1SBJA

Nmr structure of the mg2+-loaded c terminal domain of cardiac troponin c bound to the n terminal domain of cardiac troponin i
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
81
structure length
81
Chain Sequence
MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Mg2+-loaded C-lobe of cardiac troponin C bound to the N-domain of cardiac troponin I: comparison with the Ca2+-loaded structure.
pubmed doi rcsb
molecule keywords Troponin C, slow skeletal and cardiac muscles
molecule tags Contractile protein, structural protein
source organism Gallus gallus
total genus 16
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2004-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1sbjA00
2L51A 2ZKMX 1RFJA 3IF7A 3D0YB 1BLQA 1CDMA 1QV0A 1CFPA 2WC8A 2LUCA 1AJ5A 1L2OB 3OB1B 1AVSA 2M8UA 1M39A 2MHHA 2K7BA 3I5GC 1CMFA 1G33A 2FOTA 3SG5A 1K9KA 4TNCA 1G4YR 1QVIY 2KBMA 2OTGC 4OKHA 5F6TA 3EVRA 1KFXS 3EVVA 4MRXA 1XK4A 1BT6A 2JTTA 3OX5A 3TDIA 3PSRA 3JVTC 4BY4A 3JTDC 1YURA 1K9PA 2L4HA 1KFUS 1M31A 5B8IB 1B47A 5HKYA 1SY9A 2LVIA 1B8LA 1K93D 1S6JA 2KNEA 1TIZA 1Y1AA 1K95A 1A2XA 4A4CA 3I5HB 2KFGA 1SCMB 2H61A 4AOMA 2ZN8A 4MZLA 1M45A 3VRNA 3I5HC 1SCMC 1AK8A 4MZKA 4Q04A 2LLUA 2BE6A 1FI6A 1DJZA 2LLSA 3NSOA 3CWGA 3GK1A 1MWNA 1CM1A 2JQ6A 2K2AA 2BBMA 1KQMB 1XFUO 1KSMA 3SG2A 1KK8B 2QPTA 1UHJA 1KK8C 2Q4UA 1SL9A 1GQMA 1K94A 2L98A 3OP0A 4GGFC 1NCYA 4M2PA 1XFXO 4MVFA 2BCAA 4U8DA 3KF9A 2KOTA 2BKIB 2JPTA 3EK4A 3PN7C 3NSKA 1WDCB 1AUIB 3A4UB 3SG3A 1CLLA 1QJTA 5CPVA 1F4QA 3SG6A 4PHJA 1WDCC 3D10A 3GK4X 4FTGA 3K21A 1WRKA 2CXJA 3TS5B 1IGVA 3DF0A 1Q80A 2M0RA 5HKWA 1OE9B 5DKRA 2LMTA 1J1DA 4MLWA 2O60A 3TS5C 5PALA 1QX2A 1JFJA 2Y1MA 1NCXA 1PVAA 2MAZA 3ZWHA 1DF0A 3BYAA 1CLMA 1QATA 2JT3A 2L5XB 2LV7A 1IG5A 1A03A 1DJIA 2PMYA 2LMUA 3M0WA 2M7NA 1YUTA 2LCPA 2JNXA 3QRXA 2I7AA 4I5LB 4DUQA 1IJ5A 1N0YA 1NIWA 2K0JA 2PSRA 3CLNA 1XFZO 1F4OA 1RWYA 4MZJA 1UHNA 5ER4X 3BUXB 4E68A 4PALA 1KFUL 1LXFC 2HQ8A 4QJ4B 2E30A 1B7TY 2MRDA 2P6BB 2GGZA 1TNQA 1SRAA 1IRJA 1DJGA 1DJXA 2I94A 2KAYA 3BUMB 5G08A 3RM1A 1K90D 1SK6D 1MXLC 1S5GZ 2K61A 3VGOA 2FCEA 1DVIA 1OMDA 1HQVA 4QJ3B 2K2FA 4JWQA 4WQ3A 1WY9A 1ODBA 1NX1A 5BPJA 5DKQA 2A4JA 4ORCB 3BUOB 1R6PA 1UP5A 3OHMB 1MXEA 1NX2A 2JC2A 3AKBA 3EKJA 3KO0A 1DMOA 1J7RA 2LLTA 3VRPA 1C7VA 1CMGA 2Y1NA 4GUKA 4PE1A 1QVIZ 1DJWA 4GBAA 4N1GA 1JC2A 2WOSA 2H2KA 1OZSA 2K7CA 2KI6D 2V53A 1NX3A 4MSPA 2NCOA 1XYDA 3AKAA 4P5OE 5HLVA 1U5IB 2B1UA 1QIWA 2MA2A 2SCPA 5DKNA 1BJFA 3DVJA 1TN4A 2FCDA 1DJYA 1CDNA 1B8CA 1L2OC 4OR9B 1F55A 3O4YA 2ZNDA 3I5IB 1G8IA 3BOWA 3TDZA 1F71A 3DF0B 1TNPA 1WLZA 1L7ZA 1XO5A 4ORAB 1NP8A 1S36A 4PHNA 2JOJA 1J7OA 4L9MA 1BG1A 1K8UA 3DVKA 1B9AA 4WQ2A 1C07A 3CZTX 2M1UA 4GAOA 3EK8A 3WHTB 1XFYO 1N65A 1BMOA 1KSOA 2I2RE 1PK0D 2TN4A 1SL8A 4YGDB 1S6IA 1DF0B 3GOFA 2CT9A 3TUYB 1SR6B 1YUSA 3SIAA 1UHHA 4YBHB 2CCMA 1XA5A 1NWDA 2LHIA 4YGEB 2LVJA 1YX7A 5ER5A 1FBVA 3WNXB 1CNPA 2MLEC 3BUNB 1ZUZA 1QXPA 2LE9B 1PULA 2BECA 4NDDA 4NQGA 2F8PA 4I5NB 1EG4A 1QX7A 1LKJA 2E6WA 4OV2A 5HYDA 1KK7Y 1K96A 1YRTB 2BL0B 2PASA 2EHBA 4NDCA 2BCBA 2MLFC 5AFPA 2BL0C 2COLB 2KGBC 4PE4A 1BF5A 2ZFDA 1A4PA 1CFCA 1OZOA 1M63B 1KQMC 1QTXA 1TCOB 2JZIA 4D1EA 3ZNIA 4PE0A 2M1KB 1AHRA 2SASA 1SNLA 1SPYA 4DCKA 3FS7A 3NSIA 1J55A 1EXRA 1LA3A 2AMIA 2ZRSA 1YR5A 4USLA 2F3YA 2L0PA 3BUWB 3BQ3A 4GPLB 4YI8A 4ZCUA 3CTNA 4XJKA 3ICBA 3NSLA 1SYMA 1CFDA 4MBEA 1Y0VH 2K7OA 2M9GA 1BOCA 1N2DA 3I5FB 1YRUB 3IQOA 4GFTA 4M2QA 1JF0A 2G9BA 3I5FC 4AQJA 1BODA 2RGIA 1EL4A 1JFKA 4YRUA 1D1OA 2NCPA 1RJVA 5JJGA 2JTZA 4FQOA 4R1EA 4MEWA 5J3XA 1EG3A 1AJ4A 1GGWA 1PRWA 4PHKA 4QJ5B 1B7TZ 2CBLA 4BY5A 1F70A 1WLMA 1SMGA 4ORBB 4N5XA 1ALVA 1M46A 2QACA 3LK0A 5K89A 3O78A 1NCZA 1NX0A 1OOJA 2WORA 3PLFB 4WRIA 1KFXL 4YGBB 3RLZA 4GNKB 1BU3A 4XYNA 1YVLA 1DTLA 1AP4A 1YTZC 1XK4C 2KQYA 3AAJA 2LM5A 4IL1A 4OVNF 5I2LA 1DJHA 1S1EA 2LC5A 3SG7A 4AQIA 2HQWA 4HRHA 4MN0A 5KU1A 2VRGA 3WHUB 2KI6C 1PSRA 1IWQA 5KSZA 2Q91A 1SL7A 1RROA 2ISDA 1MF8B 2M3WA 5I2OA 3VROA 5KTYA 1CKKA 1ZFSA 2LUXA 1YUUA 2L4IA 3LK1A 2JULA 2L2EA 1CLBA 1PVBA 2JU0A 1LA0A 1SBJA 3PFVA 2KAXA 4YGAA 2WNDA 5AANA 3TDUA 3SJSA 2EC6B 4I5JA 2LP3A 1IJ6A 3H4SE 1FPWA 4NDBA 3KPXA 4CLNA 2ZN9A 2EC6C 4MRYA 2PVBA 4GGFA 3CGAA 1Y1UA 1NUBA 2NXQA 4PCWA 5GQQC 1ZMZA 2KGRA 1XFWO 3O6BA 5FYXA 1C7WA 1OSAA 3CR2A 5I2QA 1S3PA 2LHLA 4PDZA 1E8AA 1CFFA 2EGDA 2KSPA 1KWOB 1DT7B 2M29A 2WCFA 4P2YB 5CSFA 5CSIA 3OB2B 5JOLA 1CDPA 3KEVA 2IS9A 2Y5IA 1OMRA 3F45A 4ZCVA 3VRRA 5HLOA 3I5IC 2JXLA 5AEQA 4CPVA 3DD4A 3C1VA 4N1FA 1BR1B 1RECA 4CFQA 1KK7Z 4DS7A 5D7FA 2BE4A 4F0ZB 4HREE 1CDLA 1YX8A 1RK9A 1YVHA 1XVJA 3NXAA 5HKZA 3EVUA 2KFFA 2PALA 1QS7A 1UUSA 1Y6WA 1QIVA 1GJYA 3I5GB 4HSZA 3TUYC 1J1EA 1SR6C 2KBIA 3FIAA 3SIBA 1JBAA 2LNKA 1K2HA 1UWOA 1JF2A 2OTGB 1KQVA 4I5KA 2FJUB 2G2BA 2M7LA 2CNPA 1IKUA 1LINA 2JNFA 3HCMA 3PM8A 1S6CA 2LVVA 1W7JB 1CM4A 3JVTB 3JTDB 2BCXA 2JT0A 1PALA 3LL8B 2KYCA 3LLEA 4M2OA 4GGNA 3GK2A 2F33A 4JQ0D 4YGCB 1MQ1A 1JUOA 1RTP1 2LMVA 1LVCD 2KAVA 2KFHA 3EK7A 2JWWA 1R2UA 1IH0A 4YI9A 1B1GA 3PALA 4A4BA 1Y1XA 1A75A 1QLKA 1WRZA 2K7DA 2ZRTA 3DVEA 3OX6A 1ZACA 1F8HA 1UHKA 2NZ0A 1OQPA 5TNCA 1SCVA 2ZNEA 1FI5A 1JWDA 2JXCA 1NSHA 2NLNA 1XFVO 2F3ZA 1BR4B 2LVKA 3E3RA 2PRUA 2WCBA 2F2OA 1TTXA 2CTNA 1B8RA 5AERA 4C0JA 2R2IA 3PATA 2AAOA 1EH2A 3PN7B 5I8NA 2HF5A 3D0YA 1U5IA 1QLSA 1WRLA 3CR5X 1KCYA 3A8RA 3KHEA 2K8MB 3BOWB 1J7PA 2DOQA 1EJ3A 1OMVA 2KYFA 1QV1A 2MJWB 1TNXA 1UHIA 2HETA 1W7IB 2OS8B 2OS8C 1FW4A 1HT9A 4JPZB 4PE7A 1SKTA 5CSJA 2BBNA 3FWCA 2KQ6A 2L50A 2Y4QA 2JRFA 1SW8A 5IBWA 1VRKA 2D8NA 3VRQA 5D69A 2H61C 4CFRA 1ZOTB 3BXKA 1PSBA 4C0KA 1CTRA 1J7QA 2O5GA 3CR4X 5AXIA 2M49B 1TNWA 3AAKA 2KHNA 3HX4A 1JSAA 2MBXA 2LANA 4C0LA 3IQQA 4DIRA 2BKHB 1S26D 2JT8A 3O2PA 4PHMA 1QX5B 3CS1A 1X02A 1DGUA 1QASA 2OPOA 4CIDA 1TCFA 2M97A 2F2PA 1A75B 1V1FA 1CB1A 1K9UA 4XJKB 2GV5A 2KI4B 2AUCA 2WCEA 3LCPC 4ICBA 1NYAA 2HPSA 1H4BA 1GGZA 1UURA 3TZ1A 2KI4C 2LP2A 1DGVA 2GGMA 1KWOC 3DVMA 5CSNA 1F54A 1MUXA 2LAPA 4DRWA 4UPGA 1B4CA 2KDHA 1IQ5A 1V1GA 1TOPA 2I18A 3SG4A 1ALWA 1IQ3A 3EKHA 1S5GY 3WXAA 3MSEB 1A29A 1NPQA 1TRFA 1FF1A 4HRGA 1MHOA 4OCIA 1MR8A 3FWBA 1H8BA 4ETOA
chains in the Genus database with same CATH superfamily
2L51A 2ZKMX 1RFJA 3IF7A 3D0YB 1BLQA 1CDMA 1QV0A 1CFPA 2WC8A 2LUCA 1AJ5A 1L2OB 3V2LA 3OB1B 1AVSA 2M8UA 1M39A 2MHHA 2K7BA 3CYZA 3I5GC 1CMFA 1G33A 2FOTA 3SG5A 1K9KA 2PQLA 4TNCA 1G4YR 1QVIY 2KBMA 2OTGC 4OKHA 5F6TA 3EVRA 1KFXS 2P71A 3CZ0A 3EVVA 1XK4A 1BT6A 2JTTA 3OX5A 4MRXA 2KPHA 3JVTC 3PSRA 1TUZA 3JTDC 1YURA 1K9PA 2L4HA 1KFUS 1M31A 5B8IB 2YGUA 1B47A 5HKYA 1QWVA 1SY9A 2LVIA 1B8LA 1K93D 1S6JA 2KNEA 1TIZA 1Y1AA 1K95A 1A2XA 4A4CA 3I5HB 2KFGA 1SCMB 2H61A 3BFHA 4AOMA 2ZN8A 4MZLA 1M45A 3VRNA 3I5HC 1SCMC 1AK8A 4MZKA 4Q04A 2LLUA 2BE6A 3S0GA 1FI6A 1DJZA 2LLSA 3NSOA 2P70A 3CWGA 3GK1A 1MWNA 1CM1A 2JQ6A 2K2AA 2BBMA 1KQMB 1GM0A 1XFUO 1KSMA 3SG2A 1KK8B 2QPTA 1IIOA 1UHJA 1KK8C 2Q4UA 1SL9A 1GQMA 1K94A 2L98A 3BFAA 3OP0A 4GGFC 1NCYA 4M2PA 3SS3A 3OBVA 2KLDA 1XFXO 4MVFA 2BCAA 4U8DA 3KF9A 2KOTA 2BKIB 2JPTA 3EK4A 3PN7C 3NSKA 1WDCB 1AUIB 1T14A 3A4UB 3B86A 1CLLA 1QJTA 3SG3A 5CPVA 1F4QA 1SSEB 4PHJA 1WDCC 3D10A 3GK4X 4FTGA 3SG6A 3B88A 3K21A 1WRKA 2CXJA 3TS5B 1IGVA 3DF0A 1Q80A 1DC1A 2M0RA 5HKWA 1OE9B 2BAPA 5DKRA 2LMTA 1J1DA 4MLWA 2O60A 3TS5C 2K60A 4JD9A 5PALA 1QX2A 4INWA 1JFJA 2Y1MA 1NCXA 1PVAA 2MAZA 3ZWHA 1OOFA 1DF0A 3BYAA 1CLMA 1QATA 2WCLA 2JT3A 2L5XB 2LV7A 1IG5A 1A03A 1DJIA 2PMYA 2LMUA 3M0WA 2M7NA 1YUTA 2LCPA 2JNXA 3QRXA 2I7AA 4I5LB 4DUQA 1IJ5A 1N0YA 1NIWA 2K0JA 2PSRA 3CLNA 1XFZO 1F4OA 1RWYA 4MZJA 1UHNA 5ER4X 3BUXB 4E68A 4PALA 1KFUL 1LXFC 2HQ8A 4QJ4B 2E30A 1B7TY 3S0FA 2MRDA 2P6BB 2GGZA 3O4XA 1TNQA 1SRAA 1IRJA 1DJGA 1DJXA 2I94A 2KAYA 1Z4HA 3BUMB 5G08A 3RM1A 1K90D 1SK6D 1MXLC 1S5GZ 2K61A 3VGOA 2WCHA 2FCEA 1DVIA 1OMDA 1HQVA 4QJ3B 2K2FA 4JWQA 4WQ3A 1WY9A 1ODBA 1NX1A 5BPJA 3SS5A 1TUJA 5DKQA 2A4JA 4ORCB 3BUOB 1R6PA 1UP5A 3OHMB 1MXEA 3DZTA 3PJIA 1NX2A 2JC2A 3AKBA 3EKJA 3KO0A 1DMOA 1J7RA 2LLTA 3VRPA 1C7VA 1CMGA 2Y1NA 3S0AA 4GUKA 4PE1A 1QVIZ 1DJWA 4GBAA 4N1GA 1JC2A 2WOSA 2H2KA 1DQEA 1OZSA 2K7CA 2KI6D 2V53A 1NX3A 4MSPA 2NCOA 1XYDA 3AKAA 4P5OE 5HLVA 1U5IB 2B1UA 1QIWA 2MA2A 2SCPA 3B87A 4F7FA 5DKNA 4IJ7A 1BJFA 3DVJA 1TN4A 2FCDA 1DJYA 3S0BA 1CDNA 1B8CA 1L2OC 4OR9B 1F55A 3O4YA 2ZNDA 3I5IB 1G8IA 3BOWA 3TDZA 1F71A 4OZDA 3DF0B 1TNPA 1WLZA 1L7ZA 1XO5A 4ORAB 1NP8A 1S36A 4PHNA 2JOJA 1J7OA 4L9MA 1BG1A 1K8UA 3DVKA 1B9AA 4WQ2A 1C07A 3CZTX 2M1UA 4GAOA 3EK8A 3WHTB 1XFYO 1N65A 1BMOA 1KSOA 2I2RE 1PK0D 2TN4A 1SL8A 4YGDB 1S6IA 1DF0B 3GOFA 2CT9A 3TUYB 1SR6B 1YUSA 3SIAA 1UHHA 3R1PA 4YBHB 2CCMA 1XA5A 1NWDA 2LHIA 3DXLA 4YGEB 2LVJA 1P28A 1YX7A 5ER5A 1FBVA 3BJHA 3WNXB 1CNPA 2MLEC 3BUNB 1ZUZA 1QXPA 2LE9B 1PULA 2BECA 4NDDA 1C3YA 4NQGA 2F8PA 4I5NB 1DEKA 1EG4A 1LKJA 1QX7A 2E6WA 4OV2A 5HYDA 3FE9A 3UO9A 1KK7Y 1K96A 1YRTB 2BL0B 1W9ZA 2PASA 2EHBA 3R1VA 4NDCA 2BCBA 2MLFC 5AFPA 2BL0C 2COLB 2KGBC 4PE4A 1BF5A 2ZFDA 1A4PA 1CFCA 1OZOA 1M63B 1KQMC 1QTXA 1TCOB 2JZIA 2WC5A 4D1EA 3ZNIA 4PE0A 2M1KB 1AHRA 2SASA 1SNLA 1SPYA 4DCKA 3FS7A 3NSIA 1J55A 1EXRA 1LA3A 2AMIA 2ZRSA 1YR5A 4USLA 2F3YA 2L0PA 3BUWB 3BQ3A 4GPLB 4YI8A 4ZCUA 3CTNA 4XJKA 3ICBA 3NSLA 1SYMA 3FE8A 1CFDA 3D76A 4MBEA 1Y0VH 2K7OA 2M9GA 1BOCA 1N2DA 5FI7A 3D77A 3I5FB 1YRUB 2H8VA 3IQOA 4GFTA 4M2QA 1JF0A 2G9BA 3I5FC 3D78A 4AQJA 1BODA 2RGIA 1EL4A 1JFKA 4YRUA 1D1OA 3B6XA 2NCPA 1RJVA 5JJGA 2JTZA 3DYEA 4FQOA 4MEWA 4R1EA 1EG3A 1AJ4A 5J3XA 1PRWA 1GGWA 4PHKA 4QJ5B 1B7TZ 2CBLA 4BY5A 1F70A 1WLMA 1SMGA 4ORBB 4N5XA 1ALVA 1M46A 2QACA 3LK0A 5K89A 2L2CA 3O78A 1NCZA 1NX0A 1OOJA 2WORA 3PLFB 4WRIA 1KFXL 3FE6A 4YGBB 3RLZA 4JKTA 4GNKB 1BU3A 2QDIA 4XYNA 1YVLA 3VB1A 1DTLA 2QEHA 1AP4A 1YTZC 1XK4C 2KQYA 3AAJA 2LM5A 1C3ZA 4IL1A 4OVNF 5I2LA 3CZ1A 1DJHA 1S1EA 2LC5A 3SG7A 4AQIA 2HQWA 2QEVA 4HRHA 4MN0A 2VRGA 3WHUB 2KI6C 5KU1A 3S0DA 1PSRA 1IWQA 5KSZA 2Q91A 1SL7A 1RROA 2WCKA 3D73A 2ISDA 1MF8B 2M3WA 5I2OA 3VROA 5KTYA 1CKKA 1ZFSA 2LUXA 1YUUA 2L4IA 3LK1A 2JULA 2L2EA 1CLBA 1PVBA 2JU0A 1LA0A 1SBJA 3PFVA 2KAXA 1OOIX 4YGAA 2WNDA 5AANA 3TDUA 3SJSA 2EC6B 4I5JA 2LP3A 3L4LA 1IJ6A 1LS8A 2ERBA 2QEOA 3H4SE 4NDBA 3KPXA 1FPWA 4CLNA 2ZN9A 2EC6C 4MRYA 2FJYA 2PVBA 3B7AA 3CGAA 1Y1UA 4GGFA 1NUBA 2NXQA 4PCWA 5GQQC 1ZMZA 2KGRA 1XFWO 3O6BA 5FYXA 1C7WA 1OSAA 3CR2A 5I2QA 1S3PA 2LHLA 3PM2A 3Q8IA 3CABA 4PDZA 1E8AA 1CFFA 2EGDA 2KSPA 1KWOB 1DT7B 2M29A 2WCFA 4P2YB 5CSFA 5CSIA 3OB2B 5JOLA 1CDPA 3KEVA 2IS9A 2Y5IA 1OMRA 3F45A 4INXA 4ZCVA 3VRRA 1DELA 1XFRA 5HL1A 5HLOA 3I5IC 2JXLA 3CDNA 5AEQA 1OOGA 4CPVA 3DD4A 3C1VA 4N1FA 1BR1B 1RECA 4CFQA 1KK7Z 4DS7A 5D7FA 2BE4A 4F0ZB 3NHTA 4HREE 3UNWA 1CDLA 3NHIA 1YX8A 1RK9A 1YVHA 1XVJA 3NXAA 3BFBA 5HKZA 3EVUA 2KFFA 2BNXA 3NGVA 2PALA 1QS7A 1UUSA 1Y6WA 3OGNA 1QIVA 1GJYA 3I5GB 4HSZA 3TUYC 1J1EA 1SR6C 2KBIA 3FIAA 3SIBA 1JBAA 2LNKA 1K2HA 3R72A 1UWOA 1JF2A 2OTGB 1KQVA 4I5KA 2FJUB 2G2BA 3QMEA 2M7LA 2CNPA 1IKUA 2PYQA 1LINA 2JNFA 3HCMA 3PM8A 1S6CA 2LVVA 1W7JB 1CM4A 3JVTB 3JTDB 2BCXA 2JT0A 1PALA 3LL8B 2KYCA 3LLEA 4M2OA 4GGNA 3GK2A 2F33A 4JQ0D 4YGCB 1MQ1A 1JUOA 1RTP1 2LMVA 3SS4A 1LVCD 2KAVA 2KFHA 5FI2A 3EK7A 2JWWA 3DY9A 1R2UA 1IH0A 4YI9A 1B1GA 3PALA 4A4BA 1Y1XA 1A75A 1QLKA 1WRZA 2K7DA 2ZRTA 3EG5B 3DVEA 3OX6A 1ZACA 2WC6A 1F8HA 1UHKA 2NZ0A 1OQPA 5TNCA 1SCVA 2ZNEA 3L47A 1FI5A 3S0EA 1JWDA 2JXCA 1NSHA 2JPOA 2NLNA 1XFVO 5DICA 2F3ZA 3RZSA 1BR4B 2LVKA 3E3RA 2QEBA 2PRUA 2WCBA 2F2OA 1TTXA 2CTNA 1B8RA 5AERA 2KLEA 3D74A 4C0JA 2R2IA 3PATA 1ORGA 2AAOA 1EH2A 3PN7B 5I8NA 2HF5A 3D0YA 1U5IA 5EL2A 1QLSA 1WRLA 3TDIA 4BY4A 3CR5X 1KCYA 3A8RA 3KHEA 2K8MB 3BOWB 2GTEA 1J7PA 2DOQA 1EJ3A 1OMVA 2KYFA 1QV1A 2MJWB 1TNXA 1UHIA 2HETA 1W7IB 2OS8B 2WCMA 2OS8C 1FW4A 1HT9A 4JPZB 4PE7A 1SKTA 3IVTA 5D3OA 5CSJA 2BBNA 3FWCA 2KQ6A 2L50A 2Y4QA 2JRFA 1SW8A 5IBWA 1VRKA 2D8NA 3VRQA 5D69A 4FQTA 2H61C 4CFRA 1ZOTB 3L4AA 5FI6A 5I94A 3BXKA 1PSBA 4C0KA 1CTRA 1J7QA 2O5GA 3CR4X 5AXIA 2M49B 1TNWA 3AAKA 2KHNA 3HX4A 1JSAA 2MBXA 2LANA 4C0LA 3IQQA 4PT1A 4DIRA 2L5YA 2BKHB 1S26D 2JT8A 3O2PA 4PHMA 1QX5B 3R1OA 3CS1A 1X02A 1DGUA 1QASA 2OPOA 4CIDA 1TCFA 3K1EA 2M97A 2F2PA 1A75B 3N7HA 1V1FA 1CB1A 1Z2CB 1K9UA 4XJKB 2GV5A 2WCJA 2KI4B 2AUCA 2WCEA 3LCPC 4ICBA 1NYAA 2HPSA 3CZ2A 1H4BA 1GGZA 1UURA 3TZ1A 2KI4C 2LP2A 1DGVA 2GGMA 1KWOC 3DVMA 5CSNA 1F54A 1MUXA 2LAPA 4DRWA 1OOHA 4UPGA 1B4CA 2KDHA 1IQ5A 1V1GA 1TOPA 2I18A 3SG4A 1ALWA 1IQ3A 4KYNA 3EKHA 1TWOA 1S5GY 3WXAA 3MSEB 1A29A 1NPQA 1TRFA 1FF1A 3D75A 1MHOA 1OW4A 4HRGA 4OCIA 1MR8A 3FWBA 1H8BA 4ETOA
chains in the Genus database with same CATH topology
2L51A 2ZKMX 1RFJA 3IF7A 3D0YB 1BLQA 1CDMA 1QV0A 1CFPA 2WC8A 2LUCA 1AJ5A 1L2OB 3OB1B 1AVSA 2M8UA 1M39A 2MHHA 2K7BA 3I5GC 1CMFA 1G33A 2FOTA 3SG5A 1K9KA 4TNCA 1G4YR 1QVIY 2KBMA 2OTGC 4OKHA 5F6TA 3EVRA 1KFXS 3EVVA 4MRXA 1XK4A 1BT6A 2JTTA 3OX5A 3TDIA 3PSRA 3JVTC 4BY4A 3JTDC 1YURA 1K9PA 2L4HA 1KFUS 1M31A 5B8IB 1B47A 5HKYA 1SY9A 2LVIA 1B8LA 1K93D 1S6JA 2KNEA 1TIZA 1Y1AA 1K95A 1A2XA 4A4CA 3I5HB 2KFGA 1SCMB 2H61A 4AOMA 2ZN8A 4MZLA 1M45A 3VRNA 3I5HC 1SCMC 1AK8A 4MZKA 4Q04A 2LLUA 2BE6A 1FI6A 1DJZA 2LLSA 3NSOA 3CWGA 3GK1A 1MWNA 1CM1A 2JQ6A 2K2AA 2BBMA 1KQMB 1XFUO 1KSMA 3SG2A 1KK8B 2QPTA 1UHJA 1KK8C 2Q4UA 1SL9A 1GQMA 1K94A 2L98A 3OP0A 4GGFC 1NCYA 4M2PA 1XFXO 4MVFA 2BCAA 4U8DA 3KF9A 2KOTA 2BKIB 2JPTA 3EK4A 3PN7C 3NSKA 1WDCB 1AUIB 3A4UB 3SG3A 1CLLA 1QJTA 5CPVA 1F4QA 3SG6A 4PHJA 1WDCC 3D10A 3GK4X 4FTGA 3K21A 1WRKA 2CXJA 3TS5B 1IGVA 3DF0A 1Q80A 2M0RA 5HKWA 1OE9B 5DKRA 2LMTA 1J1DA 4MLWA 2O60A 3TS5C 5PALA 1QX2A 1JFJA 2Y1MA 1NCXA 1PVAA 2MAZA 3ZWHA 1DF0A 3BYAA 1CLMA 1QATA 2JT3A 2L5XB 2LV7A 1IG5A 1A03A 1DJIA 2PMYA 2LMUA 3M0WA 2M7NA 1YUTA 2LCPA 2JNXA 3QRXA 2I7AA 4I5LB 4DUQA 1IJ5A 1N0YA 1NIWA 2K0JA 2PSRA 3CLNA 1XFZO 1F4OA 1RWYA 4MZJA 1UHNA 5ER4X 3BUXB 4E68A 4PALA 1KFUL 1LXFC 2HQ8A 4QJ4B 2E30A 1B7TY 2MRDA 2P6BB 2GGZA 1TNQA 1SRAA 1IRJA 1DJGA 1DJXA 2I94A 2KAYA 3BUMB 5G08A 3RM1A 1K90D 1SK6D 1MXLC 1S5GZ 2K61A 3VGOA 2FCEA 1DVIA 1OMDA 1HQVA 4QJ3B 2K2FA 4JWQA 4WQ3A 1WY9A 1ODBA 1NX1A 5BPJA 5DKQA 2A4JA 4ORCB 3BUOB 1R6PA 1UP5A 3OHMB 1MXEA 1NX2A 2JC2A 3AKBA 3EKJA 3KO0A 1DMOA 1J7RA 2LLTA 3VRPA 1C7VA 1CMGA 2Y1NA 4GUKA 4PE1A 1QVIZ 1DJWA 4GBAA 4N1GA 1JC2A 2WOSA 2H2KA 1OZSA 2K7CA 2KI6D 2V53A 1NX3A 4MSPA 2NCOA 1XYDA 3AKAA 4P5OE 5HLVA 1U5IB 2B1UA 1QIWA 2MA2A 2SCPA 5DKNA 1BJFA 3DVJA 1TN4A 2FCDA 1DJYA 1CDNA 1B8CA 1L2OC 4OR9B 1F55A 3O4YA 2ZNDA 3I5IB 1G8IA 3BOWA 3TDZA 1F71A 3DF0B 1TNPA 1WLZA 1L7ZA 1XO5A 4ORAB 1NP8A 1S36A 4PHNA 2JOJA 1J7OA 4L9MA 1BG1A 1K8UA 3DVKA 1B9AA 4WQ2A 1C07A 3CZTX 2M1UA 4GAOA 3EK8A 3WHTB 1XFYO 1N65A 1BMOA 1KSOA 2I2RE 1PK0D 2TN4A 1SL8A 4YGDB 1S6IA 1DF0B 3GOFA 2CT9A 3TUYB 1SR6B 1YUSA 3SIAA 1UHHA 4YBHB 2CCMA 1XA5A 1NWDA 2LHIA 4YGEB 2LVJA 1YX7A 5ER5A 1FBVA 3WNXB 1CNPA 2MLEC 3BUNB 1ZUZA 1QXPA 2LE9B 1PULA 2BECA 4NDDA 4NQGA 2F8PA 4I5NB 1EG4A 1QX7A 1LKJA 2E6WA 4OV2A 5HYDA 1KK7Y 1K96A 1YRTB 2BL0B 2PASA 2EHBA 4NDCA 2BCBA 2MLFC 5AFPA 2BL0C 2COLB 2KGBC 4PE4A 1BF5A 2ZFDA 1A4PA 1CFCA 1OZOA 1M63B 1KQMC 1QTXA 1TCOB 2JZIA 4D1EA 3ZNIA 4PE0A 2M1KB 1AHRA 2SASA 1SNLA 1SPYA 4DCKA 3FS7A 3NSIA 1J55A 1EXRA 1LA3A 2AMIA 2ZRSA 1YR5A 4USLA 2F3YA 2L0PA 3BUWB 3BQ3A 4GPLB 4YI8A 4ZCUA 3CTNA 4XJKA 3ICBA 3NSLA 1SYMA 1CFDA 4MBEA 1Y0VH 2K7OA 2M9GA 1BOCA 1N2DA 3I5FB 1YRUB 3IQOA 4GFTA 4M2QA 1JF0A 2G9BA 3I5FC 4AQJA 1BODA 2RGIA 1EL4A 1JFKA 4YRUA 1D1OA 2NCPA 1RJVA 5JJGA 2JTZA 4FQOA 4R1EA 4MEWA 5J3XA 1EG3A 1AJ4A 1GGWA 1PRWA 4PHKA 4QJ5B 1B7TZ 2CBLA 4BY5A 1F70A 1WLMA 1SMGA 4ORBB 4N5XA 1ALVA 1M46A 2QACA 3LK0A 5K89A 3O78A 1NCZA 1NX0A 1OOJA 2WORA 3PLFB 4WRIA 1KFXL 4YGBB 3RLZA 4GNKB 1BU3A 4XYNA 1YVLA 1DTLA 1AP4A 1YTZC 1XK4C 2KQYA 3AAJA 2LM5A 4IL1A 4OVNF 5I2LA 1DJHA 1S1EA 2LC5A 3SG7A 4AQIA 2HQWA 4HRHA 4MN0A 5KU1A 2VRGA 3WHUB 2KI6C 1PSRA 1IWQA 5KSZA 2Q91A 1SL7A 1RROA 2ISDA 1MF8B 2M3WA 5I2OA 3VROA 5KTYA 1CKKA 1ZFSA 2LUXA 1YUUA 2L4IA 3LK1A 2JULA 2L2EA 1CLBA 1PVBA 2JU0A 1LA0A 1SBJA 3PFVA 2KAXA 4YGAA 2WNDA 5AANA 3TDUA 3SJSA 2EC6B 4I5JA 2LP3A 1IJ6A 3H4SE 1FPWA 4NDBA 3KPXA 4CLNA 2ZN9A 2EC6C 4MRYA 2PVBA 4GGFA 3CGAA 1Y1UA 1NUBA 2NXQA 4PCWA 5GQQC 1ZMZA 2KGRA 1XFWO 3O6BA 5FYXA 1C7WA 1OSAA 3CR2A 5I2QA 1S3PA 2LHLA 4PDZA 1E8AA 1CFFA 2EGDA 2KSPA 1KWOB 1DT7B 2M29A 2WCFA 4P2YB 5CSFA 5CSIA 3OB2B 5JOLA 1CDPA 3KEVA 2IS9A 2Y5IA 1OMRA 3F45A 4ZCVA 3VRRA 5HLOA 3I5IC 2JXLA 5AEQA 4CPVA 3DD4A 3C1VA 4N1FA 1BR1B 1RECA 4CFQA 1KK7Z 4DS7A 5D7FA 2BE4A 4F0ZB 4HREE 1CDLA 1YX8A 1RK9A 1YVHA 1XVJA 3NXAA 5HKZA 3EVUA 2KFFA 2PALA 1QS7A 1UUSA 1Y6WA 1QIVA 1GJYA 3I5GB 4HSZA 3TUYC 1J1EA 1SR6C 2KBIA 3FIAA 3SIBA 1JBAA 2LNKA 1K2HA 1UWOA 1JF2A 2OTGB 1KQVA 4I5KA 2FJUB 2G2BA 2M7LA 2CNPA 1IKUA 1LINA 2JNFA 3HCMA 3PM8A 1S6CA 2LVVA 1W7JB 1CM4A 3JVTB 3JTDB 2BCXA 2JT0A 1PALA 3LL8B 2KYCA 3LLEA 4M2OA 4GGNA 3GK2A 2F33A 4JQ0D 4YGCB 1MQ1A 1JUOA 1RTP1 2LMVA 1LVCD 2KAVA 2KFHA 3EK7A 2JWWA 1R2UA 1IH0A 4YI9A 1B1GA 3PALA 4A4BA 1Y1XA 1A75A 1QLKA 1WRZA 2K7DA 2ZRTA 3DVEA 3OX6A 1ZACA 1F8HA 1UHKA 2NZ0A 1OQPA 5TNCA 1SCVA 2ZNEA 1FI5A 1JWDA 2JXCA 1NSHA 2NLNA 1XFVO 2F3ZA 1BR4B 2LVKA 3E3RA 2PRUA 2WCBA 2F2OA 1TTXA 2CTNA 1B8RA 5AERA 4C0JA 2R2IA 3PATA 2AAOA 1EH2A 3PN7B 5I8NA 2HF5A 3D0YA 1U5IA 1QLSA 1WRLA 3CR5X 1KCYA 3A8RA 3KHEA 2K8MB 3BOWB 1J7PA 2DOQA 1EJ3A 1OMVA 2KYFA 1QV1A 2MJWB 1TNXA 1UHIA 2HETA 1W7IB 2OS8B 2OS8C 1FW4A 1HT9A 4JPZB 4PE7A 1SKTA 5CSJA 2BBNA 3FWCA 2KQ6A 2L50A 2Y4QA 2JRFA 1SW8A 5IBWA 1VRKA 2D8NA 3VRQA 5D69A 2H61C 4CFRA 1ZOTB 3BXKA 1PSBA 4C0KA 1CTRA 1J7QA 2O5GA 3CR4X 5AXIA 2M49B 1TNWA 3AAKA 2KHNA 3HX4A 1JSAA 2MBXA 2LANA 4C0LA 3IQQA 4DIRA 2BKHB 1S26D 2JT8A 3O2PA 4PHMA 1QX5B 3CS1A 1X02A 1DGUA 1QASA 2OPOA 4CIDA 1TCFA 2M97A 2F2PA 1A75B 1V1FA 1CB1A 1K9UA 4XJKB 2GV5A 2KI4B 2AUCA 2WCEA 3LCPC 4ICBA 1NYAA 2HPSA 1H4BA 1GGZA 1UURA 3TZ1A 2KI4C 2LP2A 1DGVA 2GGMA 1KWOC 3DVMA 5CSNA 1F54A 1MUXA 2LAPA 4DRWA 4UPGA 1B4CA 2KDHA 1IQ5A 1V1GA 1TOPA 2I18A 3SG4A 1ALWA 1IQ3A 3EKHA 1S5GY 3WXAA 3MSEB 1A29A 1NPQA 1TRFA 1FF1A 4HRGA 1MHOA 4OCIA 1MR8A 3FWBA 1H8BA 4ETOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L51 A;  2ZKM X;  1RFJ A;  3IF7 A;  3D0Y B;  1BLQ A;  1CDM A;  1QV0 A;  1CFP A;  2WC8 A;  2LUC A;  1AJ5 A;  1L2O B;  3OB1 B;  1AVS A;  2M8U A;  1M39 A;  2MHH A;  2K7B A;  3I5G C;  1CMF A;  1G33 A;  2FOT A;  3SG5 A;  1K9K A;  4TNC A;  1G4Y R;  1QVI Y;  2KBM A;  2OTG C;  4OKH A;  5F6T A;  3EVR A;  1KFX S;  3EVV A;  4MRX A;  1XK4 A;  1BT6 A;  2JTT A;  3OX5 A;  3TDI A;  3PSR A;  3JVT C;  4BY4 A;  3JTD C;  1YUR A;  1K9P A;  2L4H A;  1KFU S;  1M31 A;  5B8I B;  1B47 A;  5HKY A;  1SY9 A;  2LVI A;  1B8L A;  1K93 D;  1S6J A;  2KNE A;  1TIZ A;  1Y1A A;  1K95 A;  1A2X A;  4A4C A;  3I5H B;  2KFG A;  1SCM B;  2H61 A;  4AOM A;  2ZN8 A;  4MZL A;  1M45 A;  3VRN A;  3I5H C;  1SCM C;  1AK8 A;  4MZK A;  4Q04 A;  2LLU A;  2BE6 A;  1FI6 A;  1DJZ A;  2LLS A;  3NSO A;  3CWG A;  3GK1 A;  1MWN A;  1CM1 A;  2JQ6 A;  2K2A A;  2BBM A;  1KQM B;  1XFU O;  1KSM A;  3SG2 A;  1KK8 B;  2QPT A;  1UHJ A;  1KK8 C;  2Q4U A;  1SL9 A;  1GQM A;  1K94 A;  2L98 A;  3OP0 A;  4GGF C;  1NCY A;  4M2P A;  1XFX O;  4MVF A;  2BCA A;  4U8D A;  3KF9 A;  2KOT A;  2BKI B;  2JPT A;  3EK4 A;  3PN7 C;  3NSK A;  1WDC B;  1AUI B;  3A4U B;  3SG3 A;  1CLL A;  1QJT A;  5CPV A;  1F4Q A;  3SG6 A;  4PHJ A;  1WDC C;  3D10 A;  3GK4 X;  4FTG A;  3K21 A;  1WRK A;  2CXJ A;  3TS5 B;  1IGV A;  3DF0 A;  1Q80 A;  2M0R A;  5HKW A;  1OE9 B;  5DKR A;  2LMT A;  1J1D A;  4MLW A;  2O60 A;  3TS5 C;  5PAL A;  1QX2 A;  1JFJ A;  2Y1M A;  1NCX A;  1PVA A;  2MAZ A;  3ZWH A;  1DF0 A;  3BYA A;  1CLM A;  1QAT A;  2JT3 A;  2L5X B;  2LV7 A;  1IG5 A;  1A03 A;  1DJI A;  2PMY A;  2LMU A;  3M0W A;  2M7N A;  1YUT A;  2LCP A;  2JNX A;  3QRX A;  2I7A A;  4I5L B;  4DUQ A;  1IJ5 A;  1N0Y A;  1NIW A;  2K0J A;  2PSR A;  3CLN A;  1XFZ O;  1F4O A;  1RWY A;  4MZJ A;  1UHN A;  5ER4 X;  3BUX B;  4E68 A;  4PAL A;  1KFU L;  1LXF C;  2HQ8 A;  4QJ4 B;  2E30 A;  1B7T Y;  2MRD A;  2P6B B;  2GGZ A;  1TNQ A;  1SRA A;  1IRJ A;  1DJG A;  1DJX A;  2I94 A;  2KAY A;  3BUM B;  5G08 A;  3RM1 A;  1K90 D;  1SK6 D;  1MXL C;  1S5G Z;  2K61 A;  3VGO A;  2FCE A;  1DVI A;  1OMD A;  1HQV A;  4QJ3 B;  2K2F A;  4JWQ A;  4WQ3 A;  1WY9 A;  1ODB A;  1NX1 A;  5BPJ A;  5DKQ A;  2A4J A;  4ORC B;  3BUO B;  1R6P A;  1UP5 A;  3OHM B;  1MXE A;  1NX2 A;  2JC2 A;  3AKB A;  3EKJ A;  3KO0 A;  1DMO A;  1J7R A;  2LLT A;  3VRP A;  1C7V A;  1CMG A;  2Y1N A;  4GUK A;  4PE1 A;  1QVI Z;  1DJW A;  4GBA A;  4N1G A;  1JC2 A;  2WOS A;  2H2K A;  1OZS A;  2K7C A;  2KI6 D;  2V53 A;  1NX3 A;  4MSP A;  2NCO A;  1XYD A;  3AKA A;  4P5O E;  5HLV A;  1U5I B;  2B1U A;  1QIW A;  2MA2 A;  2SCP A;  5DKN A;  1BJF A;  3DVJ A;  1TN4 A;  2FCD A;  1DJY A;  1CDN A;  1B8C A;  1L2O C;  4OR9 B;  1F55 A;  3O4Y A;  2ZND A;  3I5I B;  1G8I A;  3BOW A;  3TDZ A;  1F71 A;  3DF0 B;  1TNP A;  1WLZ A;  1L7Z A;  1XO5 A;  4ORA B;  1NP8 A;  1S36 A;  4PHN A;  2JOJ A;  1J7O A;  4L9M A;  1BG1 A;  1K8U A;  3DVK A;  1B9A A;  4WQ2 A;  1C07 A;  3CZT X;  2M1U A;  4GAO A;  3EK8 A;  3WHT B;  1XFY O;  1N65 A;  1BMO A;  1KSO A;  2I2R E;  1PK0 D;  2TN4 A;  1SL8 A;  4YGD B;  1S6I A;  1DF0 B;  3GOF A;  2CT9 A;  3TUY B;  1SR6 B;  1YUS A;  3SIA A;  1UHH A;  4YBH B;  2CCM A;  1XA5 A;  1NWD A;  2LHI A;  4YGE B;  2LVJ A;  1YX7 A;  5ER5 A;  1FBV A;  3WNX B;  1CNP A;  2MLE C;  3BUN B;  1ZUZ A;  1QXP A;  2LE9 B;  1PUL A;  2BEC A;  4NDD A;  4NQG A;  2F8P A;  4I5N B;  1EG4 A;  1QX7 A;  1LKJ A;  2E6W A;  4OV2 A;  5HYD A;  1KK7 Y;  1K96 A;  1YRT B;  2BL0 B;  2PAS A;  2EHB A;  4NDC A;  2BCB A;  2MLF C;  5AFP A;  2BL0 C;  2COL B;  2KGB C;  4PE4 A;  1BF5 A;  2ZFD A;  1A4P A;  1CFC A;  1OZO A;  1M63 B;  1KQM C;  1QTX A;  1TCO B;  2JZI A;  4D1E A;  3ZNI A;  4PE0 A;  2M1K B;  1AHR A;  2SAS A;  1SNL A;  1SPY A;  4DCK A;  3FS7 A;  3NSI A;  1J55 A;  1EXR A;  1LA3 A;  2AMI A;  2ZRS A;  1YR5 A;  4USL A;  2F3Y A;  2L0P A;  3BUW B;  3BQ3 A;  4GPL B;  4YI8 A;  4ZCU A;  3CTN A;  4XJK A;  3ICB A;  3NSL A;  1SYM A;  1CFD A;  4MBE A;  1Y0V H;  2K7O A;  2M9G A;  1BOC A;  1N2D A;  3I5F B;  1YRU B;  3IQO A;  4GFT A;  4M2Q A;  1JF0 A;  2G9B A;  3I5F C;  4AQJ A;  1BOD A;  2RGI A;  1EL4 A;  1JFK A;  4YRU A;  1D1O A;  2NCP A;  1RJV A;  5JJG A;  2JTZ A;  4FQO A;  4R1E A;  4MEW A;  5J3X A;  1EG3 A;  1AJ4 A;  1GGW A;  1PRW A;  4PHK A;  4QJ5 B;  1B7T Z;  2CBL A;  4BY5 A;  1F70 A;  1WLM A;  1SMG A;  4ORB B;  4N5X A;  1ALV A;  1M46 A;  2QAC A;  3LK0 A;  5K89 A;  3O78 A;  1NCZ A;  1NX0 A;  1OOJ A;  2WOR A;  3PLF B;  4WRI A;  1KFX L;  4YGB B;  3RLZ A;  4GNK B;  1BU3 A;  4XYN A;  1YVL A;  1DTL A;  1AP4 A;  1YTZ C;  1XK4 C;  2KQY A;  3AAJ A;  2LM5 A;  4IL1 A;  4OVN F;  5I2L A;  1DJH A;  1S1E A;  2LC5 A;  3SG7 A;  4AQI A;  2HQW A;  4HRH A;  4MN0 A;  5KU1 A;  2VRG A;  3WHU B;  2KI6 C;  1PSR A;  1IWQ A;  5KSZ A;  2Q91 A;  1SL7 A;  1RRO A;  2ISD A;  1MF8 B;  2M3W A;  5I2O A;  3VRO A;  5KTY A;  1CKK A;  1ZFS A;  2LUX A;  1YUU A;  2L4I A;  3LK1 A;  2JUL A;  2L2E A;  1CLB A;  1PVB A;  2JU0 A;  1LA0 A;  1SBJ A;  3PFV A;  2KAX A;  4YGA A;  2WND A;  5AAN A;  3TDU A;  3SJS A;  2EC6 B;  4I5J A;  2LP3 A;  1IJ6 A;  3H4S E;  1FPW A;  4NDB A;  3KPX A;  4CLN A;  2ZN9 A;  2EC6 C;  4MRY A;  2PVB A;  4GGF A;  3CGA A;  1Y1U A;  1NUB A;  2NXQ A;  4PCW A;  5GQQ C;  1ZMZ A;  2KGR A;  1XFW O;  3O6B A;  5FYX A;  1C7W A;  1OSA A;  3CR2 A;  5I2Q A;  1S3P A;  2LHL A;  4PDZ A;  1E8A A;  1CFF A;  2EGD A;  2KSP A;  1KWO B;  1DT7 B;  2M29 A;  2WCF A;  4P2Y B;  5CSF A;  5CSI A;  3OB2 B;  5JOL A;  1CDP A;  3KEV A;  2IS9 A;  2Y5I A;  1OMR A;  3F45 A;  4ZCV A;  3VRR A;  5HLO A;  3I5I C;  2JXL A;  5AEQ A;  4CPV A;  3DD4 A;  3C1V A;  4N1F A;  1BR1 B;  1REC A;  4CFQ A;  1KK7 Z;  4DS7 A;  5D7F A;  2BE4 A;  4F0Z B;  4HRE E;  1CDL A;  1YX8 A;  1RK9 A;  1YVH A;  1XVJ A;  3NXA A;  5HKZ A;  3EVU A;  2KFF A;  2PAL A;  1QS7 A;  1UUS A;  1Y6W A;  1QIV A;  1GJY A;  3I5G B;  4HSZ A;  3TUY C;  1J1E A;  1SR6 C;  2KBI A;  3FIA A;  3SIB A;  1JBA A;  2LNK A;  1K2H A;  1UWO A;  1JF2 A;  2OTG B;  1KQV A;  4I5K A;  2FJU B;  2G2B A;  2M7L A;  2CNP A;  1IKU A;  1LIN A;  2JNF A;  3HCM A;  3PM8 A;  1S6C A;  2LVV A;  1W7J B;  1CM4 A;  3JVT B;  3JTD B;  2BCX A;  2JT0 A;  1PAL A;  3LL8 B;  2KYC A;  3LLE A;  4M2O A;  4GGN A;  3GK2 A;  2F33 A;  4JQ0 D;  4YGC B;  1MQ1 A;  1JUO A;  1RTP 1;  2LMV A;  1LVC D;  2KAV A;  2KFH A;  3EK7 A;  2JWW A;  1R2U A;  1IH0 A;  4YI9 A;  1B1G A;  3PAL A;  4A4B A;  1Y1X A;  1A75 A;  1QLK A;  1WRZ A;  2K7D A;  2ZRT A;  3DVE A;  3OX6 A;  1ZAC A;  1F8H A;  1UHK A;  2NZ0 A;  1OQP A;  5TNC A;  1SCV A;  2ZNE A;  1FI5 A;  1JWD A;  2JXC A;  1NSH A;  2NLN A;  1XFV O;  2F3Z A;  1BR4 B;  2LVK A;  3E3R A;  2PRU A;  2WCB A;  2F2O A;  1TTX A;  2CTN A;  1B8R A;  5AER A;  4C0J A;  2R2I A;  3PAT A;  2AAO A;  1EH2 A;  3PN7 B;  5I8N A;  2HF5 A;  3D0Y A;  1U5I A;  1QLS A;  1WRL A;  3CR5 X;  1KCY A;  3A8R A;  3KHE A;  2K8M B;  3BOW B;  1J7P A;  2DOQ A;  1EJ3 A;  1OMV A;  2KYF A;  1QV1 A;  2MJW B;  1TNX A;  1UHI A;  2HET A;  1W7I B;  2OS8 B;  2OS8 C;  1FW4 A;  1HT9 A;  4JPZ B;  4PE7 A;  1SKT A;  5CSJ A;  2BBN A;  3FWC A;  2KQ6 A;  2L50 A;  2Y4Q A;  2JRF A;  1SW8 A;  5IBW A;  1VRK A;  2D8N A;  3VRQ A;  5D69 A;  2H61 C;  4CFR A;  1ZOT B;  3BXK A;  1PSB A;  4C0K A;  1CTR A;  1J7Q A;  2O5G A;  3CR4 X;  5AXI A;  2M49 B;  1TNW A;  3AAK A;  2KHN A;  3HX4 A;  1JSA A;  2MBX A;  2LAN A;  4C0L A;  3IQQ A;  4DIR A;  2BKH B;  1S26 D;  2JT8 A;  3O2P A;  4PHM A;  1QX5 B;  3CS1 A;  1X02 A;  1DGU A;  1QAS A;  2OPO A;  4CID A;  1TCF A;  2M97 A;  2F2P A;  1A75 B;  1V1F A;  1CB1 A;  1K9U A;  4XJK B;  2GV5 A;  2KI4 B;  2AUC A;  2WCE A;  3LCP C;  4ICB A;  1NYA A;  2HPS A;  1H4B A;  1GGZ A;  1UUR A;  3TZ1 A;  2KI4 C;  2LP2 A;  1DGV A;  2GGM A;  1KWO C;  3DVM A;  5CSN A;  1F54 A;  1MUX A;  2LAP A;  4DRW A;  4UPG A;  1B4C A;  2KDH A;  1IQ5 A;  1V1G A;  1TOP A;  2I18 A;  3SG4 A;  1ALW A;  1IQ3 A;  3EKH A;  1S5G Y;  3WXA A;  3MSE B;  1A29 A;  1NPQ A;  1TRF A;  1FF1 A;  4HRG A;  1MHO A;  4OCI A;  1MR8 A;  3FWB A;  1H8B A;  4ETO A; 
#chains in the Genus database with same CATH topology
 2L51 A;  2ZKM X;  1RFJ A;  3IF7 A;  3D0Y B;  1BLQ A;  1CDM A;  1QV0 A;  1CFP A;  2WC8 A;  2LUC A;  1AJ5 A;  1L2O B;  3V2L A;  3OB1 B;  1AVS A;  2M8U A;  1M39 A;  2MHH A;  2K7B A;  3CYZ A;  3I5G C;  1CMF A;  1G33 A;  2FOT A;  3SG5 A;  1K9K A;  2PQL A;  4TNC A;  1G4Y R;  1QVI Y;  2KBM A;  2OTG C;  4OKH A;  5F6T A;  3EVR A;  1KFX S;  2P71 A;  3CZ0 A;  3EVV A;  1XK4 A;  1BT6 A;  2JTT A;  3OX5 A;  4MRX A;  2KPH A;  3JVT C;  3PSR A;  1TUZ A;  3JTD C;  1YUR A;  1K9P A;  2L4H A;  1KFU S;  1M31 A;  5B8I B;  2YGU A;  1B47 A;  5HKY A;  1QWV A;  1SY9 A;  2LVI A;  1B8L A;  1K93 D;  1S6J A;  2KNE A;  1TIZ A;  1Y1A A;  1K95 A;  1A2X A;  4A4C A;  3I5H B;  2KFG A;  1SCM B;  2H61 A;  3BFH A;  4AOM A;  2ZN8 A;  4MZL A;  1M45 A;  3VRN A;  3I5H C;  1SCM C;  1AK8 A;  4MZK A;  4Q04 A;  2LLU A;  2BE6 A;  3S0G A;  1FI6 A;  1DJZ A;  2LLS A;  3NSO A;  2P70 A;  3CWG A;  3GK1 A;  1MWN A;  1CM1 A;  2JQ6 A;  2K2A A;  2BBM A;  1KQM B;  1GM0 A;  1XFU O;  1KSM A;  3SG2 A;  1KK8 B;  2QPT A;  1IIO A;  1UHJ A;  1KK8 C;  2Q4U A;  1SL9 A;  1GQM A;  1K94 A;  2L98 A;  3BFA A;  3OP0 A;  4GGF C;  1NCY A;  4M2P A;  3SS3 A;  3OBV A;  2KLD A;  1XFX O;  4MVF A;  2BCA A;  4U8D A;  3KF9 A;  2KOT A;  2BKI B;  2JPT A;  3EK4 A;  3PN7 C;  3NSK A;  1WDC B;  1AUI B;  1T14 A;  3A4U B;  3B86 A;  1CLL A;  1QJT A;  3SG3 A;  5CPV A;  1F4Q A;  1SSE B;  4PHJ A;  1WDC C;  3D10 A;  3GK4 X;  4FTG A;  3SG6 A;  3B88 A;  3K21 A;  1WRK A;  2CXJ A;  3TS5 B;  1IGV A;  3DF0 A;  1Q80 A;  1DC1 A;  2M0R A;  5HKW A;  1OE9 B;  2BAP A;  5DKR A;  2LMT A;  1J1D A;  4MLW A;  2O60 A;  3TS5 C;  2K60 A;  4JD9 A;  5PAL A;  1QX2 A;  4INW A;  1JFJ A;  2Y1M A;  1NCX A;  1PVA A;  2MAZ A;  3ZWH A;  1OOF A;  1DF0 A;  3BYA A;  1CLM A;  1QAT A;  2WCL A;  2JT3 A;  2L5X B;  2LV7 A;  1IG5 A;  1A03 A;  1DJI A;  2PMY A;  2LMU A;  3M0W A;  2M7N A;  1YUT A;  2LCP A;  2JNX A;  3QRX A;  2I7A A;  4I5L B;  4DUQ A;  1IJ5 A;  1N0Y A;  1NIW A;  2K0J A;  2PSR A;  3CLN A;  1XFZ O;  1F4O A;  1RWY A;  4MZJ A;  1UHN A;  5ER4 X;  3BUX B;  4E68 A;  4PAL A;  1KFU L;  1LXF C;  2HQ8 A;  4QJ4 B;  2E30 A;  1B7T Y;  3S0F A;  2MRD A;  2P6B B;  2GGZ A;  3O4X A;  1TNQ A;  1SRA A;  1IRJ A;  1DJG A;  1DJX A;  2I94 A;  2KAY A;  1Z4H A;  3BUM B;  5G08 A;  3RM1 A;  1K90 D;  1SK6 D;  1MXL C;  1S5G Z;  2K61 A;  3VGO A;  2WCH A;  2FCE A;  1DVI A;  1OMD A;  1HQV A;  4QJ3 B;  2K2F A;  4JWQ A;  4WQ3 A;  1WY9 A;  1ODB A;  1NX1 A;  5BPJ A;  3SS5 A;  1TUJ A;  5DKQ A;  2A4J A;  4ORC B;  3BUO B;  1R6P A;  1UP5 A;  3OHM B;  1MXE A;  3DZT A;  3PJI A;  1NX2 A;  2JC2 A;  3AKB A;  3EKJ A;  3KO0 A;  1DMO A;  1J7R A;  2LLT A;  3VRP A;  1C7V A;  1CMG A;  2Y1N A;  3S0A A;  4GUK A;  4PE1 A;  1QVI Z;  1DJW A;  4GBA A;  4N1G A;  1JC2 A;  2WOS A;  2H2K A;  1DQE A;  1OZS A;  2K7C A;  2KI6 D;  2V53 A;  1NX3 A;  4MSP A;  2NCO A;  1XYD A;  3AKA A;  4P5O E;  5HLV A;  1U5I B;  2B1U A;  1QIW A;  2MA2 A;  2SCP A;  3B87 A;  4F7F A;  5DKN A;  4IJ7 A;  1BJF A;  3DVJ A;  1TN4 A;  2FCD A;  1DJY A;  3S0B A;  1CDN A;  1B8C A;  1L2O C;  4OR9 B;  1F55 A;  3O4Y A;  2ZND A;  3I5I B;  1G8I A;  3BOW A;  3TDZ A;  1F71 A;  4OZD A;  3DF0 B;  1TNP A;  1WLZ A;  1L7Z A;  1XO5 A;  4ORA B;  1NP8 A;  1S36 A;  4PHN A;  2JOJ A;  1J7O A;  4L9M A;  1BG1 A;  1K8U A;  3DVK A;  1B9A A;  4WQ2 A;  1C07 A;  3CZT X;  2M1U A;  4GAO A;  3EK8 A;  3WHT B;  1XFY O;  1N65 A;  1BMO A;  1KSO A;  2I2R E;  1PK0 D;  2TN4 A;  1SL8 A;  4YGD B;  1S6I A;  1DF0 B;  3GOF A;  2CT9 A;  3TUY B;  1SR6 B;  1YUS A;  3SIA A;  1UHH A;  3R1P A;  4YBH B;  2CCM A;  1XA5 A;  1NWD A;  2LHI A;  3DXL A;  4YGE B;  2LVJ A;  1P28 A;  1YX7 A;  5ER5 A;  1FBV A;  3BJH A;  3WNX B;  1CNP A;  2MLE C;  3BUN B;  1ZUZ A;  1QXP A;  2LE9 B;  1PUL A;  2BEC A;  4NDD A;  1C3Y A;  4NQG A;  2F8P A;  4I5N B;  1DEK A;  1EG4 A;  1LKJ A;  1QX7 A;  2E6W A;  4OV2 A;  5HYD A;  3FE9 A;  3UO9 A;  1KK7 Y;  1K96 A;  1YRT B;  2BL0 B;  1W9Z A;  2PAS A;  2EHB A;  3R1V A;  4NDC A;  2BCB A;  2MLF C;  5AFP A;  2BL0 C;  2COL B;  2KGB C;  4PE4 A;  1BF5 A;  2ZFD A;  1A4P A;  1CFC A;  1OZO A;  1M63 B;  1KQM C;  1QTX A;  1TCO B;  2JZI A;  2WC5 A;  4D1E A;  3ZNI A;  4PE0 A;  2M1K B;  1AHR A;  2SAS A;  1SNL A;  1SPY A;  4DCK A;  3FS7 A;  3NSI A;  1J55 A;  1EXR A;  1LA3 A;  2AMI A;  2ZRS A;  1YR5 A;  4USL A;  2F3Y A;  2L0P A;  3BUW B;  3BQ3 A;  4GPL B;  4YI8 A;  4ZCU A;  3CTN A;  4XJK A;  3ICB A;  3NSL A;  1SYM A;  3FE8 A;  1CFD A;  3D76 A;  4MBE A;  1Y0V H;  2K7O A;  2M9G A;  1BOC A;  1N2D A;  5FI7 A;  3D77 A;  3I5F B;  1YRU B;  2H8V A;  3IQO A;  4GFT A;  4M2Q A;  1JF0 A;  2G9B A;  3I5F C;  3D78 A;  4AQJ A;  1BOD A;  2RGI A;  1EL4 A;  1JFK A;  4YRU A;  1D1O A;  3B6X A;  2NCP A;  1RJV A;  5JJG A;  2JTZ A;  3DYE A;  4FQO A;  4MEW A;  4R1E A;  1EG3 A;  1AJ4 A;  5J3X A;  1PRW A;  1GGW A;  4PHK A;  4QJ5 B;  1B7T Z;  2CBL A;  4BY5 A;  1F70 A;  1WLM A;  1SMG A;  4ORB B;  4N5X A;  1ALV A;  1M46 A;  2QAC A;  3LK0 A;  5K89 A;  2L2C A;  3O78 A;  1NCZ A;  1NX0 A;  1OOJ A;  2WOR A;  3PLF B;  4WRI A;  1KFX L;  3FE6 A;  4YGB B;  3RLZ A;  4JKT A;  4GNK B;  1BU3 A;  2QDI A;  4XYN A;  1YVL A;  3VB1 A;  1DTL A;  2QEH A;  1AP4 A;  1YTZ C;  1XK4 C;  2KQY A;  3AAJ A;  2LM5 A;  1C3Z A;  4IL1 A;  4OVN F;  5I2L A;  3CZ1 A;  1DJH A;  1S1E A;  2LC5 A;  3SG7 A;  4AQI A;  2HQW A;  2QEV A;  4HRH A;  4MN0 A;  2VRG A;  3WHU B;  2KI6 C;  5KU1 A;  3S0D A;  1PSR A;  1IWQ A;  5KSZ A;  2Q91 A;  1SL7 A;  1RRO A;  2WCK A;  3D73 A;  2ISD A;  1MF8 B;  2M3W A;  5I2O A;  3VRO A;  5KTY A;  1CKK A;  1ZFS A;  2LUX A;  1YUU A;  2L4I A;  3LK1 A;  2JUL A;  2L2E A;  1CLB A;  1PVB A;  2JU0 A;  1LA0 A;  1SBJ A;  3PFV A;  2KAX A;  1OOI X;  4YGA A;  2WND A;  5AAN A;  3TDU A;  3SJS A;  2EC6 B;  4I5J A;  2LP3 A;  3L4L A;  1IJ6 A;  1LS8 A;  2ERB A;  2QEO A;  3H4S E;  4NDB A;  3KPX A;  1FPW A;  4CLN A;  2ZN9 A;  2EC6 C;  4MRY A;  2FJY A;  2PVB A;  3B7A A;  3CGA A;  1Y1U A;  4GGF A;  1NUB A;  2NXQ A;  4PCW A;  5GQQ C;  1ZMZ A;  2KGR A;  1XFW O;  3O6B A;  5FYX A;  1C7W A;  1OSA A;  3CR2 A;  5I2Q A;  1S3P A;  2LHL A;  3PM2 A;  3Q8I A;  3CAB A;  4PDZ A;  1E8A A;  1CFF A;  2EGD A;  2KSP A;  1KWO B;  1DT7 B;  2M29 A;  2WCF A;  4P2Y B;  5CSF A;  5CSI A;  3OB2 B;  5JOL A;  1CDP A;  3KEV A;  2IS9 A;  2Y5I A;  1OMR A;  3F45 A;  4INX A;  4ZCV A;  3VRR A;  1DEL A;  1XFR A;  5HL1 A;  5HLO A;  3I5I C;  2JXL A;  3CDN A;  5AEQ A;  1OOG A;  4CPV A;  3DD4 A;  3C1V A;  4N1F A;  1BR1 B;  1REC A;  4CFQ A;  1KK7 Z;  4DS7 A;  5D7F A;  2BE4 A;  4F0Z B;  3NHT A;  4HRE E;  3UNW A;  1CDL A;  3NHI A;  1YX8 A;  1RK9 A;  1YVH A;  1XVJ A;  3NXA A;  3BFB A;  5HKZ A;  3EVU A;  2KFF A;  2BNX A;  3NGV A;  2PAL A;  1QS7 A;  1UUS A;  1Y6W A;  3OGN A;  1QIV A;  1GJY A;  3I5G B;  4HSZ A;  3TUY C;  1J1E A;  1SR6 C;  2KBI A;  3FIA A;  3SIB A;  1JBA A;  2LNK A;  1K2H A;  3R72 A;  1UWO A;  1JF2 A;  2OTG B;  1KQV A;  4I5K A;  2FJU B;  2G2B A;  3QME A;  2M7L A;  2CNP A;  1IKU A;  2PYQ A;  1LIN A;  2JNF A;  3HCM A;  3PM8 A;  1S6C A;  2LVV A;  1W7J B;  1CM4 A;  3JVT B;  3JTD B;  2BCX A;  2JT0 A;  1PAL A;  3LL8 B;  2KYC A;  3LLE A;  4M2O A;  4GGN A;  3GK2 A;  2F33 A;  4JQ0 D;  4YGC B;  1MQ1 A;  1JUO A;  1RTP 1;  2LMV A;  3SS4 A;  1LVC D;  2KAV A;  2KFH A;  5FI2 A;  3EK7 A;  2JWW A;  3DY9 A;  1R2U A;  1IH0 A;  4YI9 A;  1B1G A;  3PAL A;  4A4B A;  1Y1X A;  1A75 A;  1QLK A;  1WRZ A;  2K7D A;  2ZRT A;  3EG5 B;  3DVE A;  3OX6 A;  1ZAC A;  2WC6 A;  1F8H A;  1UHK A;  2NZ0 A;  1OQP A;  5TNC A;  1SCV A;  2ZNE A;  3L47 A;  1FI5 A;  3S0E A;  1JWD A;  2JXC A;  1NSH A;  2JPO A;  2NLN A;  1XFV O;  5DIC A;  2F3Z A;  3RZS A;  1BR4 B;  2LVK A;  3E3R A;  2QEB A;  2PRU A;  2WCB A;  2F2O A;  1TTX A;  2CTN A;  1B8R A;  5AER A;  2KLE A;  3D74 A;  4C0J A;  2R2I A;  3PAT A;  1ORG A;  2AAO A;  1EH2 A;  3PN7 B;  5I8N A;  2HF5 A;  3D0Y A;  1U5I A;  5EL2 A;  1QLS A;  1WRL A;  3TDI A;  4BY4 A;  3CR5 X;  1KCY A;  3A8R A;  3KHE A;  2K8M B;  3BOW B;  2GTE A;  1J7P A;  2DOQ A;  1EJ3 A;  1OMV A;  2KYF A;  1QV1 A;  2MJW B;  1TNX A;  1UHI A;  2HET A;  1W7I B;  2OS8 B;  2WCM A;  2OS8 C;  1FW4 A;  1HT9 A;  4JPZ B;  4PE7 A;  1SKT A;  3IVT A;  5D3O A;  5CSJ A;  2BBN A;  3FWC A;  2KQ6 A;  2L50 A;  2Y4Q A;  2JRF A;  1SW8 A;  5IBW A;  1VRK A;  2D8N A;  3VRQ A;  5D69 A;  4FQT A;  2H61 C;  4CFR A;  1ZOT B;  3L4A A;  5FI6 A;  5I94 A;  3BXK A;  1PSB A;  4C0K A;  1CTR A;  1J7Q A;  2O5G A;  3CR4 X;  5AXI A;  2M49 B;  1TNW A;  3AAK A;  2KHN A;  3HX4 A;  1JSA A;  2MBX A;  2LAN A;  4C0L A;  3IQQ A;  4PT1 A;  4DIR A;  2L5Y A;  2BKH B;  1S26 D;  2JT8 A;  3O2P A;  4PHM A;  1QX5 B;  3R1O A;  3CS1 A;  1X02 A;  1DGU A;  1QAS A;  2OPO A;  4CID A;  1TCF A;  3K1E A;  2M97 A;  2F2P A;  1A75 B;  3N7H A;  1V1F A;  1CB1 A;  1Z2C B;  1K9U A;  4XJK B;  2GV5 A;  2WCJ A;  2KI4 B;  2AUC A;  2WCE A;  3LCP C;  4ICB A;  1NYA A;  2HPS A;  3CZ2 A;  1H4B A;  1GGZ A;  1UUR A;  3TZ1 A;  2KI4 C;  2LP2 A;  1DGV A;  2GGM A;  1KWO C;  3DVM A;  5CSN A;  1F54 A;  1MUX A;  2LAP A;  4DRW A;  1OOH A;  4UPG A;  1B4C A;  2KDH A;  1IQ5 A;  1V1G A;  1TOP A;  2I18 A;  3SG4 A;  1ALW A;  1IQ3 A;  4KYN A;  3EKH A;  1TWO A;  1S5G Y;  3WXA A;  3MSE B;  1A29 A;  1NPQ A;  1TRF A;  1FF1 A;  3D75 A;  1MHO A;  1OW4 A;  4HRG A;  4OCI A;  1MR8 A;  3FWB A;  1H8B A;  4ETO A; 
#chains in the Genus database with same CATH homology
 2L51 A;  2ZKM X;  1RFJ A;  3IF7 A;  3D0Y B;  1BLQ A;  1CDM A;  1QV0 A;  1CFP A;  2WC8 A;  2LUC A;  1AJ5 A;  1L2O B;  3OB1 B;  1AVS A;  2M8U A;  1M39 A;  2MHH A;  2K7B A;  3I5G C;  1CMF A;  1G33 A;  2FOT A;  3SG5 A;  1K9K A;  4TNC A;  1G4Y R;  1QVI Y;  2KBM A;  2OTG C;  4OKH A;  5F6T A;  3EVR A;  1KFX S;  3EVV A;  4MRX A;  1XK4 A;  1BT6 A;  2JTT A;  3OX5 A;  3TDI A;  3PSR A;  3JVT C;  4BY4 A;  3JTD C;  1YUR A;  1K9P A;  2L4H A;  1KFU S;  1M31 A;  5B8I B;  1B47 A;  5HKY A;  1SY9 A;  2LVI A;  1B8L A;  1K93 D;  1S6J A;  2KNE A;  1TIZ A;  1Y1A A;  1K95 A;  1A2X A;  4A4C A;  3I5H B;  2KFG A;  1SCM B;  2H61 A;  4AOM A;  2ZN8 A;  4MZL A;  1M45 A;  3VRN A;  3I5H C;  1SCM C;  1AK8 A;  4MZK A;  4Q04 A;  2LLU A;  2BE6 A;  1FI6 A;  1DJZ A;  2LLS A;  3NSO A;  3CWG A;  3GK1 A;  1MWN A;  1CM1 A;  2JQ6 A;  2K2A A;  2BBM A;  1KQM B;  1XFU O;  1KSM A;  3SG2 A;  1KK8 B;  2QPT A;  1UHJ A;  1KK8 C;  2Q4U A;  1SL9 A;  1GQM A;  1K94 A;  2L98 A;  3OP0 A;  4GGF C;  1NCY A;  4M2P A;  1XFX O;  4MVF A;  2BCA A;  4U8D A;  3KF9 A;  2KOT A;  2BKI B;  2JPT A;  3EK4 A;  3PN7 C;  3NSK A;  1WDC B;  1AUI B;  3A4U B;  3SG3 A;  1CLL A;  1QJT A;  5CPV A;  1F4Q A;  3SG6 A;  4PHJ A;  1WDC C;  3D10 A;  3GK4 X;  4FTG A;  3K21 A;  1WRK A;  2CXJ A;  3TS5 B;  1IGV A;  3DF0 A;  1Q80 A;  2M0R A;  5HKW A;  1OE9 B;  5DKR A;  2LMT A;  1J1D A;  4MLW A;  2O60 A;  3TS5 C;  5PAL A;  1QX2 A;  1JFJ A;  2Y1M A;  1NCX A;  1PVA A;  2MAZ A;  3ZWH A;  1DF0 A;  3BYA A;  1CLM A;  1QAT A;  2JT3 A;  2L5X B;  2LV7 A;  1IG5 A;  1A03 A;  1DJI A;  2PMY A;  2LMU A;  3M0W A;  2M7N A;  1YUT A;  2LCP A;  2JNX A;  3QRX A;  2I7A A;  4I5L B;  4DUQ A;  1IJ5 A;  1N0Y A;  1NIW A;  2K0J A;  2PSR A;  3CLN A;  1XFZ O;  1F4O A;  1RWY A;  4MZJ A;  1UHN A;  5ER4 X;  3BUX B;  4E68 A;  4PAL A;  1KFU L;  1LXF C;  2HQ8 A;  4QJ4 B;  2E30 A;  1B7T Y;  2MRD A;  2P6B B;  2GGZ A;  1TNQ A;  1SRA A;  1IRJ A;  1DJG A;  1DJX A;  2I94 A;  2KAY A;  3BUM B;  5G08 A;  3RM1 A;  1K90 D;  1SK6 D;  1MXL C;  1S5G Z;  2K61 A;  3VGO A;  2FCE A;  1DVI A;  1OMD A;  1HQV A;  4QJ3 B;  2K2F A;  4JWQ A;  4WQ3 A;  1WY9 A;  1ODB A;  1NX1 A;  5BPJ A;  5DKQ A;  2A4J A;  4ORC B;  3BUO B;  1R6P A;  1UP5 A;  3OHM B;  1MXE A;  1NX2 A;  2JC2 A;  3AKB A;  3EKJ A;  3KO0 A;  1DMO A;  1J7R A;  2LLT A;  3VRP A;  1C7V A;  1CMG A;  2Y1N A;  4GUK A;  4PE1 A;  1QVI Z;  1DJW A;  4GBA A;  4N1G A;  1JC2 A;  2WOS A;  2H2K A;  1OZS A;  2K7C A;  2KI6 D;  2V53 A;  1NX3 A;  4MSP A;  2NCO A;  1XYD A;  3AKA A;  4P5O E;  5HLV A;  1U5I B;  2B1U A;  1QIW A;  2MA2 A;  2SCP A;  5DKN A;  1BJF A;  3DVJ A;  1TN4 A;  2FCD A;  1DJY A;  1CDN A;  1B8C A;  1L2O C;  4OR9 B;  1F55 A;  3O4Y A;  2ZND A;  3I5I B;  1G8I A;  3BOW A;  3TDZ A;  1F71 A;  3DF0 B;  1TNP A;  1WLZ A;  1L7Z A;  1XO5 A;  4ORA B;  1NP8 A;  1S36 A;  4PHN A;  2JOJ A;  1J7O A;  4L9M A;  1BG1 A;  1K8U A;  3DVK A;  1B9A A;  4WQ2 A;  1C07 A;  3CZT X;  2M1U A;  4GAO A;  3EK8 A;  3WHT B;  1XFY O;  1N65 A;  1BMO A;  1KSO A;  2I2R E;  1PK0 D;  2TN4 A;  1SL8 A;  4YGD B;  1S6I A;  1DF0 B;  3GOF A;  2CT9 A;  3TUY B;  1SR6 B;  1YUS A;  3SIA A;  1UHH A;  4YBH B;  2CCM A;  1XA5 A;  1NWD A;  2LHI A;  4YGE B;  2LVJ A;  1YX7 A;  5ER5 A;  1FBV A;  3WNX B;  1CNP A;  2MLE C;  3BUN B;  1ZUZ A;  1QXP A;  2LE9 B;  1PUL A;  2BEC A;  4NDD A;  4NQG A;  2F8P A;  4I5N B;  1EG4 A;  1QX7 A;  1LKJ A;  2E6W A;  4OV2 A;  5HYD A;  1KK7 Y;  1K96 A;  1YRT B;  2BL0 B;  2PAS A;  2EHB A;  4NDC A;  2BCB A;  2MLF C;  5AFP A;  2BL0 C;  2COL B;  2KGB C;  4PE4 A;  1BF5 A;  2ZFD A;  1A4P A;  1CFC A;  1OZO A;  1M63 B;  1KQM C;  1QTX A;  1TCO B;  2JZI A;  4D1E A;  3ZNI A;  4PE0 A;  2M1K B;  1AHR A;  2SAS A;  1SNL A;  1SPY A;  4DCK A;  3FS7 A;  3NSI A;  1J55 A;  1EXR A;  1LA3 A;  2AMI A;  2ZRS A;  1YR5 A;  4USL A;  2F3Y A;  2L0P A;  3BUW B;  3BQ3 A;  4GPL B;  4YI8 A;  4ZCU A;  3CTN A;  4XJK A;  3ICB A;  3NSL A;  1SYM A;  1CFD A;  4MBE A;  1Y0V H;  2K7O A;  2M9G A;  1BOC A;  1N2D A;  3I5F B;  1YRU B;  3IQO A;  4GFT A;  4M2Q A;  1JF0 A;  2G9B A;  3I5F C;  4AQJ A;  1BOD A;  2RGI A;  1EL4 A;  1JFK A;  4YRU A;  1D1O A;  2NCP A;  1RJV A;  5JJG A;  2JTZ A;  4FQO A;  4R1E A;  4MEW A;  5J3X A;  1EG3 A;  1AJ4 A;  1GGW A;  1PRW A;  4PHK A;  4QJ5 B;  1B7T Z;  2CBL A;  4BY5 A;  1F70 A;  1WLM A;  1SMG A;  4ORB B;  4N5X A;  1ALV A;  1M46 A;  2QAC A;  3LK0 A;  5K89 A;  3O78 A;  1NCZ A;  1NX0 A;  1OOJ A;  2WOR A;  3PLF B;  4WRI A;  1KFX L;  4YGB B;  3RLZ A;  4GNK B;  1BU3 A;  4XYN A;  1YVL A;  1DTL A;  1AP4 A;  1YTZ C;  1XK4 C;  2KQY A;  3AAJ A;  2LM5 A;  4IL1 A;  4OVN F;  5I2L A;  1DJH A;  1S1E A;  2LC5 A;  3SG7 A;  4AQI A;  2HQW A;  4HRH A;  4MN0 A;  5KU1 A;  2VRG A;  3WHU B;  2KI6 C;  1PSR A;  1IWQ A;  5KSZ A;  2Q91 A;  1SL7 A;  1RRO A;  2ISD A;  1MF8 B;  2M3W A;  5I2O A;  3VRO A;  5KTY A;  1CKK A;  1ZFS A;  2LUX A;  1YUU A;  2L4I A;  3LK1 A;  2JUL A;  2L2E A;  1CLB A;  1PVB A;  2JU0 A;  1LA0 A;  1SBJ A;  3PFV A;  2KAX A;  4YGA A;  2WND A;  5AAN A;  3TDU A;  3SJS A;  2EC6 B;  4I5J A;  2LP3 A;  1IJ6 A;  3H4S E;  1FPW A;  4NDB A;  3KPX A;  4CLN A;  2ZN9 A;  2EC6 C;  4MRY A;  2PVB A;  4GGF A;  3CGA A;  1Y1U A;  1NUB A;  2NXQ A;  4PCW A;  5GQQ C;  1ZMZ A;  2KGR A;  1XFW O;  3O6B A;  5FYX A;  1C7W A;  1OSA A;  3CR2 A;  5I2Q A;  1S3P A;  2LHL A;  4PDZ A;  1E8A A;  1CFF A;  2EGD A;  2KSP A;  1KWO B;  1DT7 B;  2M29 A;  2WCF A;  4P2Y B;  5CSF A;  5CSI A;  3OB2 B;  5JOL A;  1CDP A;  3KEV A;  2IS9 A;  2Y5I A;  1OMR A;  3F45 A;  4ZCV A;  3VRR A;  5HLO A;  3I5I C;  2JXL A;  5AEQ A;  4CPV A;  3DD4 A;  3C1V A;  4N1F A;  1BR1 B;  1REC A;  4CFQ A;  1KK7 Z;  4DS7 A;  5D7F A;  2BE4 A;  4F0Z B;  4HRE E;  1CDL A;  1YX8 A;  1RK9 A;  1YVH A;  1XVJ A;  3NXA A;  5HKZ A;  3EVU A;  2KFF A;  2PAL A;  1QS7 A;  1UUS A;  1Y6W A;  1QIV A;  1GJY A;  3I5G B;  4HSZ A;  3TUY C;  1J1E A;  1SR6 C;  2KBI A;  3FIA A;  3SIB A;  1JBA A;  2LNK A;  1K2H A;  1UWO A;  1JF2 A;  2OTG B;  1KQV A;  4I5K A;  2FJU B;  2G2B A;  2M7L A;  2CNP A;  1IKU A;  1LIN A;  2JNF A;  3HCM A;  3PM8 A;  1S6C A;  2LVV A;  1W7J B;  1CM4 A;  3JVT B;  3JTD B;  2BCX A;  2JT0 A;  1PAL A;  3LL8 B;  2KYC A;  3LLE A;  4M2O A;  4GGN A;  3GK2 A;  2F33 A;  4JQ0 D;  4YGC B;  1MQ1 A;  1JUO A;  1RTP 1;  2LMV A;  1LVC D;  2KAV A;  2KFH A;  3EK7 A;  2JWW A;  1R2U A;  1IH0 A;  4YI9 A;  1B1G A;  3PAL A;  4A4B A;  1Y1X A;  1A75 A;  1QLK A;  1WRZ A;  2K7D A;  2ZRT A;  3DVE A;  3OX6 A;  1ZAC A;  1F8H A;  1UHK A;  2NZ0 A;  1OQP A;  5TNC A;  1SCV A;  2ZNE A;  1FI5 A;  1JWD A;  2JXC A;  1NSH A;  2NLN A;  1XFV O;  2F3Z A;  1BR4 B;  2LVK A;  3E3R A;  2PRU A;  2WCB A;  2F2O A;  1TTX A;  2CTN A;  1B8R A;  5AER A;  4C0J A;  2R2I A;  3PAT A;  2AAO A;  1EH2 A;  3PN7 B;  5I8N A;  2HF5 A;  3D0Y A;  1U5I A;  1QLS A;  1WRL A;  3CR5 X;  1KCY A;  3A8R A;  3KHE A;  2K8M B;  3BOW B;  1J7P A;  2DOQ A;  1EJ3 A;  1OMV A;  2KYF A;  1QV1 A;  2MJW B;  1TNX A;  1UHI A;  2HET A;  1W7I B;  2OS8 B;  2OS8 C;  1FW4 A;  1HT9 A;  4JPZ B;  4PE7 A;  1SKT A;  5CSJ A;  2BBN A;  3FWC A;  2KQ6 A;  2L50 A;  2Y4Q A;  2JRF A;  1SW8 A;  5IBW A;  1VRK A;  2D8N A;  3VRQ A;  5D69 A;  2H61 C;  4CFR A;  1ZOT B;  3BXK A;  1PSB A;  4C0K A;  1CTR A;  1J7Q A;  2O5G A;  3CR4 X;  5AXI A;  2M49 B;  1TNW A;  3AAK A;  2KHN A;  3HX4 A;  1JSA A;  2MBX A;  2LAN A;  4C0L A;  3IQQ A;  4DIR A;  2BKH B;  1S26 D;  2JT8 A;  3O2P A;  4PHM A;  1QX5 B;  3CS1 A;  1X02 A;  1DGU A;  1QAS A;  2OPO A;  4CID A;  1TCF A;  2M97 A;  2F2P A;  1A75 B;  1V1F A;  1CB1 A;  1K9U A;  4XJK B;  2GV5 A;  2KI4 B;  2AUC A;  2WCE A;  3LCP C;  4ICB A;  1NYA A;  2HPS A;  1H4B A;  1GGZ A;  1UUR A;  3TZ1 A;  2KI4 C;  2LP2 A;  1DGV A;  2GGM A;  1KWO C;  3DVM A;  5CSN A;  1F54 A;  1MUX A;  2LAP A;  4DRW A;  4UPG A;  1B4C A;  2KDH A;  1IQ5 A;  1V1G A;  1TOP A;  2I18 A;  3SG4 A;  1ALW A;  1IQ3 A;  3EKH A;  1S5G Y;  3WXA A;  3MSE B;  1A29 A;  1NPQ A;  1TRF A;  1FF1 A;  4HRG A;  1MHO A;  4OCI A;  1MR8 A;  3FWB A;  1H8B A;  4ETO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...