA 2QDIA 1B9AA 1QIVA 4WQ2A 1QS7A 1WRKA 3S0FA 2ZFDA 2LHLA 5TNCA 1L7ZA 3JTDC 4NDBA 3BUNB 1UHIA 3S0DA 4CFQA 2BAPA 2LLUA 3BYAA 1AJ4A 3RZSA 3S0BA 1DMOA 1XO5A 2QPTA 5FI6A 1OQPA 1BOCA 3EVRA 1EXRA 1Q80A 5D7FA 2WOSA 3VRQA 3VB1A 2JOJA 5B8IB 1TNWA 1JFJA 2AUCA 1KFUS 3I5FC 3I5HB 4CPVA 1GM0A 1H4BA 3Q8IA 1FI5A 4AOMA 1DC1A 4ETOA 1TWOA 3SG2A 1OOFA 1JFKA 1AUIB 1LXFC 2LVIA 2LUCA 2LMUA 5ER4X 1JSAA 2CNPA 1CFPA 2WCLA 3BUOB 2PALA 1DJYA 1K96A 1IQ5A 3AKBA 2LUXA 1DGUA 5EL2A 1DTLA 1IG5A 1G4YR 1TCFA 1U5IB 3BJHA 4PCWA 2WCJA 3RLZA 3PSRA 1NIWA 1QX5B 4JD9A 1WDCB 4YGAA 2B1UA 3VRNA 1ODBA 4NDCA 1OMDA 3UO9A 2WCHA 2JWWA 1IQ3A 2JPOA 3DY9A 3S0EA 2GV5A 3O6BA 1MHOA 2G2BA 3B88A 3BUMB 3B7AA 2K2FA 5DKQA 3PATA 3FE9A 2BBNA 1SKTA 1OOGA 2LV7A 3BFAA 3PN7B 1N0YA 1NCZA 2JC2A 2L4IA 1CDMA 3V2LA 5HLOA 3TS5C 1ALVA 1KK8C 2Y1NA 1CDLA 2BE4A 1XFVO 3SS3A 4MBEA 4INWA 3CR4X 1TNXA 1BMOA 1TNQA 4N5XA 4ZCVA 2FOTA 1K2HA 1IKUA 2JULA 1QJTA 1KK7Y 4E68A 3EK4A 2LM5A 1ZFSA 3GK1A 5KU1A 2LE9B 1EH2A 5FI7A 1DJGA 2L2EA 4YGBB 1FF1A 3DD4A 1KSMA 4MZJA 4OKHA 4R1EA 1QV1A 2KI6D 1OSAA 2AAOA 2K7OA 2JT8A 2LAPA 1WLZA 1YUUA 3H4SE 4QJ3B 3NHIA 3UNWA 2Y1MA 2HQ8A 2JTTA 2PVBA 5HKZA 5GQQC 1A2XA 1EL4A 2M9GA 4QJ4B 1XVJA 4HRHA 3NSLA 1ORGA 3EVUA 1NX3A 3AAJA 1GJYA 2KPHA 1CLLA 3CR5X 5I2QA 5HLVA 2L98A 3SG4A 3PJIA 2P70A 3LLEA 2M1KB 4C0JA 3EKJA 3NGVA 3TDUA 1UHJA 1VRKA 2OS8C 4DS7A
chains in the Genus database with same CATH topology
1EJ3A 1RECA 3GK4X 2BL0C 1XK4C 2BCAA 2LVKA 4MEWA 3BQ3A 2BECA 4PDZA 2EC6B 3FS7A 3NSOA 1LKJA 1UUSA 1Y0VH 1W7JB 3EVVA 3HCMA 4QJ5B 1AHRA 2MBXA 2LP3A 4JWQA 1SCMB 2JPTA 1BU3A 2VRGA 1Y6WA 1YX8A 1AK8A 2K0JA 3EKHA 1YVHA 2O60A 4YI8A 3TUYC 4A4BA 2Y5IA 3CS1A 3O2PA 2BKIB 3WXAA 5AANA 1RJVA 4HRGA 1DF0A 1CB1A 2AMIA 1QLSA 3DVMA 2ZNDA 1A75A 4GUKA 1QV0A 1XFWO 4BY4A 1DJIA 2KI4B 2CCMA 2PASA 1EG3A 2ZKMX 2H61A 2K7CA 3KF9A 1K9PA 3QRXA 1MUXA 2L51A 1M63B 3TDIA 1YX7A 1CLBA 1RWYA 4HSZA 3SIAA 5HKYA 3I5FB 2MLFC 1FPWA 1N65A 3EK8A 1J1DA 1YRUB 2P6BB 3I5GC 4ORCB 2LVVA 1B8RA 1LA0A 2KNEA 1CM4A 4L9MA 4NQGA 3C1VA 4M2OA 1DT7B 4I5JA 1WRLA 2HQWA 2GGZA 1IWQA 2JXCA 2WCFA 1V1GA 1J55A 3D0YA 2BCXA 2E6WA 4I5LB 1Y1AA 5BPJA 2COLB 2Q91A 3OB1B 4A4CA 4MZLA 2JT0A 4ORBB 5CSJA 4PE0A 3SG7A 2LP2A 4F0ZB 1CFFA 4CFRA 1PVBA 1FI6A 1OZOA 1SR6C 1HQVA 4PE7A 1MQ1A 1V1FA 2K2AA 2I2RE 3OX6A 4GPLB 1NYAA 2Y4QA 3PM8A 1DF0B 1NPQA 2CBLA 4DRWA 1JF0A 4MSPA 5I8NA 1TN4A 2ISDA 1K94A 3O78A 4GGNA 2JT3A 3BUXB 2BBMA 2WNDA 2K7DA 2PSRA 1PVAA 1SL8A 5FYXA 2Q4UA 1G8IA 1XK4A 4PHNA 3SG6A 1QVIY 3DVKA 3A4UB 1JUOA 4MLWA 1K90D 2KBMA 3WNXB 1JC2A 1R6PA 3I5HC 4C0LA 2KYFA 2D8NA 2SCPA 1FW4A 1NX1A 2A4JA 1S6IA 2LVJA 1KQVA 4GGFC 1KWOC 4CIDA 1YTZC 1B7TZ 4AQIA 1RK9A 4AQJA 1CDNA 4I5KA 5AERA 1UHNA 3ICBA 1QTXA 2JTZA 1QASA 1DJXA 2H2KA 2LHIA 1QLKA 3KHEA 3D0YB 1ZACA 3IQQA 5CSNA 3DF0A 1QIWA 2KDHA 1F55A 2LCPA 1J7RA 2I94A 1F4QA 1RROA 2KI6C 1BODA 2M97A 2MAZA 4USLA 1B8CA 1WDCC 1GGZA 4MRXA 3VRRA 4YRUA 1WY9A 2BCBA 1KCYA 1BR4B 3A8RA 3OHMB 3WHUB 4I5NB 4NDDA 2WCEA 4MN0A 3E3RA 5IBWA 2CT9A 1GQMA 5DKRA 3NXAA 2MA2A 2ZRSA 1TCOB 2KSPA 4GAOA 1S36A 1NCXA 2OS8B 3PN7C 1PALA 1XFXO 1QXPA 2ZN9A 2M49B 3VGOA 1R2UA 2FCEA 2CXJA 1CFCA 3SG3A 1MR8A 5HYDA 4WQ3A 2DOQA 2MLEC 1FBVA 2M8UA 1YRTB 3EK7A 2EHBA 1ALWA 2NXQA 1YVLA 1SCVA 3BXKA 4OV2A 4PHJA 1CMFA 1BLQA 3LL8B 1C7VA 4PHMA 2LANA 1D1OA 2LLSA 2OTGB 2LLTA 3BUWB 2E30A 2WORA 1YR5A 4GNKB 1DJWA 2HPSA 1JF2A 4PHKA 3I5IB 3FIAA 3KEVA 1XFZO 1XYDA 2M0RA 2KQ6A 3PFVA 1B47A 3BOWA 1RTP1 2QACA 3DF0B 3F45A 3GK2A 1M45A 3JVTB 2JNFA 1EG4A 1QX2A 3PALA 1KQMB 3VRPA 1Y1UA 5D69A 4N1GA 2KAVA 2M1UA 1S26D 1PK0D 2BKHB 2JZIA 3JTDB 3TDZA 3M0WA 1SMGA 3IF7A 4Q04A 1RFJA 1TRFA 1SK6D 1XFUO 4YI9A 1QX7A 2HETA 1G33A 4ZCUA 1IJ5A 1PRWA 3I5GB 2KHNA 1NX2A 1K93D 4GGFA 4GFTA 1X02A 1ZOTB 1S6CA 4JPZB 3RM1A 1WLMA 2ZRTA 3HX4A 2EC6C 1F54A 1MXLC 2BE6A 3AKAA 2M29A 5CSIA 2LMVA 2R2IA 1SCMC 1H8BA 1OMVA 1UP5A 2F2PA 1NCYA 1OZSA 1CKKA 1NUBA 1UHKA 3FWCA 3WHTB 2GGMA 1SW8A 1A4PA 3KO0A 4TNCA 1L2OC 1S5GY 1TNPA 1LINA 1SL9A 1QVIZ 3LCPC 3ZWHA 1TIZA 1SYMA 1KFXL 1OE9B 3BOWB 1IGVA 2KAXA 4OCIA 2HF5A 1F4OA 1K95A 2KI4C 1F8HA 3LK0A 2I18A 5AEQA 3MSEB 1CM1A 5CPVA 1CDPA 3ZNIA 2ZNEA 3DVEA 2M3WA 4HREE 1SRAA 2KQYA 2KFFA 2NZ0A 1W7IB 2L5XB 4M2QA 1A75B 2L0PA 2RGIA 2TN4A 1PSBA 1M39A 1S1EA 1YUSA 4DUQA 1AP4A 4YBHB 1BJFA 3CZTX 3KPXA 4MVFA 1E8AA 1KWOB 1KK7Z 2KYCA 3K21A 1C07A 3TS5B 1F70A 1KK8B 4ICBA 2CTNA 2ZN8A 2LMTA 2FJUB 3NSKA 1BT6A 1M31A 2F3ZA 5KSZA 2KFHA 3NSIA 1NX0A 2MJWB 3GOFA 2JRFA 4D1EA 2V53A 4YGCB 2PRUA 1KFUL 1S3PA 2F3YA 2JU0A 1SPYA 1C7WA 1SL7A 4ORAB 3VROA 1F71A 1DGVA 4JQ0D 1UWOA 1B8LA 1MXEA 1IJ6A 1NSHA 3IQOA 5F6TA 3SIBA 3OX5A 1JBAA 1BR1B 1N2DA 1XFYO 5ER5A 4DIRA 5HKWA 3CR2A 2F33A 1LA3A 4DCKA 4U8DA 4P2YB 2H61C 2NLNA 4IL1A 1M46A 3CTNA 5AXIA 5J3XA 3SJSA 2WC8A 2MRDA 2IS9A 1OMRA 1J7OA 1AJ5A 3TZ1A 2WCBA 3D10A 1AVSA 2G9BA 1CTRA 3CLNA 1UHHA 1B4CA 1CNPA 5JOLA 1TOPA 4FTGA 2BL0B 2K61A 1NWDA 1BG1A 1K9UA 2MHHA 1DJHA 1LVCD 4CLNA 1SBJA 1GGWA 1CLMA 4XJKA 2KFGA 1SNLA 2KAYA 4PALA 1SY9A 1YURA 5CSFA 3O4YA 1J7PA 1HT9A 1B7TY 1K8UA 2O5GA 2SASA 3DVJA 4N1FA 3TUYB 4C0KA 1BF5A 2KOTA 1ZMZA 4GBAA 4M2PA 5JJGA 4MZKA 2KBIA 2NCOA 1CMGA 1J7QA 1ZUZA 2L4HA 1WRZA 4BY5A 5K89A 1XA5A 2M7NA 1K9KA 1Y1XA 2KGRA 5DKNA 2JXLA 4UPGA 4OR9B 1KSOA 2JNXA 2F2OA 2EGDA 4P5OE 1IH0A 1CFDA 1J1EA 4PE4A 1MF8B 1S5GZ 1UURA 1PSRA 1YUTA 1PULA 3OB2B 2F8PA 1JWDA 4FQOA 5PALA 3AAKA 2FCDA 2LNKA 1IRJA 2OPOA 5AFPA 3SG5A 1S6JA 3CGAA 1B1GA 1KFXS 2OTGC 2PMYA 2NCPA 1L2OB 2JQ6A 2I7AA 4WRIA 3I5IC 1DVIA 2K7BA 3FWBA 4XJKB 4XYNA 1NP8A 1U5IA 4OVNF 5G08A 4PE1A 1DJZA 4MRYA 4YGEB 5I2LA 1OOJA 1TTXA 3LK1A 5I2OA 1MWNA 3OP0A 3JVTC 1QATA 5KTYA 1A03A 3CWGA 1KQMC 1SR6B 1A29A 2KGBC 4YGDB 2L50A 2LC5A 2K8MB 3PLFB 2M7LA 1B9AA 1QIVA 4WQ2A 1QS7A 1WRKA 2ZFDA 2LHLA 5TNCA 1L7ZA 3JTDC 4NDBA 3BUNB 1UHIA 4CFQA 2LLUA 3BYAA 1AJ4A 1DMOA 1XO5A 2QPTA 1BOCA 1OQPA 3EVRA 1EXRA 1Q80A 5D7FA 2WOSA 3VRQA 2JOJA 5B8IB 1TNWA 1JFJA 2AUCA 1KFUS 3I5FC 3I5HB 4CPVA 1H4BA 1FI5A 4AOMA 4ETOA 3SG2A 1JSAA 1JFKA 1AUIB 1LXFC 2LVIA 2LUCA 2LMUA 5ER4X 2CNPA 1CFPA 3BUOB 2PALA 1DJYA 1K96A 1IQ5A 3AKBA 2LUXA 1DGUA 1DTLA 1IG5A 1G4YR 1TCFA 1U5IB 4PCWA 3RLZA 3PSRA 1NIWA 1QX5B 1WDCB 4YGAA 2B1UA 3VRNA 1ODBA 4NDCA 1OMDA 2JWWA 1IQ3A 2GV5A 3O6BA 1MHOA 2G2BA 5DKQA 3BUMB 2K2FA 3PATA 2BBNA 1SKTA 2LV7A 3PN7B 1N0YA 1NCZA 2JC2A 2L4IA 1CDMA 5HLOA 3TS5C 1ALVA 1KK8C 2Y1NA 1CDLA 2BE4A 1XFVO 4MBEA 3CR4X 1TNXA 1BMOA 1TNQA 4N5XA 4ZCVA 2FOTA 1K2HA 1IKUA 2JULA 1QJTA 1KK7Y 4E68A 3EK4A 2LM5A 1ZFSA 3GK1A 5KU1A 2LE9B 1EH2A 1DJGA 2L2EA 4YGBB 1FF1A 3DD4A 1KSMA 4MZJA 4OKHA 4R1EA 1QV1A 2KI6D 1OSAA 2AAOA 2K7OA 2JT8A 2LAPA 1WLZA 1YUUA 3H4SE 4QJ3B 2Y1MA 2HQ8A 2JTTA 2PVBA 5HKZA 5GQQC 1A2XA 1EL4A 2M9GA 4QJ4B 1XVJA 4HRHA 3NSLA 3EVUA 1NX3A 3AAJA 1GJYA 1CLLA 3CR5X 5I2QA 5HLVA 2L98A 3SG4A 3LLEA 2M1KB 4C0JA 3EKJA 3TDUA 1UHJA 1VRKA 2OS8C 4DS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EJ3 A;  1REC A;  3GK4 X;  2BL0 C;  1XK4 C;  2BCA A;  2LVK A;  4MEW A;  3BQ3 A;  2BEC A;  4PDZ A;  2EC6 B;  3FS7 A;  3NSO A;  1LKJ A;  1UUS A;  1Y0V H;  1W7J B;  3EVV A;  3HCM A;  4QJ5 B;  1AHR A;  2MBX A;  2LP3 A;  4JWQ A;  1SCM B;  2JPT A;  1BU3 A;  2VRG A;  1Y6W A;  1YX8 A;  1AK8 A;  2K0J A;  3EKH A;  1YVH A;  2O60 A;  4YI8 A;  3TUY C;  4A4B A;  2Y5I A;  3CS1 A;  3O2P A;  2BKI B;  3WXA A;  5AAN A;  1RJV A;  4HRG A;  1DF0 A;  1CB1 A;  2AMI A;  1QLS A;  3DVM A;  2ZND A;  1A75 A;  4GUK A;  1QV0 A;  1XFW O;  4BY4 A;  1DJI A;  2KI4 B;  2CCM A;  2PAS A;  1EG3 A;  2ZKM X;  2H61 A;  2K7C A;  3KF9 A;  1K9P A;  3QRX A;  1MUX A;  2L51 A;  1M63 B;  3TDI A;  1YX7 A;  1CLB A;  1RWY A;  4HSZ A;  3SIA A;  5HKY A;  3I5F B;  2MLF C;  1FPW A;  1N65 A;  3EK8 A;  1J1D A;  1YRU B;  2P6B B;  3I5G C;  4ORC B;  2LVV A;  1B8R A;  1LA0 A;  2KNE A;  1CM4 A;  4L9M A;  4NQG A;  3C1V A;  4M2O A;  1DT7 B;  4I5J A;  1WRL A;  2HQW A;  2GGZ A;  1IWQ A;  2JXC A;  2WCF A;  1V1G A;  1J55 A;  3D0Y A;  2BCX A;  2E6W A;  4I5L B;  1Y1A A;  5BPJ A;  2COL B;  2Q91 A;  3OB1 B;  4A4C A;  4MZL A;  2JT0 A;  4ORB B;  5CSJ A;  4PE0 A;  3SG7 A;  2LP2 A;  4F0Z B;  1CFF A;  4CFR A;  1PVB A;  1FI6 A;  1OZO A;  1SR6 C;  1HQV A;  4PE7 A;  1MQ1 A;  1V1F A;  2K2A A;  2I2R E;  3OX6 A;  4GPL B;  1NYA A;  2Y4Q A;  3PM8 A;  1DF0 B;  1NPQ A;  2CBL A;  4DRW A;  1JF0 A;  4MSP A;  5I8N A;  1TN4 A;  2ISD A;  1K94 A;  3O78 A;  4GGN A;  2JT3 A;  3BUX B;  2BBM A;  2WND A;  2K7D A;  2PSR A;  1PVA A;  1SL8 A;  5FYX A;  2Q4U A;  1G8I A;  1XK4 A;  4PHN A;  3SG6 A;  1QVI Y;  3DVK A;  3A4U B;  1JUO A;  4MLW A;  1K90 D;  2KBM A;  3WNX B;  1JC2 A;  1R6P A;  3I5H C;  4C0L A;  2KYF A;  2D8N A;  2SCP A;  1FW4 A;  1NX1 A;  2A4J A;  1S6I A;  2LVJ A;  1KQV A;  4GGF C;  1KWO C;  4CID A;  1YTZ C;  1B7T Z;  4AQI A;  1RK9 A;  4AQJ A;  1CDN A;  4I5K A;  5AER A;  1UHN A;  3ICB A;  1QTX A;  2JTZ A;  1QAS A;  1DJX A;  2H2K A;  2LHI A;  1QLK A;  3KHE A;  3D0Y B;  1ZAC A;  3IQQ A;  5CSN A;  3DF0 A;  1QIW A;  2KDH A;  1F55 A;  2LCP A;  1J7R A;  2I94 A;  1F4Q A;  1RRO A;  2KI6 C;  1BOD A;  2M97 A;  2MAZ A;  4USL A;  1B8C A;  1WDC C;  1GGZ A;  4MRX A;  3VRR A;  4YRU A;  1WY9 A;  2BCB A;  1KCY A;  1BR4 B;  3A8R A;  3OHM B;  3WHU B;  4I5N B;  4NDD A;  2WCE A;  4MN0 A;  3E3R A;  5IBW A;  2CT9 A;  1GQM A;  5DKR A;  3NXA A;  2MA2 A;  2ZRS A;  1TCO B;  2KSP A;  4GAO A;  1S36 A;  1NCX A;  2OS8 B;  3PN7 C;  1PAL A;  1XFX O;  1QXP A;  2ZN9 A;  2M49 B;  3VGO A;  1R2U A;  2FCE A;  2CXJ A;  1CFC A;  3SG3 A;  1MR8 A;  5HYD A;  4WQ3 A;  2DOQ A;  2MLE C;  1FBV A;  2M8U A;  1YRT B;  3EK7 A;  2EHB A;  1ALW A;  2NXQ A;  1YVL A;  1SCV A;  3BXK A;  4OV2 A;  4PHJ A;  1CMF A;  1BLQ A;  3LL8 B;  1C7V A;  4PHM A;  2LAN A;  1D1O A;  2LLS A;  2OTG B;  2LLT A;  3BUW B;  2E30 A;  2WOR A;  1YR5 A;  4GNK B;  1DJW A;  2HPS A;  1JF2 A;  4PHK A;  3I5I B;  3FIA A;  3KEV A;  1XFZ O;  1XYD A;  2M0R A;  2KQ6 A;  3PFV A;  1B47 A;  3BOW A;  1RTP 1;  2QAC A;  3DF0 B;  3F45 A;  3GK2 A;  1M45 A;  3JVT B;  2JNF A;  1EG4 A;  1QX2 A;  3PAL A;  1KQM B;  3VRP A;  1Y1U A;  5D69 A;  4N1G A;  2KAV A;  2M1U A;  1S26 D;  1PK0 D;  2BKH B;  2JZI A;  3JTD B;  3TDZ A;  3M0W A;  1SMG A;  3IF7 A;  4Q04 A;  1RFJ A;  1TRF A;  1SK6 D;  1XFU O;  4YI9 A;  1QX7 A;  2HET A;  1G33 A;  4ZCU A;  1IJ5 A;  1PRW A;  3I5G B;  2KHN A;  1NX2 A;  1K93 D;  4GGF A;  4GFT A;  1X02 A;  1ZOT B;  1S6C A;  4JPZ B;  3RM1 A;  1WLM A;  2ZRT A;  3HX4 A;  2EC6 C;  1F54 A;  1MXL C;  2BE6 A;  3AKA A;  2M29 A;  5CSI A;  2LMV A;  2R2I A;  1SCM C;  1H8B A;  1OMV A;  1UP5 A;  2F2P A;  1NCY A;  1OZS A;  1CKK A;  1NUB A;  1UHK A;  3FWC A;  3WHT B;  2GGM A;  1SW8 A;  1A4P A;  3KO0 A;  4TNC A;  1L2O C;  1S5G Y;  1TNP A;  1LIN A;  1SL9 A;  1QVI Z;  3LCP C;  3ZWH A;  1TIZ A;  1SYM A;  1KFX L;  1OE9 B;  3BOW B;  1IGV A;  2KAX A;  4OCI A;  2HF5 A;  1F4O A;  1K95 A;  2KI4 C;  1F8H A;  3LK0 A;  2I18 A;  5AEQ A;  3MSE B;  1CM1 A;  5CPV A;  1CDP A;  3ZNI A;  2ZNE A;  3DVE A;  2M3W A;  4HRE E;  1SRA A;  2KQY A;  2KFF A;  2NZ0 A;  1W7I B;  2L5X B;  4M2Q A;  1A75 B;  2L0P A;  2RGI A;  2TN4 A;  1PSB A;  1M39 A;  1S1E A;  1YUS A;  4DUQ A;  1AP4 A;  4YBH B;  1BJF A;  3CZT X;  3KPX A;  4MVF A;  1E8A A;  1KWO B;  1KK7 Z;  2KYC A;  3K21 A;  1C07 A;  3TS5 B;  1F70 A;  1KK8 B;  4ICB A;  2CTN A;  2ZN8 A;  2LMT A;  2FJU B;  3NSK A;  1BT6 A;  1M31 A;  2F3Z A;  5KSZ A;  2KFH A;  3NSI A;  1NX0 A;  2MJW B;  3GOF A;  2JRF A;  4D1E A;  2V53 A;  4YGC B;  2PRU A;  1KFU L;  1S3P A;  2F3Y A;  2JU0 A;  1SPY A;  1C7W A;  1SL7 A;  4ORA B;  3VRO A;  1F71 A;  1DGV A;  4JQ0 D;  1UWO A;  1B8L A;  1MXE A;  1IJ6 A;  1NSH A;  3IQO A;  5F6T A;  3SIB A;  3OX5 A;  1JBA A;  1BR1 B;  1N2D A;  1XFY O;  5ER5 A;  4DIR A;  5HKW A;  3CR2 A;  2F33 A;  1LA3 A;  4DCK A;  4U8D A;  4P2Y B;  2H61 C;  2NLN A;  4IL1 A;  1M46 A;  3CTN A;  5AXI A;  5J3X A;  3SJS A;  2WC8 A;  2MRD A;  2IS9 A;  1OMR A;  1J7O A;  1AJ5 A;  3TZ1 A;  2WCB A;  3D10 A;  1AVS A;  2G9B A;  1CTR A;  3CLN A;  1UHH A;  1B4C A;  1CNP A;  5JOL A;  1TOP A;  4FTG A;  2BL0 B;  2K61 A;  1NWD A;  1BG1 A;  1K9U A;  2MHH A;  1DJH A;  1LVC D;  4CLN A;  1SBJ A;  1GGW A;  1CLM A;  4XJK A;  2KFG A;  1SNL A;  2KAY A;  4PAL A;  1SY9 A;  1YUR A;  5CSF A;  3O4Y A;  1J7P A;  1HT9 A;  1B7T Y;  1K8U A;  2O5G A;  2SAS A;  3DVJ A;  4N1F A;  3TUY B;  4C0K A;  1BF5 A;  2KOT A;  1ZMZ A;  4GBA A;  4M2P A;  5JJG A;  4MZK A;  2KBI A;  2NCO A;  1CMG A;  1J7Q A;  1ZUZ A;  2L4H A;  1WRZ A;  4BY5 A;  5K89 A;  1XA5 A;  2M7N A;  1K9K A;  1Y1X A;  2KGR A;  5DKN A;  2JXL A;  4UPG A;  4OR9 B;  1KSO A;  2JNX A;  2F2O A;  2EGD A;  4P5O E;  1IH0 A;  1CFD A;  1J1E A;  4PE4 A;  1MF8 B;  1S5G Z;  1UUR A;  1PSR A;  1YUT A;  1PUL A;  3OB2 B;  2F8P A;  1JWD A;  4FQO A;  5PAL A;  3AAK A;  2FCD A;  2LNK A;  1IRJ A;  2OPO A;  5AFP A;  3SG5 A;  1S6J A;  3CGA A;  1B1G A;  1KFX S;  2OTG C;  2PMY A;  2NCP A;  1L2O B;  2JQ6 A;  2I7A A;  4WRI A;  3I5I C;  1DVI A;  2K7B A;  3FWB A;  4XJK B;  4XYN A;  1NP8 A;  1U5I A;  4OVN F;  5G08 A;  4PE1 A;  1DJZ A;  4MRY A;  4YGE B;  5I2L A;  1OOJ A;  1TTX A;  3LK1 A;  5I2O A;  1MWN A;  3OP0 A;  3JVT C;  1QAT A;  5KTY A;  1A03 A;  3CWG A;  1KQM C;  1SR6 B;  1A29 A;  2KGB C;  4YGD B;  2L50 A;  2LC5 A;  2K8M B;  3PLF B;  2M7L A;  1B9A A;  1QIV A;  4WQ2 A;  1QS7 A;  1WRK A;  2ZFD A;  2LHL A;  5TNC A;  1L7Z A;  3JTD C;  4NDB A;  3BUN B;  1UHI A;  4CFQ A;  2LLU A;  3BYA A;  1AJ4 A;  1DMO A;  1XO5 A;  2QPT A;  1BOC A;  1OQP A;  3EVR A;  1EXR A;  1Q80 A;  5D7F A;  2WOS A;  3VRQ A;  2JOJ A;  5B8I B;  1TNW A;  1JFJ A;  2AUC A;  1KFU S;  3I5F C;  3I5H B;  4CPV A;  1H4B A;  1FI5 A;  4AOM A;  4ETO A;  3SG2 A;  1JSA A;  1JFK A;  1AUI B;  1LXF C;  2LVI A;  2LUC A;  2LMU A;  5ER4 X;  2CNP A;  1CFP A;  3BUO B;  2PAL A;  1DJY A;  1K96 A;  1IQ5 A;  3AKB A;  2LUX A;  1DGU A;  1DTL A;  1IG5 A;  1G4Y R;  1TCF A;  1U5I B;  4PCW A;  3RLZ A;  3PSR A;  1NIW A;  1QX5 B;  1WDC B;  4YGA A;  2B1U A;  3VRN A;  1ODB A;  4NDC A;  1OMD A;  2JWW A;  1IQ3 A;  2GV5 A;  3O6B A;  1MHO A;  2G2B A;  5DKQ A;  3BUM B;  2K2F A;  3PAT A;  2BBN A;  1SKT A;  2LV7 A;  3PN7 B;  1N0Y A;  1NCZ A;  2JC2 A;  2L4I A;  1CDM A;  5HLO A;  3TS5 C;  1ALV A;  1KK8 C;  2Y1N A;  1CDL A;  2BE4 A;  1XFV O;  4MBE A;  3CR4 X;  1TNX A;  1BMO A;  1TNQ A;  4N5X A;  4ZCV A;  2FOT A;  1K2H A;  1IKU A;  2JUL A;  1QJT A;  1KK7 Y;  4E68 A;  3EK4 A;  2LM5 A;  1ZFS A;  3GK1 A;  5KU1 A;  2LE9 B;  1EH2 A;  1DJG A;  2L2E A;  4YGB B;  1FF1 A;  3DD4 A;  1KSM A;  4MZJ A;  4OKH A;  4R1E A;  1QV1 A;  2KI6 D;  1OSA A;  2AAO A;  2K7O A;  2JT8 A;  2LAP A;  1WLZ A;  1YUU A;  3H4S E;  4QJ3 B;  2Y1M A;  2HQ8 A;  2JTT A;  2PVB A;  5HKZ A;  5GQQ C;  1A2X A;  1EL4 A;  2M9G A;  4QJ4 B;  1XVJ A;  4HRH A;  3NSL A;  3EVU A;  1NX3 A;  3AAJ A;  1GJY A;  1CLL A;  3CR5 X;  5I2Q A;  5HLV A;  2L98 A;  3SG4 A;  3LLE A;  2M1K B;  4C0J A;  3EKJ A;  3TDU A;  1UHJ A;  1VRK A;  2OS8 C;  4DS7 A; 
#chains in the Genus database with same CATH topology
 1EJ3 A;  1REC A;  3GK4 X;  2BL0 C;  1XK4 C;  2BCA A;  2LVK A;  4MEW A;  3BQ3 A;  2BEC A;  4PDZ A;  2EC6 B;  3FS7 A;  3NSO A;  5I94 A;  1LKJ A;  1UUS A;  1Y0V H;  1W7J B;  2K60 A;  3EVV A;  3HCM A;  4QJ5 B;  4IJ7 A;  1AHR A;  2MBX A;  2LP3 A;  4JWQ A;  1SCM B;  3CZ1 A;  2JPT A;  1BU3 A;  2VRG A;  1Y6W A;  3OBV A;  1YX8 A;  1AK8 A;  2K0J A;  3EKH A;  1YVH A;  2O60 A;  2WC6 A;  4YI8 A;  3TUY C;  4A4B A;  2Y5I A;  3CS1 A;  3O2P A;  2BKI B;  3WXA A;  5AAN A;  1RJV A;  4HRG A;  1DF0 A;  3S0G A;  1CB1 A;  2AMI A;  1QLS A;  3DVM A;  2ZND A;  1A75 A;  4GUK A;  1QV0 A;  1XFW O;  4BY4 A;  1DJI A;  2KI4 B;  1OW4 A;  2CCM A;  2PAS A;  4OZD A;  1EG3 A;  2ZKM X;  2H61 A;  2K7C A;  3KF9 A;  3D77 A;  1K9P A;  3QRX A;  1MUX A;  2L51 A;  1M63 B;  3TDI A;  1YX7 A;  1CLB A;  1RWY A;  4HSZ A;  3SIA A;  3N7H A;  3I5F B;  1Z4H A;  5HKY A;  2MLF C;  1FPW A;  1N65 A;  3EK8 A;  1J1D A;  1YRU B;  2P6B B;  3I5G C;  4ORC B;  2LVV A;  1B8R A;  1LA0 A;  2KNE A;  1CM4 A;  3PM2 A;  4L9M A;  4NQG A;  3C1V A;  4M2O A;  1DT7 B;  4I5J A;  1IIO A;  1C3Y A;  1WRL A;  2HQW A;  2GGZ A;  3R1O A;  1IWQ A;  2JXC A;  2WCF A;  1V1G A;  1J55 A;  3D0Y A;  2BCX A;  2E6W A;  3D74 A;  3CDN A;  4I5L B;  1Y1A A;  5BPJ A;  2COL B;  2Q91 A;  3OB1 B;  4A4C A;  4MZL A;  2JT0 A;  4ORB B;  5CSJ A;  4PE0 A;  3SG7 A;  2LP2 A;  4F0Z B;  1CFF A;  4CFR A;  1PVB A;  3BFB A;  3CYZ A;  1OZO A;  1SR6 C;  1HQV A;  4PE7 A;  1FI6 A;  1MQ1 A;  1V1F A;  2K2A A;  2I2R E;  3OX6 A;  4GPL B;  1NYA A;  2Y4Q A;  3D73 A;  3PM8 A;  1DF0 B;  1NPQ A;  2CBL A;  4DRW A;  1JF0 A;  4MSP A;  5I8N A;  2WCK A;  1TN4 A;  2ISD A;  1K94 A;  3O78 A;  3QME A;  4GGN A;  2JT3 A;  3BUX B;  2BBM A;  2WND A;  2K7D A;  2PSR A;  2L5Y A;  1PVA A;  3BFH A;  1QWV A;  1SL8 A;  5FYX A;  2Q4U A;  1G8I A;  4PT1 A;  1XK4 A;  4PHN A;  3SG6 A;  1QVI Y;  5DIC A;  3DVK A;  3A4U B;  1JUO A;  4MLW A;  1K90 D;  2KBM A;  3WNX B;  1JC2 A;  1R6P A;  3I5H C;  3FE8 A;  2QEO A;  4C0L A;  2KYF A;  2D8N A;  3B6X A;  2SCP A;  1FW4 A;  1NX1 A;  2A4J A;  1S6I A;  2LVJ A;  1KQV A;  4GGF C;  1KWO C;  4CID A;  1YTZ C;  1B7T Z;  4AQI A;  1RK9 A;  4AQJ A;  1P28 A;  1CDN A;  4I5K A;  5AER A;  1UHN A;  3ICB A;  1QTX A;  2JTZ A;  1QAS A;  4F7F A;  1DEL A;  1DJX A;  2H2K A;  1QLK A;  2LHI A;  2P71 A;  3KHE A;  3NHT A;  3D0Y B;  1ZAC A;  3IQQ A;  5CSN A;  3DF0 A;  1QIW A;  2KDH A;  1F55 A;  3B86 A;  2LCP A;  1J7R A;  2I94 A;  1F4Q A;  1RRO A;  2KI6 C;  1BOD A;  2M97 A;  2MAZ A;  4USL A;  1B8C A;  1WDC C;  1GGZ A;  4MRX A;  3VRR A;  4YRU A;  1WY9 A;  2BCB A;  1KCY A;  1BR4 B;  3A8R A;  3OHM B;  3WHU B;  4I5N B;  4NDD A;  2WCE A;  4MN0 A;  3E3R A;  5IBW A;  1SSE B;  2CT9 A;  1OOH A;  1GQM A;  5DKR A;  3NXA A;  2MA2 A;  2ZRS A;  1TCO B;  2KSP A;  4GAO A;  1S36 A;  1NCX A;  2OS8 B;  3PN7 C;  1PAL A;  1XFX O;  1QXP A;  2ZN9 A;  2WCM A;  2M49 B;  3VGO A;  1R2U A;  2FCE A;  1DEK A;  2CXJ A;  1CFC A;  3SG3 A;  1MR8 A;  5HYD A;  4WQ3 A;  2DOQ A;  2MLE C;  1FBV A;  2M8U A;  1YRT B;  3EK7 A;  2EHB A;  1ALW A;  2NXQ A;  1YVL A;  1SCV A;  3BXK A;  4OV2 A;  4PHJ A;  1CMF A;  1BLQ A;  3LL8 B;  1C7V A;  4PHM A;  2LAN A;  1D1O A;  2LLS A;  2OTG B;  2LLT A;  3BUW B;  2E30 A;  2WOR A;  1YR5 A;  4GNK B;  1DJW A;  2HPS A;  1JF2 A;  4PHK A;  3I5I B;  3FIA A;  1Z2C B;  3KEV A;  1XFZ O;  1XYD A;  2M0R A;  2KQ6 A;  3PFV A;  1B47 A;  3BOW A;  1RTP 1;  2QAC A;  3DF0 B;  3IVT A;  3F45 A;  3GK2 A;  1M45 A;  3S0A A;  3JVT B;  2JNF A;  1EG4 A;  1QX2 A;  3PAL A;  1KQM B;  3SS4 A;  1Y1U A;  3VRP A;  5D69 A;  4N1G A;  2H8V A;  2KAV A;  2M1U A;  1S26 D;  1PK0 D;  2BKH B;  3D75 A;  2JZI A;  1DQE A;  3JTD B;  3TDZ A;  3M0W A;  1SMG A;  3IF7 A;  4Q04 A;  1RFJ A;  1TRF A;  1SK6 D;  1XFU O;  3D78 A;  5FI2 A;  4YI9 A;  1QX7 A;  2HET A;  3B87 A;  1G33 A;  2KLE A;  4ZCU A;  1IJ5 A;  1PRW A;  3I5G B;  2KHN A;  3R1V A;  1NX2 A;  1K93 D;  4GGF A;  4GFT A;  1X02 A;  1ZOT B;  1S6C A;  4JPZ B;  3RM1 A;  1WLM A;  2ZRT A;  3HX4 A;  2EC6 C;  1F54 A;  1MXL C;  2BE6 A;  3L4A A;  3AKA A;  2M29 A;  5CSI A;  2LMV A;  2PQL A;  2R2I A;  1SCM C;  1H8B A;  1OMV A;  2YGU A;  1UP5 A;  2F2P A;  1NCY A;  1OZS A;  1CKK A;  3CAB A;  1NUB A;  1UHK A;  3FWC A;  3WHT B;  2GGM A;  1SW8 A;  2ERB A;  1A4P A;  3KO0 A;  4TNC A;  1L2O C;  1S5G Y;  1TNP A;  1LIN A;  1SL9 A;  1QVI Z;  3LCP C;  3ZWH A;  1TIZ A;  1SYM A;  1KFX L;  1OE9 B;  3BOW B;  1TUJ A;  1IGV A;  2KAX A;  4OCI A;  2HF5 A;  1F4O A;  1K95 A;  2KI4 C;  1F8H A;  4KYN A;  3LK0 A;  2I18 A;  5AEQ A;  3MSE B;  1CM1 A;  4FQT A;  1CDP A;  5CPV A;  3ZNI A;  2ZNE A;  3DVE A;  2M3W A;  4HRE E;  1SRA A;  2KQY A;  2KFF A;  2NZ0 A;  1W7I B;  2L5X B;  3R72 A;  4M2Q A;  1LS8 A;  1A75 B;  2L0P A;  2RGI A;  2QEH A;  2TN4 A;  1PSB A;  1M39 A;  1S1E A;  1YUS A;  4DUQ A;  4JKT A;  1AP4 A;  4INX A;  4YBH B;  1BJF A;  3CZT X;  3KPX A;  4MVF A;  1E8A A;  1KWO B;  1KK7 Z;  2KYC A;  3K21 A;  1C07 A;  3TS5 B;  1F70 A;  1KK8 B;  4ICB A;  2CTN A;  2ZN8 A;  2LMT A;  2FJU B;  3NSK A;  1BT6 A;  1M31 A;  2F3Z A;  3OGN A;  2KFH A;  3NSI A;  5KSZ A;  1OOI X;  1NX0 A;  2MJW B;  3GOF A;  2JRF A;  4D1E A;  2V53 A;  4YGC B;  2PRU A;  1KFU L;  1S3P A;  2F3Y A;  1C3Z A;  2JU0 A;  1TUZ A;  2QEV A;  1SPY A;  1C7W A;  1SL7 A;  2FJY A;  4ORA B;  3VRO A;  1F71 A;  1DGV A;  4JQ0 D;  1UWO A;  1B8L A;  1MXE A;  1IJ6 A;  1NSH A;  3IQO A;  5F6T A;  3SIB A;  3OX5 A;  1JBA A;  1BR1 B;  1N2D A;  1XFY O;  2WC5 A;  5ER5 A;  4DIR A;  5HKW A;  3CR2 A;  2F33 A;  1LA3 A;  3L4L A;  3L47 A;  1T14 A;  4DCK A;  4U8D A;  4P2Y B;  2H61 C;  5HL1 A;  2NLN A;  4IL1 A;  1M46 A;  3CTN A;  5AXI A;  5J3X A;  3DZT A;  2WC8 A;  3D76 A;  3SJS A;  2MRD A;  1XFR A;  2IS9 A;  1OMR A;  1J7O A;  1AJ5 A;  3O4X A;  2QEB A;  3TZ1 A;  2WCB A;  3D10 A;  1AVS A;  2G9B A;  1CTR A;  3CLN A;  1UHH A;  1B4C A;  1CNP A;  5JOL A;  1TOP A;  1W9Z A;  4FTG A;  2BL0 B;  2K61 A;  3EG5 B;  1NWD A;  1BG1 A;  3CZ2 A;  1K9U A;  2MHH A;  1DJH A;  1LVC D;  3CZ0 A;  4CLN A;  1SBJ A;  1GGW A;  1CLM A;  4XJK A;  2KFG A;  1SNL A;  2KAY A;  4PAL A;  1SY9 A;  1YUR A;  5CSF A;  3O4Y A;  3K1E A;  3SS5 A;  1J7P A;  1HT9 A;  1B7T Y;  1K8U A;  2O5G A;  2SAS A;  3DVJ A;  2BNX A;  4N1F A;  3TUY B;  4C0K A;  2KOT A;  1BF5 A;  1ZMZ A;  4GBA A;  4M2P A;  5JJG A;  4MZK A;  2KBI A;  2NCO A;  5D3O A;  1CMG A;  1ZUZ A;  1J7Q A;  2L4H A;  1WRZ A;  4BY5 A;  5K89 A;  1XA5 A;  2M7N A;  1K9K A;  1Y1X A;  2KGR A;  2L2C A;  5DKN A;  2JXL A;  2PYQ A;  4UPG A;  3DXL A;  4OR9 B;  1KSO A;  2JNX A;  2F2O A;  3FE6 A;  2EGD A;  4P5O E;  3R1P A;  1IH0 A;  1CFD A;  1J1E A;  4PE4 A;  1MF8 B;  1S5G Z;  1UUR A;  1PSR A;  1YUT A;  1PUL A;  3OB2 B;  2F8P A;  1JWD A;  2GTE A;  4FQO A;  5PAL A;  3AAK A;  2FCD A;  2LNK A;  1IRJ A;  2OPO A;  5AFP A;  3DYE A;  3SG5 A;  1S6J A;  3CGA A;  1B1G A;  1KFX S;  2OTG C;  2PMY A;  2NCP A;  1L2O B;  2JQ6 A;  2I7A A;  4WRI A;  3I5I C;  1DVI A;  2K7B A;  3FWB A;  4XJK B;  4XYN A;  1NP8 A;  2KLD A;  1U5I A;  4OVN F;  5G08 A;  4PE1 A;  1DJZ A;  4MRY A;  4YGE B;  5I2L A;  1OOJ A;  1TTX A;  3LK1 A;  5I2O A;  1MWN A;  3OP0 A;  3JVT C;  1QAT A;  5KTY A;  1A03 A;  3CWG A;  1KQM C;  1SR6 B;  1A29 A;  2KGB C;  4YGD B;  2L50 A;  2LC5 A;  2K8M B;  3PLF B;  2M7L A;  2QDI A;  1B9A A;  1QIV A;  4WQ2 A;  1QS7 A;  1WRK A;  3S0F A;  2ZFD A;  2LHL A;  5TNC A;  1L7Z A;  3JTD C;  4NDB A;  3BUN B;  1UHI A;  3S0D A;  4CFQ A;  2BAP A;  2LLU A;  3BYA A;  1AJ4 A;  3RZS A;  3S0B A;  1DMO A;  1XO5 A;  2QPT A;  5FI6 A;  1OQP A;  1BOC A;  3EVR A;  1EXR A;  1Q80 A;  5D7F A;  2WOS A;  3VRQ A;  3VB1 A;  2JOJ A;  5B8I B;  1TNW A;  1JFJ A;  2AUC A;  1KFU S;  3I5F C;  3I5H B;  4CPV A;  1GM0 A;  1H4B A;  3Q8I A;  1FI5 A;  4AOM A;  1DC1 A;  4ETO A;  1TWO A;  3SG2 A;  1OOF A;  1JFK A;  1AUI B;  1LXF C;  2LVI A;  2LUC A;  2LMU A;  5ER4 X;  1JSA A;  2CNP A;  1CFP A;  2WCL A;  3BUO B;  2PAL A;  1DJY A;  1K96 A;  1IQ5 A;  3AKB A;  2LUX A;  1DGU A;  5EL2 A;  1DTL A;  1IG5 A;  1G4Y R;  1TCF A;  1U5I B;  3BJH A;  4PCW A;  2WCJ A;  3RLZ A;  3PSR A;  1NIW A;  1QX5 B;  4JD9 A;  1WDC B;  4YGA A;  2B1U A;  3VRN A;  1ODB A;  4NDC A;  1OMD A;  3UO9 A;  2WCH A;  2JWW A;  1IQ3 A;  2JPO A;  3DY9 A;  3S0E A;  2GV5 A;  3O6B A;  1MHO A;  2G2B A;  3B88 A;  3BUM B;  3B7A A;  2K2F A;  5DKQ A;  3PAT A;  3FE9 A;  2BBN A;  1SKT A;  1OOG A;  2LV7 A;  3BFA A;  3PN7 B;  1N0Y A;  1NCZ A;  2JC2 A;  2L4I A;  1CDM A;  3V2L A;  5HLO A;  3TS5 C;  1ALV A;  1KK8 C;  2Y1N A;  1CDL A;  2BE4 A;  1XFV O;  3SS3 A;  4MBE A;  4INW A;  3CR4 X;  1TNX A;  1BMO A;  1TNQ A;  4N5X A;  4ZCV A;  2FOT A;  1K2H A;  1IKU A;  2JUL A;  1QJT A;  1KK7 Y;  4E68 A;  3EK4 A;  2LM5 A;  1ZFS A;  3GK1 A;  5KU1 A;  2LE9 B;  1EH2 A;  5FI7 A;  1DJG A;  2L2E A;  4YGB B;  1FF1 A;  3DD4 A;  1KSM A;  4MZJ A;  4OKH A;  4R1E A;  1QV1 A;  2KI6 D;  1OSA A;  2AAO A;  2K7O A;  2JT8 A;  2LAP A;  1WLZ A;  1YUU A;  3H4S E;  4QJ3 B;  3NHI A;  3UNW A;  2Y1M A;  2HQ8 A;  2JTT A;  2PVB A;  5HKZ A;  5GQQ C;  1A2X A;  1EL4 A;  2M9G A;  4QJ4 B;  1XVJ A;  4HRH A;  3NSL A;  1ORG A;  3EVU A;  1NX3 A;  3AAJ A;  1GJY A;  2KPH A;  1CLL A;  3CR5 X;  5I2Q A;  5HLV A;  2L98 A;  3SG4 A;  3PJI A;  2P70 A;  3LLE A;  2M1K B;  4C0J A;  3EKJ A;  3NGV A;  3TDU A;  1UHJ A;  1VRK A;  2OS8 C;  4DS7 A; 
#chains in the Genus database with same CATH homology
 1EJ3 A;  1REC A;  3GK4 X;  2BL0 C;  1XK4 C;  2BCA A;  2LVK A;  4MEW A;  3BQ3 A;  2BEC A;  4PDZ A;  2EC6 B;  3FS7 A;  3NSO A;  1LKJ A;  1UUS A;  1Y0V H;  1W7J B;  3EVV A;  3HCM A;  4QJ5 B;  1AHR A;  2MBX A;  2LP3 A;  4JWQ A;  1SCM B;  2JPT A;  1BU3 A;  2VRG A;  1Y6W A;  1YX8 A;  1AK8 A;  2K0J A;  3EKH A;  1YVH A;  2O60 A;  4YI8 A;  3TUY C;  4A4B A;  2Y5I A;  3CS1 A;  3O2P A;  2BKI B;  3WXA A;  5AAN A;  1RJV A;  4HRG A;  1DF0 A;  1CB1 A;  2AMI A;  1QLS A;  3DVM A;  2ZND A;  1A75 A;  4GUK A;  1QV0 A;  1XFW O;  4BY4 A;  1DJI A;  2KI4 B;  2CCM A;  2PAS A;  1EG3 A;  2ZKM X;  2H61 A;  2K7C A;  3KF9 A;  1K9P A;  3QRX A;  1MUX A;  2L51 A;  1M63 B;  3TDI A;  1YX7 A;  1CLB A;  1RWY A;  4HSZ A;  3SIA A;  5HKY A;  3I5F B;  2MLF C;  1FPW A;  1N65 A;  3EK8 A;  1J1D A;  1YRU B;  2P6B B;  3I5G C;  4ORC B;  2LVV A;  1B8R A;  1LA0 A;  2KNE A;  1CM4 A;  4L9M A;  4NQG A;  3C1V A;  4M2O A;  1DT7 B;  4I5J A;  1WRL A;  2HQW A;  2GGZ A;  1IWQ A;  2JXC A;  2WCF A;  1V1G A;  1J55 A;  3D0Y A;  2BCX A;  2E6W A;  4I5L B;  1Y1A A;  5BPJ A;  2COL B;  2Q91 A;  3OB1 B;  4A4C A;  4MZL A;  2JT0 A;  4ORB B;  5CSJ A;  4PE0 A;  3SG7 A;  2LP2 A;  4F0Z B;  1CFF A;  4CFR A;  1PVB A;  1FI6 A;  1OZO A;  1SR6 C;  1HQV A;  4PE7 A;  1MQ1 A;  1V1F A;  2K2A A;  2I2R E;  3OX6 A;  4GPL B;  1NYA A;  2Y4Q A;  3PM8 A;  1DF0 B;  1NPQ A;  2CBL A;  4DRW A;  1JF0 A;  4MSP A;  5I8N A;  1TN4 A;  2ISD A;  1K94 A;  3O78 A;  4GGN A;  2JT3 A;  3BUX B;  2BBM A;  2WND A;  2K7D A;  2PSR A;  1PVA A;  1SL8 A;  5FYX A;  2Q4U A;  1G8I A;  1XK4 A;  4PHN A;  3SG6 A;  1QVI Y;  3DVK A;  3A4U B;  1JUO A;  4MLW A;  1K90 D;  2KBM A;  3WNX B;  1JC2 A;  1R6P A;  3I5H C;  4C0L A;  2KYF A;  2D8N A;  2SCP A;  1FW4 A;  1NX1 A;  2A4J A;  1S6I A;  2LVJ A;  1KQV A;  4GGF C;  1KWO C;  4CID A;  1YTZ C;  1B7T Z;  4AQI A;  1RK9 A;  4AQJ A;  1CDN A;  4I5K A;  5AER A;  1UHN A;  3ICB A;  1QTX A;  2JTZ A;  1QAS A;  1DJX A;  2H2K A;  2LHI A;  1QLK A;  3KHE A;  3D0Y B;  1ZAC A;  3IQQ A;  5CSN A;  3DF0 A;  1QIW A;  2KDH A;  1F55 A;  2LCP A;  1J7R A;  2I94 A;  1F4Q A;  1RRO A;  2KI6 C;  1BOD A;  2M97 A;  2MAZ A;  4USL A;  1B8C A;  1WDC C;  1GGZ A;  4MRX A;  3VRR A;  4YRU A;  1WY9 A;  2BCB A;  1KCY A;  1BR4 B;  3A8R A;  3OHM B;  3WHU B;  4I5N B;  4NDD A;  2WCE A;  4MN0 A;  3E3R A;  5IBW A;  2CT9 A;  1GQM A;  5DKR A;  3NXA A;  2MA2 A;  2ZRS A;  1TCO B;  2KSP A;  4GAO A;  1S36 A;  1NCX A;  2OS8 B;  3PN7 C;  1PAL A;  1XFX O;  1QXP A;  2ZN9 A;  2M49 B;  3VGO A;  1R2U A;  2FCE A;  2CXJ A;  1CFC A;  3SG3 A;  1MR8 A;  5HYD A;  4WQ3 A;  2DOQ A;  2MLE C;  1FBV A;  2M8U A;  1YRT B;  3EK7 A;  2EHB A;  1ALW A;  2NXQ A;  1YVL A;  1SCV A;  3BXK A;  4OV2 A;  4PHJ A;  1CMF A;  1BLQ A;  3LL8 B;  1C7V A;  4PHM A;  2LAN A;  1D1O A;  2LLS A;  2OTG B;  2LLT A;  3BUW B;  2E30 A;  2WOR A;  1YR5 A;  4GNK B;  1DJW A;  2HPS A;  1JF2 A;  4PHK A;  3I5I B;  3FIA A;  3KEV A;  1XFZ O;  1XYD A;  2M0R A;  2KQ6 A;  3PFV A;  1B47 A;  3BOW A;  1RTP 1;  2QAC A;  3DF0 B;  3F45 A;  3GK2 A;  1M45 A;  3JVT B;  2JNF A;  1EG4 A;  1QX2 A;  3PAL A;  1KQM B;  3VRP A;  1Y1U A;  5D69 A;  4N1G A;  2KAV A;  2M1U A;  1S26 D;  1PK0 D;  2BKH B;  2JZI A;  3JTD B;  3TDZ A;  3M0W A;  1SMG A;  3IF7 A;  4Q04 A;  1RFJ A;  1TRF A;  1SK6 D;  1XFU O;  4YI9 A;  1QX7 A;  2HET A;  1G33 A;  4ZCU A;  1IJ5 A;  1PRW A;  3I5G B;  2KHN A;  1NX2 A;  1K93 D;  4GGF A;  4GFT A;  1X02 A;  1ZOT B;  1S6C A;  4JPZ B;  3RM1 A;  1WLM A;  2ZRT A;  3HX4 A;  2EC6 C;  1F54 A;  1MXL C;  2BE6 A;  3AKA A;  2M29 A;  5CSI A;  2LMV A;  2R2I A;  1SCM C;  1H8B A;  1OMV A;  1UP5 A;  2F2P A;  1NCY A;  1OZS A;  1CKK A;  1NUB A;  1UHK A;  3FWC A;  3WHT B;  2GGM A;  1SW8 A;  1A4P A;  3KO0 A;  4TNC A;  1L2O C;  1S5G Y;  1TNP A;  1LIN A;  1SL9 A;  1QVI Z;  3LCP C;  3ZWH A;  1TIZ A;  1SYM A;  1KFX L;  1OE9 B;  3BOW B;  1IGV A;  2KAX A;  4OCI A;  2HF5 A;  1F4O A;  1K95 A;  2KI4 C;  1F8H A;  3LK0 A;  2I18 A;  5AEQ A;  3MSE B;  1CM1 A;  5CPV A;  1CDP A;  3ZNI A;  2ZNE A;  3DVE A;  2M3W A;  4HRE E;  1SRA A;  2KQY A;  2KFF A;  2NZ0 A;  1W7I B;  2L5X B;  4M2Q A;  1A75 B;  2L0P A;  2RGI A;  2TN4 A;  1PSB A;  1M39 A;  1S1E A;  1YUS A;  4DUQ A;  1AP4 A;  4YBH B;  1BJF A;  3CZT X;  3KPX A;  4MVF A;  1E8A A;  1KWO B;  1KK7 Z;  2KYC A;  3K21 A;  1C07 A;  3TS5 B;  1F70 A;  1KK8 B;  4ICB A;  2CTN A;  2ZN8 A;  2LMT A;  2FJU B;  3NSK A;  1BT6 A;  1M31 A;  2F3Z A;  5KSZ A;  2KFH A;  3NSI A;  1NX0 A;  2MJW B;  3GOF A;  2JRF A;  4D1E A;  2V53 A;  4YGC B;  2PRU A;  1KFU L;  1S3P A;  2F3Y A;  2JU0 A;  1SPY A;  1C7W A;  1SL7 A;  4ORA B;  3VRO A;  1F71 A;  1DGV A;  4JQ0 D;  1UWO A;  1B8L A;  1MXE A;  1IJ6 A;  1NSH A;  3IQO A;  5F6T A;  3SIB A;  3OX5 A;  1JBA A;  1BR1 B;  1N2D A;  1XFY O;  5ER5 A;  4DIR A;  5HKW A;  3CR2 A;  2F33 A;  1LA3 A;  4DCK A;  4U8D A;  4P2Y B;  2H61 C;  2NLN A;  4IL1 A;  1M46 A;  3CTN A;  5AXI A;  5J3X A;  3SJS A;  2WC8 A;  2MRD A;  2IS9 A;  1OMR A;  1J7O A;  1AJ5 A;  3TZ1 A;  2WCB A;  3D10 A;  1AVS A;  2G9B A;  1CTR A;  3CLN A;  1UHH A;  1B4C A;  1CNP A;  5JOL A;  1TOP A;  4FTG A;  2BL0 B;  2K61 A;  1NWD A;  1BG1 A;  1K9U A;  2MHH A;  1DJH A;  1LVC D;  4CLN A;  1SBJ A;  1GGW A;  1CLM A;  4XJK A;  2KFG A;  1SNL A;  2KAY A;  4PAL A;  1SY9 A;  1YUR A;  5CSF A;  3O4Y A;  1J7P A;  1HT9 A;  1B7T Y;  1K8U A;  2O5G A;  2SAS A;  3DVJ A;  4N1F A;  3TUY B;  4C0K A;  1BF5 A;  2KOT A;  1ZMZ A;  4GBA A;  4M2P A;  5JJG A;  4MZK A;  2KBI A;  2NCO A;  1CMG A;  1J7Q A;  1ZUZ A;  2L4H A;  1WRZ A;  4BY5 A;  5K89 A;  1XA5 A;  2M7N A;  1K9K A;  1Y1X A;  2KGR A;  5DKN A;  2JXL A;  4UPG A;  4OR9 B;  1KSO A;  2JNX A;  2F2O A;  2EGD A;  4P5O E;  1IH0 A;  1CFD A;  1J1E A;  4PE4 A;  1MF8 B;  1S5G Z;  1UUR A;  1PSR A;  1YUT A;  1PUL A;  3OB2 B;  2F8P A;  1JWD A;  4FQO A;  5PAL A;  3AAK A;  2FCD A;  2LNK A;  1IRJ A;  2OPO A;  5AFP A;  3SG5 A;  1S6J A;  3CGA A;  1B1G A;  1KFX S;  2OTG C;  2PMY A;  2NCP A;  1L2O B;  2JQ6 A;  2I7A A;  4WRI A;  3I5I C;  1DVI A;  2K7B A;  3FWB A;  4XJK B;  4XYN A;  1NP8 A;  1U5I A;  4OVN F;  5G08 A;  4PE1 A;  1DJZ A;  4MRY A;  4YGE B;  5I2L A;  1OOJ A;  1TTX A;  3LK1 A;  5I2O A;  1MWN A;  3OP0 A;  3JVT C;  1QAT A;  5KTY A;  1A03 A;  3CWG A;  1KQM C;  1SR6 B;  1A29 A;  2KGB C;  4YGD B;  2L50 A;  2LC5 A;  2K8M B;  3PLF B;  2M7L A;  1B9A A;  1QIV A;  4WQ2 A;  1QS7 A;  1WRK A;  2ZFD A;  2LHL A;  5TNC A;  1L7Z A;  3JTD C;  4NDB A;  3BUN B;  1UHI A;  4CFQ A;  2LLU A;  3BYA A;  1AJ4 A;  1DMO A;  1XO5 A;  2QPT A;  1BOC A;  1OQP A;  3EVR A;  1EXR A;  1Q80 A;  5D7F A;  2WOS A;  3VRQ A;  2JOJ A;  5B8I B;  1TNW A;  1JFJ A;  2AUC A;  1KFU S;  3I5F C;  3I5H B;  4CPV A;  1H4B A;  1FI5 A;  4AOM A;  4ETO A;  3SG2 A;  1JSA A;  1JFK A;  1AUI B;  1LXF C;  2LVI A;  2LUC A;  2LMU A;  5ER4 X;  2CNP A;  1CFP A;  3BUO B;  2PAL A;  1DJY A;  1K96 A;  1IQ5 A;  3AKB A;  2LUX A;  1DGU A;  1DTL A;  1IG5 A;  1G4Y R;  1TCF A;  1U5I B;  4PCW A;  3RLZ A;  3PSR A;  1NIW A;  1QX5 B;  1WDC B;  4YGA A;  2B1U A;  3VRN A;  1ODB A;  4NDC A;  1OMD A;  2JWW A;  1IQ3 A;  2GV5 A;  3O6B A;  1MHO A;  2G2B A;  5DKQ A;  3BUM B;  2K2F A;  3PAT A;  2BBN A;  1SKT A;  2LV7 A;  3PN7 B;  1N0Y A;  1NCZ A;  2JC2 A;  2L4I A;  1CDM A;  5HLO A;  3TS5 C;  1ALV A;  1KK8 C;  2Y1N A;  1CDL A;  2BE4 A;  1XFV O;  4MBE A;  3CR4 X;  1TNX A;  1BMO A;  1TNQ A;  4N5X A;  4ZCV A;  2FOT A;  1K2H A;  1IKU A;  2JUL A;  1QJT A;  1KK7 Y;  4E68 A;  3EK4 A;  2LM5 A;  1ZFS A;  3GK1 A;  5KU1 A;  2LE9 B;  1EH2 A;  1DJG A;  2L2E A;  4YGB B;  1FF1 A;  3DD4 A;  1KSM A;  4MZJ A;  4OKH A;  4R1E A;  1QV1 A;  2KI6 D;  1OSA A;  2AAO A;  2K7O A;  2JT8 A;  2LAP A;  1WLZ A;  1YUU A;  3H4S E;  4QJ3 B;  2Y1M A;  2HQ8 A;  2JTT A;  2PVB A;  5HKZ A;  5GQQ C;  1A2X A;  1EL4 A;  2M9G A;  4QJ4 B;  1XVJ A;  4HRH A;  3NSL A;  3EVU A;  1NX3 A;  3AAJ A;  1GJY A;  1CLL A;  3CR5 X;  5I2Q A;  5HLV A;  2L98 A;  3SG4 A;  3LLE A;  2M1K B;  4C0J A;  3EKJ A;  3TDU A;  1UHJ A;  1VRK A;  2OS8 C;  4DS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...