1SBJA

Nmr structure of the mg2+-loaded c terminal domain of cardiac troponin c bound to the n terminal domain of cardiac troponin i
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
81
structure length
81
Chain Sequence
b'MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Troponin C, slow skeletal and cardiac muscles
publication title Structure of the Mg2+-loaded C-lobe of cardiac troponin C bound to the N-domain of cardiac troponin I: comparison with the Ca2+-loaded structure.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Contractile protein, structural protein
total genus 16
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2004-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1sbjA00
1B8CA 4D1EA 4HRHA 1LA0A 4MRYA 1RROA 1KFUL 1PK0D 4DRWA 1NWDA 2GGZA 1HQVA 1YTZC 2KYFA 2I18A 3BXKA 1K96A 1KFXS 2PVBA 1UUSA 2L50A 1ZUZA 4GBAA 3IQOA 1BJFA 2LVIA 1SR6C 3F45A 1NYAA 1J1EA 4CFQA 1ZFSA 3EVVA 1YVLA 3PN7B 1KSMA 2Y4QA 1MWNA 1KWOC 4MSPA 3GOFA 2WORA 2ZRTA 4BY4A 2SASA 3GK1A 4C0KA 3BOWA 1FI5A 2LMVA 2M8UA 2P6BB 1YX7A 1PVBA 2KI6C 2KQ6A 2MLFC 3SJSA 5TNCA 2KI6D 2LNKA 1K90D 1K9PA 1B47A 1XFZO 1Y1XA 2ZNEA 4ORBB 5AEQA 3GK2A 1OMDA 2K8MB 2JC2A 4GGNA 2COLB 1TNPA 1IG5A 1SL7A 4AOMA 2NLNA 2JU0A 4FQOA 2CXJA 1AJ5A 3DD4A 1K9UA 3EVRA 1AHRA 2ZRSA 1NIWA 2CBLA 3EKJA 5CSIA 3I5HC 3A8RA 1A2XA 2E6WA 1IQ3A 1M46A 4FTGA 2BCXA 2SCPA 5HKWA 1H4BA 2HQ8A 4A4BA 2Y5IA 3BOWB 2M0RA 1EJ3A 4ORCB 2OTGC 2JNFA 5ER5A 5HYDA 1KK7Y 2WCBA 5BPJA 1BMOA 3D0YA 1JSAA 1YUTA 1WLMA 3DF0A 1SCMC 1Y1AA 3EVUA 1KQMB 4ORAB 1FPWA 2EC6C 1C07A 4PHMA 1QV0A 1KFXL 1OQPA 1CLBA 1CFPA 1LXFC 2O60A 4WQ3A 2KNEA 3RM1A 1CDMA 2JNXA 4PE0A 3OHMB 2JTZA 1JWDA 1SW8A 1CTRA 2KI4B 2E30A 3EK4A 2VRGA 3TDIA 1F54A 2MHHA 2JWWA 3BUOB 3AKAA 1TNXA 2F2OA 2WC8A 2JXCA 1QVIZ 1TTXA 3IQQA 1XFUO 1GGZA 1FI6A 1SL8A 4MEWA 1CKKA 3RLZA 1GGWA 1R6PA 3EK7A 1NX1A 2M97A 3D0YB 4M2QA 1QX2A 2CNPA 4OR9B 2FCEA 5HKZA 4AQJA 2NCOA 1OZSA 4HREE 2WOSA 2GV5A 4WRIA 1CDPA 4XJKB 1CM1A 2KYCA 3H4SE 5B8IB 4UPGA 1W7JB 1MF8B 1WLZA 2LMTA 4ZCVA 3TDZA 1KSOA 2LLTA 4M2OA 1Y1UA 4MBEA 1EL4A 2ISDA 2NZ0A 2F3ZA 2PSRA 2LC5A 3QRXA 1OSAA 1EG4A 2BL0B 3NSLA 1N0YA 2AMIA 4L9MA 1IH0A 2MA2A 4PHKA 4U8DA 1JFKA 3GK4X 1XO5A 2BCAA 2JULA 1DJXA 1N2DA 1Y6WA 4N1FA 1F70A 1CMGA 2LP3A 3SIBA 4N1GA 4GGFC 2PASA 1SY9A 3BUMB 5KU1A 1QXPA 3FS7A 1BR1B 2LLSA 1XA5A 3D10A 2LANA 1WY9A 3VRQA 3NSIA 2KOTA 4HRGA 2I2RE 3CR2A 2F2PA 1B9AA 5AERA 1M45A 2M7LA 1K93D 3K21A 4MZJA 1F8HA 1NUBA 1V1GA 5J3XA 1QATA 5K89A 5CSJA 3JTDB 1IKUA 3CLNA 2CT9A 3PN7C 1J7QA 1H8BA 4GFTA 4OKHA 1BU3A 3PALA 4E68A 1BG1A 3SG3A 1PVAA 1XFWO 1IRJA 1DF0B 1S5GZ 2FCDA 3SIAA 1F4QA 1G8IA 2QACA 2KSPA 1QIWA 2ZN9A 1XK4C 3BUXB 3FIAA 2LLUA 4NDDA 3OX5A 2L2EA 3SG2A 2ZN8A 3I5FB 3O78A 4MRXA 1W7IB 1S6IA 4XYNA 2LVVA 1EXRA 3CTNA 1NP8A 1YURA 2KDHA 1ALVA 2K2FA 1KK8B 4JWQA 2CTNA 2CCMA 2RGIA 2JT0A 2ZKMX 4MVFA 2AUCA 2D8NA 1UHHA 2BKHB 1QLSA 1CB1A 2MJWB 5KSZA 1KQVA 2WCFA 1DGUA 3AAJA 1S3PA 1B7TZ 3TS5B 3DVKA 3NXAA 1JFJA 3I5GB 1NCZA 1C7WA 3M0WA 4WQ2A 1DMOA 1MHOA 5I8NA 1NCYA 3LL8B 1HT9A 1FW4A 1DJZA 3O4YA 2ZNDA 2JXLA 2LAPA 1GQMA 2JQ6A 3PM8A 3IF7A 2KBIA 1SK6D 3WHUB 1DVIA 5I2OA 1OOJA 1S6JA 2K7CA 2LE9B 3ICBA 1A29A 4YRUA 2F3YA 1KQMC 4PE4A 2F8PA 2K7DA 2TN4A 3DVEA 2MAZA 3TUYB 1QX7A 3JVTB 5PALA 2L98A 2OPOA 1F4OA 2LCPA 1ODBA 3BUWB 3EKHA 2KI4C 1DTLA 5I2LA 2M3WA 4ZCUA 1CNPA 1DJWA 1BT6A 1NSHA 1WRZA 2K0JA 3KHEA 1CFFA 5AANA 4CPVA 4DIRA 2M9GA 5IBWA 2R2IA 1NX2A 2BKIB 2M1KB 4MLWA 4YBHB 3NSOA 5CPVA 1BOCA 1K2HA 3MSEB 4BY5A 2B1UA 1Q80A 2KHNA 1QVIY 2K61A 3AKBA 1MXLC 1QS7A 4GUKA 1SNLA 1AJ4A 2G2BA 3SG7A 2DOQA 4YI9A 1ZACA 2MBXA 5HLOA 3CGAA 1ZOTB 1QTXA 1XFXO 3DF0B 4TNCA 1XYDA 1A75A 1YX8A 3OP0A 1TCFA 1CFCA 1K9KA 2BL0C 1JF2A 4CIDA 1NX3A 1K8UA 1U5IA 2M49B 1M63B 5CSFA 1J1DA 2F33A 3I5IB 3VRRA 1IJ5A 1LKJA 5DKQA 2LP2A 4JQ0D 1TNWA 1XFYO 1YUSA 1EG3A 1RECA 3OB2B 1AVSA 4C0LA 1CDLA 3LLEA 3CZTX 4CLNA 1BLQA 4P2YB 4OCIA 1JC2A 4P5OE 4YGAA 4NDBA 1M39A 1TOPA 5DKNA 2V53A 1LVCD 1TIZA 2KBMA 4M2PA 1CLLA 2H61A 2ZFDA 1UURA 1J7PA 1TCOB 2BECA 1S26D 2GGMA 1SYMA 4IL1A 4NDCA 2I7AA 1Y0VH 3PLFB 5GQQC 5I2QA 1DT7B 4PDZA 5HKYA 3FWBA 4GNKB 1S1EA 2JT3A 1ALWA 2M1UA 1M31A 2PMYA 3JTDC 2HQWA 1OMRA 2L0PA 1RTP1 1MR8A 1JF0A 1CLMA 1XVJA 1OMVA 1NX0A 1YRTB 2LV7A 3HCMA 2K7BA 1PSBA 1UP5A 3DVMA 4N5XA 2JZIA 5JOLA 1S5GY 1RJVA 3PSRA 1B8LA 2EHBA 2MLEC 3TZ1A 4C0JA 1QV1A 2LMUA 3I5FC 1V1FA 2KFHA 1PULA 2A4JA 3WHTB 1IJ6A 3LK0A 1JBAA 5AXIA 1J7OA 2KFFA 2G9BA 3WNXB 2EGDA 1CDNA 1KCYA 1KK8C 2IS9A 2K2AA 3EK8A 3VROA 1UWOA 1IQ5A 2H2KA 4Q04A 1XK4A 5DKRA 3OB1B 1WDCB 1UHNA 4GPLB 1J7RA 2I94A 5D69A 2WCEA 5JJGA 1B4CA 4PE7A 1QX5B 1A4PA 3CR5X 4I5KA 1UHKA 2JRFA 3TS5C 1RK9A 4JPZB 4DCKA 3DVJA 3I5GC 4OV2A 2L5XB 4PE1A 1QJTA 3C1VA 3VRPA 1BODA 1K95A 1SMGA 1B7TY 2KAVA 3A4UB 4MZKA 1A03A 1R2UA 1MXEA 1AUIB 1YR5A 2NCPA 2KFGA 1PSRA 3SG4A 4PCWA 4MZLA 5FYXA 1SR6B 4YGCB 3TUYC 2LUXA 4DUQA 1S36A 3JVTC 4USLA 4YGBB 2Q91A 1SKTA 1J55A 1BR4B 4YI8A 1L7ZA 4MN0A 1KWOB 3HX4A 1PRWA 2HF5A 3VGOA 4F0ZB 4CFRA 1EH2A 1YUUA 3BYAA 4ETOA 2LHIA 1NPQA 1UHIA 1OE9B 3PFVA 4GAOA 1LA3A 2HETA 1UHJA 3TDUA 1SCVA 2PRUA 2BCBA 3BQ3A 3NSKA 3SG5A 1IWQA 1WRKA 3LCPC 2KQYA 5F6TA 3I5HB 2BE4A 1TN4A 1YVHA 2KGRA 2WNDA 1L2OC 2Y1NA 1SBJA 2L4IA 4I5NB 1F55A 1YRUB 1KK7Z 2BE6A 3KEVA 5HLVA 4HSZA 4I5JA 2OTGB 1IGVA 2LHLA 3LK1A 1B1GA 3VRNA 1QIVA 4XJKA 1SRAA 1B8RA 1L2OB 3I5IC 3O6BA 2FJUB 3PATA 4PHNA 1AP4A 2K7OA 1S6CA 3CS1A 2KAYA 1CM4A 1LINA 1SCMB 1KFUS 4OVNF 2EC6B 2LVKA 2MRDA 1XFVO 1MQ1A 2L51A 2LVJA 1JUOA 3E3RA 3AAKA 4YGDB 3KO0A 5AFPA 1GJYA 3SG6A 4DS7A 4QJ4B 4R1EA 1FBVA 2JOJA 2OS8C 2Y1MA 3CWGA 3FWCA 4NQGA 3O2PA 1E8AA 2PALA 1C7VA 1OZOA 2LM5A 2FOTA 1NCXA 2OS8B 1K94A 1DJYA 2JPTA 2KAXA 1G33A 2AAOA 1DJIA 1A75B 1SPYA 2M7NA 1RWYA 4GGFA 4YGEB 3ZWHA 1N65A 1TRFA 3WXAA 3CR4X 1DJHA 1RFJA 2JTTA 1U5IB 1CFDA 1G4YR 5G08A 1X02A 1FF1A 1DJGA 2HPSA 4A4CA 2H61C 1VRKA 3ZNIA 3BUNB 1ZMZA 1DGVA 1F71A 5D7FA 2BBMA 4AQIA 1PALA 2NXQA 4PALA 1D1OA 5KTYA 4QJ3B 1QASA 2KGBC 2QPTA 2BBNA 2L4HA 1BF5A 1DF0A 2LUCA 4ICBA 1SL9A 4I5LB 2JT8A 3KF9A 1QLKA 2Q4UA 5ER4X 1WDCC 1TNQA 2O5GA 1MUXA 4QJ5B 3KPXA 3OX6A 4PHJA 1CMFA 2M29A 1AK8A 5CSNA 1WRLA
chains in the Genus database with same CATH superfamily
1B8CA 4D1EA 4HRHA 1LA0A 4MRYA 5DICA 1RROA 1KFUL 1PK0D 4DRWA 1NWDA 2GGZA 1HQVA 1YTZC 2KYFA 2I18A 3BXKA 4JD9A 1K96A 1KFXS 2BNXA 2PVBA 1UUSA 2L50A 1ZUZA 4GBAA 3IQOA 1BJFA 3NHTA 2LVIA 1SR6C 3F45A 3OGNA 1NYAA 1J1EA 3D77A 4CFQA 1ZFSA 3EVVA 1YVLA 3PN7B 1KSMA 4OZDA 2Y4QA 1OOIX 1MWNA 1KWOC 4MSPA 3GOFA 2WORA 2ZRTA 4BY4A 2SASA 3GK1A 4C0KA 3BOWA 1FI5A 2LMVA 4JKTA 2M8UA 2P6BB 1YX7A 1PVBA 2KI6C 1LS8A 2KQ6A 2MLFC 3SJSA 5TNCA 2KI6D 2LNKA 1K90D 1K9PA 1B47A 1XFZO 1Y1XA 2ZNEA 4ORBB 5AEQA 2YGUA 3GK2A 1OMDA 2K8MB 2JC2A 4GGNA 2COLB 1TNPA 1IG5A 1SL7A 4AOMA 2NLNA 2JU0A 4FQOA 2CXJA 1AJ5A 3DD4A 1K9UA 3EVRA 3N7HA 1AHRA 2ZRSA 1NIWA 2CBLA 2L2CA 3EKJA 5CSIA 3I5HC 3A8RA 3CABA 1A2XA 2E6WA 1IQ3A 2WCLA 1M46A 4FTGA 2BCXA 2SCPA 5HKWA 1H4BA 2HQ8A 4A4BA 2Y5IA 3BOWB 2JPOA 2M0RA 1EJ3A 4ORCB 2OTGC 2JNFA 1OOFA 5ER5A 5HYDA 1KK7Y 2WCBA 3B6XA 5BPJA 1BMOA 3D0YA 1JSAA 1YUTA 1WLMA 3DF0A 1SCMC 1Y1AA 3EVUA 1KQMB 4ORAB 1FPWA 2EC6C 1C07A 4PHMA 1QV0A 3L4LA 1KFXL 3D74A 1OQPA 1CLBA 1CFPA 1LXFC 2O60A 4WQ3A 2KNEA 3RM1A 1CDMA 3BFBA 5D3OA 2JNXA 4PE0A 3OHMB 2JTZA 1JWDA 1SW8A 1CTRA 2KI4B 2E30A 3EK4A 1Z4HA 2VRGA 3TDIA 1F54A 2MHHA 2JWWA 2QEBA 1C3YA 1TWOA 3BUOB 3AKAA 1TNXA 2F2OA 2WC8A 2JXCA 1QVIZ 1TTXA 3IQQA 2GTEA 1XFUO 1GGZA 1FI6A 1SL8A 4MEWA 1CKKA 3RLZA 1GGWA 1R6PA 3EK7A 1NX1A 2M97A 3D0YB 4M2QA 1QX2A 2CNPA 3OBVA 4OR9B 3SS4A 2FCEA 5HKZA 4AQJA 2NCOA 1OZSA 4HREE 2WOSA 2GV5A 4WRIA 1CDPA 4XJKB 1CM1A 1OOHA 2KYCA 3H4SE 5B8IB 4UPGA 1W7JB 1MF8B 1WLZA 2LMTA 4ZCVA 3TDZA 1KSOA 3V2LA 2LLTA 4M2OA 1Y1UA 4MBEA 1EL4A 2ISDA 2NZ0A 2F3ZA 2PSRA 2LC5A 3QRXA 1OSAA 1EG4A 2BL0B 3NSLA 1N0YA 2AMIA 4L9MA 4F7FA 1IH0A 2MA2A 4PHKA 4U8DA 1JFKA 3GK4X 1XO5A 2BCAA 2L5YA 2JULA 1DJXA 1N2DA 1Y6WA 4N1FA 1F70A 1CMGA 2LP3A 3SIBA 4N1GA 4IJ7A 4GGFC 2PASA 1SY9A 3BUMB 5KU1A 1QXPA 3B88A 3FS7A 1BR1B 2LLSA 3SS5A 1XA5A 3D10A 2LANA 1WY9A 3VRQA 3NSIA 5FI7A 2KOTA 4HRGA 2I2RE 3CR2A 2F2PA 1B9AA 5AERA 5EL2A 1M45A 1DQEA 1K93D 3K21A 4MZJA 2M7LA 2BAPA 3CZ0A 1NUBA 1V1GA 5J3XA 1F8HA 1QATA 5K89A 5CSJA 3JTDB 1IKUA 3CLNA 2CT9A 3PN7C 1J7QA 1H8BA 4GFTA 4OKHA 3L47A 1BU3A 3PALA 4E68A 1BG1A 2KPHA 3D76A 3SG3A 1PVAA 1XFWO 1IRJA 1DF0B 1S5GZ 2FCDA 3SIAA 1F4QA 1G8IA 2QACA 2KSPA 1QIWA 2ZN9A 1XK4C 3BUXB 3FIAA 1ORGA 2LLUA 4NDDA 3OX5A 2L2EA 3SG2A 2ZN8A 3I5FB 3O78A 3S0AA 4MRXA 3R1PA 1W7IB 1S6IA 3D73A 4XYNA 2LVVA 1EXRA 3CTNA 1NP8A 1YURA 2KDHA 3K1EA 1OW4A 1ALVA 2K2FA 1KK8B 4JWQA 2CTNA 2CCMA 2RGIA 2JT0A 2ZKMX 4MVFA 2AUCA 2D8NA 1UHHA 2BKHB 1QLSA 1CB1A 3EG5B 2MJWB 5KSZA 1KQVA 2WCFA 1DGUA 3AAJA 1S3PA 1B7TZ 3TS5B 2QEOA 3DVKA 3NXAA 1JFJA 3I5GB 1NCZA 1C7WA 3M0WA 4WQ2A 1DMOA 1MHOA 5I8NA 1NCYA 3LL8B 1HT9A 3SS3A 1FW4A 1DJZA 3O4YA 2ZNDA 2PQLA 2JXLA 2LAPA 1GQMA 2JQ6A 3PM8A 3IF7A 2KBIA 1SK6D 3WHUB 1DVIA 5I2OA 1OOJA 1S6JA 2K7CA 2KLEA 2LE9B 3ICBA 1A29A 4YRUA 1TUZA 2F3YA 1KQMC 4PE4A 2F8PA 2K7DA 2TN4A 3DVEA 2MAZA 3TUYB 1QX7A 3JVTB 3B87A 5PALA 2L98A 2OPOA 1F4OA 1Z2CB 2LCPA 1ODBA 3BUWB 3EKHA 2KI4C 1DTLA 5I2LA 2M3WA 2WCKA 4ZCUA 1CNPA 5I94A 1DJWA 1BT6A 1NSHA 1WRZA 2K0JA 3KHEA 2H8VA 5AANA 4CPVA 1CFFA 4DIRA 1DELA 2M9GA 5IBWA 2R2IA 1NX2A 2BKIB 2M1KB 4MLWA 4YBHB 3NSOA 5CPVA 1BOCA 1K2HA 3R1OA 3MSEB 4PT1A 4BY5A 2B1UA 1Q80A 5FI6A 2KHNA 3NHIA 1QVIY 3NGVA 2K61A 3AKBA 1MXLC 1QS7A 4GUKA 1SNLA 1AJ4A 2G2BA 3PJIA 2DOQA 4YI9A 3SG7A 1ZACA 2K60A 5HL1A 2MBXA 5HLOA 3CGAA 1ZOTB 1QTXA 1XFXO 3DF0B 2PYQA 4TNCA 1XYDA 1A75A 1YX8A 3R72A 3OP0A 1TCFA 1CFCA 1K9KA 2BL0C 1JF2A 3CYZA 4CIDA 1NX3A 1K8UA 1U5IA 2M49B 1M63B 5CSFA 1J1DA 2F33A 3I5IB 3VRRA 1IJ5A 1LKJA 5DKQA 2LP2A 4JQ0D 1TNWA 1XFYO 1YUSA 1EG3A 1RECA 3OB2B 1AVSA 4C0LA 1CDLA 3LLEA 3CZTX 4CLNA 1BLQA 4P2YB 4OCIA 1JC2A 2QEVA 4P5OE 4YGAA 2WCMA 4NDBA 1M39A 1TOPA 5DKNA 2V53A 1LVCD 1TIZA 3DXLA 2KBMA 4M2PA 1CLLA 2H61A 3CZ1A 3Q8IA 3S0EA 4INXA 2ZFDA 1IIOA 1UURA 1J7PA 1TCOB 2BECA 1S26D 2GGMA 1SYMA 4IL1A 4NDCA 2I7AA 1Y0VH 2P70A 3PLFB 5GQQC 5I2QA 1DT7B 5FI2A 4PDZA 5HKYA 3FWBA 4GNKB 1S1EA 2JT3A 1ALWA 2M1UA 1M31A 2PMYA 3JTDC 2HQWA 1OMRA 2L0PA 2WCHA 1RTP1 1SSEB 1MR8A 1JF0A 2WCJA 1CLMA 1XVJA 1OMVA 1NX0A 1YRTB 2LV7A 3HCMA 2K7BA 3PM2A 1PSBA 1UP5A 3DVMA 4N5XA 2JZIA 5JOLA 1S5GY 1RJVA 3PSRA 1B8LA 2EHBA 2MLEC 3TZ1A 4C0JA 1QV1A 2LMUA 3I5FC 1V1FA 2KFHA 1PULA 2A4JA 3WHTB 3UO9A 1IJ6A 3LK0A 1JBAA 5AXIA 1J7OA 2KFFA 2G9BA 3WNXB 1DEKA 2EGDA 1CDNA 1KCYA 1KK8C 2IS9A 2K2AA 3EK8A 4KYNA 3VROA 1UWOA 1IQ5A 2H2KA 4Q04A 3S0DA 1XK4A 5DKRA 3OB1B 1TUJA 1WDCB 3UNWA 1UHNA 4GPLB 1J7RA 2I94A 1P28A 2WCEA 5D69A 5JJGA 4PE7A 1QX5B 1A4PA 1B4CA 3CR5X 3IVTA 4I5KA 1UHKA 3CDNA 2JRFA 3TS5C 1RK9A 4JPZB 4DCKA 3DVJA 3I5GC 4OV2A 2L5XB 4PE1A 1QJTA 3C1VA 3VRPA 1BODA 1K95A 1SMGA 1B7TY 2KAVA 3BJHA 1DC1A 3A4UB 4MZKA 1A03A 4FQTA 1R2UA 1MXEA 1AUIB 1YR5A 2NCPA 2KFGA 1PSRA 3SG4A 4PCWA 1QWVA 4MZLA 5FYXA 1SR6B 4YGCB 3TUYC 2LUXA 4DUQA 1S36A 3JVTC 4USLA 4YGBB 2Q91A 1SKTA 1J55A 1BR4B 4YI8A 1L7ZA 3B7AA 4MN0A 1KWOB 3BFHA 3HX4A 1PRWA 2HF5A 3VGOA 4F0ZB 3DY9A 4CFRA 1EH2A 1YUUA 3BYAA 4ETOA 2LHIA 1NPQA 1UHIA 1OE9B 3O4XA 3PFVA 4GAOA 2FJYA 1LA3A 2HETA 1UHJA 3TDUA 1SCVA 2PRUA 1C3ZA 2BCBA 3BQ3A 2WC6A 3NSKA 3SG5A 1IWQA 3DZTA 1WRKA 3BFAA 3LCPC 2KQYA 5F6TA 3I5HB 2BE4A 1W9ZA 1TN4A 1YVHA 2KGRA 2WNDA 1L2OC 2P71A 1SBJA 2L4IA 2Y1NA 4INWA 4I5NB 1F55A 1YRUB 3R1VA 1KK7Z 2BE6A 3KEVA 5HLVA 3FE8A 4HSZA 4I5JA 2OTGB 1IGVA 2LHLA 3LK1A 1B1GA 3VRNA 1QIVA 1OOGA 1SRAA 1B8RA 1L2OB 4XJKA 3I5IC 3O6BA 2FJUB 3PATA 4PHNA 1AP4A 2K7OA 1S6CA 3CS1A 2KAYA 1CM4A 1LINA 1SCMB 1KFUS 2QDIA 4OVNF 2EC6B 2LVKA 1T14A 3S0BA 2MRDA 1XFVO 1MQ1A 2L51A 2LVJA 1JUOA 3DYEA 3AAKA 3E3RA 4YGDB 3KO0A 1XFRA 5AFPA 2ERBA 1GJYA 3SG6A 4DS7A 4QJ4B 4R1EA 1FBVA 3CZ2A 2JOJA 2OS8C 2Y1MA 3CWGA 3L4AA 2KLDA 3S0GA 3FWCA 4NQGA 3O2PA 3VB1A 1E8AA 2PALA 1C7VA 1OZOA 2LM5A 2FOTA 1NCXA 2OS8B 1K94A 1DJYA 2JPTA 2KAXA 3D78A 1G33A 2AAOA 2WC5A 3B86A 1GM0A 1DJIA 1A75B 1SPYA 2M7NA 3S0FA 1RWYA 4GGFA 4YGEB 3ZWHA 1N65A 1TRFA 3WXAA 3CR4X 1DJHA 1RFJA 2JTTA 1U5IB 1CFDA 1G4YR 5G08A 3FE6A 1X02A 1FF1A 1DJGA 2HPSA 4A4CA 2H61C 1VRKA 3ZNIA 3BUNB 1ZMZA 1DGVA 1F71A 5D7FA 2BBMA 4AQIA 1PALA 2NXQA 4PALA 1D1OA 5KTYA 4QJ3B 1QASA 2KGBC 2QPTA 3FE9A 3D75A 2BBNA 2L4HA 1BF5A 1DF0A 2LUCA 4ICBA 1SL9A 2QEHA 4I5LB 3QMEA 3RZSA 2JT8A 3KF9A 1QLKA 2Q4UA 5ER4X 1WDCC 1TNQA 2O5GA 1MUXA 4QJ5B 3KPXA 3OX6A 4PHJA 1CMFA 2M29A 1AK8A 5CSNA 1WRLA
chains in the Genus database with same CATH topology
1B8CA 4D1EA 4HRHA 1LA0A 4MRYA 1RROA 1KFUL 1PK0D 4DRWA 1NWDA 2GGZA 1HQVA 1YTZC 2KYFA 2I18A 3BXKA 1K96A 1KFXS 2PVBA 1UUSA 2L50A 1ZUZA 4GBAA 3IQOA 1BJFA 2LVIA 1SR6C 3F45A 1NYAA 1J1EA 4CFQA 1ZFSA 3EVVA 1YVLA 3PN7B 1KSMA 2Y4QA 1MWNA 1KWOC 4MSPA 3GOFA 2WORA 2ZRTA 4BY4A 2SASA 3GK1A 4C0KA 3BOWA 1FI5A 2LMVA 2M8UA 2P6BB 1YX7A 1PVBA 2KI6C 2KQ6A 2MLFC 3SJSA 5TNCA 2KI6D 2LNKA 1K90D 1K9PA 1B47A 1XFZO 1Y1XA 2ZNEA 4ORBB 5AEQA 3GK2A 1OMDA 2K8MB 2JC2A 4GGNA 2COLB 1TNPA 1IG5A 1SL7A 4AOMA 2NLNA 2JU0A 4FQOA 2CXJA 1AJ5A 3DD4A 1K9UA 3EVRA 1AHRA 2ZRSA 1NIWA 2CBLA 3EKJA 5CSIA 3I5HC 3A8RA 1A2XA 2E6WA 1IQ3A 1M46A 4FTGA 2BCXA 2SCPA 5HKWA 1H4BA 2HQ8A 4A4BA 2Y5IA 3BOWB 2M0RA 1EJ3A 4ORCB 2OTGC 2JNFA 5ER5A 5HYDA 1KK7Y 2WCBA 5BPJA 1BMOA 3D0YA 1JSAA 1YUTA 1WLMA 3DF0A 1SCMC 1Y1AA 3EVUA 1KQMB 4ORAB 1FPWA 2EC6C 1C07A 4PHMA 1QV0A 1KFXL 1OQPA 1CLBA 1CFPA 1LXFC 2O60A 4WQ3A 2KNEA 3RM1A 1CDMA 2JNXA 4PE0A 3OHMB 2JTZA 1JWDA 1SW8A 1CTRA 2KI4B 2E30A 3EK4A 2VRGA 3TDIA 1F54A 2MHHA 2JWWA 3BUOB 3AKAA 1TNXA 2F2OA 2WC8A 2JXCA 1QVIZ 1TTXA 3IQQA 1XFUO 1GGZA 1FI6A 1SL8A 4MEWA 1CKKA 3RLZA 1GGWA 1R6PA 3EK7A 1NX1A 2M97A 3D0YB 4M2QA 1QX2A 2CNPA 4OR9B 2FCEA 5HKZA 4AQJA 2NCOA 1OZSA 4HREE 2WOSA 2GV5A 4WRIA 1CDPA 4XJKB 1CM1A 2KYCA 3H4SE 5B8IB 4UPGA 1W7JB 1MF8B 1WLZA 2LMTA 4ZCVA 3TDZA 1KSOA 2LLTA 4M2OA 1Y1UA 4MBEA 1EL4A 2ISDA 2NZ0A 2F3ZA 2PSRA 2LC5A 3QRXA 1OSAA 1EG4A 2BL0B 3NSLA 1N0YA 2AMIA 4L9MA 1IH0A 2MA2A 4PHKA 4U8DA 1JFKA 3GK4X 1XO5A 2BCAA 2JULA 1DJXA 1N2DA 1Y6WA 4N1FA 1F70A 1CMGA 2LP3A 3SIBA 4N1GA 4GGFC 2PASA 1SY9A 3BUMB 5KU1A 1QXPA 3FS7A 1BR1B 2LLSA 1XA5A 3D10A 2LANA 1WY9A 3VRQA 3NSIA 2KOTA 4HRGA 2I2RE 3CR2A 2F2PA 1B9AA 5AERA 1M45A 2M7LA 1K93D 3K21A 4MZJA 1F8HA 1NUBA 1V1GA 5J3XA 1QATA 5K89A 5CSJA 3JTDB 1IKUA 3CLNA 2CT9A 3PN7C 1J7QA 1H8BA 4GFTA 4OKHA 1BU3A 3PALA 4E68A 1BG1A 3SG3A 1PVAA 1XFWO 1IRJA 1DF0B 1S5GZ 2FCDA 3SIAA 1F4QA 1G8IA 2QACA 2KSPA 1QIWA 2ZN9A 1XK4C 3BUXB 3FIAA 2LLUA 4NDDA 3OX5A 2L2EA 3SG2A 2ZN8A 3I5FB 3O78A 4MRXA 1W7IB 1S6IA 4XYNA 2LVVA 1EXRA 3CTNA 1NP8A 1YURA 2KDHA 1ALVA 2K2FA 1KK8B 4JWQA 2CTNA 2CCMA 2RGIA 2JT0A 2ZKMX 4MVFA 2AUCA 2D8NA 1UHHA 2BKHB 1QLSA 1CB1A 2MJWB 5KSZA 1KQVA 2WCFA 1DGUA 3AAJA 1S3PA 1B7TZ 3TS5B 3DVKA 3NXAA 1JFJA 3I5GB 1NCZA 1C7WA 3M0WA 4WQ2A 1DMOA 1MHOA 5I8NA 1NCYA 3LL8B 1HT9A 1FW4A 1DJZA 3O4YA 2ZNDA 2JXLA 2LAPA 1GQMA 2JQ6A 3PM8A 3IF7A 2KBIA 1SK6D 3WHUB 1DVIA 5I2OA 1OOJA 1S6JA 2K7CA 2LE9B 3ICBA 1A29A 4YRUA 2F3YA 1KQMC 4PE4A 2F8PA 2K7DA 2TN4A 3DVEA 2MAZA 3TUYB 1QX7A 3JVTB 5PALA 2L98A 2OPOA 1F4OA 2LCPA 1ODBA 3BUWB 3EKHA 2KI4C 1DTLA 5I2LA 2M3WA 4ZCUA 1CNPA 1DJWA 1BT6A 1NSHA 1WRZA 2K0JA 3KHEA 1CFFA 5AANA 4CPVA 4DIRA 2M9GA 5IBWA 2R2IA 1NX2A 2BKIB 2M1KB 4MLWA 4YBHB 3NSOA 5CPVA 1BOCA 1K2HA 3MSEB 4BY5A 2B1UA 1Q80A 2KHNA 1QVIY 2K61A 3AKBA 1MXLC 1QS7A 4GUKA 1SNLA 1AJ4A 2G2BA 3SG7A 2DOQA 4YI9A 1ZACA 2MBXA 5HLOA 3CGAA 1ZOTB 1QTXA 1XFXO 3DF0B 4TNCA 1XYDA 1A75A 1YX8A 3OP0A 1TCFA 1CFCA 1K9KA 2BL0C 1JF2A 4CIDA 1NX3A 1K8UA 1U5IA 2M49B 1M63B 5CSFA 1J1DA 2F33A 3I5IB 3VRRA 1IJ5A 1LKJA 5DKQA 2LP2A 4JQ0D 1TNWA 1XFYO 1YUSA 1EG3A 1RECA 3OB2B 1AVSA 4C0LA 1CDLA 3LLEA 3CZTX 4CLNA 1BLQA 4P2YB 4OCIA 1JC2A 4P5OE 4YGAA 4NDBA 1M39A 1TOPA 5DKNA 2V53A 1LVCD 1TIZA 2KBMA 4M2PA 1CLLA 2H61A 2ZFDA 1UURA 1J7PA 1TCOB 2BECA 1S26D 2GGMA 1SYMA 4IL1A 4NDCA 2I7AA 1Y0VH 3PLFB 5GQQC 5I2QA 1DT7B 4PDZA 5HKYA 3FWBA 4GNKB 1S1EA 2JT3A 1ALWA 2M1UA 1M31A 2PMYA 3JTDC 2HQWA 1OMRA 2L0PA 1RTP1 1MR8A 1JF0A 1CLMA 1XVJA 1OMVA 1NX0A 1YRTB 2LV7A 3HCMA 2K7BA 1PSBA 1UP5A 3DVMA 4N5XA 2JZIA 5JOLA 1S5GY 1RJVA 3PSRA 1B8LA 2EHBA 2MLEC 3TZ1A 4C0JA 1QV1A 2LMUA 3I5FC 1V1FA 2KFHA 1PULA 2A4JA 3WHTB 1IJ6A 3LK0A 1JBAA 5AXIA 1J7OA 2KFFA 2G9BA 3WNXB 2EGDA 1CDNA 1KCYA 1KK8C 2IS9A 2K2AA 3EK8A 3VROA 1UWOA 1IQ5A 2H2KA 4Q04A 1XK4A 5DKRA 3OB1B 1WDCB 1UHNA 4GPLB 1J7RA 2I94A 5D69A 2WCEA 5JJGA 1B4CA 4PE7A 1QX5B 1A4PA 3CR5X 4I5KA 1UHKA 2JRFA 3TS5C 1RK9A 4JPZB 4DCKA 3DVJA 3I5GC 4OV2A 2L5XB 4PE1A 1QJTA 3C1VA 3VRPA 1BODA 1K95A 1SMGA 1B7TY 2KAVA 3A4UB 4MZKA 1A03A 1R2UA 1MXEA 1AUIB 1YR5A 2NCPA 2KFGA 1PSRA 3SG4A 4PCWA 4MZLA 5FYXA 1SR6B 4YGCB 3TUYC 2LUXA 4DUQA 1S36A 3JVTC 4USLA 4YGBB 2Q91A 1SKTA 1J55A 1BR4B 4YI8A 1L7ZA 4MN0A 1KWOB 3HX4A 1PRWA 2HF5A 3VGOA 4F0ZB 4CFRA 1EH2A 1YUUA 3BYAA 4ETOA 2LHIA 1NPQA 1UHIA 1OE9B 3PFVA 4GAOA 1LA3A 2HETA 1UHJA 3TDUA 1SCVA 2PRUA 2BCBA 3BQ3A 3NSKA 3SG5A 1IWQA 1WRKA 3LCPC 2KQYA 5F6TA 3I5HB 2BE4A 1TN4A 1YVHA 2KGRA 2WNDA 1L2OC 2Y1NA 1SBJA 2L4IA 4I5NB 1F55A 1YRUB 1KK7Z 2BE6A 3KEVA 5HLVA 4HSZA 4I5JA 2OTGB 1IGVA 2LHLA 3LK1A 1B1GA 3VRNA 1QIVA 4XJKA 1SRAA 1B8RA 1L2OB 3I5IC 3O6BA 2FJUB 3PATA 4PHNA 1AP4A 2K7OA 1S6CA 3CS1A 2KAYA 1CM4A 1LINA 1SCMB 1KFUS 4OVNF 2EC6B 2LVKA 2MRDA 1XFVO 1MQ1A 2L51A 2LVJA 1JUOA 3E3RA 3AAKA 4YGDB 3KO0A 5AFPA 1GJYA 3SG6A 4DS7A 4QJ4B 4R1EA 1FBVA 2JOJA 2OS8C 2Y1MA 3CWGA 3FWCA 4NQGA 3O2PA 1E8AA 2PALA 1C7VA 1OZOA 2LM5A 2FOTA 1NCXA 2OS8B 1K94A 1DJYA 2JPTA 2KAXA 1G33A 2AAOA 1DJIA 1A75B 1SPYA 2M7NA 1RWYA 4GGFA 4YGEB 3ZWHA 1N65A 1TRFA 3WXAA 3CR4X 1DJHA 1RFJA 2JTTA 1U5IB 1CFDA 1G4YR 5G08A 1X02A 1FF1A 1DJGA 2HPSA 4A4CA 2H61C 1VRKA 3ZNIA 3BUNB 1ZMZA 1DGVA 1F71A 5D7FA 2BBMA 4AQIA 1PALA 2NXQA 4PALA 1D1OA 5KTYA 4QJ3B 1QASA 2KGBC 2QPTA 2BBNA 2L4HA 1BF5A 1DF0A 2LUCA 4ICBA 1SL9A 4I5LB 2JT8A 3KF9A 1QLKA 2Q4UA 5ER4X 1WDCC 1TNQA 2O5GA 1MUXA 4QJ5B 3KPXA 3OX6A 4PHJA 1CMFA 2M29A 1AK8A 5CSNA 1WRLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B8C A;  4D1E A;  4HRH A;  1LA0 A;  4MRY A;  1RRO A;  1KFU L;  1PK0 D;  4DRW A;  1NWD A;  2GGZ A;  1HQV A;  1YTZ C;  2KYF A;  2I18 A;  3BXK A;  1K96 A;  1KFX S;  2PVB A;  1UUS A;  2L50 A;  1ZUZ A;  4GBA A;  3IQO A;  1BJF A;  2LVI A;  1SR6 C;  3F45 A;  1NYA A;  1J1E A;  4CFQ A;  1ZFS A;  3EVV A;  1YVL A;  3PN7 B;  1KSM A;  2Y4Q A;  1MWN A;  1KWO C;  4MSP A;  3GOF A;  2WOR A;  2ZRT A;  4BY4 A;  2SAS A;  3GK1 A;  4C0K A;  3BOW A;  1FI5 A;  2LMV A;  2M8U A;  2P6B B;  1YX7 A;  1PVB A;  2KI6 C;  2KQ6 A;  2MLF C;  3SJS A;  5TNC A;  2KI6 D;  2LNK A;  1K90 D;  1K9P A;  1B47 A;  1XFZ O;  1Y1X A;  2ZNE A;  4ORB B;  5AEQ A;  3GK2 A;  1OMD A;  2K8M B;  2JC2 A;  4GGN A;  2COL B;  1TNP A;  1IG5 A;  1SL7 A;  4AOM A;  2NLN A;  2JU0 A;  4FQO A;  2CXJ A;  1AJ5 A;  3DD4 A;  1K9U A;  3EVR A;  1AHR A;  2ZRS A;  1NIW A;  2CBL A;  3EKJ A;  5CSI A;  3I5H C;  3A8R A;  1A2X A;  2E6W A;  1IQ3 A;  1M46 A;  4FTG A;  2BCX A;  2SCP A;  5HKW A;  1H4B A;  2HQ8 A;  4A4B A;  2Y5I A;  3BOW B;  2M0R A;  1EJ3 A;  4ORC B;  2OTG C;  2JNF A;  5ER5 A;  5HYD A;  1KK7 Y;  2WCB A;  5BPJ A;  1BMO A;  3D0Y A;  1JSA A;  1YUT A;  1WLM A;  3DF0 A;  1SCM C;  1Y1A A;  3EVU A;  1KQM B;  4ORA B;  1FPW A;  2EC6 C;  1C07 A;  4PHM A;  1QV0 A;  1KFX L;  1OQP A;  1CLB A;  1CFP A;  1LXF C;  2O60 A;  4WQ3 A;  2KNE A;  3RM1 A;  1CDM A;  2JNX A;  4PE0 A;  3OHM B;  2JTZ A;  1JWD A;  1SW8 A;  1CTR A;  2KI4 B;  2E30 A;  3EK4 A;  2VRG A;  3TDI A;  1F54 A;  2MHH A;  2JWW A;  3BUO B;  3AKA A;  1TNX A;  2F2O A;  2WC8 A;  2JXC A;  1QVI Z;  1TTX A;  3IQQ A;  1XFU O;  1GGZ A;  1FI6 A;  1SL8 A;  4MEW A;  1CKK A;  3RLZ A;  1GGW A;  1R6P A;  3EK7 A;  1NX1 A;  2M97 A;  3D0Y B;  4M2Q A;  1QX2 A;  2CNP A;  4OR9 B;  2FCE A;  5HKZ A;  4AQJ A;  2NCO A;  1OZS A;  4HRE E;  2WOS A;  2GV5 A;  4WRI A;  1CDP A;  4XJK B;  1CM1 A;  2KYC A;  3H4S E;  5B8I B;  4UPG A;  1W7J B;  1MF8 B;  1WLZ A;  2LMT A;  4ZCV A;  3TDZ A;  1KSO A;  2LLT A;  4M2O A;  1Y1U A;  4MBE A;  1EL4 A;  2ISD A;  2NZ0 A;  2F3Z A;  2PSR A;  2LC5 A;  3QRX A;  1OSA A;  1EG4 A;  2BL0 B;  3NSL A;  1N0Y A;  2AMI A;  4L9M A;  1IH0 A;  2MA2 A;  4PHK A;  4U8D A;  1JFK A;  3GK4 X;  1XO5 A;  2BCA A;  2JUL A;  1DJX A;  1N2D A;  1Y6W A;  4N1F A;  1F70 A;  1CMG A;  2LP3 A;  3SIB A;  4N1G A;  4GGF C;  2PAS A;  1SY9 A;  3BUM B;  5KU1 A;  1QXP A;  3FS7 A;  1BR1 B;  2LLS A;  1XA5 A;  3D10 A;  2LAN A;  1WY9 A;  3VRQ A;  3NSI A;  2KOT A;  4HRG A;  2I2R E;  3CR2 A;  2F2P A;  1B9A A;  5AER A;  1M45 A;  2M7L A;  1K93 D;  3K21 A;  4MZJ A;  1F8H A;  1NUB A;  1V1G A;  5J3X A;  1QAT A;  5K89 A;  5CSJ A;  3JTD B;  1IKU A;  3CLN A;  2CT9 A;  3PN7 C;  1J7Q A;  1H8B A;  4GFT A;  4OKH A;  1BU3 A;  3PAL A;  4E68 A;  1BG1 A;  3SG3 A;  1PVA A;  1XFW O;  1IRJ A;  1DF0 B;  1S5G Z;  2FCD A;  3SIA A;  1F4Q A;  1G8I A;  2QAC A;  2KSP A;  1QIW A;  2ZN9 A;  1XK4 C;  3BUX B;  3FIA A;  2LLU A;  4NDD A;  3OX5 A;  2L2E A;  3SG2 A;  2ZN8 A;  3I5F B;  3O78 A;  4MRX A;  1W7I B;  1S6I A;  4XYN A;  2LVV A;  1EXR A;  3CTN A;  1NP8 A;  1YUR A;  2KDH A;  1ALV A;  2K2F A;  1KK8 B;  4JWQ A;  2CTN A;  2CCM A;  2RGI A;  2JT0 A;  2ZKM X;  4MVF A;  2AUC A;  2D8N A;  1UHH A;  2BKH B;  1QLS A;  1CB1 A;  2MJW B;  5KSZ A;  1KQV A;  2WCF A;  1DGU A;  3AAJ A;  1S3P A;  1B7T Z;  3TS5 B;  3DVK A;  3NXA A;  1JFJ A;  3I5G B;  1NCZ A;  1C7W A;  3M0W A;  4WQ2 A;  1DMO A;  1MHO A;  5I8N A;  1NCY A;  3LL8 B;  1HT9 A;  1FW4 A;  1DJZ A;  3O4Y A;  2ZND A;  2JXL A;  2LAP A;  1GQM A;  2JQ6 A;  3PM8 A;  3IF7 A;  2KBI A;  1SK6 D;  3WHU B;  1DVI A;  5I2O A;  1OOJ A;  1S6J A;  2K7C A;  2LE9 B;  3ICB A;  1A29 A;  4YRU A;  2F3Y A;  1KQM C;  4PE4 A;  2F8P A;  2K7D A;  2TN4 A;  3DVE A;  2MAZ A;  3TUY B;  1QX7 A;  3JVT B;  5PAL A;  2L98 A;  2OPO A;  1F4O A;  2LCP A;  1ODB A;  3BUW B;  3EKH A;  2KI4 C;  1DTL A;  5I2L A;  2M3W A;  4ZCU A;  1CNP A;  1DJW A;  1BT6 A;  1NSH A;  1WRZ A;  2K0J A;  3KHE A;  1CFF A;  5AAN A;  4CPV A;  4DIR A;  2M9G A;  5IBW A;  2R2I A;  1NX2 A;  2BKI B;  2M1K B;  4MLW A;  4YBH B;  3NSO A;  5CPV A;  1BOC A;  1K2H A;  3MSE B;  4BY5 A;  2B1U A;  1Q80 A;  2KHN A;  1QVI Y;  2K61 A;  3AKB A;  1MXL C;  1QS7 A;  4GUK A;  1SNL A;  1AJ4 A;  2G2B A;  3SG7 A;  2DOQ A;  4YI9 A;  1ZAC A;  2MBX A;  5HLO A;  3CGA A;  1ZOT B;  1QTX A;  1XFX O;  3DF0 B;  4TNC A;  1XYD A;  1A75 A;  1YX8 A;  3OP0 A;  1TCF A;  1CFC A;  1K9K A;  2BL0 C;  1JF2 A;  4CID A;  1NX3 A;  1K8U A;  1U5I A;  2M49 B;  1M63 B;  5CSF A;  1J1D A;  2F33 A;  3I5I B;  3VRR A;  1IJ5 A;  1LKJ A;  5DKQ A;  2LP2 A;  4JQ0 D;  1TNW A;  1XFY O;  1YUS A;  1EG3 A;  1REC A;  3OB2 B;  1AVS A;  4C0L A;  1CDL A;  3LLE A;  3CZT X;  4CLN A;  1BLQ A;  4P2Y B;  4OCI A;  1JC2 A;  4P5O E;  4YGA A;  4NDB A;  1M39 A;  1TOP A;  5DKN A;  2V53 A;  1LVC D;  1TIZ A;  2KBM A;  4M2P A;  1CLL A;  2H61 A;  2ZFD A;  1UUR A;  1J7P A;  1TCO B;  2BEC A;  1S26 D;  2GGM A;  1SYM A;  4IL1 A;  4NDC A;  2I7A A;  1Y0V H;  3PLF B;  5GQQ C;  5I2Q A;  1DT7 B;  4PDZ A;  5HKY A;  3FWB A;  4GNK B;  1S1E A;  2JT3 A;  1ALW A;  2M1U A;  1M31 A;  2PMY A;  3JTD C;  2HQW A;  1OMR A;  2L0P A;  1RTP 1;  1MR8 A;  1JF0 A;  1CLM A;  1XVJ A;  1OMV A;  1NX0 A;  1YRT B;  2LV7 A;  3HCM A;  2K7B A;  1PSB A;  1UP5 A;  3DVM A;  4N5X A;  2JZI A;  5JOL A;  1S5G Y;  1RJV A;  3PSR A;  1B8L A;  2EHB A;  2MLE C;  3TZ1 A;  4C0J A;  1QV1 A;  2LMU A;  3I5F C;  1V1F A;  2KFH A;  1PUL A;  2A4J A;  3WHT B;  1IJ6 A;  3LK0 A;  1JBA A;  5AXI A;  1J7O A;  2KFF A;  2G9B A;  3WNX B;  2EGD A;  1CDN A;  1KCY A;  1KK8 C;  2IS9 A;  2K2A A;  3EK8 A;  3VRO A;  1UWO A;  1IQ5 A;  2H2K A;  4Q04 A;  1XK4 A;  5DKR A;  3OB1 B;  1WDC B;  1UHN A;  4GPL B;  1J7R A;  2I94 A;  5D69 A;  2WCE A;  5JJG A;  1B4C A;  4PE7 A;  1QX5 B;  1A4P A;  3CR5 X;  4I5K A;  1UHK A;  2JRF A;  3TS5 C;  1RK9 A;  4JPZ B;  4DCK A;  3DVJ A;  3I5G C;  4OV2 A;  2L5X B;  4PE1 A;  1QJT A;  3C1V A;  3VRP A;  1BOD A;  1K95 A;  1SMG A;  1B7T Y;  2KAV A;  3A4U B;  4MZK A;  1A03 A;  1R2U A;  1MXE A;  1AUI B;  1YR5 A;  2NCP A;  2KFG A;  1PSR A;  3SG4 A;  4PCW A;  4MZL A;  5FYX A;  1SR6 B;  4YGC B;  3TUY C;  2LUX A;  4DUQ A;  1S36 A;  3JVT C;  4USL A;  4YGB B;  2Q91 A;  1SKT A;  1J55 A;  1BR4 B;  4YI8 A;  1L7Z A;  4MN0 A;  1KWO B;  3HX4 A;  1PRW A;  2HF5 A;  3VGO A;  4F0Z B;  4CFR A;  1EH2 A;  1YUU A;  3BYA A;  4ETO A;  2LHI A;  1NPQ A;  1UHI A;  1OE9 B;  3PFV A;  4GAO A;  1LA3 A;  2HET A;  1UHJ A;  3TDU A;  1SCV A;  2PRU A;  2BCB A;  3BQ3 A;  3NSK A;  3SG5 A;  1IWQ A;  1WRK A;  3LCP C;  2KQY A;  5F6T A;  3I5H B;  2BE4 A;  1TN4 A;  1YVH A;  2KGR A;  2WND A;  1L2O C;  2Y1N A;  1SBJ A;  2L4I A;  4I5N B;  1F55 A;  1YRU B;  1KK7 Z;  2BE6 A;  3KEV A;  5HLV A;  4HSZ A;  4I5J A;  2OTG B;  1IGV A;  2LHL A;  3LK1 A;  1B1G A;  3VRN A;  1QIV A;  4XJK A;  1SRA A;  1B8R A;  1L2O B;  3I5I C;  3O6B A;  2FJU B;  3PAT A;  4PHN A;  1AP4 A;  2K7O A;  1S6C A;  3CS1 A;  2KAY A;  1CM4 A;  1LIN A;  1SCM B;  1KFU S;  4OVN F;  2EC6 B;  2LVK A;  2MRD A;  1XFV O;  1MQ1 A;  2L51 A;  2LVJ A;  1JUO A;  3E3R A;  3AAK A;  4YGD B;  3KO0 A;  5AFP A;  1GJY A;  3SG6 A;  4DS7 A;  4QJ4 B;  4R1E A;  1FBV A;  2JOJ A;  2OS8 C;  2Y1M A;  3CWG A;  3FWC A;  4NQG A;  3O2P A;  1E8A A;  2PAL A;  1C7V A;  1OZO A;  2LM5 A;  2FOT A;  1NCX A;  2OS8 B;  1K94 A;  1DJY A;  2JPT A;  2KAX A;  1G33 A;  2AAO A;  1DJI A;  1A75 B;  1SPY A;  2M7N A;  1RWY A;  4GGF A;  4YGE B;  3ZWH A;  1N65 A;  1TRF A;  3WXA A;  3CR4 X;  1DJH A;  1RFJ A;  2JTT A;  1U5I B;  1CFD A;  1G4Y R;  5G08 A;  1X02 A;  1FF1 A;  1DJG A;  2HPS A;  4A4C A;  2H61 C;  1VRK A;  3ZNI A;  3BUN B;  1ZMZ A;  1DGV A;  1F71 A;  5D7F A;  2BBM A;  4AQI A;  1PAL A;  2NXQ A;  4PAL A;  1D1O A;  5KTY A;  4QJ3 B;  1QAS A;  2KGB C;  2QPT A;  2BBN A;  2L4H A;  1BF5 A;  1DF0 A;  2LUC A;  4ICB A;  1SL9 A;  4I5L B;  2JT8 A;  3KF9 A;  1QLK A;  2Q4U A;  5ER4 X;  1WDC C;  1TNQ A;  2O5G A;  1MUX A;  4QJ5 B;  3KPX A;  3OX6 A;  4PHJ A;  1CMF A;  2M29 A;  1AK8 A;  5CSN A;  1WRL A; 
#chains in the Genus database with same CATH topology
 1B8C A;  4D1E A;  4HRH A;  1LA0 A;  4MRY A;  5DIC A;  1RRO A;  1KFU L;  1PK0 D;  4DRW A;  1NWD A;  2GGZ A;  1HQV A;  1YTZ C;  2KYF A;  2I18 A;  3BXK A;  4JD9 A;  1K96 A;  1KFX S;  2BNX A;  2PVB A;  1UUS A;  2L50 A;  1ZUZ A;  4GBA A;  3IQO A;  1BJF A;  3NHT A;  2LVI A;  1SR6 C;  3F45 A;  3OGN A;  1NYA A;  1J1E A;  3D77 A;  4CFQ A;  1ZFS A;  3EVV A;  1YVL A;  3PN7 B;  1KSM A;  4OZD A;  2Y4Q A;  1OOI X;  1MWN A;  1KWO C;  4MSP A;  3GOF A;  2WOR A;  2ZRT A;  4BY4 A;  2SAS A;  3GK1 A;  4C0K A;  3BOW A;  1FI5 A;  2LMV A;  4JKT A;  2M8U A;  2P6B B;  1YX7 A;  1PVB A;  2KI6 C;  1LS8 A;  2KQ6 A;  2MLF C;  3SJS A;  5TNC A;  2KI6 D;  2LNK A;  1K90 D;  1K9P A;  1B47 A;  1XFZ O;  1Y1X A;  2ZNE A;  4ORB B;  5AEQ A;  2YGU A;  3GK2 A;  1OMD A;  2K8M B;  2JC2 A;  4GGN A;  2COL B;  1TNP A;  1IG5 A;  1SL7 A;  4AOM A;  2NLN A;  2JU0 A;  4FQO A;  2CXJ A;  1AJ5 A;  3DD4 A;  1K9U A;  3EVR A;  3N7H A;  1AHR A;  2ZRS A;  1NIW A;  2CBL A;  2L2C A;  3EKJ A;  5CSI A;  3I5H C;  3A8R A;  3CAB A;  1A2X A;  2E6W A;  1IQ3 A;  2WCL A;  1M46 A;  4FTG A;  2BCX A;  2SCP A;  5HKW A;  1H4B A;  2HQ8 A;  4A4B A;  2Y5I A;  3BOW B;  2JPO A;  2M0R A;  1EJ3 A;  4ORC B;  2OTG C;  2JNF A;  1OOF A;  5ER5 A;  5HYD A;  1KK7 Y;  2WCB A;  3B6X A;  5BPJ A;  1BMO A;  3D0Y A;  1JSA A;  1YUT A;  1WLM A;  3DF0 A;  1SCM C;  1Y1A A;  3EVU A;  1KQM B;  4ORA B;  1FPW A;  2EC6 C;  1C07 A;  4PHM A;  1QV0 A;  3L4L A;  1KFX L;  3D74 A;  1OQP A;  1CLB A;  1CFP A;  1LXF C;  2O60 A;  4WQ3 A;  2KNE A;  3RM1 A;  1CDM A;  3BFB A;  5D3O A;  2JNX A;  4PE0 A;  3OHM B;  2JTZ A;  1JWD A;  1SW8 A;  1CTR A;  2KI4 B;  2E30 A;  3EK4 A;  1Z4H A;  2VRG A;  3TDI A;  1F54 A;  2MHH A;  2JWW A;  2QEB A;  1C3Y A;  1TWO A;  3BUO B;  3AKA A;  1TNX A;  2F2O A;  2WC8 A;  2JXC A;  1QVI Z;  1TTX A;  3IQQ A;  2GTE A;  1XFU O;  1GGZ A;  1FI6 A;  1SL8 A;  4MEW A;  1CKK A;  3RLZ A;  1GGW A;  1R6P A;  3EK7 A;  1NX1 A;  2M97 A;  3D0Y B;  4M2Q A;  1QX2 A;  2CNP A;  3OBV A;  4OR9 B;  3SS4 A;  2FCE A;  5HKZ A;  4AQJ A;  2NCO A;  1OZS A;  4HRE E;  2WOS A;  2GV5 A;  4WRI A;  1CDP A;  4XJK B;  1CM1 A;  1OOH A;  2KYC A;  3H4S E;  5B8I B;  4UPG A;  1W7J B;  1MF8 B;  1WLZ A;  2LMT A;  4ZCV A;  3TDZ A;  1KSO A;  3V2L A;  2LLT A;  4M2O A;  1Y1U A;  4MBE A;  1EL4 A;  2ISD A;  2NZ0 A;  2F3Z A;  2PSR A;  2LC5 A;  3QRX A;  1OSA A;  1EG4 A;  2BL0 B;  3NSL A;  1N0Y A;  2AMI A;  4L9M A;  4F7F A;  1IH0 A;  2MA2 A;  4PHK A;  4U8D A;  1JFK A;  3GK4 X;  1XO5 A;  2BCA A;  2L5Y A;  2JUL A;  1DJX A;  1N2D A;  1Y6W A;  4N1F A;  1F70 A;  1CMG A;  2LP3 A;  3SIB A;  4N1G A;  4IJ7 A;  4GGF C;  2PAS A;  1SY9 A;  3BUM B;  5KU1 A;  1QXP A;  3B88 A;  3FS7 A;  1BR1 B;  2LLS A;  3SS5 A;  1XA5 A;  3D10 A;  2LAN A;  1WY9 A;  3VRQ A;  3NSI A;  5FI7 A;  2KOT A;  4HRG A;  2I2R E;  3CR2 A;  2F2P A;  1B9A A;  5AER A;  5EL2 A;  1M45 A;  1DQE A;  1K93 D;  3K21 A;  4MZJ A;  2M7L A;  2BAP A;  3CZ0 A;  1NUB A;  1V1G A;  5J3X A;  1F8H A;  1QAT A;  5K89 A;  5CSJ A;  3JTD B;  1IKU A;  3CLN A;  2CT9 A;  3PN7 C;  1J7Q A;  1H8B A;  4GFT A;  4OKH A;  3L47 A;  1BU3 A;  3PAL A;  4E68 A;  1BG1 A;  2KPH A;  3D76 A;  3SG3 A;  1PVA A;  1XFW O;  1IRJ A;  1DF0 B;  1S5G Z;  2FCD A;  3SIA A;  1F4Q A;  1G8I A;  2QAC A;  2KSP A;  1QIW A;  2ZN9 A;  1XK4 C;  3BUX B;  3FIA A;  1ORG A;  2LLU A;  4NDD A;  3OX5 A;  2L2E A;  3SG2 A;  2ZN8 A;  3I5F B;  3O78 A;  3S0A A;  4MRX A;  3R1P A;  1W7I B;  1S6I A;  3D73 A;  4XYN A;  2LVV A;  1EXR A;  3CTN A;  1NP8 A;  1YUR A;  2KDH A;  3K1E A;  1OW4 A;  1ALV A;  2K2F A;  1KK8 B;  4JWQ A;  2CTN A;  2CCM A;  2RGI A;  2JT0 A;  2ZKM X;  4MVF A;  2AUC A;  2D8N A;  1UHH A;  2BKH B;  1QLS A;  1CB1 A;  3EG5 B;  2MJW B;  5KSZ A;  1KQV A;  2WCF A;  1DGU A;  3AAJ A;  1S3P A;  1B7T Z;  3TS5 B;  2QEO A;  3DVK A;  3NXA A;  1JFJ A;  3I5G B;  1NCZ A;  1C7W A;  3M0W A;  4WQ2 A;  1DMO A;  1MHO A;  5I8N A;  1NCY A;  3LL8 B;  1HT9 A;  3SS3 A;  1FW4 A;  1DJZ A;  3O4Y A;  2ZND A;  2PQL A;  2JXL A;  2LAP A;  1GQM A;  2JQ6 A;  3PM8 A;  3IF7 A;  2KBI A;  1SK6 D;  3WHU B;  1DVI A;  5I2O A;  1OOJ A;  1S6J A;  2K7C A;  2KLE A;  2LE9 B;  3ICB A;  1A29 A;  4YRU A;  1TUZ A;  2F3Y A;  1KQM C;  4PE4 A;  2F8P A;  2K7D A;  2TN4 A;  3DVE A;  2MAZ A;  3TUY B;  1QX7 A;  3JVT B;  3B87 A;  5PAL A;  2L98 A;  2OPO A;  1F4O A;  1Z2C B;  2LCP A;  1ODB A;  3BUW B;  3EKH A;  2KI4 C;  1DTL A;  5I2L A;  2M3W A;  2WCK A;  4ZCU A;  1CNP A;  5I94 A;  1DJW A;  1BT6 A;  1NSH A;  1WRZ A;  2K0J A;  3KHE A;  2H8V A;  5AAN A;  4CPV A;  1CFF A;  4DIR A;  1DEL A;  2M9G A;  5IBW A;  2R2I A;  1NX2 A;  2BKI B;  2M1K B;  4MLW A;  4YBH B;  3NSO A;  5CPV A;  1BOC A;  1K2H A;  3R1O A;  3MSE B;  4PT1 A;  4BY5 A;  2B1U A;  1Q80 A;  5FI6 A;  2KHN A;  3NHI A;  1QVI Y;  3NGV A;  2K61 A;  3AKB A;  1MXL C;  1QS7 A;  4GUK A;  1SNL A;  1AJ4 A;  2G2B A;  3PJI A;  2DOQ A;  4YI9 A;  3SG7 A;  1ZAC A;  2K60 A;  5HL1 A;  2MBX A;  5HLO A;  3CGA A;  1ZOT B;  1QTX A;  1XFX O;  3DF0 B;  2PYQ A;  4TNC A;  1XYD A;  1A75 A;  1YX8 A;  3R72 A;  3OP0 A;  1TCF A;  1CFC A;  1K9K A;  2BL0 C;  1JF2 A;  3CYZ A;  4CID A;  1NX3 A;  1K8U A;  1U5I A;  2M49 B;  1M63 B;  5CSF A;  1J1D A;  2F33 A;  3I5I B;  3VRR A;  1IJ5 A;  1LKJ A;  5DKQ A;  2LP2 A;  4JQ0 D;  1TNW A;  1XFY O;  1YUS A;  1EG3 A;  1REC A;  3OB2 B;  1AVS A;  4C0L A;  1CDL A;  3LLE A;  3CZT X;  4CLN A;  1BLQ A;  4P2Y B;  4OCI A;  1JC2 A;  2QEV A;  4P5O E;  4YGA A;  2WCM A;  4NDB A;  1M39 A;  1TOP A;  5DKN A;  2V53 A;  1LVC D;  1TIZ A;  3DXL A;  2KBM A;  4M2P A;  1CLL A;  2H61 A;  3CZ1 A;  3Q8I A;  3S0E A;  4INX A;  2ZFD A;  1IIO A;  1UUR A;  1J7P A;  1TCO B;  2BEC A;  1S26 D;  2GGM A;  1SYM A;  4IL1 A;  4NDC A;  2I7A A;  1Y0V H;  2P70 A;  3PLF B;  5GQQ C;  5I2Q A;  1DT7 B;  5FI2 A;  4PDZ A;  5HKY A;  3FWB A;  4GNK B;  1S1E A;  2JT3 A;  1ALW A;  2M1U A;  1M31 A;  2PMY A;  3JTD C;  2HQW A;  1OMR A;  2L0P A;  2WCH A;  1RTP 1;  1SSE B;  1MR8 A;  1JF0 A;  2WCJ A;  1CLM A;  1XVJ A;  1OMV A;  1NX0 A;  1YRT B;  2LV7 A;  3HCM A;  2K7B A;  3PM2 A;  1PSB A;  1UP5 A;  3DVM A;  4N5X A;  2JZI A;  5JOL A;  1S5G Y;  1RJV A;  3PSR A;  1B8L A;  2EHB A;  2MLE C;  3TZ1 A;  4C0J A;  1QV1 A;  2LMU A;  3I5F C;  1V1F A;  2KFH A;  1PUL A;  2A4J A;  3WHT B;  3UO9 A;  1IJ6 A;  3LK0 A;  1JBA A;  5AXI A;  1J7O A;  2KFF A;  2G9B A;  3WNX B;  1DEK A;  2EGD A;  1CDN A;  1KCY A;  1KK8 C;  2IS9 A;  2K2A A;  3EK8 A;  4KYN A;  3VRO A;  1UWO A;  1IQ5 A;  2H2K A;  4Q04 A;  3S0D A;  1XK4 A;  5DKR A;  3OB1 B;  1TUJ A;  1WDC B;  3UNW A;  1UHN A;  4GPL B;  1J7R A;  2I94 A;  1P28 A;  2WCE A;  5D69 A;  5JJG A;  4PE7 A;  1QX5 B;  1A4P A;  1B4C A;  3CR5 X;  3IVT A;  4I5K A;  1UHK A;  3CDN A;  2JRF A;  3TS5 C;  1RK9 A;  4JPZ B;  4DCK A;  3DVJ A;  3I5G C;  4OV2 A;  2L5X B;  4PE1 A;  1QJT A;  3C1V A;  3VRP A;  1BOD A;  1K95 A;  1SMG A;  1B7T Y;  2KAV A;  3BJH A;  1DC1 A;  3A4U B;  4MZK A;  1A03 A;  4FQT A;  1R2U A;  1MXE A;  1AUI B;  1YR5 A;  2NCP A;  2KFG A;  1PSR A;  3SG4 A;  4PCW A;  1QWV A;  4MZL A;  5FYX A;  1SR6 B;  4YGC B;  3TUY C;  2LUX A;  4DUQ A;  1S36 A;  3JVT C;  4USL A;  4YGB B;  2Q91 A;  1SKT A;  1J55 A;  1BR4 B;  4YI8 A;  1L7Z A;  3B7A A;  4MN0 A;  1KWO B;  3BFH A;  3HX4 A;  1PRW A;  2HF5 A;  3VGO A;  4F0Z B;  3DY9 A;  4CFR A;  1EH2 A;  1YUU A;  3BYA A;  4ETO A;  2LHI A;  1NPQ A;  1UHI A;  1OE9 B;  3O4X A;  3PFV A;  4GAO A;  2FJY A;  1LA3 A;  2HET A;  1UHJ A;  3TDU A;  1SCV A;  2PRU A;  1C3Z A;  2BCB A;  3BQ3 A;  2WC6 A;  3NSK A;  3SG5 A;  1IWQ A;  3DZT A;  1WRK A;  3BFA A;  3LCP C;  2KQY A;  5F6T A;  3I5H B;  2BE4 A;  1W9Z A;  1TN4 A;  1YVH A;  2KGR A;  2WND A;  1L2O C;  2P71 A;  1SBJ A;  2L4I A;  2Y1N A;  4INW A;  4I5N B;  1F55 A;  1YRU B;  3R1V A;  1KK7 Z;  2BE6 A;  3KEV A;  5HLV A;  3FE8 A;  4HSZ A;  4I5J A;  2OTG B;  1IGV A;  2LHL A;  3LK1 A;  1B1G A;  3VRN A;  1QIV A;  1OOG A;  1SRA A;  1B8R A;  1L2O B;  4XJK A;  3I5I C;  3O6B A;  2FJU B;  3PAT A;  4PHN A;  1AP4 A;  2K7O A;  1S6C A;  3CS1 A;  2KAY A;  1CM4 A;  1LIN A;  1SCM B;  1KFU S;  2QDI A;  4OVN F;  2EC6 B;  2LVK A;  1T14 A;  3S0B A;  2MRD A;  1XFV O;  1MQ1 A;  2L51 A;  2LVJ A;  1JUO A;  3DYE A;  3AAK A;  3E3R A;  4YGD B;  3KO0 A;  1XFR A;  5AFP A;  2ERB A;  1GJY A;  3SG6 A;  4DS7 A;  4QJ4 B;  4R1E A;  1FBV A;  3CZ2 A;  2JOJ A;  2OS8 C;  2Y1M A;  3CWG A;  3L4A A;  2KLD A;  3S0G A;  3FWC A;  4NQG A;  3O2P A;  3VB1 A;  1E8A A;  2PAL A;  1C7V A;  1OZO A;  2LM5 A;  2FOT A;  1NCX A;  2OS8 B;  1K94 A;  1DJY A;  2JPT A;  2KAX A;  3D78 A;  1G33 A;  2AAO A;  2WC5 A;  3B86 A;  1GM0 A;  1DJI A;  1A75 B;  1SPY A;  2M7N A;  3S0F A;  1RWY A;  4GGF A;  4YGE B;  3ZWH A;  1N65 A;  1TRF A;  3WXA A;  3CR4 X;  1DJH A;  1RFJ A;  2JTT A;  1U5I B;  1CFD A;  1G4Y R;  5G08 A;  3FE6 A;  1X02 A;  1FF1 A;  1DJG A;  2HPS A;  4A4C A;  2H61 C;  1VRK A;  3ZNI A;  3BUN B;  1ZMZ A;  1DGV A;  1F71 A;  5D7F A;  2BBM A;  4AQI A;  1PAL A;  2NXQ A;  4PAL A;  1D1O A;  5KTY A;  4QJ3 B;  1QAS A;  2KGB C;  2QPT A;  3FE9 A;  3D75 A;  2BBN A;  2L4H A;  1BF5 A;  1DF0 A;  2LUC A;  4ICB A;  1SL9 A;  2QEH A;  4I5L B;  3QME A;  3RZS A;  2JT8 A;  3KF9 A;  1QLK A;  2Q4U A;  5ER4 X;  1WDC C;  1TNQ A;  2O5G A;  1MUX A;  4QJ5 B;  3KPX A;  3OX6 A;  4PHJ A;  1CMF A;  2M29 A;  1AK8 A;  5CSN A;  1WRL A; 
#chains in the Genus database with same CATH homology
 1B8C A;  4D1E A;  4HRH A;  1LA0 A;  4MRY A;  1RRO A;  1KFU L;  1PK0 D;  4DRW A;  1NWD A;  2GGZ A;  1HQV A;  1YTZ C;  2KYF A;  2I18 A;  3BXK A;  1K96 A;  1KFX S;  2PVB A;  1UUS A;  2L50 A;  1ZUZ A;  4GBA A;  3IQO A;  1BJF A;  2LVI A;  1SR6 C;  3F45 A;  1NYA A;  1J1E A;  4CFQ A;  1ZFS A;  3EVV A;  1YVL A;  3PN7 B;  1KSM A;  2Y4Q A;  1MWN A;  1KWO C;  4MSP A;  3GOF A;  2WOR A;  2ZRT A;  4BY4 A;  2SAS A;  3GK1 A;  4C0K A;  3BOW A;  1FI5 A;  2LMV A;  2M8U A;  2P6B B;  1YX7 A;  1PVB A;  2KI6 C;  2KQ6 A;  2MLF C;  3SJS A;  5TNC A;  2KI6 D;  2LNK A;  1K90 D;  1K9P A;  1B47 A;  1XFZ O;  1Y1X A;  2ZNE A;  4ORB B;  5AEQ A;  3GK2 A;  1OMD A;  2K8M B;  2JC2 A;  4GGN A;  2COL B;  1TNP A;  1IG5 A;  1SL7 A;  4AOM A;  2NLN A;  2JU0 A;  4FQO A;  2CXJ A;  1AJ5 A;  3DD4 A;  1K9U A;  3EVR A;  1AHR A;  2ZRS A;  1NIW A;  2CBL A;  3EKJ A;  5CSI A;  3I5H C;  3A8R A;  1A2X A;  2E6W A;  1IQ3 A;  1M46 A;  4FTG A;  2BCX A;  2SCP A;  5HKW A;  1H4B A;  2HQ8 A;  4A4B A;  2Y5I A;  3BOW B;  2M0R A;  1EJ3 A;  4ORC B;  2OTG C;  2JNF A;  5ER5 A;  5HYD A;  1KK7 Y;  2WCB A;  5BPJ A;  1BMO A;  3D0Y A;  1JSA A;  1YUT A;  1WLM A;  3DF0 A;  1SCM C;  1Y1A A;  3EVU A;  1KQM B;  4ORA B;  1FPW A;  2EC6 C;  1C07 A;  4PHM A;  1QV0 A;  1KFX L;  1OQP A;  1CLB A;  1CFP A;  1LXF C;  2O60 A;  4WQ3 A;  2KNE A;  3RM1 A;  1CDM A;  2JNX A;  4PE0 A;  3OHM B;  2JTZ A;  1JWD A;  1SW8 A;  1CTR A;  2KI4 B;  2E30 A;  3EK4 A;  2VRG A;  3TDI A;  1F54 A;  2MHH A;  2JWW A;  3BUO B;  3AKA A;  1TNX A;  2F2O A;  2WC8 A;  2JXC A;  1QVI Z;  1TTX A;  3IQQ A;  1XFU O;  1GGZ A;  1FI6 A;  1SL8 A;  4MEW A;  1CKK A;  3RLZ A;  1GGW A;  1R6P A;  3EK7 A;  1NX1 A;  2M97 A;  3D0Y B;  4M2Q A;  1QX2 A;  2CNP A;  4OR9 B;  2FCE A;  5HKZ A;  4AQJ A;  2NCO A;  1OZS A;  4HRE E;  2WOS A;  2GV5 A;  4WRI A;  1CDP A;  4XJK B;  1CM1 A;  2KYC A;  3H4S E;  5B8I B;  4UPG A;  1W7J B;  1MF8 B;  1WLZ A;  2LMT A;  4ZCV A;  3TDZ A;  1KSO A;  2LLT A;  4M2O A;  1Y1U A;  4MBE A;  1EL4 A;  2ISD A;  2NZ0 A;  2F3Z A;  2PSR A;  2LC5 A;  3QRX A;  1OSA A;  1EG4 A;  2BL0 B;  3NSL A;  1N0Y A;  2AMI A;  4L9M A;  1IH0 A;  2MA2 A;  4PHK A;  4U8D A;  1JFK A;  3GK4 X;  1XO5 A;  2BCA A;  2JUL A;  1DJX A;  1N2D A;  1Y6W A;  4N1F A;  1F70 A;  1CMG A;  2LP3 A;  3SIB A;  4N1G A;  4GGF C;  2PAS A;  1SY9 A;  3BUM B;  5KU1 A;  1QXP A;  3FS7 A;  1BR1 B;  2LLS A;  1XA5 A;  3D10 A;  2LAN A;  1WY9 A;  3VRQ A;  3NSI A;  2KOT A;  4HRG A;  2I2R E;  3CR2 A;  2F2P A;  1B9A A;  5AER A;  1M45 A;  2M7L A;  1K93 D;  3K21 A;  4MZJ A;  1F8H A;  1NUB A;  1V1G A;  5J3X A;  1QAT A;  5K89 A;  5CSJ A;  3JTD B;  1IKU A;  3CLN A;  2CT9 A;  3PN7 C;  1J7Q A;  1H8B A;  4GFT A;  4OKH A;  1BU3 A;  3PAL A;  4E68 A;  1BG1 A;  3SG3 A;  1PVA A;  1XFW O;  1IRJ A;  1DF0 B;  1S5G Z;  2FCD A;  3SIA A;  1F4Q A;  1G8I A;  2QAC A;  2KSP A;  1QIW A;  2ZN9 A;  1XK4 C;  3BUX B;  3FIA A;  2LLU A;  4NDD A;  3OX5 A;  2L2E A;  3SG2 A;  2ZN8 A;  3I5F B;  3O78 A;  4MRX A;  1W7I B;  1S6I A;  4XYN A;  2LVV A;  1EXR A;  3CTN A;  1NP8 A;  1YUR A;  2KDH A;  1ALV A;  2K2F A;  1KK8 B;  4JWQ A;  2CTN A;  2CCM A;  2RGI A;  2JT0 A;  2ZKM X;  4MVF A;  2AUC A;  2D8N A;  1UHH A;  2BKH B;  1QLS A;  1CB1 A;  2MJW B;  5KSZ A;  1KQV A;  2WCF A;  1DGU A;  3AAJ A;  1S3P A;  1B7T Z;  3TS5 B;  3DVK A;  3NXA A;  1JFJ A;  3I5G B;  1NCZ A;  1C7W A;  3M0W A;  4WQ2 A;  1DMO A;  1MHO A;  5I8N A;  1NCY A;  3LL8 B;  1HT9 A;  1FW4 A;  1DJZ A;  3O4Y A;  2ZND A;  2JXL A;  2LAP A;  1GQM A;  2JQ6 A;  3PM8 A;  3IF7 A;  2KBI A;  1SK6 D;  3WHU B;  1DVI A;  5I2O A;  1OOJ A;  1S6J A;  2K7C A;  2LE9 B;  3ICB A;  1A29 A;  4YRU A;  2F3Y A;  1KQM C;  4PE4 A;  2F8P A;  2K7D A;  2TN4 A;  3DVE A;  2MAZ A;  3TUY B;  1QX7 A;  3JVT B;  5PAL A;  2L98 A;  2OPO A;  1F4O A;  2LCP A;  1ODB A;  3BUW B;  3EKH A;  2KI4 C;  1DTL A;  5I2L A;  2M3W A;  4ZCU A;  1CNP A;  1DJW A;  1BT6 A;  1NSH A;  1WRZ A;  2K0J A;  3KHE A;  1CFF A;  5AAN A;  4CPV A;  4DIR A;  2M9G A;  5IBW A;  2R2I A;  1NX2 A;  2BKI B;  2M1K B;  4MLW A;  4YBH B;  3NSO A;  5CPV A;  1BOC A;  1K2H A;  3MSE B;  4BY5 A;  2B1U A;  1Q80 A;  2KHN A;  1QVI Y;  2K61 A;  3AKB A;  1MXL C;  1QS7 A;  4GUK A;  1SNL A;  1AJ4 A;  2G2B A;  3SG7 A;  2DOQ A;  4YI9 A;  1ZAC A;  2MBX A;  5HLO A;  3CGA A;  1ZOT B;  1QTX A;  1XFX O;  3DF0 B;  4TNC A;  1XYD A;  1A75 A;  1YX8 A;  3OP0 A;  1TCF A;  1CFC A;  1K9K A;  2BL0 C;  1JF2 A;  4CID A;  1NX3 A;  1K8U A;  1U5I A;  2M49 B;  1M63 B;  5CSF A;  1J1D A;  2F33 A;  3I5I B;  3VRR A;  1IJ5 A;  1LKJ A;  5DKQ A;  2LP2 A;  4JQ0 D;  1TNW A;  1XFY O;  1YUS A;  1EG3 A;  1REC A;  3OB2 B;  1AVS A;  4C0L A;  1CDL A;  3LLE A;  3CZT X;  4CLN A;  1BLQ A;  4P2Y B;  4OCI A;  1JC2 A;  4P5O E;  4YGA A;  4NDB A;  1M39 A;  1TOP A;  5DKN A;  2V53 A;  1LVC D;  1TIZ A;  2KBM A;  4M2P A;  1CLL A;  2H61 A;  2ZFD A;  1UUR A;  1J7P A;  1TCO B;  2BEC A;  1S26 D;  2GGM A;  1SYM A;  4IL1 A;  4NDC A;  2I7A A;  1Y0V H;  3PLF B;  5GQQ C;  5I2Q A;  1DT7 B;  4PDZ A;  5HKY A;  3FWB A;  4GNK B;  1S1E A;  2JT3 A;  1ALW A;  2M1U A;  1M31 A;  2PMY A;  3JTD C;  2HQW A;  1OMR A;  2L0P A;  1RTP 1;  1MR8 A;  1JF0 A;  1CLM A;  1XVJ A;  1OMV A;  1NX0 A;  1YRT B;  2LV7 A;  3HCM A;  2K7B A;  1PSB A;  1UP5 A;  3DVM A;  4N5X A;  2JZI A;  5JOL A;  1S5G Y;  1RJV A;  3PSR A;  1B8L A;  2EHB A;  2MLE C;  3TZ1 A;  4C0J A;  1QV1 A;  2LMU A;  3I5F C;  1V1F A;  2KFH A;  1PUL A;  2A4J A;  3WHT B;  1IJ6 A;  3LK0 A;  1JBA A;  5AXI A;  1J7O A;  2KFF A;  2G9B A;  3WNX B;  2EGD A;  1CDN A;  1KCY A;  1KK8 C;  2IS9 A;  2K2A A;  3EK8 A;  3VRO A;  1UWO A;  1IQ5 A;  2H2K A;  4Q04 A;  1XK4 A;  5DKR A;  3OB1 B;  1WDC B;  1UHN A;  4GPL B;  1J7R A;  2I94 A;  5D69 A;  2WCE A;  5JJG A;  1B4C A;  4PE7 A;  1QX5 B;  1A4P A;  3CR5 X;  4I5K A;  1UHK A;  2JRF A;  3TS5 C;  1RK9 A;  4JPZ B;  4DCK A;  3DVJ A;  3I5G C;  4OV2 A;  2L5X B;  4PE1 A;  1QJT A;  3C1V A;  3VRP A;  1BOD A;  1K95 A;  1SMG A;  1B7T Y;  2KAV A;  3A4U B;  4MZK A;  1A03 A;  1R2U A;  1MXE A;  1AUI B;  1YR5 A;  2NCP A;  2KFG A;  1PSR A;  3SG4 A;  4PCW A;  4MZL A;  5FYX A;  1SR6 B;  4YGC B;  3TUY C;  2LUX A;  4DUQ A;  1S36 A;  3JVT C;  4USL A;  4YGB B;  2Q91 A;  1SKT A;  1J55 A;  1BR4 B;  4YI8 A;  1L7Z A;  4MN0 A;  1KWO B;  3HX4 A;  1PRW A;  2HF5 A;  3VGO A;  4F0Z B;  4CFR A;  1EH2 A;  1YUU A;  3BYA A;  4ETO A;  2LHI A;  1NPQ A;  1UHI A;  1OE9 B;  3PFV A;  4GAO A;  1LA3 A;  2HET A;  1UHJ A;  3TDU A;  1SCV A;  2PRU A;  2BCB A;  3BQ3 A;  3NSK A;  3SG5 A;  1IWQ A;  1WRK A;  3LCP C;  2KQY A;  5F6T A;  3I5H B;  2BE4 A;  1TN4 A;  1YVH A;  2KGR A;  2WND A;  1L2O C;  2Y1N A;  1SBJ A;  2L4I A;  4I5N B;  1F55 A;  1YRU B;  1KK7 Z;  2BE6 A;  3KEV A;  5HLV A;  4HSZ A;  4I5J A;  2OTG B;  1IGV A;  2LHL A;  3LK1 A;  1B1G A;  3VRN A;  1QIV A;  4XJK A;  1SRA A;  1B8R A;  1L2O B;  3I5I C;  3O6B A;  2FJU B;  3PAT A;  4PHN A;  1AP4 A;  2K7O A;  1S6C A;  3CS1 A;  2KAY A;  1CM4 A;  1LIN A;  1SCM B;  1KFU S;  4OVN F;  2EC6 B;  2LVK A;  2MRD A;  1XFV O;  1MQ1 A;  2L51 A;  2LVJ A;  1JUO A;  3E3R A;  3AAK A;  4YGD B;  3KO0 A;  5AFP A;  1GJY A;  3SG6 A;  4DS7 A;  4QJ4 B;  4R1E A;  1FBV A;  2JOJ A;  2OS8 C;  2Y1M A;  3CWG A;  3FWC A;  4NQG A;  3O2P A;  1E8A A;  2PAL A;  1C7V A;  1OZO A;  2LM5 A;  2FOT A;  1NCX A;  2OS8 B;  1K94 A;  1DJY A;  2JPT A;  2KAX A;  1G33 A;  2AAO A;  1DJI A;  1A75 B;  1SPY A;  2M7N A;  1RWY A;  4GGF A;  4YGE B;  3ZWH A;  1N65 A;  1TRF A;  3WXA A;  3CR4 X;  1DJH A;  1RFJ A;  2JTT A;  1U5I B;  1CFD A;  1G4Y R;  5G08 A;  1X02 A;  1FF1 A;  1DJG A;  2HPS A;  4A4C A;  2H61 C;  1VRK A;  3ZNI A;  3BUN B;  1ZMZ A;  1DGV A;  1F71 A;  5D7F A;  2BBM A;  4AQI A;  1PAL A;  2NXQ A;  4PAL A;  1D1O A;  5KTY A;  4QJ3 B;  1QAS A;  2KGB C;  2QPT A;  2BBN A;  2L4H A;  1BF5 A;  1DF0 A;  2LUC A;  4ICB A;  1SL9 A;  4I5L B;  2JT8 A;  3KF9 A;  1QLK A;  2Q4U A;  5ER4 X;  1WDC C;  1TNQ A;  2O5G A;  1MUX A;  4QJ5 B;  3KPX A;  3OX6 A;  4PHJ A;  1CMF A;  2M29 A;  1AK8 A;  5CSN A;  1WRL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...