3WHUB

Crystal structure of ergic-53/mcfd2, calcium/man2-bound form
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
71
structure length
58
Chain Sequence
b'QLHYFKMHDYDGNNLLDGLELSTAITMSEDELINIIDGVLRDDDKNNDGYIDYAEFAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein ERGIC-53
publication title Structural Basis for Disparate Sugar-Binding Specificities in the Homologous Cargo Receptors ERGIC-53 and VIP36
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 18
structure length 58
sequence length 71
ec nomenclature
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3whuB00
3ZNIA 2JC2A 3I5IB 5DKNA 2CXJA 1DJGA 1K96A 2RGIA 5I2LA 3TDZA 3WHTB 3IQOA 3FWBA 2MBXA 2M7NA 2M29A 2EGDA 2KI6D 3VGOA 1TCOB 1Y1UA 4HRGA 2ZFDA 1K8UA 1B8LA 1WRLA 2KFFA 2LP3A 2PMYA 1M31A 1YVLA 3CGAA 1UUSA 1X02A 1YUTA 4GBAA 3QRXA 1H4BA 1W7IB 1CLLA 3DVEA 3BUNB 5CSFA 1K94A 2CTNA 3DD4A 2KAVA 2L2EA 1UHJA 2BE6A 3JVTB 4M2OA 2O5GA 4OVNF 1F70A 3VRPA 1TNXA 4YGBB 1SY9A 1S36A 4M2QA 4I5LB 4YI8A 2BKIB 2A4JA 5GQQC 1IKUA 3CZTX 2K0JA 3IF7A 1IRJA 1L2OB 3A8RA 2WORA 2Y1MA 5JOLA 4AQJA 2OTGB 1J7PA 1SCMB 1U5IB 2LLTA 3DF0A 3BQ3A 3PFVA 3M0WA 1NYAA 2K61A 4L9MA 1FW4A 1TNQA 5TNCA 1OSAA 2KI4C 1CM4A 1LXFC 1MUXA 1F4QA 5HLVA 1DVIA 1YX7A 1QLSA 1VRKA 1W7JB 2MA2A 1AP4A 1IH0A 2KDHA 1SL8A 1RROA 3OHMB 4PE0A 3GK1A 2JT3A 2FOTA 3VRQA 4CFQA 1KQMC 2M0RA 1QASA 3PM8A 4DIRA 3WHUB 2ZN9A 2NLNA 2EC6B 2KSPA 3OB1B 4OR9B 2CNPA 3NSLA 1J7RA 1XFYO 4NDBA 4GPLB 1SRAA 4PDZA 1ZOTB 2M1KB 2V53A 2OS8C 3EKJA 4WQ2A 2L50A 1A75B 1YURA 3I5HC 2K2FA 3O78A 1F54A 1A4PA 1KWOC 3D0YB 3GOFA 1J1EA 1DTLA 1WRKA 4YGAA 2WNDA 3AKAA 4MEWA 2LMVA 2SASA 3CWGA 1DMOA 1BMOA 2K7BA 2M3WA 3CLNA 4PHMA 2LUXA 1LA3A 5B8IB 1DJIA 2Y1NA 3E3RA 1IJ5A 1OE9B 1QX2A 4QJ5B 1SPYA 1N0YA 4JPZB 1BLQA 1FF1A 2FCDA 5HKZA 1CLBA 5CSNA 2KOTA 1UWOA 2M8UA 1S6JA 1SR6C 2BECA 2P6BB 1PULA 2F3YA 5HLOA 5BPJA 1NSHA 1K9PA 1CMFA 3I5FC 4MSPA 3WXAA 1BODA 2ZRSA 4GFTA 1NPQA 1BT6A 4CLNA 3A4UB 1NCZA 2M49B 3EKHA 3AAKA 2WCFA 4MBEA 1BU3A 1S5GY 3NSKA 3LL8B 1NCXA 1V1FA 3TUYC 3RLZA 1XFWO 4D1EA 4E68A 2LUCA 4YI9A 1QJTA 2MLEC 2SCPA 1PK0D 1WY9A 1YRUB 1PRWA 1ALVA 3PN7B 4YGCB 3TDUA 1DGUA 2KGRA 1NUBA 2CCMA 3SIBA 2KBIA 1PSRA 2VRGA 1N2DA 1QX5B 3PSRA 3EK4A 2GGZA 1IJ6A 1RFJA 1TOPA 3LK1A 1KCYA 1YTZC 1CDPA 2G9BA 4FQOA 1ZFSA 4PHKA 4PE7A 2KI4B 1HT9A 3VROA 2AAOA 1GQMA 3KPXA 1KQVA 1TNWA 1TNPA 2KBMA 4OCIA 4DS7A 1EG4A 3I5GC 4CFRA 3TZ1A 1JC2A 1M63B 4A4CA 5CPVA 2TN4A 1WDCB 4PE1A 1CFCA 2HQ8A 1XFZO 1JUOA 4XYNA 1DT7B 3KO0A 3DF0B 3O4YA 1J7QA 1KFUS 2JT0A 1XO5A 1DJXA 3LCPC 1LVCD 1DJYA 1SBJA 2ZKMX 1OZSA 1ALWA 1KK8B 3H4SE 2JXCA 1K2HA 2KQYA 4WRIA 4QJ3B 5CSIA 3I5HB 2LANA 1Y6WA 3CS1A 5AANA 1RJVA 2I18A 4F0ZB 1QX7A 4C0JA 5F6TA 2MAZA 3KHEA 1JF0A 1QV0A 1A29A 2LMTA 2LM5A 2WCEA 1LA0A 1QATA 1AJ5A 1S5GZ 1FI5A 4ORAB 1NX2A 1R2UA 1BJFA 2PRUA 4MRYA 1LINA 5DKQA 2L4HA 2JOJA 1J55A 4ICBA 2LCPA 4ETOA 5AERA 4DRWA 4PHJA 1RTP1 1YX8A 2B1UA 2JTZA 3I5FB 3CTNA 1XK4C 1H8BA 5J3XA 2MLFC 5G08A 5AEQA 2WC8A 2JULA 1OZOA 2LVKA 1BR4B 1KSMA 4MLWA 1B7TY 2BL0C 3SG7A 2PVBA 3TS5B 3PALA 3F45A 3SG4A 1RWYA 2K7OA 2LLUA 2BCBA 2Q4UA 3EVUA 1A2XA 1B47A 1DF0A 4PCWA 2BBNA 1N65A 5HKYA 3EK7A 1OMVA 1CM1A 2QPTA 4YGDB 3BOWA 1K9UA 4XJKA 1QLKA 3HX4A 3D10A 1YVHA 1OMDA 1QVIY 1UURA 2H61C 2QACA 3DVJA 5KTYA 1F8HA 2LE9B 2L51A 1DGVA 3OX5A 3HCMA 3KF9A 3BUMB 3PLFB 5KU1A 3KEVA 5D69A 2LHIA 2L0PA 4BY5A 5AXIA 3JTDC 4PHNA 3BUXB 4M2PA 1UP5A 1XYDA 4P5OE 1MQ1A 3TDIA 2JT8A 2I7AA 1AK8A 3JVTC 2ISDA 2FJUB 2I2RE 3MSEB 1K93D 4AOMA 3EVRA 1E8AA 1FI6A 4WQ3A 2KAXA 4GUKA 1UHKA 1SL7A 1EJ3A 3BXKA 2KNEA 2HF5A 4YGEB 2LHLA 3LK0A 1F4OA 1TTXA 3C1VA 1TN4A 3O2PA 4GGNA 3EVVA 4TNCA 1A03A 1SL9A 1FPWA 2EHBA 3BUWB 1K95A 2PASA 3GK2A 1D1OA 4FTGA 2I94A 4ORBB 1C7VA 1UHHA 5AFPA 5HYDA 2ZRTA 2JNXA 1QS7A 1SCMC 2D8NA 5FYXA 1SK6D 2Y4QA 2F3ZA 1S26D 2F2PA 1SW8A 2LAPA 4MVFA 4MZKA 3PATA 4MZJA 2PSRA 4HREE 2LV7A 1KFUL 2M97A 4N5XA 2Q91A 2KYFA 1UHNA 1B7TZ 1C7WA 2MJWB 2ZN8A 1G4YR 1EH2A 2FCEA 2KAYA 2O60A 2M7LA 1UHIA 1XFXO 1JF2A 1EXRA 1CLMA 1L7ZA 1CFDA 1QVIZ 1Y0VH 2E6WA 1M46A 1AHRA 1NX0A 3FS7A 1WLMA 4OKHA 1B4CA 1PALA 1TCFA 1ZACA 3DVKA 4U8DA 4GGFC 1KQMB 2LNKA 1ODBA 4Q04A 1NP8A 3FIAA 2H2KA 2G2BA 4MN0A 1YR5A 1KSOA 2JQ6A 1OQPA 4YBHB 5CSJA 2JU0A 1IG5A 3LLEA 5ER4X 2JWWA 4CPVA 3OP0A 1KFXS 1MF8B 5I2QA 2OS8B 1ZUZA 1K9KA 3CR5X 3K21A 2NZ0A 4ORCB 3WNXB 1BR1B 3ZWHA 1KWOB 1BF5A 1NCYA 4YRUA 2R2IA 1XK4A 2NCOA 5KSZA 2F33A 4DUQA 2WCBA 2MRDA 2L5XB 2CBLA 1YRTB 3JTDB 1IQ3A 1TIZA 1DF0B 2OPOA 3O6BA 5HKWA 1MXLC 5DKRA 3BOWB 1CTRA 2BBMA 1RK9A 1S3PA 2JRFA 2JTTA 4XJKB 1Q80A 1OOJA 5IBWA 4N1GA 4P2YB 1BG1A 1S1EA 2GGMA 2GV5A 2H61A 2COLB 1SR6B 2HQWA 2WOSA 1SNLA 3AAJA 1GGWA 4UPGA 1NIWA 1QV1A 3VRNA 1DJWA 1JFJA 1KK7Y 1PSBA 3BYAA 3PN7C 4PE4A 2JNFA 5D7FA 4I5NB 3OX6A 4NDCA 4BY4A 1R6PA 1V1GA 2M9GA 2DOQA 1AVSA 3OB2B 4IL1A 1QIWA 4USLA 1MHOA 2LVJA 3CR4X 4ZCUA 1K90D 1BOCA 2K7CA 1JFKA 3TUYB 1JBAA 5ER5A 5I8NA 1AJ4A 1DJHA 1YUSA 3ICBA 2BCAA 3I5IC 4JWQA 1J7OA 1EG3A 2F2OA 2JXLA 1F55A 4NDDA 4N1FA 3SJSA 2ZNEA 2ZNDA 1CB1A 2CT9A 3AKBA 1WDCC 4MRXA 1GGZA 1SCVA 1CDMA 1J1DA 1Y1XA 1CFFA 1CDLA 1AUIB 2HPSA 3BUOB 1IQ5A 1DJZA 1EL4A 2KFGA 1U5IA 1XA5A 2K8MB 4GNKB 1JWDA 1XFVO 2KI6C 1Y1AA 1KK8C 3I5GB 1CMGA 4JQ0D 4AQIA 1MR8A 1SYMA 4MZLA 1MWNA 4GAOA 4PALA 3IQQA 1WRZA 4I5JA 2LC5A 2BE4A 1QXPA 1GJYA 1NX1A 1FBVA 1OMRA 2F8PA 2M1UA 2JPTA 1RECA 2LP2A 1L2OC 2BKHB 2KYCA 1SKTA 2LVVA 2OTGC 5PALA 2Y5IA 3SG2A 5JJGA 3SG3A 2LLSA 4CIDA 4ZCVA 1PVBA 3SG6A 1KK7Z 2HETA 4QJ4B 2KGBC 1A75A 3SG5A 3VRRA 4NQGA 4HSZA 1MXEA 1SMGA 4GGFA 3RM1A 2L98A 3GK4X 1KFXL 3D0YA 3NSIA 1HQVA 3EK8A 2E30A 4DCKA 5I2OA 1XVJA 2LMUA 1S6IA 1PVAA 1B9AA 2AUCA 3DVMA 3TS5C 3SIAA 2EC6C 5K89A 1CNPA 4I5KA 1QTXA 1NX3A 1NWDA 2IS9A 2L4IA 1G8IA 1G33A 1IGVA 2NCPA 2NXQA 2K7DA 4OV2A 2AMIA 4R1EA 1C07A 1F71A 2BCXA 2JZIA 2MHHA 1IWQA 4HRHA 1LKJA 1QIVA 2KHNA 4C0KA 3FWCA 1YUUA 3NSOA 2KQ6A 1CKKA 1CFPA 2BL0B 1ZMZA 1JSAA 2LVIA 1B8CA 1CDNA 1XFUO 1M39A 1B8RA 2KFHA 3NXAA 4A4BA 1WLZA 1B1GA 2PALA 4C0LA 1M45A 3CR2A 1TRFA 1S6CA 2K2AA
chains in the Genus database with same CATH superfamily
3ZNIA 2JC2A 3I5IB 5DKNA 2CXJA 1DJGA 1K96A 2RGIA 5I2LA 3TDZA 3WHTB 3IQOA 3FWBA 2MBXA 2PYQA 2M7NA 2M29A 4F7FA 2EGDA 2KI6D 3DYEA 3VGOA 1TCOB 1Y1UA 4HRGA 2ZFDA 1K8UA 1B8LA 1WRLA 2KFFA 2LP3A 2PMYA 1M31A 1YVLA 2QEOA 3CGAA 1UUSA 1X02A 1YUTA 4GBAA 3QRXA 1W9ZA 1W7IB 1H4BA 1CLLA 3NHTA 3DVEA 3BUNB 5CSFA 1K94A 2CTNA 3DD4A 2KAVA 5HL1A 3S0FA 2L2EA 1UHJA 2BE6A 3JVTB 4M2OA 2O5GA 4OVNF 1F70A 1TUZA 3VRPA 3OBVA 1TNXA 3BFHA 4YGBB 1SY9A 1S36A 4M2QA 4I5LB 4YI8A 2BKIB 2A4JA 5GQQC 1IKUA 3CZTX 2K0JA 3B87A 3IF7A 1IRJA 1L2OB 1OOHA 2WORA 2Y1MA 3A8RA 5JOLA 1IIOA 4AQJA 5I94A 2OTGB 1J7PA 1SCMB 1U5IB 2LLTA 3DF0A 2K60A 3BQ3A 3PFVA 3M0WA 1NYAA 2K61A 4L9MA 1FW4A 1TNQA 5TNCA 1OSAA 2KI4C 1CM4A 1LXFC 1MUXA 1F4QA 2BAPA 5HLVA 1DVIA 1YX7A 1QLSA 1VRKA 1W7JB 2MA2A 2QEVA 1AP4A 1IH0A 2KDHA 3R1OA 1SL8A 2QEHA 1RROA 3OHMB 4PE0A 3GK1A 2JT3A 2FOTA 2L2CA 3VRQA 4CFQA 1KQMC 2M0RA 1QASA 3CZ0A 3PM8A 4DIRA 3WHUB 3IVTA 2ZN9A 2NLNA 2EC6B 2BNXA 1OOIX 2KSPA 3OB1B 4OR9B 2CNPA 3NSLA 1J7RA 1XFYO 4NDBA 4GPLB 1SRAA 4PDZA 1ZOTB 2M1KB 2V53A 2OS8C 3EKJA 4WQ2A 2L50A 1A75B 1LS8A 1YURA 3I5HC 3SS3A 2K2FA 3O78A 1F54A 1A4PA 1KWOC 3D0YB 3GOFA 1J1EA 5D3OA 1DTLA 1WRKA 4YGAA 2WNDA 3AKAA 4MEWA 2LMVA 2SASA 3CWGA 1DMOA 1BMOA 2K7BA 2M3WA 3CLNA 4PHMA 2LUXA 1LA3A 5B8IB 1DJIA 2Y1NA 3E3RA 1IJ5A 1OE9B 1QX2A 4QJ5B 1SPYA 2L5YA 1N0YA 4JPZB 1BLQA 1FF1A 2FCDA 5HKZA 1CLBA 5CSNA 2KOTA 1UWOA 2M8UA 1S6JA 1SR6C 2BECA 2P6BB 1PULA 2F3YA 5HLOA 5BPJA 1NSHA 1K9PA 1CMFA 3I5FC 3PM2A 1QWVA 4MSPA 3WXAA 1BODA 2ZRSA 4GFTA 1NPQA 1BT6A 4CLNA 2WCMA 3A4UB 3L4AA 1DEKA 1NCZA 2M49B 3EKHA 3AAKA 2WCFA 4MBEA 3CABA 1BU3A 3SS5A 1S5GY 3NSKA 3LL8B 1NCXA 1V1FA 3R1VA 3TUYC 3RLZA 1XFWO 4D1EA 4E68A 2LUCA 4INWA 1QJTA 2MLEC 2SCPA 4YI9A 3VB1A 1PK0D 1WY9A 1YRUB 1PRWA 1ALVA 3PN7B 4YGCB 3TDUA 1DGUA 2KGRA 1NUBA 2CCMA 3SIBA 2KBIA 5EL2A 1PSRA 2VRGA 1N2DA 1QX5B 3PSRA 3EK4A 2GGZA 1IJ6A 1RFJA 1TOPA 3LK1A 1KCYA 1YTZC 1CDPA 1TWOA 2G9BA 3D77A 1ZFSA 4FQOA 4PHKA 4PE7A 2KI4B 1HT9A 3VROA 2AAOA 1GQMA 3D75A 3KPXA 1TNWA 1KQVA 1TNPA 3S0BA 2KBMA 4JD9A 4OCIA 3UNWA 4DS7A 1EG4A 3DXLA 3I5GC 4CFRA 3TZ1A 1JC2A 1M63B 4A4CA 2WC5A 3EG5B 2TN4A 1WDCB 4PE1A 5CPVA 1CFCA 4PT1A 2HQ8A 1XFZO 1JUOA 4XYNA 1DT7B 3KO0A 3DF0B 3O4YA 1J7QA 1KFUS 2JT0A 1XO5A 1DJXA 3LCPC 3D74A 1LVCD 1DJYA 1SBJA 2ZKMX 1OZSA 1ALWA 1KK8B 3H4SE 2P70A 2JXCA 2WC6A 2KQYA 4WRIA 1K2HA 4QJ3B 5CSIA 1Z2CB 3I5HB 3FE8A 2LANA 1Y6WA 3CS1A 5AANA 1RJVA 2I18A 4F0ZB 1QX7A 4C0JA 5F6TA 4INXA 2MAZA 3KHEA 1JF0A 1QV0A 1A29A 2LMTA 2LM5A 2WCEA 1LA0A 2WCHA 1QATA 1AJ5A 1S5GZ 1FI5A 4ORAB 1NX2A 1R2UA 1BJFA 1OOFA 2PRUA 4MRYA 1LINA 5DKQA 2L4HA 2JOJA 1J55A 4ICBA 2LCPA 4ETOA 5AERA 4DRWA 4PHJA 1RTP1 1YX8A 2B1UA 2JTZA 3I5FB 2WCKA 3CTNA 1XK4C 5FI2A 1H8BA 5J3XA 2MLFC 5G08A 5AEQA 2WC8A 2JULA 1OZOA 3FE6A 2LVKA 1BR4B 1KSMA 4MLWA 1B7TY 1P28A 2BL0C 2PVBA 5DICA 3PALA 3S0EA 3F45A 3SG7A 3SG4A 1RWYA 2K7OA 2LLUA 2BCBA 2Q4UA 3EVUA 1A2XA 1B47A 1DF0A 4PCWA 2BBNA 1C3ZA 1N65A 3EK7A 5HKYA 1OMVA 1CM1A 2QPTA 4YGDB 3CDNA 3BOWA 3L47A 1K9UA 4XJKA 1QLKA 3BFBA 3D10A 1YVHA 1OMDA 1QVIY 1UURA 2H61C 2QACA 3DVJA 3S0DA 5KTYA 1F8HA 2KLDA 2LE9B 2L51A 1DGVA 3OX5A 3HCMA 3KF9A 3BUMB 3PLFB 2FJYA 5KU1A 3KEVA 5D69A 2LHIA 3HX4A 2L0PA 1T14A 4BY5A 5AXIA 3JTDC 1OW4A 4PHNA 3BUXB 3R1PA 4M2PA 1UP5A 1XYDA 2WCJA 4P5OE 1MQ1A 3TDIA 2JT8A 3PJIA 2QEBA 2I7AA 3TS5B 1AK8A 3JVTC 2ISDA 2FJUB 2I2RE 3MSEB 1K93D 4AOMA 3EVRA 1E8AA 1FI6A 4WQ3A 2KAXA 4GUKA 1UHKA 1SL7A 1EJ3A 3BXKA 2KNEA 2HF5A 4YGEB 2LHLA 3LK0A 1F4OA 1TTXA 3C1VA 1TN4A 3O2PA 4GGNA 3EVVA 4TNCA 1A03A 1SL9A 1FPWA 3QMEA 2EHBA 3BUWB 1K95A 2PASA 3GK2A 1D1OA 4FTGA 2I94A 4ORBB 1C7VA 1UHHA 5AFPA 5HYDA 2ZRTA 2JNXA 1QS7A 1SCMC 2D8NA 5FYXA 1SK6D 2Y4QA 2F3ZA 1S26D 2F2PA 1SW8A 2LAPA 4MVFA 4MZKA 3PATA 4MZJA 2PSRA 4HREE 2LV7A 1KFUL 2M97A 4N5XA 2Q91A 3B88A 2KYFA 1UHNA 1B7TZ 1C7WA 2MJWB 2ZN8A 1G4YR 1EH2A 3V2LA 2FCEA 2KAYA 2O60A 2M7LA 1UHIA 1XFXO 1JF2A 1TUJA 1EXRA 1CLMA 1L7ZA 2P71A 1CFDA 2WCLA 1QVIZ 1Y0VH 2E6WA 3D76A 3BJHA 1M46A 1AHRA 1NX0A 2ERBA 2QDIA 3FS7A 1WLMA 4OKHA 1B4CA 1PALA 1TCFA 1C3YA 1ZACA 3DVKA 4U8DA 4GGFC 1KQMB 2LNKA 1ODBA 4Q04A 1NP8A 3FIAA 2H2KA 2G2BA 4MN0A 1YR5A 1KSOA 2JQ6A 1OQPA 4YBHB 5CSJA 2JU0A 1IG5A 3LLEA 5ER4X 2JWWA 4CPVA 3OP0A 1KFXS 1MF8B 5I2QA 2OS8B 1ZUZA 1K9KA 3CR5X 3K21A 2GTEA 2NZ0A 4ORCB 3WNXB 1BR1B 3ZWHA 5FI6A 1KWOB 3K1EA 3NHIA 1NCYA 2PQLA 1BF5A 4YRUA 2R2IA 1XK4A 3CZ1A 4JKTA 2NCOA 5KSZA 2F33A 4DUQA 2WCBA 2MRDA 2L5XB 3CZ2A 2CBLA 1YRTB 3JTDB 1IQ3A 1TIZA 1DF0B 2OPOA 3O6BA 5HKWA 1MXLC 5DKRA 3BOWB 3R72A 1CTRA 2BBMA 1RK9A 1S3PA 2JRFA 2JTTA 4XJKB 1Q80A 1DQEA 1OOJA 5IBWA 4N1GA 4P2YB 1BG1A 1S1EA 2GGMA 2GV5A 2H61A 1SR6B 2COLB 2HQWA 2WOSA 1SNLA 3AAJA 1GGWA 4UPGA 3B6XA 1NIWA 1QV1A 3FE9A 3VRNA 1DJWA 1OOGA 1KK7Y 3Q8IA 1JFJA 1PSBA 3BYAA 3PN7C 4PE4A 2JNFA 5D7FA 4I5NB 3OX6A 4NDCA 4BY4A 1DELA 1R6PA 1V1GA 2M9GA 2DOQA 1AVSA 3OB2B 3L4LA 1QIWA 4IL1A 4USLA 1MHOA 2LVJA 3CR4X 4FQTA 4ZCUA 1K90D 3UO9A 1BOCA 2K7CA 1JFKA 3TUYB 1JBAA 2KLEA 1SSEB 5ER5A 5I8NA 1AJ4A 1DJHA 1YUSA 3ICBA 2BCAA 3I5IC 4JWQA 1J7OA 1EG3A 2F2OA 2JXLA 4OZDA 1F55A 4NDDA 4N1FA 3SJSA 2ZNEA 2ZNDA 1CB1A 2CT9A 3AKBA 1WDCC 4MRXA 1GGZA 1SCVA 1CDMA 1J1DA 1Y1XA 1CFFA 1CDLA 1AUIB 2HPSA 3BUOB 1IQ5A 1DJZA 3B86A 1GM0A 1EL4A 2KFGA 1U5IA 1XA5A 2JPOA 2K8MB 4GNKB 1JWDA 3OGNA 3RZSA 1XFVO 2KI6C 3O4XA 1Y1AA 1KK8C 3I5GB 1CMGA 2YGUA 4JQ0D 4AQIA 1Z4HA 1MR8A 1SYMA 4MZLA 1MWNA 4GAOA 4PALA 3IQQA 1WRZA 4KYNA 4I5JA 2LC5A 2BE4A 1QXPA 1GJYA 1NX1A 1FBVA 1OMRA 2F8PA 2KPHA 2M1UA 2JPTA 1RECA 1DC1A 2LP2A 1L2OC 2BKHB 2KYCA 3D73A 1SKTA 2LVVA 2OTGC 3BFAA 5PALA 2Y5IA 3SG2A 5JJGA 3CYZA 3SG3A 3NGVA 2LLSA 4CIDA 4ZCVA 1PVBA 1ORGA 1KK7Z 3SG6A 2HETA 4QJ4B 2KGBC 1A75A 3SG5A 3VRRA 1XFRA 4NQGA 4HSZA 1MXEA 1SMGA 4GGFA 3RM1A 2L98A 3GK4X 1KFXL 3D0YA 3NSIA 1HQVA 3DZTA 4IJ7A 3EK8A 2E30A 4DCKA 5I2OA 1XVJA 2LMUA 1S6IA 1PVAA 1B9AA 2AUCA 3DVMA 3TS5C 3SIAA 2EC6C 5K89A 3D78A 3S0AA 4I5KA 1CNPA 1QTXA 1NX3A 1NWDA 2IS9A 2L4IA 3SS4A 3N7HA 1G8IA 3B7AA 1G33A 1IGVA 2NCPA 2NXQA 2K7DA 4OV2A 2AMIA 4R1EA 1C07A 1F71A 2BCXA 2JZIA 2MHHA 1IWQA 4HRHA 1LKJA 1QIVA 2KHNA 4C0KA 3FWCA 1YUUA 3NSOA 2KQ6A 1CKKA 1CFPA 2BL0B 1ZMZA 1JSAA 2LVIA 1B8CA 1CDNA 1XFUO 1M39A 1B8RA 2KFHA 3NXAA 4A4BA 1WLZA 1B1GA 2PALA 4C0LA 1M45A 2H8VA 5FI7A 3CR2A 3S0GA 1TRFA 1S6CA 2K2AA 3DY9A
chains in the Genus database with same CATH topology
3ZNIA 2JC2A 3I5IB 5DKNA 2CXJA 1DJGA 1K96A 2RGIA 5I2LA 3TDZA 3WHTB 3IQOA 3FWBA 2MBXA 2M7NA 2M29A 2EGDA 2KI6D 3VGOA 1TCOB 1Y1UA 4HRGA 2ZFDA 1K8UA 1B8LA 1WRLA 2KFFA 2LP3A 2PMYA 1M31A 1YVLA 3CGAA 1UUSA 1X02A 1YUTA 4GBAA 3QRXA 1H4BA 1W7IB 1CLLA 3DVEA 3BUNB 5CSFA 1K94A 2CTNA 3DD4A 2KAVA 2L2EA 1UHJA 2BE6A 3JVTB 4M2OA 2O5GA 4OVNF 1F70A 3VRPA 1TNXA 4YGBB 1SY9A 1S36A 4M2QA 4I5LB 4YI8A 2BKIB 2A4JA 5GQQC 1IKUA 3CZTX 2K0JA 3IF7A 1IRJA 1L2OB 3A8RA 2WORA 2Y1MA 5JOLA 4AQJA 2OTGB 1J7PA 1SCMB 1U5IB 2LLTA 3DF0A 3BQ3A 3PFVA 3M0WA 1NYAA 2K61A 4L9MA 1FW4A 1TNQA 5TNCA 1OSAA 2KI4C 1CM4A 1LXFC 1MUXA 1F4QA 5HLVA 1DVIA 1YX7A 1QLSA 1VRKA 1W7JB 2MA2A 1AP4A 1IH0A 2KDHA 1SL8A 1RROA 3OHMB 4PE0A 3GK1A 2JT3A 2FOTA 3VRQA 4CFQA 1KQMC 2M0RA 1QASA 3PM8A 4DIRA 3WHUB 2ZN9A 2NLNA 2EC6B 2KSPA 3OB1B 4OR9B 2CNPA 3NSLA 1J7RA 1XFYO 4NDBA 4GPLB 1SRAA 4PDZA 1ZOTB 2M1KB 2V53A 2OS8C 3EKJA 4WQ2A 2L50A 1A75B 1YURA 3I5HC 2K2FA 3O78A 1F54A 1A4PA 1KWOC 3D0YB 3GOFA 1J1EA 1DTLA 1WRKA 4YGAA 2WNDA 3AKAA 4MEWA 2LMVA 2SASA 3CWGA 1DMOA 1BMOA 2K7BA 2M3WA 3CLNA 4PHMA 2LUXA 1LA3A 5B8IB 1DJIA 2Y1NA 3E3RA 1IJ5A 1OE9B 1QX2A 4QJ5B 1SPYA 1N0YA 4JPZB 1BLQA 1FF1A 2FCDA 5HKZA 1CLBA 5CSNA 2KOTA 1UWOA 2M8UA 1S6JA 1SR6C 2BECA 2P6BB 1PULA 2F3YA 5HLOA 5BPJA 1NSHA 1K9PA 1CMFA 3I5FC 4MSPA 3WXAA 1BODA 2ZRSA 4GFTA 1NPQA 1BT6A 4CLNA 3A4UB 1NCZA 2M49B 3EKHA 3AAKA 2WCFA 4MBEA 1BU3A 1S5GY 3NSKA 3LL8B 1NCXA 1V1FA 3TUYC 3RLZA 1XFWO 4D1EA 4E68A 2LUCA 4YI9A 1QJTA 2MLEC 2SCPA 1PK0D 1WY9A 1YRUB 1PRWA 1ALVA 3PN7B 4YGCB 3TDUA 1DGUA 2KGRA 1NUBA 2CCMA 3SIBA 2KBIA 1PSRA 2VRGA 1N2DA 1QX5B 3PSRA 3EK4A 2GGZA 1IJ6A 1RFJA 1TOPA 3LK1A 1KCYA 1YTZC 1CDPA 2G9BA 4FQOA 1ZFSA 4PHKA 4PE7A 2KI4B 1HT9A 3VROA 2AAOA 1GQMA 3KPXA 1KQVA 1TNWA 1TNPA 2KBMA 4OCIA 4DS7A 1EG4A 3I5GC 4CFRA 3TZ1A 1JC2A 1M63B 4A4CA 5CPVA 2TN4A 1WDCB 4PE1A 1CFCA 2HQ8A 1XFZO 1JUOA 4XYNA 1DT7B 3KO0A 3DF0B 3O4YA 1J7QA 1KFUS 2JT0A 1XO5A 1DJXA 3LCPC 1LVCD 1DJYA 1SBJA 2ZKMX 1OZSA 1ALWA 1KK8B 3H4SE 2JXCA 1K2HA 2KQYA 4WRIA 4QJ3B 5CSIA 3I5HB 2LANA 1Y6WA 3CS1A 5AANA 1RJVA 2I18A 4F0ZB 1QX7A 4C0JA 5F6TA 2MAZA 3KHEA 1JF0A 1QV0A 1A29A 2LMTA 2LM5A 2WCEA 1LA0A 1QATA 1AJ5A 1S5GZ 1FI5A 4ORAB 1NX2A 1R2UA 1BJFA 2PRUA 4MRYA 1LINA 5DKQA 2L4HA 2JOJA 1J55A 4ICBA 2LCPA 4ETOA 5AERA 4DRWA 4PHJA 1RTP1 1YX8A 2B1UA 2JTZA 3I5FB 3CTNA 1XK4C 1H8BA 5J3XA 2MLFC 5G08A 5AEQA 2WC8A 2JULA 1OZOA 2LVKA 1BR4B 1KSMA 4MLWA 1B7TY 2BL0C 3SG7A 2PVBA 3TS5B 3PALA 3F45A 3SG4A 1RWYA 2K7OA 2LLUA 2BCBA 2Q4UA 3EVUA 1A2XA 1B47A 1DF0A 4PCWA 2BBNA 1N65A 5HKYA 3EK7A 1OMVA 1CM1A 2QPTA 4YGDB 3BOWA 1K9UA 4XJKA 1QLKA 3HX4A 3D10A 1YVHA 1OMDA 1QVIY 1UURA 2H61C 2QACA 3DVJA 5KTYA 1F8HA 2LE9B 2L51A 1DGVA 3OX5A 3HCMA 3KF9A 3BUMB 3PLFB 5KU1A 3KEVA 5D69A 2LHIA 2L0PA 4BY5A 5AXIA 3JTDC 4PHNA 3BUXB 4M2PA 1UP5A 1XYDA 4P5OE 1MQ1A 3TDIA 2JT8A 2I7AA 1AK8A 3JVTC 2ISDA 2FJUB 2I2RE 3MSEB 1K93D 4AOMA 3EVRA 1E8AA 1FI6A 4WQ3A 2KAXA 4GUKA 1UHKA 1SL7A 1EJ3A 3BXKA 2KNEA 2HF5A 4YGEB 2LHLA 3LK0A 1F4OA 1TTXA 3C1VA 1TN4A 3O2PA 4GGNA 3EVVA 4TNCA 1A03A 1SL9A 1FPWA 2EHBA 3BUWB 1K95A 2PASA 3GK2A 1D1OA 4FTGA 2I94A 4ORBB 1C7VA 1UHHA 5AFPA 5HYDA 2ZRTA 2JNXA 1QS7A 1SCMC 2D8NA 5FYXA 1SK6D 2Y4QA 2F3ZA 1S26D 2F2PA 1SW8A 2LAPA 4MVFA 4MZKA 3PATA 4MZJA 2PSRA 4HREE 2LV7A 1KFUL 2M97A 4N5XA 2Q91A 2KYFA 1UHNA 1B7TZ 1C7WA 2MJWB 2ZN8A 1G4YR 1EH2A 2FCEA 2KAYA 2O60A 2M7LA 1UHIA 1XFXO 1JF2A 1EXRA 1CLMA 1L7ZA 1CFDA 1QVIZ 1Y0VH 2E6WA 1M46A 1AHRA 1NX0A 3FS7A 1WLMA 4OKHA 1B4CA 1PALA 1TCFA 1ZACA 3DVKA 4U8DA 4GGFC 1KQMB 2LNKA 1ODBA 4Q04A 1NP8A 3FIAA 2H2KA 2G2BA 4MN0A 1YR5A 1KSOA 2JQ6A 1OQPA 4YBHB 5CSJA 2JU0A 1IG5A 3LLEA 5ER4X 2JWWA 4CPVA 3OP0A 1KFXS 1MF8B 5I2QA 2OS8B 1ZUZA 1K9KA 3CR5X 3K21A 2NZ0A 4ORCB 3WNXB 1BR1B 3ZWHA 1KWOB 1BF5A 1NCYA 4YRUA 2R2IA 1XK4A 2NCOA 5KSZA 2F33A 4DUQA 2WCBA 2MRDA 2L5XB 2CBLA 1YRTB 3JTDB 1IQ3A 1TIZA 1DF0B 2OPOA 3O6BA 5HKWA 1MXLC 5DKRA 3BOWB 1CTRA 2BBMA 1RK9A 1S3PA 2JRFA 2JTTA 4XJKB 1Q80A 1OOJA 5IBWA 4N1GA 4P2YB 1BG1A 1S1EA 2GGMA 2GV5A 2H61A 2COLB 1SR6B 2HQWA 2WOSA 1SNLA 3AAJA 1GGWA 4UPGA 1NIWA 1QV1A 3VRNA 1DJWA 1JFJA 1KK7Y 1PSBA 3BYAA 3PN7C 4PE4A 2JNFA 5D7FA 4I5NB 3OX6A 4NDCA 4BY4A 1R6PA 1V1GA 2M9GA 2DOQA 1AVSA 3OB2B 4IL1A 1QIWA 4USLA 1MHOA 2LVJA 3CR4X 4ZCUA 1K90D 1BOCA 2K7CA 1JFKA 3TUYB 1JBAA 5ER5A 5I8NA 1AJ4A 1DJHA 1YUSA 3ICBA 2BCAA 3I5IC 4JWQA 1J7OA 1EG3A 2F2OA 2JXLA 1F55A 4NDDA 4N1FA 3SJSA 2ZNEA 2ZNDA 1CB1A 2CT9A 3AKBA 1WDCC 4MRXA 1GGZA 1SCVA 1CDMA 1J1DA 1Y1XA 1CFFA 1CDLA 1AUIB 2HPSA 3BUOB 1IQ5A 1DJZA 1EL4A 2KFGA 1U5IA 1XA5A 2K8MB 4GNKB 1JWDA 1XFVO 2KI6C 1Y1AA 1KK8C 3I5GB 1CMGA 4JQ0D 4AQIA 1MR8A 1SYMA 4MZLA 1MWNA 4GAOA 4PALA 3IQQA 1WRZA 4I5JA 2LC5A 2BE4A 1QXPA 1GJYA 1NX1A 1FBVA 1OMRA 2F8PA 2M1UA 2JPTA 1RECA 2LP2A 1L2OC 2BKHB 2KYCA 1SKTA 2LVVA 2OTGC 5PALA 2Y5IA 3SG2A 5JJGA 3SG3A 2LLSA 4CIDA 4ZCVA 1PVBA 3SG6A 1KK7Z 2HETA 4QJ4B 2KGBC 1A75A 3SG5A 3VRRA 4NQGA 4HSZA 1MXEA 1SMGA 4GGFA 3RM1A 2L98A 3GK4X 1KFXL 3D0YA 3NSIA 1HQVA 3EK8A 2E30A 4DCKA 5I2OA 1XVJA 2LMUA 1S6IA 1PVAA 1B9AA 2AUCA 3DVMA 3TS5C 3SIAA 2EC6C 5K89A 1CNPA 4I5KA 1QTXA 1NX3A 1NWDA 2IS9A 2L4IA 1G8IA 1G33A 1IGVA 2NCPA 2NXQA 2K7DA 4OV2A 2AMIA 4R1EA 1C07A 1F71A 2BCXA 2JZIA 2MHHA 1IWQA 4HRHA 1LKJA 1QIVA 2KHNA 4C0KA 3FWCA 1YUUA 3NSOA 2KQ6A 1CKKA 1CFPA 2BL0B 1ZMZA 1JSAA 2LVIA 1B8CA 1CDNA 1XFUO 1M39A 1B8RA 2KFHA 3NXAA 4A4BA 1WLZA 1B1GA 2PALA 4C0LA 1M45A 3CR2A 1TRFA 1S6CA 2K2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZNI A;  2JC2 A;  3I5I B;  5DKN A;  2CXJ A;  1DJG A;  1K96 A;  2RGI A;  5I2L A;  3TDZ A;  3WHT B;  3IQO A;  3FWB A;  2MBX A;  2M7N A;  2M29 A;  2EGD A;  2KI6 D;  3VGO A;  1TCO B;  1Y1U A;  4HRG A;  2ZFD A;  1K8U A;  1B8L A;  1WRL A;  2KFF A;  2LP3 A;  2PMY A;  1M31 A;  1YVL A;  3CGA A;  1UUS A;  1X02 A;  1YUT A;  4GBA A;  3QRX A;  1H4B A;  1W7I B;  1CLL A;  3DVE A;  3BUN B;  5CSF A;  1K94 A;  2CTN A;  3DD4 A;  2KAV A;  2L2E A;  1UHJ A;  2BE6 A;  3JVT B;  4M2O A;  2O5G A;  4OVN F;  1F70 A;  3VRP A;  1TNX A;  4YGB B;  1SY9 A;  1S36 A;  4M2Q A;  4I5L B;  4YI8 A;  2BKI B;  2A4J A;  5GQQ C;  1IKU A;  3CZT X;  2K0J A;  3IF7 A;  1IRJ A;  1L2O B;  3A8R A;  2WOR A;  2Y1M A;  5JOL A;  4AQJ A;  2OTG B;  1J7P A;  1SCM B;  1U5I B;  2LLT A;  3DF0 A;  3BQ3 A;  3PFV A;  3M0W A;  1NYA A;  2K61 A;  4L9M A;  1FW4 A;  1TNQ A;  5TNC A;  1OSA A;  2KI4 C;  1CM4 A;  1LXF C;  1MUX A;  1F4Q A;  5HLV A;  1DVI A;  1YX7 A;  1QLS A;  1VRK A;  1W7J B;  2MA2 A;  1AP4 A;  1IH0 A;  2KDH A;  1SL8 A;  1RRO A;  3OHM B;  4PE0 A;  3GK1 A;  2JT3 A;  2FOT A;  3VRQ A;  4CFQ A;  1KQM C;  2M0R A;  1QAS A;  3PM8 A;  4DIR A;  3WHU B;  2ZN9 A;  2NLN A;  2EC6 B;  2KSP A;  3OB1 B;  4OR9 B;  2CNP A;  3NSL A;  1J7R A;  1XFY O;  4NDB A;  4GPL B;  1SRA A;  4PDZ A;  1ZOT B;  2M1K B;  2V53 A;  2OS8 C;  3EKJ A;  4WQ2 A;  2L50 A;  1A75 B;  1YUR A;  3I5H C;  2K2F A;  3O78 A;  1F54 A;  1A4P A;  1KWO C;  3D0Y B;  3GOF A;  1J1E A;  1DTL A;  1WRK A;  4YGA A;  2WND A;  3AKA A;  4MEW A;  2LMV A;  2SAS A;  3CWG A;  1DMO A;  1BMO A;  2K7B A;  2M3W A;  3CLN A;  4PHM A;  2LUX A;  1LA3 A;  5B8I B;  1DJI A;  2Y1N A;  3E3R A;  1IJ5 A;  1OE9 B;  1QX2 A;  4QJ5 B;  1SPY A;  1N0Y A;  4JPZ B;  1BLQ A;  1FF1 A;  2FCD A;  5HKZ A;  1CLB A;  5CSN A;  2KOT A;  1UWO A;  2M8U A;  1S6J A;  1SR6 C;  2BEC A;  2P6B B;  1PUL A;  2F3Y A;  5HLO A;  5BPJ A;  1NSH A;  1K9P A;  1CMF A;  3I5F C;  4MSP A;  3WXA A;  1BOD A;  2ZRS A;  4GFT A;  1NPQ A;  1BT6 A;  4CLN A;  3A4U B;  1NCZ A;  2M49 B;  3EKH A;  3AAK A;  2WCF A;  4MBE A;  1BU3 A;  1S5G Y;  3NSK A;  3LL8 B;  1NCX A;  1V1F A;  3TUY C;  3RLZ A;  1XFW O;  4D1E A;  4E68 A;  2LUC A;  4YI9 A;  1QJT A;  2MLE C;  2SCP A;  1PK0 D;  1WY9 A;  1YRU B;  1PRW A;  1ALV A;  3PN7 B;  4YGC B;  3TDU A;  1DGU A;  2KGR A;  1NUB A;  2CCM A;  3SIB A;  2KBI A;  1PSR A;  2VRG A;  1N2D A;  1QX5 B;  3PSR A;  3EK4 A;  2GGZ A;  1IJ6 A;  1RFJ A;  1TOP A;  3LK1 A;  1KCY A;  1YTZ C;  1CDP A;  2G9B A;  4FQO A;  1ZFS A;  4PHK A;  4PE7 A;  2KI4 B;  1HT9 A;  3VRO A;  2AAO A;  1GQM A;  3KPX A;  1KQV A;  1TNW A;  1TNP A;  2KBM A;  4OCI A;  4DS7 A;  1EG4 A;  3I5G C;  4CFR A;  3TZ1 A;  1JC2 A;  1M63 B;  4A4C A;  5CPV A;  2TN4 A;  1WDC B;  4PE1 A;  1CFC A;  2HQ8 A;  1XFZ O;  1JUO A;  4XYN A;  1DT7 B;  3KO0 A;  3DF0 B;  3O4Y A;  1J7Q A;  1KFU S;  2JT0 A;  1XO5 A;  1DJX A;  3LCP C;  1LVC D;  1DJY A;  1SBJ A;  2ZKM X;  1OZS A;  1ALW A;  1KK8 B;  3H4S E;  2JXC A;  1K2H A;  2KQY A;  4WRI A;  4QJ3 B;  5CSI A;  3I5H B;  2LAN A;  1Y6W A;  3CS1 A;  5AAN A;  1RJV A;  2I18 A;  4F0Z B;  1QX7 A;  4C0J A;  5F6T A;  2MAZ A;  3KHE A;  1JF0 A;  1QV0 A;  1A29 A;  2LMT A;  2LM5 A;  2WCE A;  1LA0 A;  1QAT A;  1AJ5 A;  1S5G Z;  1FI5 A;  4ORA B;  1NX2 A;  1R2U A;  1BJF A;  2PRU A;  4MRY A;  1LIN A;  5DKQ A;  2L4H A;  2JOJ A;  1J55 A;  4ICB A;  2LCP A;  4ETO A;  5AER A;  4DRW A;  4PHJ A;  1RTP 1;  1YX8 A;  2B1U A;  2JTZ A;  3I5F B;  3CTN A;  1XK4 C;  1H8B A;  5J3X A;  2MLF C;  5G08 A;  5AEQ A;  2WC8 A;  2JUL A;  1OZO A;  2LVK A;  1BR4 B;  1KSM A;  4MLW A;  1B7T Y;  2BL0 C;  3SG7 A;  2PVB A;  3TS5 B;  3PAL A;  3F45 A;  3SG4 A;  1RWY A;  2K7O A;  2LLU A;  2BCB A;  2Q4U A;  3EVU A;  1A2X A;  1B47 A;  1DF0 A;  4PCW A;  2BBN A;  1N65 A;  5HKY A;  3EK7 A;  1OMV A;  1CM1 A;  2QPT A;  4YGD B;  3BOW A;  1K9U A;  4XJK A;  1QLK A;  3HX4 A;  3D10 A;  1YVH A;  1OMD A;  1QVI Y;  1UUR A;  2H61 C;  2QAC A;  3DVJ A;  5KTY A;  1F8H A;  2LE9 B;  2L51 A;  1DGV A;  3OX5 A;  3HCM A;  3KF9 A;  3BUM B;  3PLF B;  5KU1 A;  3KEV A;  5D69 A;  2LHI A;  2L0P A;  4BY5 A;  5AXI A;  3JTD C;  4PHN A;  3BUX B;  4M2P A;  1UP5 A;  1XYD A;  4P5O E;  1MQ1 A;  3TDI A;  2JT8 A;  2I7A A;  1AK8 A;  3JVT C;  2ISD A;  2FJU B;  2I2R E;  3MSE B;  1K93 D;  4AOM A;  3EVR A;  1E8A A;  1FI6 A;  4WQ3 A;  2KAX A;  4GUK A;  1UHK A;  1SL7 A;  1EJ3 A;  3BXK A;  2KNE A;  2HF5 A;  4YGE B;  2LHL A;  3LK0 A;  1F4O A;  1TTX A;  3C1V A;  1TN4 A;  3O2P A;  4GGN A;  3EVV A;  4TNC A;  1A03 A;  1SL9 A;  1FPW A;  2EHB A;  3BUW B;  1K95 A;  2PAS A;  3GK2 A;  1D1O A;  4FTG A;  2I94 A;  4ORB B;  1C7V A;  1UHH A;  5AFP A;  5HYD A;  2ZRT A;  2JNX A;  1QS7 A;  1SCM C;  2D8N A;  5FYX A;  1SK6 D;  2Y4Q A;  2F3Z A;  1S26 D;  2F2P A;  1SW8 A;  2LAP A;  4MVF A;  4MZK A;  3PAT A;  4MZJ A;  2PSR A;  4HRE E;  2LV7 A;  1KFU L;  2M97 A;  4N5X A;  2Q91 A;  2KYF A;  1UHN A;  1B7T Z;  1C7W A;  2MJW B;  2ZN8 A;  1G4Y R;  1EH2 A;  2FCE A;  2KAY A;  2O60 A;  2M7L A;  1UHI A;  1XFX O;  1JF2 A;  1EXR A;  1CLM A;  1L7Z A;  1CFD A;  1QVI Z;  1Y0V H;  2E6W A;  1M46 A;  1AHR A;  1NX0 A;  3FS7 A;  1WLM A;  4OKH A;  1B4C A;  1PAL A;  1TCF A;  1ZAC A;  3DVK A;  4U8D A;  4GGF C;  1KQM B;  2LNK A;  1ODB A;  4Q04 A;  1NP8 A;  3FIA A;  2H2K A;  2G2B A;  4MN0 A;  1YR5 A;  1KSO A;  2JQ6 A;  1OQP A;  4YBH B;  5CSJ A;  2JU0 A;  1IG5 A;  3LLE A;  5ER4 X;  2JWW A;  4CPV A;  3OP0 A;  1KFX S;  1MF8 B;  5I2Q A;  2OS8 B;  1ZUZ A;  1K9K A;  3CR5 X;  3K21 A;  2NZ0 A;  4ORC B;  3WNX B;  1BR1 B;  3ZWH A;  1KWO B;  1BF5 A;  1NCY A;  4YRU A;  2R2I A;  1XK4 A;  2NCO A;  5KSZ A;  2F33 A;  4DUQ A;  2WCB A;  2MRD A;  2L5X B;  2CBL A;  1YRT B;  3JTD B;  1IQ3 A;  1TIZ A;  1DF0 B;  2OPO A;  3O6B A;  5HKW A;  1MXL C;  5DKR A;  3BOW B;  1CTR A;  2BBM A;  1RK9 A;  1S3P A;  2JRF A;  2JTT A;  4XJK B;  1Q80 A;  1OOJ A;  5IBW A;  4N1G A;  4P2Y B;  1BG1 A;  1S1E A;  2GGM A;  2GV5 A;  2H61 A;  2COL B;  1SR6 B;  2HQW A;  2WOS A;  1SNL A;  3AAJ A;  1GGW A;  4UPG A;  1NIW A;  1QV1 A;  3VRN A;  1DJW A;  1JFJ A;  1KK7 Y;  1PSB A;  3BYA A;  3PN7 C;  4PE4 A;  2JNF A;  5D7F A;  4I5N B;  3OX6 A;  4NDC A;  4BY4 A;  1R6P A;  1V1G A;  2M9G A;  2DOQ A;  1AVS A;  3OB2 B;  4IL1 A;  1QIW A;  4USL A;  1MHO A;  2LVJ A;  3CR4 X;  4ZCU A;  1K90 D;  1BOC A;  2K7C A;  1JFK A;  3TUY B;  1JBA A;  5ER5 A;  5I8N A;  1AJ4 A;  1DJH A;  1YUS A;  3ICB A;  2BCA A;  3I5I C;  4JWQ A;  1J7O A;  1EG3 A;  2F2O A;  2JXL A;  1F55 A;  4NDD A;  4N1F A;  3SJS A;  2ZNE A;  2ZND A;  1CB1 A;  2CT9 A;  3AKB A;  1WDC C;  4MRX A;  1GGZ A;  1SCV A;  1CDM A;  1J1D A;  1Y1X A;  1CFF A;  1CDL A;  1AUI B;  2HPS A;  3BUO B;  1IQ5 A;  1DJZ A;  1EL4 A;  2KFG A;  1U5I A;  1XA5 A;  2K8M B;  4GNK B;  1JWD A;  1XFV O;  2KI6 C;  1Y1A A;  1KK8 C;  3I5G B;  1CMG A;  4JQ0 D;  4AQI A;  1MR8 A;  1SYM A;  4MZL A;  1MWN A;  4GAO A;  4PAL A;  3IQQ A;  1WRZ A;  4I5J A;  2LC5 A;  2BE4 A;  1QXP A;  1GJY A;  1NX1 A;  1FBV A;  1OMR A;  2F8P A;  2M1U A;  2JPT A;  1REC A;  2LP2 A;  1L2O C;  2BKH B;  2KYC A;  1SKT A;  2LVV A;  2OTG C;  5PAL A;  2Y5I A;  3SG2 A;  5JJG A;  3SG3 A;  2LLS A;  4CID A;  4ZCV A;  1PVB A;  3SG6 A;  1KK7 Z;  2HET A;  4QJ4 B;  2KGB C;  1A75 A;  3SG5 A;  3VRR A;  4NQG A;  4HSZ A;  1MXE A;  1SMG A;  4GGF A;  3RM1 A;  2L98 A;  3GK4 X;  1KFX L;  3D0Y A;  3NSI A;  1HQV A;  3EK8 A;  2E30 A;  4DCK A;  5I2O A;  1XVJ A;  2LMU A;  1S6I A;  1PVA A;  1B9A A;  2AUC A;  3DVM A;  3TS5 C;  3SIA A;  2EC6 C;  5K89 A;  1CNP A;  4I5K A;  1QTX A;  1NX3 A;  1NWD A;  2IS9 A;  2L4I A;  1G8I A;  1G33 A;  1IGV A;  2NCP A;  2NXQ A;  2K7D A;  4OV2 A;  2AMI A;  4R1E A;  1C07 A;  1F71 A;  2BCX A;  2JZI A;  2MHH A;  1IWQ A;  4HRH A;  1LKJ A;  1QIV A;  2KHN A;  4C0K A;  3FWC A;  1YUU A;  3NSO A;  2KQ6 A;  1CKK A;  1CFP A;  2BL0 B;  1ZMZ A;  1JSA A;  2LVI A;  1B8C A;  1CDN A;  1XFU O;  1M39 A;  1B8R A;  2KFH A;  3NXA A;  4A4B A;  1WLZ A;  1B1G A;  2PAL A;  4C0L A;  1M45 A;  3CR2 A;  1TRF A;  1S6C A;  2K2A A; 
#chains in the Genus database with same CATH topology
 3ZNI A;  2JC2 A;  3I5I B;  5DKN A;  2CXJ A;  1DJG A;  1K96 A;  2RGI A;  5I2L A;  3TDZ A;  3WHT B;  3IQO A;  3FWB A;  2MBX A;  2PYQ A;  2M7N A;  2M29 A;  4F7F A;  2EGD A;  2KI6 D;  3DYE A;  3VGO A;  1TCO B;  1Y1U A;  4HRG A;  2ZFD A;  1K8U A;  1B8L A;  1WRL A;  2KFF A;  2LP3 A;  2PMY A;  1M31 A;  1YVL A;  2QEO A;  3CGA A;  1UUS A;  1X02 A;  1YUT A;  4GBA A;  3QRX A;  1W9Z A;  1W7I B;  1H4B A;  1CLL A;  3NHT A;  3DVE A;  3BUN B;  5CSF A;  1K94 A;  2CTN A;  3DD4 A;  2KAV A;  5HL1 A;  3S0F A;  2L2E A;  1UHJ A;  2BE6 A;  3JVT B;  4M2O A;  2O5G A;  4OVN F;  1F70 A;  1TUZ A;  3VRP A;  3OBV A;  1TNX A;  3BFH A;  4YGB B;  1SY9 A;  1S36 A;  4M2Q A;  4I5L B;  4YI8 A;  2BKI B;  2A4J A;  5GQQ C;  1IKU A;  3CZT X;  2K0J A;  3B87 A;  3IF7 A;  1IRJ A;  1L2O B;  1OOH A;  2WOR A;  2Y1M A;  3A8R A;  5JOL A;  1IIO A;  4AQJ A;  5I94 A;  2OTG B;  1J7P A;  1SCM B;  1U5I B;  2LLT A;  3DF0 A;  2K60 A;  3BQ3 A;  3PFV A;  3M0W A;  1NYA A;  2K61 A;  4L9M A;  1FW4 A;  1TNQ A;  5TNC A;  1OSA A;  2KI4 C;  1CM4 A;  1LXF C;  1MUX A;  1F4Q A;  2BAP A;  5HLV A;  1DVI A;  1YX7 A;  1QLS A;  1VRK A;  1W7J B;  2MA2 A;  2QEV A;  1AP4 A;  1IH0 A;  2KDH A;  3R1O A;  1SL8 A;  2QEH A;  1RRO A;  3OHM B;  4PE0 A;  3GK1 A;  2JT3 A;  2FOT A;  2L2C A;  3VRQ A;  4CFQ A;  1KQM C;  2M0R A;  1QAS A;  3CZ0 A;  3PM8 A;  4DIR A;  3WHU B;  3IVT A;  2ZN9 A;  2NLN A;  2EC6 B;  2BNX A;  1OOI X;  2KSP A;  3OB1 B;  4OR9 B;  2CNP A;  3NSL A;  1J7R A;  1XFY O;  4NDB A;  4GPL B;  1SRA A;  4PDZ A;  1ZOT B;  2M1K B;  2V53 A;  2OS8 C;  3EKJ A;  4WQ2 A;  2L50 A;  1A75 B;  1LS8 A;  1YUR A;  3I5H C;  3SS3 A;  2K2F A;  3O78 A;  1F54 A;  1A4P A;  1KWO C;  3D0Y B;  3GOF A;  1J1E A;  5D3O A;  1DTL A;  1WRK A;  4YGA A;  2WND A;  3AKA A;  4MEW A;  2LMV A;  2SAS A;  3CWG A;  1DMO A;  1BMO A;  2K7B A;  2M3W A;  3CLN A;  4PHM A;  2LUX A;  1LA3 A;  5B8I B;  1DJI A;  2Y1N A;  3E3R A;  1IJ5 A;  1OE9 B;  1QX2 A;  4QJ5 B;  1SPY A;  2L5Y A;  1N0Y A;  4JPZ B;  1BLQ A;  1FF1 A;  2FCD A;  5HKZ A;  1CLB A;  5CSN A;  2KOT A;  1UWO A;  2M8U A;  1S6J A;  1SR6 C;  2BEC A;  2P6B B;  1PUL A;  2F3Y A;  5HLO A;  5BPJ A;  1NSH A;  1K9P A;  1CMF A;  3I5F C;  3PM2 A;  1QWV A;  4MSP A;  3WXA A;  1BOD A;  2ZRS A;  4GFT A;  1NPQ A;  1BT6 A;  4CLN A;  2WCM A;  3A4U B;  3L4A A;  1DEK A;  1NCZ A;  2M49 B;  3EKH A;  3AAK A;  2WCF A;  4MBE A;  3CAB A;  1BU3 A;  3SS5 A;  1S5G Y;  3NSK A;  3LL8 B;  1NCX A;  1V1F A;  3R1V A;  3TUY C;  3RLZ A;  1XFW O;  4D1E A;  4E68 A;  2LUC A;  4INW A;  1QJT A;  2MLE C;  2SCP A;  4YI9 A;  3VB1 A;  1PK0 D;  1WY9 A;  1YRU B;  1PRW A;  1ALV A;  3PN7 B;  4YGC B;  3TDU A;  1DGU A;  2KGR A;  1NUB A;  2CCM A;  3SIB A;  2KBI A;  5EL2 A;  1PSR A;  2VRG A;  1N2D A;  1QX5 B;  3PSR A;  3EK4 A;  2GGZ A;  1IJ6 A;  1RFJ A;  1TOP A;  3LK1 A;  1KCY A;  1YTZ C;  1CDP A;  1TWO A;  2G9B A;  3D77 A;  1ZFS A;  4FQO A;  4PHK A;  4PE7 A;  2KI4 B;  1HT9 A;  3VRO A;  2AAO A;  1GQM A;  3D75 A;  3KPX A;  1TNW A;  1KQV A;  1TNP A;  3S0B A;  2KBM A;  4JD9 A;  4OCI A;  3UNW A;  4DS7 A;  1EG4 A;  3DXL A;  3I5G C;  4CFR A;  3TZ1 A;  1JC2 A;  1M63 B;  4A4C A;  2WC5 A;  3EG5 B;  2TN4 A;  1WDC B;  4PE1 A;  5CPV A;  1CFC A;  4PT1 A;  2HQ8 A;  1XFZ O;  1JUO A;  4XYN A;  1DT7 B;  3KO0 A;  3DF0 B;  3O4Y A;  1J7Q A;  1KFU S;  2JT0 A;  1XO5 A;  1DJX A;  3LCP C;  3D74 A;  1LVC D;  1DJY A;  1SBJ A;  2ZKM X;  1OZS A;  1ALW A;  1KK8 B;  3H4S E;  2P70 A;  2JXC A;  2WC6 A;  2KQY A;  4WRI A;  1K2H A;  4QJ3 B;  5CSI A;  1Z2C B;  3I5H B;  3FE8 A;  2LAN A;  1Y6W A;  3CS1 A;  5AAN A;  1RJV A;  2I18 A;  4F0Z B;  1QX7 A;  4C0J A;  5F6T A;  4INX A;  2MAZ A;  3KHE A;  1JF0 A;  1QV0 A;  1A29 A;  2LMT A;  2LM5 A;  2WCE A;  1LA0 A;  2WCH A;  1QAT A;  1AJ5 A;  1S5G Z;  1FI5 A;  4ORA B;  1NX2 A;  1R2U A;  1BJF A;  1OOF A;  2PRU A;  4MRY A;  1LIN A;  5DKQ A;  2L4H A;  2JOJ A;  1J55 A;  4ICB A;  2LCP A;  4ETO A;  5AER A;  4DRW A;  4PHJ A;  1RTP 1;  1YX8 A;  2B1U A;  2JTZ A;  3I5F B;  2WCK A;  3CTN A;  1XK4 C;  5FI2 A;  1H8B A;  5J3X A;  2MLF C;  5G08 A;  5AEQ A;  2WC8 A;  2JUL A;  1OZO A;  3FE6 A;  2LVK A;  1BR4 B;  1KSM A;  4MLW A;  1B7T Y;  1P28 A;  2BL0 C;  2PVB A;  5DIC A;  3PAL A;  3S0E A;  3F45 A;  3SG7 A;  3SG4 A;  1RWY A;  2K7O A;  2LLU A;  2BCB A;  2Q4U A;  3EVU A;  1A2X A;  1B47 A;  1DF0 A;  4PCW A;  2BBN A;  1C3Z A;  1N65 A;  3EK7 A;  5HKY A;  1OMV A;  1CM1 A;  2QPT A;  4YGD B;  3CDN A;  3BOW A;  3L47 A;  1K9U A;  4XJK A;  1QLK A;  3BFB A;  3D10 A;  1YVH A;  1OMD A;  1QVI Y;  1UUR A;  2H61 C;  2QAC A;  3DVJ A;  3S0D A;  5KTY A;  1F8H A;  2KLD A;  2LE9 B;  2L51 A;  1DGV A;  3OX5 A;  3HCM A;  3KF9 A;  3BUM B;  3PLF B;  2FJY A;  5KU1 A;  3KEV A;  5D69 A;  2LHI A;  3HX4 A;  2L0P A;  1T14 A;  4BY5 A;  5AXI A;  3JTD C;  1OW4 A;  4PHN A;  3BUX B;  3R1P A;  4M2P A;  1UP5 A;  1XYD A;  2WCJ A;  4P5O E;  1MQ1 A;  3TDI A;  2JT8 A;  3PJI A;  2QEB A;  2I7A A;  3TS5 B;  1AK8 A;  3JVT C;  2ISD A;  2FJU B;  2I2R E;  3MSE B;  1K93 D;  4AOM A;  3EVR A;  1E8A A;  1FI6 A;  4WQ3 A;  2KAX A;  4GUK A;  1UHK A;  1SL7 A;  1EJ3 A;  3BXK A;  2KNE A;  2HF5 A;  4YGE B;  2LHL A;  3LK0 A;  1F4O A;  1TTX A;  3C1V A;  1TN4 A;  3O2P A;  4GGN A;  3EVV A;  4TNC A;  1A03 A;  1SL9 A;  1FPW A;  3QME A;  2EHB A;  3BUW B;  1K95 A;  2PAS A;  3GK2 A;  1D1O A;  4FTG A;  2I94 A;  4ORB B;  1C7V A;  1UHH A;  5AFP A;  5HYD A;  2ZRT A;  2JNX A;  1QS7 A;  1SCM C;  2D8N A;  5FYX A;  1SK6 D;  2Y4Q A;  2F3Z A;  1S26 D;  2F2P A;  1SW8 A;  2LAP A;  4MVF A;  4MZK A;  3PAT A;  4MZJ A;  2PSR A;  4HRE E;  2LV7 A;  1KFU L;  2M97 A;  4N5X A;  2Q91 A;  3B88 A;  2KYF A;  1UHN A;  1B7T Z;  1C7W A;  2MJW B;  2ZN8 A;  1G4Y R;  1EH2 A;  3V2L A;  2FCE A;  2KAY A;  2O60 A;  2M7L A;  1UHI A;  1XFX O;  1JF2 A;  1TUJ A;  1EXR A;  1CLM A;  1L7Z A;  2P71 A;  1CFD A;  2WCL A;  1QVI Z;  1Y0V H;  2E6W A;  3D76 A;  3BJH A;  1M46 A;  1AHR A;  1NX0 A;  2ERB A;  2QDI A;  3FS7 A;  1WLM A;  4OKH A;  1B4C A;  1PAL A;  1TCF A;  1C3Y A;  1ZAC A;  3DVK A;  4U8D A;  4GGF C;  1KQM B;  2LNK A;  1ODB A;  4Q04 A;  1NP8 A;  3FIA A;  2H2K A;  2G2B A;  4MN0 A;  1YR5 A;  1KSO A;  2JQ6 A;  1OQP A;  4YBH B;  5CSJ A;  2JU0 A;  1IG5 A;  3LLE A;  5ER4 X;  2JWW A;  4CPV A;  3OP0 A;  1KFX S;  1MF8 B;  5I2Q A;  2OS8 B;  1ZUZ A;  1K9K A;  3CR5 X;  3K21 A;  2GTE A;  2NZ0 A;  4ORC B;  3WNX B;  1BR1 B;  3ZWH A;  5FI6 A;  1KWO B;  3K1E A;  3NHI A;  1NCY A;  2PQL A;  1BF5 A;  4YRU A;  2R2I A;  1XK4 A;  3CZ1 A;  4JKT A;  2NCO A;  5KSZ A;  2F33 A;  4DUQ A;  2WCB A;  2MRD A;  2L5X B;  3CZ2 A;  2CBL A;  1YRT B;  3JTD B;  1IQ3 A;  1TIZ A;  1DF0 B;  2OPO A;  3O6B A;  5HKW A;  1MXL C;  5DKR A;  3BOW B;  3R72 A;  1CTR A;  2BBM A;  1RK9 A;  1S3P A;  2JRF A;  2JTT A;  4XJK B;  1Q80 A;  1DQE A;  1OOJ A;  5IBW A;  4N1G A;  4P2Y B;  1BG1 A;  1S1E A;  2GGM A;  2GV5 A;  2H61 A;  1SR6 B;  2COL B;  2HQW A;  2WOS A;  1SNL A;  3AAJ A;  1GGW A;  4UPG A;  3B6X A;  1NIW A;  1QV1 A;  3FE9 A;  3VRN A;  1DJW A;  1OOG A;  1KK7 Y;  3Q8I A;  1JFJ A;  1PSB A;  3BYA A;  3PN7 C;  4PE4 A;  2JNF A;  5D7F A;  4I5N B;  3OX6 A;  4NDC A;  4BY4 A;  1DEL A;  1R6P A;  1V1G A;  2M9G A;  2DOQ A;  1AVS A;  3OB2 B;  3L4L A;  1QIW A;  4IL1 A;  4USL A;  1MHO A;  2LVJ A;  3CR4 X;  4FQT A;  4ZCU A;  1K90 D;  3UO9 A;  1BOC A;  2K7C A;  1JFK A;  3TUY B;  1JBA A;  2KLE A;  1SSE B;  5ER5 A;  5I8N A;  1AJ4 A;  1DJH A;  1YUS A;  3ICB A;  2BCA A;  3I5I C;  4JWQ A;  1J7O A;  1EG3 A;  2F2O A;  2JXL A;  4OZD A;  1F55 A;  4NDD A;  4N1F A;  3SJS A;  2ZNE A;  2ZND A;  1CB1 A;  2CT9 A;  3AKB A;  1WDC C;  4MRX A;  1GGZ A;  1SCV A;  1CDM A;  1J1D A;  1Y1X A;  1CFF A;  1CDL A;  1AUI B;  2HPS A;  3BUO B;  1IQ5 A;  1DJZ A;  3B86 A;  1GM0 A;  1EL4 A;  2KFG A;  1U5I A;  1XA5 A;  2JPO A;  2K8M B;  4GNK B;  1JWD A;  3OGN A;  3RZS A;  1XFV O;  2KI6 C;  3O4X A;  1Y1A A;  1KK8 C;  3I5G B;  1CMG A;  2YGU A;  4JQ0 D;  4AQI A;  1Z4H A;  1MR8 A;  1SYM A;  4MZL A;  1MWN A;  4GAO A;  4PAL A;  3IQQ A;  1WRZ A;  4KYN A;  4I5J A;  2LC5 A;  2BE4 A;  1QXP A;  1GJY A;  1NX1 A;  1FBV A;  1OMR A;  2F8P A;  2KPH A;  2M1U A;  2JPT A;  1REC A;  1DC1 A;  2LP2 A;  1L2O C;  2BKH B;  2KYC A;  3D73 A;  1SKT A;  2LVV A;  2OTG C;  3BFA A;  5PAL A;  2Y5I A;  3SG2 A;  5JJG A;  3CYZ A;  3SG3 A;  3NGV A;  2LLS A;  4CID A;  4ZCV A;  1PVB A;  1ORG A;  1KK7 Z;  3SG6 A;  2HET A;  4QJ4 B;  2KGB C;  1A75 A;  3SG5 A;  3VRR A;  1XFR A;  4NQG A;  4HSZ A;  1MXE A;  1SMG A;  4GGF A;  3RM1 A;  2L98 A;  3GK4 X;  1KFX L;  3D0Y A;  3NSI A;  1HQV A;  3DZT A;  4IJ7 A;  3EK8 A;  2E30 A;  4DCK A;  5I2O A;  1XVJ A;  2LMU A;  1S6I A;  1PVA A;  1B9A A;  2AUC A;  3DVM A;  3TS5 C;  3SIA A;  2EC6 C;  5K89 A;  3D78 A;  3S0A A;  4I5K A;  1CNP A;  1QTX A;  1NX3 A;  1NWD A;  2IS9 A;  2L4I A;  3SS4 A;  3N7H A;  1G8I A;  3B7A A;  1G33 A;  1IGV A;  2NCP A;  2NXQ A;  2K7D A;  4OV2 A;  2AMI A;  4R1E A;  1C07 A;  1F71 A;  2BCX A;  2JZI A;  2MHH A;  1IWQ A;  4HRH A;  1LKJ A;  1QIV A;  2KHN A;  4C0K A;  3FWC A;  1YUU A;  3NSO A;  2KQ6 A;  1CKK A;  1CFP A;  2BL0 B;  1ZMZ A;  1JSA A;  2LVI A;  1B8C A;  1CDN A;  1XFU O;  1M39 A;  1B8R A;  2KFH A;  3NXA A;  4A4B A;  1WLZ A;  1B1G A;  2PAL A;  4C0L A;  1M45 A;  2H8V A;  5FI7 A;  3CR2 A;  3S0G A;  1TRF A;  1S6C A;  2K2A A;  3DY9 A; 
#chains in the Genus database with same CATH homology
 3ZNI A;  2JC2 A;  3I5I B;  5DKN A;  2CXJ A;  1DJG A;  1K96 A;  2RGI A;  5I2L A;  3TDZ A;  3WHT B;  3IQO A;  3FWB A;  2MBX A;  2M7N A;  2M29 A;  2EGD A;  2KI6 D;  3VGO A;  1TCO B;  1Y1U A;  4HRG A;  2ZFD A;  1K8U A;  1B8L A;  1WRL A;  2KFF A;  2LP3 A;  2PMY A;  1M31 A;  1YVL A;  3CGA A;  1UUS A;  1X02 A;  1YUT A;  4GBA A;  3QRX A;  1H4B A;  1W7I B;  1CLL A;  3DVE A;  3BUN B;  5CSF A;  1K94 A;  2CTN A;  3DD4 A;  2KAV A;  2L2E A;  1UHJ A;  2BE6 A;  3JVT B;  4M2O A;  2O5G A;  4OVN F;  1F70 A;  3VRP A;  1TNX A;  4YGB B;  1SY9 A;  1S36 A;  4M2Q A;  4I5L B;  4YI8 A;  2BKI B;  2A4J A;  5GQQ C;  1IKU A;  3CZT X;  2K0J A;  3IF7 A;  1IRJ A;  1L2O B;  3A8R A;  2WOR A;  2Y1M A;  5JOL A;  4AQJ A;  2OTG B;  1J7P A;  1SCM B;  1U5I B;  2LLT A;  3DF0 A;  3BQ3 A;  3PFV A;  3M0W A;  1NYA A;  2K61 A;  4L9M A;  1FW4 A;  1TNQ A;  5TNC A;  1OSA A;  2KI4 C;  1CM4 A;  1LXF C;  1MUX A;  1F4Q A;  5HLV A;  1DVI A;  1YX7 A;  1QLS A;  1VRK A;  1W7J B;  2MA2 A;  1AP4 A;  1IH0 A;  2KDH A;  1SL8 A;  1RRO A;  3OHM B;  4PE0 A;  3GK1 A;  2JT3 A;  2FOT A;  3VRQ A;  4CFQ A;  1KQM C;  2M0R A;  1QAS A;  3PM8 A;  4DIR A;  3WHU B;  2ZN9 A;  2NLN A;  2EC6 B;  2KSP A;  3OB1 B;  4OR9 B;  2CNP A;  3NSL A;  1J7R A;  1XFY O;  4NDB A;  4GPL B;  1SRA A;  4PDZ A;  1ZOT B;  2M1K B;  2V53 A;  2OS8 C;  3EKJ A;  4WQ2 A;  2L50 A;  1A75 B;  1YUR A;  3I5H C;  2K2F A;  3O78 A;  1F54 A;  1A4P A;  1KWO C;  3D0Y B;  3GOF A;  1J1E A;  1DTL A;  1WRK A;  4YGA A;  2WND A;  3AKA A;  4MEW A;  2LMV A;  2SAS A;  3CWG A;  1DMO A;  1BMO A;  2K7B A;  2M3W A;  3CLN A;  4PHM A;  2LUX A;  1LA3 A;  5B8I B;  1DJI A;  2Y1N A;  3E3R A;  1IJ5 A;  1OE9 B;  1QX2 A;  4QJ5 B;  1SPY A;  1N0Y A;  4JPZ B;  1BLQ A;  1FF1 A;  2FCD A;  5HKZ A;  1CLB A;  5CSN A;  2KOT A;  1UWO A;  2M8U A;  1S6J A;  1SR6 C;  2BEC A;  2P6B B;  1PUL A;  2F3Y A;  5HLO A;  5BPJ A;  1NSH A;  1K9P A;  1CMF A;  3I5F C;  4MSP A;  3WXA A;  1BOD A;  2ZRS A;  4GFT A;  1NPQ A;  1BT6 A;  4CLN A;  3A4U B;  1NCZ A;  2M49 B;  3EKH A;  3AAK A;  2WCF A;  4MBE A;  1BU3 A;  1S5G Y;  3NSK A;  3LL8 B;  1NCX A;  1V1F A;  3TUY C;  3RLZ A;  1XFW O;  4D1E A;  4E68 A;  2LUC A;  4YI9 A;  1QJT A;  2MLE C;  2SCP A;  1PK0 D;  1WY9 A;  1YRU B;  1PRW A;  1ALV A;  3PN7 B;  4YGC B;  3TDU A;  1DGU A;  2KGR A;  1NUB A;  2CCM A;  3SIB A;  2KBI A;  1PSR A;  2VRG A;  1N2D A;  1QX5 B;  3PSR A;  3EK4 A;  2GGZ A;  1IJ6 A;  1RFJ A;  1TOP A;  3LK1 A;  1KCY A;  1YTZ C;  1CDP A;  2G9B A;  4FQO A;  1ZFS A;  4PHK A;  4PE7 A;  2KI4 B;  1HT9 A;  3VRO A;  2AAO A;  1GQM A;  3KPX A;  1KQV A;  1TNW A;  1TNP A;  2KBM A;  4OCI A;  4DS7 A;  1EG4 A;  3I5G C;  4CFR A;  3TZ1 A;  1JC2 A;  1M63 B;  4A4C A;  5CPV A;  2TN4 A;  1WDC B;  4PE1 A;  1CFC A;  2HQ8 A;  1XFZ O;  1JUO A;  4XYN A;  1DT7 B;  3KO0 A;  3DF0 B;  3O4Y A;  1J7Q A;  1KFU S;  2JT0 A;  1XO5 A;  1DJX A;  3LCP C;  1LVC D;  1DJY A;  1SBJ A;  2ZKM X;  1OZS A;  1ALW A;  1KK8 B;  3H4S E;  2JXC A;  1K2H A;  2KQY A;  4WRI A;  4QJ3 B;  5CSI A;  3I5H B;  2LAN A;  1Y6W A;  3CS1 A;  5AAN A;  1RJV A;  2I18 A;  4F0Z B;  1QX7 A;  4C0J A;  5F6T A;  2MAZ A;  3KHE A;  1JF0 A;  1QV0 A;  1A29 A;  2LMT A;  2LM5 A;  2WCE A;  1LA0 A;  1QAT A;  1AJ5 A;  1S5G Z;  1FI5 A;  4ORA B;  1NX2 A;  1R2U A;  1BJF A;  2PRU A;  4MRY A;  1LIN A;  5DKQ A;  2L4H A;  2JOJ A;  1J55 A;  4ICB A;  2LCP A;  4ETO A;  5AER A;  4DRW A;  4PHJ A;  1RTP 1;  1YX8 A;  2B1U A;  2JTZ A;  3I5F B;  3CTN A;  1XK4 C;  1H8B A;  5J3X A;  2MLF C;  5G08 A;  5AEQ A;  2WC8 A;  2JUL A;  1OZO A;  2LVK A;  1BR4 B;  1KSM A;  4MLW A;  1B7T Y;  2BL0 C;  3SG7 A;  2PVB A;  3TS5 B;  3PAL A;  3F45 A;  3SG4 A;  1RWY A;  2K7O A;  2LLU A;  2BCB A;  2Q4U A;  3EVU A;  1A2X A;  1B47 A;  1DF0 A;  4PCW A;  2BBN A;  1N65 A;  5HKY A;  3EK7 A;  1OMV A;  1CM1 A;  2QPT A;  4YGD B;  3BOW A;  1K9U A;  4XJK A;  1QLK A;  3HX4 A;  3D10 A;  1YVH A;  1OMD A;  1QVI Y;  1UUR A;  2H61 C;  2QAC A;  3DVJ A;  5KTY A;  1F8H A;  2LE9 B;  2L51 A;  1DGV A;  3OX5 A;  3HCM A;  3KF9 A;  3BUM B;  3PLF B;  5KU1 A;  3KEV A;  5D69 A;  2LHI A;  2L0P A;  4BY5 A;  5AXI A;  3JTD C;  4PHN A;  3BUX B;  4M2P A;  1UP5 A;  1XYD A;  4P5O E;  1MQ1 A;  3TDI A;  2JT8 A;  2I7A A;  1AK8 A;  3JVT C;  2ISD A;  2FJU B;  2I2R E;  3MSE B;  1K93 D;  4AOM A;  3EVR A;  1E8A A;  1FI6 A;  4WQ3 A;  2KAX A;  4GUK A;  1UHK A;  1SL7 A;  1EJ3 A;  3BXK A;  2KNE A;  2HF5 A;  4YGE B;  2LHL A;  3LK0 A;  1F4O A;  1TTX A;  3C1V A;  1TN4 A;  3O2P A;  4GGN A;  3EVV A;  4TNC A;  1A03 A;  1SL9 A;  1FPW A;  2EHB A;  3BUW B;  1K95 A;  2PAS A;  3GK2 A;  1D1O A;  4FTG A;  2I94 A;  4ORB B;  1C7V A;  1UHH A;  5AFP A;  5HYD A;  2ZRT A;  2JNX A;  1QS7 A;  1SCM C;  2D8N A;  5FYX A;  1SK6 D;  2Y4Q A;  2F3Z A;  1S26 D;  2F2P A;  1SW8 A;  2LAP A;  4MVF A;  4MZK A;  3PAT A;  4MZJ A;  2PSR A;  4HRE E;  2LV7 A;  1KFU L;  2M97 A;  4N5X A;  2Q91 A;  2KYF A;  1UHN A;  1B7T Z;  1C7W A;  2MJW B;  2ZN8 A;  1G4Y R;  1EH2 A;  2FCE A;  2KAY A;  2O60 A;  2M7L A;  1UHI A;  1XFX O;  1JF2 A;  1EXR A;  1CLM A;  1L7Z A;  1CFD A;  1QVI Z;  1Y0V H;  2E6W A;  1M46 A;  1AHR A;  1NX0 A;  3FS7 A;  1WLM A;  4OKH A;  1B4C A;  1PAL A;  1TCF A;  1ZAC A;  3DVK A;  4U8D A;  4GGF C;  1KQM B;  2LNK A;  1ODB A;  4Q04 A;  1NP8 A;  3FIA A;  2H2K A;  2G2B A;  4MN0 A;  1YR5 A;  1KSO A;  2JQ6 A;  1OQP A;  4YBH B;  5CSJ A;  2JU0 A;  1IG5 A;  3LLE A;  5ER4 X;  2JWW A;  4CPV A;  3OP0 A;  1KFX S;  1MF8 B;  5I2Q A;  2OS8 B;  1ZUZ A;  1K9K A;  3CR5 X;  3K21 A;  2NZ0 A;  4ORC B;  3WNX B;  1BR1 B;  3ZWH A;  1KWO B;  1BF5 A;  1NCY A;  4YRU A;  2R2I A;  1XK4 A;  2NCO A;  5KSZ A;  2F33 A;  4DUQ A;  2WCB A;  2MRD A;  2L5X B;  2CBL A;  1YRT B;  3JTD B;  1IQ3 A;  1TIZ A;  1DF0 B;  2OPO A;  3O6B A;  5HKW A;  1MXL C;  5DKR A;  3BOW B;  1CTR A;  2BBM A;  1RK9 A;  1S3P A;  2JRF A;  2JTT A;  4XJK B;  1Q80 A;  1OOJ A;  5IBW A;  4N1G A;  4P2Y B;  1BG1 A;  1S1E A;  2GGM A;  2GV5 A;  2H61 A;  2COL B;  1SR6 B;  2HQW A;  2WOS A;  1SNL A;  3AAJ A;  1GGW A;  4UPG A;  1NIW A;  1QV1 A;  3VRN A;  1DJW A;  1JFJ A;  1KK7 Y;  1PSB A;  3BYA A;  3PN7 C;  4PE4 A;  2JNF A;  5D7F A;  4I5N B;  3OX6 A;  4NDC A;  4BY4 A;  1R6P A;  1V1G A;  2M9G A;  2DOQ A;  1AVS A;  3OB2 B;  4IL1 A;  1QIW A;  4USL A;  1MHO A;  2LVJ A;  3CR4 X;  4ZCU A;  1K90 D;  1BOC A;  2K7C A;  1JFK A;  3TUY B;  1JBA A;  5ER5 A;  5I8N A;  1AJ4 A;  1DJH A;  1YUS A;  3ICB A;  2BCA A;  3I5I C;  4JWQ A;  1J7O A;  1EG3 A;  2F2O A;  2JXL A;  1F55 A;  4NDD A;  4N1F A;  3SJS A;  2ZNE A;  2ZND A;  1CB1 A;  2CT9 A;  3AKB A;  1WDC C;  4MRX A;  1GGZ A;  1SCV A;  1CDM A;  1J1D A;  1Y1X A;  1CFF A;  1CDL A;  1AUI B;  2HPS A;  3BUO B;  1IQ5 A;  1DJZ A;  1EL4 A;  2KFG A;  1U5I A;  1XA5 A;  2K8M B;  4GNK B;  1JWD A;  1XFV O;  2KI6 C;  1Y1A A;  1KK8 C;  3I5G B;  1CMG A;  4JQ0 D;  4AQI A;  1MR8 A;  1SYM A;  4MZL A;  1MWN A;  4GAO A;  4PAL A;  3IQQ A;  1WRZ A;  4I5J A;  2LC5 A;  2BE4 A;  1QXP A;  1GJY A;  1NX1 A;  1FBV A;  1OMR A;  2F8P A;  2M1U A;  2JPT A;  1REC A;  2LP2 A;  1L2O C;  2BKH B;  2KYC A;  1SKT A;  2LVV A;  2OTG C;  5PAL A;  2Y5I A;  3SG2 A;  5JJG A;  3SG3 A;  2LLS A;  4CID A;  4ZCV A;  1PVB A;  3SG6 A;  1KK7 Z;  2HET A;  4QJ4 B;  2KGB C;  1A75 A;  3SG5 A;  3VRR A;  4NQG A;  4HSZ A;  1MXE A;  1SMG A;  4GGF A;  3RM1 A;  2L98 A;  3GK4 X;  1KFX L;  3D0Y A;  3NSI A;  1HQV A;  3EK8 A;  2E30 A;  4DCK A;  5I2O A;  1XVJ A;  2LMU A;  1S6I A;  1PVA A;  1B9A A;  2AUC A;  3DVM A;  3TS5 C;  3SIA A;  2EC6 C;  5K89 A;  1CNP A;  4I5K A;  1QTX A;  1NX3 A;  1NWD A;  2IS9 A;  2L4I A;  1G8I A;  1G33 A;  1IGV A;  2NCP A;  2NXQ A;  2K7D A;  4OV2 A;  2AMI A;  4R1E A;  1C07 A;  1F71 A;  2BCX A;  2JZI A;  2MHH A;  1IWQ A;  4HRH A;  1LKJ A;  1QIV A;  2KHN A;  4C0K A;  3FWC A;  1YUU A;  3NSO A;  2KQ6 A;  1CKK A;  1CFP A;  2BL0 B;  1ZMZ A;  1JSA A;  2LVI A;  1B8C A;  1CDN A;  1XFU O;  1M39 A;  1B8R A;  2KFH A;  3NXA A;  4A4B A;  1WLZ A;  1B1G A;  2PAL A;  4C0L A;  1M45 A;  3CR2 A;  1TRF A;  1S6C A;  2K2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...