3WHUB

Crystal structure of ergic-53/mcfd2, calcium/man2-bound form
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
71
structure length
58
Chain Sequence
QLHYFKMHDYDGNNLLDGLELSTAITMSEDELINIIDGVLRDDDKNNDGYIDYAEFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Disparate Sugar-Binding Specificities in the Homologous Cargo Receptors ERGIC-53 and VIP36
pubmed doi rcsb
molecule keywords Protein ERGIC-53
molecule tags Protein transport
source organism Homo sapiens
total genus 18
structure length 58
sequence length 71
ec nomenclature
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3whuB00
1DJWA 1QX2A 1CM4A 1YTZC 1H4BA 4PE0A 1KCYA 2F3YA 1TTXA 3DF0B 1C7VA 1JFKA 2PVBA 4MEWA 1WRZA 2LMVA 4PHMA 4I5JA 1UHNA 5B8IB 2MRDA 1K2HA 1OE9B 5G08A 1A75B 2L4IA 2ZFDA 1J1EA 1RTP1 1X02A 2BKHB 4NDCA 2K7DA 2KHNA 2Y4QA 5CSNA 3HX4A 2MJWB 2MA2A 4CPVA 3E3RA 2HF5A 3I5GB 2TN4A 4NDDA 1NX2A 1DJHA 1K95A 2BL0C 1W7IB 1TNPA 2LUCA 2O5GA 4MRYA 2E30A 1AJ4A 1BMOA 2FJUB 3IQOA 4U8DA 5AANA 2JOJA 1RECA 1QIVA 2BKIB 4JQ0D 1LINA 4I5NB 2EGDA 1S36A 5ER5A 1R2UA 2LLSA 4PE1A 2M7LA 1EL4A 1XA5A 2CNPA 2BCXA 1DVIA 4GGFC 1CB1A 4YGBB 2G9BA 4N5XA 4XJKA 1SY9A 1MUXA 1BR1B 2I18A 2RGIA 1L2OB 2LHLA 3EK8A 3OB2B 1B7TY 3AKBA 3GK1A 4HRHA 5J3XA 2BL0B 4C0KA 2BE4A 3VRRA 1G33A 1NUBA 2AAOA 2JWWA 2ZNDA 2I94A 3CTNA 1AVSA 5HLVA 3FWBA 1IKUA 1NSHA 1LKJA 3BYAA 3SG3A 2KOTA 1SMGA 1S1EA 2KQYA 4ORCB 2JT3A 4IL1A 4WRIA 2KBIA 4DS7A 1SCVA 1MXLC 3D0YA 3PALA 3DVEA 1KSMA 1QX7A 2KAXA 1ZOTB 1EJ3A 1K8UA 1NIWA 3ZNIA 1SNLA 1Y1XA 1J7QA 1QV1A 1CMFA 1YX8A 2Q91A 1VRKA 4DCKA 4N1FA 1FW4A 3PFVA 2M1UA 2NCOA 2NXQA 1N0YA 5DKNA 2MLFC 1Y1UA 4JWQA 1M46A 4MRXA 1DF0A 4MZKA 5K89A 1DMOA 2PASA 5DKQA 1CMGA 2JTZA 4YGCB 2ISDA 2M97A 1ZUZA 1SYMA 1DT7B 1CDMA 2L51A 1K9PA 2OS8C 3EVUA 1SL9A 4YRUA 1JWDA 3NSOA 1YVLA 2KI4C 3DF0A 1UHKA 2WCEA 5HYDA 1PULA 2Y5IA 4I5LB 1OMVA 1PRWA 1ZMZA 1B1GA 2ZRSA 1A75A 1QVIY 3BOWA 4ZCVA 1MR8A 1MHOA 5HKWA 4OV2A 2L4HA 2LLTA 1UHJA 1V1FA 2JT0A 3CS1A 2F8PA 1IJ6A 1Y0VH 1SPYA 3VRNA 2OS8B 5KTYA 3KF9A 2KFFA 1TNXA 1JF0A 2WCBA 1J7OA 4D1EA 2HQWA 1IWQA 3SG5A 1DJGA 1CTRA 3SIBA 1F70A 3NSIA 2LC5A 3CGAA 3TDIA 1OMRA 3TS5B 1DJZA 2LVVA 2KSPA 2Y1NA 5GQQC 1SK6D 2B1UA 3VRPA 1CLLA 4YGDB 1CLMA 1NPQA 1V1GA 3AAKA 1K90D 2BCAA 3BUMB 1S3PA 4PDZA 2JPTA 3O78A 3RLZA 4GPLB 2F2OA 1CNPA 3IQQA 1BG1A 1OZSA 2LP3A 4YI9A 2JZIA 2EC6C 4M2OA 1LXFC 1NYAA 1UURA 1PALA 2SCPA 2IS9A 1RJVA 4YI8A 3AKAA 1YVHA 1IGVA 2K8MB 3BOWB 4GGFA 2F3ZA 4MSPA 2ZNEA 1AJ5A 2M9GA 4PE7A 1XYDA 2PRUA 3WHUB 2GGZA 1XFVO 1M45A 1WDCC 2ZKMX 4CFQA 1FBVA 3LLEA 5CSJA 1F4QA 1GGZA 3CR5X 3JVTC 3NSLA 4HRGA 2E6WA 1KSOA 1XO5A 3CR4X 4YGAA 1SCMC 2EC6B 1NX3A 2KQ6A 1GGWA 5AXIA 4PCWA 3EK7A 3SJSA 2BCBA 1SKTA 2LMTA 2V53A 1XFWO 5DKRA 1J7RA 1QLSA 2OTGC 3TDZA 5I8NA 1IH0A 1K96A 1KFXL 1U5IB 2K2FA 2ZN8A 3A8RA 1NP8A 2LCPA 4GNKB 1BU3A 2K2AA 2JU0A 1BODA 1WLZA 3SG4A 1F8HA 1SW8A 3A4UB 3JVTB 4A4BA 1OMDA 1E8AA 2KFHA 1LA3A 3FWCA 1SBJA 1SCMB 3GOFA 2GGMA 3PATA 3I5IC 4Q04A 5CPVA 1J55A 2MAZA 4WQ2A 1PVAA 1H8BA 3ICBA 2OTGB 2LVKA 4ETOA 1QJTA 1IJ5A 2K7OA 3EVRA 1UHIA 2LP2A 1YRUB 1NX1A 4M2QA 1EH2A 2SASA 1PVBA 3D10A 1G8IA 1GQMA 4QJ4B 4CIDA 4AQIA 4PALA 1DGVA 2FOTA 4I5KA 1BR4B 1JFJA 3I5FC 1DJXA 1XK4C 1Y1AA 3FS7A 3I5IB 4NQGA 3QRXA 3VROA 5CSFA 1PSBA 1F55A 2KGBC 2PSRA 2KYCA 3JTDC 1WRKA 3O4YA 4E68A 1B8LA 3IF7A 2BBMA 3GK2A 3KPXA 1C7WA 5AEQA 4DIRA 2JULA 3NXAA 3VGOA 2K7CA 4YBHB 2MBXA 1BLQA 1A2XA 1B9AA 2JT8A 2PALA 3SG2A 1A03A 4BY5A 1SL8A 4ORAB 3WHTB 1IQ5A 2MLEC 2KAVA 1TNQA 4L9MA 3CZTX 4QJ3B 2WOSA 1KK7Z 2KBMA 2M0RA 3I5FB 1A29A 1S5GY 1SRAA 4DRWA 3OHMB 1NWDA 3PN7C 1KWOC 1FI6A 1DJIA 1RWYA 3JTDB 5F6TA 3PLFB 4YGEB 1YX7A 2LANA 3WNXB 1PK0D 1UP5A 1EXRA 2LNKA 1CLBA 1WRLA 2A4JA 4ICBA 2L5XB 3K21A 1B8CA 1AHRA 1AK8A 1BJFA 2P6BB 4F0ZB 1J7PA 1OSAA 2WCFA 1EG4A 3WXAA 1CKKA 1CM1A 1M31A 2KI4B 1M39A 3ZWHA 1QATA 3PN7B 4XYNA 1KWOB 2LV7A 4GFTA 2F2PA 3BUNB 1U5IA 1XFYO 2QPTA 1FPWA 1CFCA 2L98A 4FQOA 3MSEB 4GUKA 1KFUS 2M3WA 2KGRA 1CDPA 1B4CA 3OX5A 1RFJA 3TUYC 1MF8B 1ZACA 3OX6A 3SG6A 5HLOA 2BECA 3EK4A 2LMUA 2EHBA 1NCXA 1LVCD 1JC2A 3OP0A 2L0PA 2KFGA 2NLNA 4OVNF 1N2DA 2K61A 3PM8A 2KNEA 2VRGA 1OZOA 4AOMA 3CLNA 1DTLA 3H4SE 3AAJA 3NSKA 2H61C 5ER4X 1OQPA 1YUSA 2KI6D 1QV0A 2NCPA 1ZFSA 4ORBB 1QVIZ 1TOPA 2WORA 3TUYB 5I2OA 2KI6C 2ZN9A 5I2LA 3TZ1A 2HPSA 2LLUA 2NZ0A 2M1KB 4C0JA 4UPGA 1EG3A 4HREE 2PMYA 3SIAA 4JPZB 3RM1A 2BE6A 1SL7A 4GBAA 4A4CA 1CDNA 1JF2A 1K9KA 1QTXA 1YRTB 1YURA 5D69A 1MWNA 5HKZA 1JBAA 1QX5B 1F71A 3BXKA 3DVMA 1WDCB 1MXEA 3BUWB 3O2PA 1BF5A 1M63B 1MQ1A 3TDUA 1L2OC 5JOLA 1RROA 1KK8C 1CDLA 1CFPA 1XK4A 2JC2A 5D7FA 1TCOB 4PHNA 2FCDA 1OOJA 2JXCA 2M49B 3I5HC 3OB1B 1QASA 2FCEA 3LK0A 3KO0A 1NCYA 1WLMA 2HETA 2KAYA 5HKYA 1K94A 2HQ8A 1KFXS 2JNFA 5I2QA 1C07A 1G4YR 4OCIA 3DVKA 3DVJA 3C1VA 2LHIA 1KK7Y 5AFPA 4QJ5B 1IRJA 4MVFA 1JUOA 2LM5A 4FTGA 5KSZA 1KQMC 3BUXB 1KK8B 3EVVA 2JRFA 1S26D 2COLB 4MBEA 2L50A 4N1GA 4BY4A 4P5OE 2K0JA 4PE4A 4CFRA 3FIAA 2CXJA 1S6JA 3CWGA 2I2RE 4MZLA 4GGNA 3I5HB 2F33A 1DJYA 1QXPA 5TNCA 1IQ3A 1B8RA 2CTNA 2AMIA 2M8UA 1XFUO 1DGUA 2O60A 3KHEA 4MN0A 1CFDA 4NDBA 3LL8B 5KU1A 2H2KA 1ALWA 1HQVA 1NX0A 1QS7A 1FF1A 3BUOB 2Q4UA 3PSRA 2JQ6A 1KQMB 1UUSA 3F45A 4M2PA 1D1OA 1UHHA 1FI5A 1TCFA 1ALVA 4PHJA 3LCPC 1QIWA 1L7ZA 2JXLA 3EKJA 3CR2A 1RK9A 1B7TZ 4OKHA 1CFFA 3KEVA 2LUXA 1PSRA 1TIZA 2DOQA 2M7NA 1BOCA 2JNXA 1TNWA 1S6CA 1R6PA 1AP4A 4DUQA 1J1DA 4GAOA 4WQ3A 2LVIA 3O6BA 1Y6WA 4XJKB 4C0LA 5IBWA 1K9UA 4PHKA 1YUUA 3DD4A 4R1EA 1XVJA 2Y1MA 1F4OA 3EKHA 2L2EA 5FYXA 4AQJA 1XFZO 1IG5A 1YR5A 2JTTA 1JSAA 5BPJA 4CLNA 1HT9A 2GV5A 3HCMA 1LA0A 2ZRTA 1KFUL 3TS5C 1W7JB 2H61A 2CCMA 2R2IA 1SR6C 1ODBA 2BBNA 1N65A 1S6IA 4USLA 1AUIB 1TRFA 1K93D 4P2YB 5CSIA 3D0YB 2KYFA 2G2BA 2OPOA 2WC8A 5AERA 1TN4A 2MHHA 4TNCA 1Q80A 2CT9A 1YUTA 1KQVA 1WY9A 4HSZA 2QACA 2LVJA 2I7AA 1BT6A 2K7BA 3BQ3A 3SG7A 1QLKA 1A4PA 3M0WA 1B47A 2D8NA 1S5GZ 3GK4X 4OR9B 3LK1A 1UWOA 1DF0B 1SR6B 3VRQA 1XFXO 2AUCA 4ZCUA 2LAPA 4MLWA 5JJGA 2CBLA 2LE9B 1F54A 2WNDA 1GJYA 2M29A 2KDHA 4MZJA 3I5GC 1NCZA 5PALA
chains in the Genus database with same CATH superfamily
1DJWA 1QX2A 1CM4A 1YTZC 3D73A 3N7HA 4PE0A 1H4BA 2F3YA 1KCYA 1TTXA 3DF0B 1C7VA 1JFKA 2PVBA 4MEWA 1WRZA 4PT1A 2LMVA 4INWA 4PHMA 1OOIX 1UHNA 4I5JA 2MRDA 5B8IB 1OE9B 5G08A 1K2HA 1TWOA 1A75B 2L4IA 2ZFDA 1J1EA 1RTP1 3OGNA 1X02A 2BKHB 4NDCA 2K7DA 2KHNA 2Y4QA 3BFBA 5CSNA 3HX4A 2MJWB 2MA2A 4CPVA 3E3RA 2HF5A 3L4LA 3I5GB 2TN4A 4NDDA 1NX2A 1DJHA 1K95A 2BL0C 1W7IB 1TNPA 2LUCA 2O5GA 4MRYA 2E30A 1AJ4A 1BMOA 2FJUB 3CDNA 3CZ0A 3IQOA 4U8DA 5AANA 1QWVA 2JOJA 1RECA 1QIVA 2BKIB 4JQ0D 1LINA 4I5NB 2EGDA 1S36A 5ER5A 1R2UA 2LLSA 4PE1A 2M7LA 1EL4A 1XA5A 2CNPA 2BCXA 1DVIA 4GGFC 1CB1A 4YGBB 2G9BA 4N5XA 4XJKA 1SY9A 1MUXA 3SS3A 1BR1B 2I18A 2RGIA 1L2OB 2LHLA 3EK8A 3OB2B 4F7FA 1B7TY 3AKBA 3GK1A 4HRHA 5J3XA 2BL0B 4C0KA 2BE4A 3S0DA 3VRRA 1G33A 1NUBA 2AAOA 2JWWA 2ZNDA 1TUZA 2I94A 3PM2A 1SSEB 3CTNA 1AVSA 5HLVA 3FWBA 1IKUA 1NSHA 1LKJA 3BYAA 3SG3A 2KOTA 1SMGA 1S1EA 2KQYA 1XFRA 2WC5A 5HL1A 4ORCB 2JT3A 4IL1A 4WRIA 2KBIA 3S0BA 4DS7A 1SCVA 1MXLC 3D0YA 3PALA 3DVEA 1KSMA 1QX7A 2KAXA 1ZOTB 3FE8A 1EJ3A 1K8UA 1NIWA 2QEOA 3ZNIA 1SNLA 1Y1XA 1J7QA 1QV1A 1CMFA 1YX8A 2Q91A 1VRKA 4DCKA 4N1FA 1FW4A 3CZ1A 3PFVA 2M1UA 2NCOA 2NXQA 1N0YA 5DKNA 3DZTA 2MLFC 1Y1UA 4JWQA 1M46A 4MRXA 1DF0A 4MZKA 5K89A 1DMOA 2PASA 5DKQA 3DY9A 2QEHA 1CMGA 2JTZA 4YGCB 3D77A 2ISDA 2GTEA 2M97A 1ZUZA 2QEVA 2H8VA 3NHTA 1SYMA 1DT7B 1CDMA 2L51A 1K9PA 2OS8C 3EVUA 1SL9A 4YRUA 1JWDA 3NSOA 1YVLA 2KI4C 3DF0A 1UHKA 2WCEA 4FQTA 5HYDA 1PULA 2Y5IA 4I5LB 1OMVA 1PRWA 1ZMZA 1B1GA 2ZRSA 1A75A 1QVIY 3BOWA 4ZCVA 1MR8A 1MHOA 5HKWA 4OV2A 2L4HA 2LLTA 1UHJA 1V1FA 2JT0A 1P28A 3CS1A 2F8PA 1IJ6A 1Y0VH 1SPYA 4IJ7A 3VRNA 2OS8B 3OBVA 5KTYA 3KF9A 2KFFA 3CZ2A 1TNXA 4OZDA 2L5YA 1JF0A 2WCBA 2ERBA 3V2LA 4D1EA 3R1PA 1J7OA 2HQWA 1IWQA 3SG5A 1DJGA 1CTRA 3SIBA 1F70A 3NSIA 2LC5A 3CGAA 3TDIA 1OMRA 2WCLA 3TS5B 3S0GA 1DJZA 2LVVA 2KSPA 2Y1NA 5GQQC 1SK6D 2B1UA 3VRPA 1CLLA 4YGDB 1CLMA 1NPQA 1V1GA 2WCMA 3AAKA 1K90D 2BCAA 2PQLA 3BUMB 1S3PA 3R72A 2JPTA 4PDZA 3O78A 3RLZA 4GPLB 2F2OA 1CNPA 3IQQA 1BG1A 1OZSA 2LP3A 2WCJA 2P71A 2JZIA 3K1EA 2EC6C 3L47A 4YI9A 4M2OA 1LXFC 1NYAA 1UURA 1PALA 2SCPA 3D74A 2IS9A 3D76A 1RJVA 4YI8A 3AKAA 1YVHA 1IGVA 2K8MB 3BOWB 4GGFA 2F3ZA 4MSPA 2ZNEA 1AJ5A 2M9GA 4PE7A 1XYDA 3S0AA 2PRUA 3WHUB 2GGZA 1XFVO 1M45A 1WDCC 2ZKMX 4CFQA 1FBVA 3LLEA 5CSJA 1F4QA 1GGZA 3CR5X 3JVTC 3L4AA 3NSLA 4HRGA 1GM0A 2E6WA 1KSOA 1XO5A 3CR4X 4YGAA 1SCMC 2EC6B 1NX3A 2KQ6A 1GGWA 5AXIA 4PCWA 2KPHA 3EK7A 3SJSA 2BCBA 1SKTA 2LMTA 2V53A 1XFWO 5DKRA 1J7RA 1QLSA 2OTGC 3TDZA 5I8NA 1IH0A 1K96A 1KFXL 1U5IB 2WC6A 2K2FA 5D3OA 2ZN8A 3A8RA 1NP8A 2LCPA 4GNKB 1BU3A 2K2AA 2JU0A 1BODA 1WLZA 3SG4A 1F8HA 1SW8A 3A4UB 3JVTB 4A4BA 5EL2A 1OMDA 1E8AA 2KFHA 1LA3A 3R1VA 3FWCA 1SBJA 1SCMB 3GOFA 2GGMA 1OOFA 3I5IC 3PATA 4Q04A 1J55A 2MAZA 5CPVA 1T14A 4WQ2A 1PVAA 1H8BA 3ICBA 2OTGB 2LVKA 1OOGA 4ETOA 1QJTA 1IJ5A 2K7OA 3EVRA 1UHIA 3UO9A 2LP2A 1Z4HA 1YRUB 1DC1A 1NX1A 4M2QA 1EH2A 2SASA 1PVBA 3D10A 1G8IA 1GQMA 4QJ4B 4CIDA 4AQIA 4PALA 4JKTA 1DGVA 2FOTA 4I5KA 1BR4B 3BJHA 3RZSA 3NGVA 1JFJA 3I5FC 1DJXA 1XK4C 1Y1AA 3FS7A 3I5IB 4NQGA 3QRXA 3VROA 2FJYA 5CSFA 3B87A 1PSBA 1F55A 2KGBC 2PSRA 2KYCA 3JTDC 1WRKA 3O4YA 4E68A 3CYZA 1B8LA 3IF7A 2BBMA 3GK2A 3KPXA 1C7WA 5AEQA 4DIRA 2JULA 3NXAA 3VGOA 2K7CA 4YBHB 2MBXA 1BLQA 1A2XA 1B9AA 2JT8A 2PALA 3SG2A 1A03A 4BY5A 1SL8A 4ORAB 3WHTB 1IQ5A 2MLEC 2KAVA 3B7AA 1TNQA 4L9MA 3CZTX 1ORGA 2WOSA 4QJ3B 1KK7Z 2KBMA 2M0RA 3I5FB 2KLEA 1A29A 1S5GY 1SRAA 4DRWA 3OHMB 1NWDA 3PN7C 1KWOC 1FI6A 1DJIA 1RWYA 3JTDB 5F6TA 3PLFB 3B88A 1YX7A 2K60A 4YGEB 2LANA 3WNXB 1PK0D 1UP5A 1EXRA 2LNKA 1CLBA 1WRLA 3NHIA 2P70A 2A4JA 4ICBA 2L5XB 1DEKA 3K21A 1B8CA 3CABA 1AHRA 5I94A 1AK8A 1BJFA 2P6BB 5DICA 4F0ZB 1OSAA 2WCFA 1EG4A 3WXAA 1CKKA 1J7PA 1CM1A 1M31A 2KI4B 1M39A 3ZWHA 1QATA 3PN7B 4XYNA 1KWOB 2LV7A 4GFTA 2F2PA 3BUNB 5FI2A 1U5IA 1XFYO 2QPTA 1C3ZA 1FPWA 1CFCA 2L98A 4FQOA 3MSEB 4GUKA 1KFUS 2M3WA 2KGRA 1CDPA 1B4CA 3OX5A 1RFJA 3TUYC 1MF8B 1ZACA 3OX6A 3SG6A 5HLOA 2BECA 1Z2CB 2LMUA 2EHBA 1NCXA 3EK4A 1LVCD 3SS4A 1JC2A 3OP0A 2L0PA 2KFGA 2NLNA 4OVNF 1N2DA 2K61A 3PM8A 3S0EA 2KNEA 2VRGA 1OZOA 3SS5A 4AOMA 3CLNA 2QDIA 1DTLA 4KYNA 2L2CA 3H4SE 3AAJA 3NSKA 2H61C 5ER4X 1OQPA 1YUSA 2KI6D 1QV0A 2NCPA 1ZFSA 2QEBA 4ORBB 1QVIZ 1TOPA 2WORA 3TUYB 3D78A 5I2OA 3B86A 2KI6C 2ZN9A 5I2LA 3TZ1A 2HPSA 2LLUA 2NZ0A 2M1KB 4C0JA 4UPGA 1EG3A 4HREE 2PMYA 3SIAA 4JPZB 3RM1A 2BE6A 1SL7A 4GBAA 4A4CA 1CDNA 1JF2A 1K9KA 1QTXA 1YRTB 2BAPA 1YURA 2WCHA 1MWNA 5D69A 5HKZA 1JBAA 1QX5B 1F71A 3BXKA 3DVMA 1WDCB 1DQEA 1MXEA 3BUWB 3O2PA 4INXA 1BF5A 1M63B 1MQ1A 3TDUA 1L2OC 5JOLA 1RROA 1KK8C 1CDLA 1CFPA 1XK4A 2JC2A 3S0FA 2PYQA 5D7FA 1TCOB 4PHNA 3EG5B 3Q8IA 2FCDA 1OOJA 2JXCA 2M49B 3I5HC 3OB1B 1QASA 2FCEA 2WCKA 3LK0A 3KO0A 1NCYA 1WLMA 2HETA 2KAYA 5HKYA 1K94A 2HQ8A 1KFXS 1DELA 2JNFA 5I2QA 1G4YR 3B6XA 3DVKA 3DVJA 4OCIA 1C07A 3C1VA 1W9ZA 1KK7Y 2LHIA 5AFPA 4QJ5B 1IRJA 4MVFA 1JUOA 2LM5A 4FTGA 5KSZA 1KQMC 3BUXB 1KK8B 3EVVA 2JRFA 1S26D 2COLB 4MBEA 3UNWA 2L50A 4N1GA 4BY4A 1LS8A 2K0JA 4P5OE 4PE4A 4CFRA 3FIAA 2CXJA 1S6JA 3CWGA 2I2RE 4MZLA 4GGNA 3I5HB 2F33A 3PJIA 1DJYA 1QXPA 5TNCA 1IQ3A 1B8RA 2CTNA 2AMIA 2M8UA 1XFUO 1DGUA 2O60A 3KHEA 3IVTA 1CFDA 4MN0A 4NDBA 3LL8B 5KU1A 2H2KA 1ALWA 1HQVA 1NX0A 1QS7A 1FF1A 3BUOB 2Q4UA 3PSRA 2JQ6A 1OOHA 1KQMB 1UUSA 3F45A 4M2PA 3R1OA 1D1OA 1UHHA 2KLDA 1TCFA 1FI5A 1ALVA 4PHJA 3LCPC 1QIWA 1L7ZA 2JXLA 1IIOA 3EKJA 3CR2A 1RK9A 1B7TZ 4OKHA 1CFFA 3KEVA 2LUXA 1PSRA 1TIZA 2DOQA 2M7NA 1C3YA 1BOCA 2JNXA 1TNWA 1S6CA 1R6PA 1AP4A 4DUQA 1J1DA 4JD9A 4GAOA 4WQ3A 2LVIA 3O6BA 1Y6WA 4XJKB 4C0LA 5IBWA 1K9UA 4PHKA 1YUUA 3DD4A 4R1EA 1XVJA 3FE6A 1TUJA 1F4OA 2Y1MA 3FE9A 3EKHA 2L2EA 2YGUA 5FYXA 4AQJA 1XFZO 3DXLA 1IG5A 1YR5A 2JTTA 1JSAA 5BPJA 4CLNA 1HT9A 2GV5A 3O4XA 3HCMA 5FI7A 1LA0A 2ZRTA 1KFUL 3TS5C 1W7JB 2H61A 2CCMA 2R2IA 1SR6C 1ODBA 2BBNA 3BFHA 1N65A 5FI6A 1S6IA 4USLA 1AUIB 3DYEA 1TRFA 1K93D 4P2YB 5CSIA 3D0YB 2KYFA 2G2BA 2OPOA 2WC8A 5AERA 1TN4A 2MHHA 4TNCA 1Q80A 2CT9A 1YUTA 3BFAA 1KQVA 1WY9A 4HSZA 2QACA 2LVJA 2I7AA 1BT6A 2K7BA 3BQ3A 3SG7A 1QLKA 1A4PA 3M0WA 1B47A 2D8NA 3D75A 2BNXA 1S5GZ 3GK4X 4OR9B 3LK1A 1UWOA 1DF0B 1SR6B 3VRQA 1XFXO 2AUCA 1OW4A 4ZCUA 2LAPA 4MLWA 5JJGA 2CBLA 2LE9B 1F54A 2JPOA 2WNDA 1GJYA 3QMEA 2M29A 3VB1A 2KDHA 4MZJA 3I5GC 1NCZA 5PALA
chains in the Genus database with same CATH topology
1DJWA 1QX2A 1CM4A 1YTZC 1H4BA 4PE0A 1KCYA 2F3YA 1TTXA 3DF0B 1C7VA 1JFKA 2PVBA 4MEWA 1WRZA 2LMVA 4PHMA 4I5JA 1UHNA 5B8IB 2MRDA 1K2HA 1OE9B 5G08A 1A75B 2L4IA 2ZFDA 1J1EA 1RTP1 1X02A 2BKHB 4NDCA 2K7DA 2KHNA 2Y4QA 5CSNA 3HX4A 2MJWB 2MA2A 4CPVA 3E3RA 2HF5A 3I5GB 2TN4A 4NDDA 1NX2A 1DJHA 1K95A 2BL0C 1W7IB 1TNPA 2LUCA 2O5GA 4MRYA 2E30A 1AJ4A 1BMOA 2FJUB 3IQOA 4U8DA 5AANA 2JOJA 1RECA 1QIVA 2BKIB 4JQ0D 1LINA 4I5NB 2EGDA 1S36A 5ER5A 1R2UA 2LLSA 4PE1A 2M7LA 1EL4A 1XA5A 2CNPA 2BCXA 1DVIA 4GGFC 1CB1A 4YGBB 2G9BA 4N5XA 4XJKA 1SY9A 1MUXA 1BR1B 2I18A 2RGIA 1L2OB 2LHLA 3EK8A 3OB2B 1B7TY 3AKBA 3GK1A 4HRHA 5J3XA 2BL0B 4C0KA 2BE4A 3VRRA 1G33A 1NUBA 2AAOA 2JWWA 2ZNDA 2I94A 3CTNA 1AVSA 5HLVA 3FWBA 1IKUA 1NSHA 1LKJA 3BYAA 3SG3A 2KOTA 1SMGA 1S1EA 2KQYA 4ORCB 2JT3A 4IL1A 4WRIA 2KBIA 4DS7A 1SCVA 1MXLC 3D0YA 3PALA 3DVEA 1KSMA 1QX7A 2KAXA 1ZOTB 1EJ3A 1K8UA 1NIWA 3ZNIA 1SNLA 1Y1XA 1J7QA 1QV1A 1CMFA 1YX8A 2Q91A 1VRKA 4DCKA 4N1FA 1FW4A 3PFVA 2M1UA 2NCOA 2NXQA 1N0YA 5DKNA 2MLFC 1Y1UA 4JWQA 1M46A 4MRXA 1DF0A 4MZKA 5K89A 1DMOA 2PASA 5DKQA 1CMGA 2JTZA 4YGCB 2ISDA 2M97A 1ZUZA 1SYMA 1DT7B 1CDMA 2L51A 1K9PA 2OS8C 3EVUA 1SL9A 4YRUA 1JWDA 3NSOA 1YVLA 2KI4C 3DF0A 1UHKA 2WCEA 5HYDA 1PULA 2Y5IA 4I5LB 1OMVA 1PRWA 1ZMZA 1B1GA 2ZRSA 1A75A 1QVIY 3BOWA 4ZCVA 1MR8A 1MHOA 5HKWA 4OV2A 2L4HA 2LLTA 1UHJA 1V1FA 2JT0A 3CS1A 2F8PA 1IJ6A 1Y0VH 1SPYA 3VRNA 2OS8B 5KTYA 3KF9A 2KFFA 1TNXA 1JF0A 2WCBA 1J7OA 4D1EA 2HQWA 1IWQA 3SG5A 1DJGA 1CTRA 3SIBA 1F70A 3NSIA 2LC5A 3CGAA 3TDIA 1OMRA 3TS5B 1DJZA 2LVVA 2KSPA 2Y1NA 5GQQC 1SK6D 2B1UA 3VRPA 1CLLA 4YGDB 1CLMA 1NPQA 1V1GA 3AAKA 1K90D 2BCAA 3BUMB 1S3PA 4PDZA 2JPTA 3O78A 3RLZA 4GPLB 2F2OA 1CNPA 3IQQA 1BG1A 1OZSA 2LP3A 4YI9A 2JZIA 2EC6C 4M2OA 1LXFC 1NYAA 1UURA 1PALA 2SCPA 2IS9A 1RJVA 4YI8A 3AKAA 1YVHA 1IGVA 2K8MB 3BOWB 4GGFA 2F3ZA 4MSPA 2ZNEA 1AJ5A 2M9GA 4PE7A 1XYDA 2PRUA 3WHUB 2GGZA 1XFVO 1M45A 1WDCC 2ZKMX 4CFQA 1FBVA 3LLEA 5CSJA 1F4QA 1GGZA 3CR5X 3JVTC 3NSLA 4HRGA 2E6WA 1KSOA 1XO5A 3CR4X 4YGAA 1SCMC 2EC6B 1NX3A 2KQ6A 1GGWA 5AXIA 4PCWA 3EK7A 3SJSA 2BCBA 1SKTA 2LMTA 2V53A 1XFWO 5DKRA 1J7RA 1QLSA 2OTGC 3TDZA 5I8NA 1IH0A 1K96A 1KFXL 1U5IB 2K2FA 2ZN8A 3A8RA 1NP8A 2LCPA 4GNKB 1BU3A 2K2AA 2JU0A 1BODA 1WLZA 3SG4A 1F8HA 1SW8A 3A4UB 3JVTB 4A4BA 1OMDA 1E8AA 2KFHA 1LA3A 3FWCA 1SBJA 1SCMB 3GOFA 2GGMA 3PATA 3I5IC 4Q04A 5CPVA 1J55A 2MAZA 4WQ2A 1PVAA 1H8BA 3ICBA 2OTGB 2LVKA 4ETOA 1QJTA 1IJ5A 2K7OA 3EVRA 1UHIA 2LP2A 1YRUB 1NX1A 4M2QA 1EH2A 2SASA 1PVBA 3D10A 1G8IA 1GQMA 4QJ4B 4CIDA 4AQIA 4PALA 1DGVA 2FOTA 4I5KA 1BR4B 1JFJA 3I5FC 1DJXA 1XK4C 1Y1AA 3FS7A 3I5IB 4NQGA 3QRXA 3VROA 5CSFA 1PSBA 1F55A 2KGBC 2PSRA 2KYCA 3JTDC 1WRKA 3O4YA 4E68A 1B8LA 3IF7A 2BBMA 3GK2A 3KPXA 1C7WA 5AEQA 4DIRA 2JULA 3NXAA 3VGOA 2K7CA 4YBHB 2MBXA 1BLQA 1A2XA 1B9AA 2JT8A 2PALA 3SG2A 1A03A 4BY5A 1SL8A 4ORAB 3WHTB 1IQ5A 2MLEC 2KAVA 1TNQA 4L9MA 3CZTX 4QJ3B 2WOSA 1KK7Z 2KBMA 2M0RA 3I5FB 1A29A 1S5GY 1SRAA 4DRWA 3OHMB 1NWDA 3PN7C 1KWOC 1FI6A 1DJIA 1RWYA 3JTDB 5F6TA 3PLFB 4YGEB 1YX7A 2LANA 3WNXB 1PK0D 1UP5A 1EXRA 2LNKA 1CLBA 1WRLA 2A4JA 4ICBA 2L5XB 3K21A 1B8CA 1AHRA 1AK8A 1BJFA 2P6BB 4F0ZB 1J7PA 1OSAA 2WCFA 1EG4A 3WXAA 1CKKA 1CM1A 1M31A 2KI4B 1M39A 3ZWHA 1QATA 3PN7B 4XYNA 1KWOB 2LV7A 4GFTA 2F2PA 3BUNB 1U5IA 1XFYO 2QPTA 1FPWA 1CFCA 2L98A 4FQOA 3MSEB 4GUKA 1KFUS 2M3WA 2KGRA 1CDPA 1B4CA 3OX5A 1RFJA 3TUYC 1MF8B 1ZACA 3OX6A 3SG6A 5HLOA 2BECA 3EK4A 2LMUA 2EHBA 1NCXA 1LVCD 1JC2A 3OP0A 2L0PA 2KFGA 2NLNA 4OVNF 1N2DA 2K61A 3PM8A 2KNEA 2VRGA 1OZOA 4AOMA 3CLNA 1DTLA 3H4SE 3AAJA 3NSKA 2H61C 5ER4X 1OQPA 1YUSA 2KI6D 1QV0A 2NCPA 1ZFSA 4ORBB 1QVIZ 1TOPA 2WORA 3TUYB 5I2OA 2KI6C 2ZN9A 5I2LA 3TZ1A 2HPSA 2LLUA 2NZ0A 2M1KB 4C0JA 4UPGA 1EG3A 4HREE 2PMYA 3SIAA 4JPZB 3RM1A 2BE6A 1SL7A 4GBAA 4A4CA 1CDNA 1JF2A 1K9KA 1QTXA 1YRTB 1YURA 5D69A 1MWNA 5HKZA 1JBAA 1QX5B 1F71A 3BXKA 3DVMA 1WDCB 1MXEA 3BUWB 3O2PA 1BF5A 1M63B 1MQ1A 3TDUA 1L2OC 5JOLA 1RROA 1KK8C 1CDLA 1CFPA 1XK4A 2JC2A 5D7FA 1TCOB 4PHNA 2FCDA 1OOJA 2JXCA 2M49B 3I5HC 3OB1B 1QASA 2FCEA 3LK0A 3KO0A 1NCYA 1WLMA 2HETA 2KAYA 5HKYA 1K94A 2HQ8A 1KFXS 2JNFA 5I2QA 1C07A 1G4YR 4OCIA 3DVKA 3DVJA 3C1VA 2LHIA 1KK7Y 5AFPA 4QJ5B 1IRJA 4MVFA 1JUOA 2LM5A 4FTGA 5KSZA 1KQMC 3BUXB 1KK8B 3EVVA 2JRFA 1S26D 2COLB 4MBEA 2L50A 4N1GA 4BY4A 4P5OE 2K0JA 4PE4A 4CFRA 3FIAA 2CXJA 1S6JA 3CWGA 2I2RE 4MZLA 4GGNA 3I5HB 2F33A 1DJYA 1QXPA 5TNCA 1IQ3A 1B8RA 2CTNA 2AMIA 2M8UA 1XFUO 1DGUA 2O60A 3KHEA 4MN0A 1CFDA 4NDBA 3LL8B 5KU1A 2H2KA 1ALWA 1HQVA 1NX0A 1QS7A 1FF1A 3BUOB 2Q4UA 3PSRA 2JQ6A 1KQMB 1UUSA 3F45A 4M2PA 1D1OA 1UHHA 1FI5A 1TCFA 1ALVA 4PHJA 3LCPC 1QIWA 1L7ZA 2JXLA 3EKJA 3CR2A 1RK9A 1B7TZ 4OKHA 1CFFA 3KEVA 2LUXA 1PSRA 1TIZA 2DOQA 2M7NA 1BOCA 2JNXA 1TNWA 1S6CA 1R6PA 1AP4A 4DUQA 1J1DA 4GAOA 4WQ3A 2LVIA 3O6BA 1Y6WA 4XJKB 4C0LA 5IBWA 1K9UA 4PHKA 1YUUA 3DD4A 4R1EA 1XVJA 2Y1MA 1F4OA 3EKHA 2L2EA 5FYXA 4AQJA 1XFZO 1IG5A 1YR5A 2JTTA 1JSAA 5BPJA 4CLNA 1HT9A 2GV5A 3HCMA 1LA0A 2ZRTA 1KFUL 3TS5C 1W7JB 2H61A 2CCMA 2R2IA 1SR6C 1ODBA 2BBNA 1N65A 1S6IA 4USLA 1AUIB 1TRFA 1K93D 4P2YB 5CSIA 3D0YB 2KYFA 2G2BA 2OPOA 2WC8A 5AERA 1TN4A 2MHHA 4TNCA 1Q80A 2CT9A 1YUTA 1KQVA 1WY9A 4HSZA 2QACA 2LVJA 2I7AA 1BT6A 2K7BA 3BQ3A 3SG7A 1QLKA 1A4PA 3M0WA 1B47A 2D8NA 1S5GZ 3GK4X 4OR9B 3LK1A 1UWOA 1DF0B 1SR6B 3VRQA 1XFXO 2AUCA 4ZCUA 2LAPA 4MLWA 5JJGA 2CBLA 2LE9B 1F54A 2WNDA 1GJYA 2M29A 2KDHA 4MZJA 3I5GC 1NCZA 5PALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DJW A;  1QX2 A;  1CM4 A;  1YTZ C;  1H4B A;  4PE0 A;  1KCY A;  2F3Y A;  1TTX A;  3DF0 B;  1C7V A;  1JFK A;  2PVB A;  4MEW A;  1WRZ A;  2LMV A;  4PHM A;  4I5J A;  1UHN A;  5B8I B;  2MRD A;  1K2H A;  1OE9 B;  5G08 A;  1A75 B;  2L4I A;  2ZFD A;  1J1E A;  1RTP 1;  1X02 A;  2BKH B;  4NDC A;  2K7D A;  2KHN A;  2Y4Q A;  5CSN A;  3HX4 A;  2MJW B;  2MA2 A;  4CPV A;  3E3R A;  2HF5 A;  3I5G B;  2TN4 A;  4NDD A;  1NX2 A;  1DJH A;  1K95 A;  2BL0 C;  1W7I B;  1TNP A;  2LUC A;  2O5G A;  4MRY A;  2E30 A;  1AJ4 A;  1BMO A;  2FJU B;  3IQO A;  4U8D A;  5AAN A;  2JOJ A;  1REC A;  1QIV A;  2BKI B;  4JQ0 D;  1LIN A;  4I5N B;  2EGD A;  1S36 A;  5ER5 A;  1R2U A;  2LLS A;  4PE1 A;  2M7L A;  1EL4 A;  1XA5 A;  2CNP A;  2BCX A;  1DVI A;  4GGF C;  1CB1 A;  4YGB B;  2G9B A;  4N5X A;  4XJK A;  1SY9 A;  1MUX A;  1BR1 B;  2I18 A;  2RGI A;  1L2O B;  2LHL A;  3EK8 A;  3OB2 B;  1B7T Y;  3AKB A;  3GK1 A;  4HRH A;  5J3X A;  2BL0 B;  4C0K A;  2BE4 A;  3VRR A;  1G33 A;  1NUB A;  2AAO A;  2JWW A;  2ZND A;  2I94 A;  3CTN A;  1AVS A;  5HLV A;  3FWB A;  1IKU A;  1NSH A;  1LKJ A;  3BYA A;  3SG3 A;  2KOT A;  1SMG A;  1S1E A;  2KQY A;  4ORC B;  2JT3 A;  4IL1 A;  4WRI A;  2KBI A;  4DS7 A;  1SCV A;  1MXL C;  3D0Y A;  3PAL A;  3DVE A;  1KSM A;  1QX7 A;  2KAX A;  1ZOT B;  1EJ3 A;  1K8U A;  1NIW A;  3ZNI A;  1SNL A;  1Y1X A;  1J7Q A;  1QV1 A;  1CMF A;  1YX8 A;  2Q91 A;  1VRK A;  4DCK A;  4N1F A;  1FW4 A;  3PFV A;  2M1U A;  2NCO A;  2NXQ A;  1N0Y A;  5DKN A;  2MLF C;  1Y1U A;  4JWQ A;  1M46 A;  4MRX A;  1DF0 A;  4MZK A;  5K89 A;  1DMO A;  2PAS A;  5DKQ A;  1CMG A;  2JTZ A;  4YGC B;  2ISD A;  2M97 A;  1ZUZ A;  1SYM A;  1DT7 B;  1CDM A;  2L51 A;  1K9P A;  2OS8 C;  3EVU A;  1SL9 A;  4YRU A;  1JWD A;  3NSO A;  1YVL A;  2KI4 C;  3DF0 A;  1UHK A;  2WCE A;  5HYD A;  1PUL A;  2Y5I A;  4I5L B;  1OMV A;  1PRW A;  1ZMZ A;  1B1G A;  2ZRS A;  1A75 A;  1QVI Y;  3BOW A;  4ZCV A;  1MR8 A;  1MHO A;  5HKW A;  4OV2 A;  2L4H A;  2LLT A;  1UHJ A;  1V1F A;  2JT0 A;  3CS1 A;  2F8P A;  1IJ6 A;  1Y0V H;  1SPY A;  3VRN A;  2OS8 B;  5KTY A;  3KF9 A;  2KFF A;  1TNX A;  1JF0 A;  2WCB A;  1J7O A;  4D1E A;  2HQW A;  1IWQ A;  3SG5 A;  1DJG A;  1CTR A;  3SIB A;  1F70 A;  3NSI A;  2LC5 A;  3CGA A;  3TDI A;  1OMR A;  3TS5 B;  1DJZ A;  2LVV A;  2KSP A;  2Y1N A;  5GQQ C;  1SK6 D;  2B1U A;  3VRP A;  1CLL A;  4YGD B;  1CLM A;  1NPQ A;  1V1G A;  3AAK A;  1K90 D;  2BCA A;  3BUM B;  1S3P A;  4PDZ A;  2JPT A;  3O78 A;  3RLZ A;  4GPL B;  2F2O A;  1CNP A;  3IQQ A;  1BG1 A;  1OZS A;  2LP3 A;  4YI9 A;  2JZI A;  2EC6 C;  4M2O A;  1LXF C;  1NYA A;  1UUR A;  1PAL A;  2SCP A;  2IS9 A;  1RJV A;  4YI8 A;  3AKA A;  1YVH A;  1IGV A;  2K8M B;  3BOW B;  4GGF A;  2F3Z A;  4MSP A;  2ZNE A;  1AJ5 A;  2M9G A;  4PE7 A;  1XYD A;  2PRU A;  3WHU B;  2GGZ A;  1XFV O;  1M45 A;  1WDC C;  2ZKM X;  4CFQ A;  1FBV A;  3LLE A;  5CSJ A;  1F4Q A;  1GGZ A;  3CR5 X;  3JVT C;  3NSL A;  4HRG A;  2E6W A;  1KSO A;  1XO5 A;  3CR4 X;  4YGA A;  1SCM C;  2EC6 B;  1NX3 A;  2KQ6 A;  1GGW A;  5AXI A;  4PCW A;  3EK7 A;  3SJS A;  2BCB A;  1SKT A;  2LMT A;  2V53 A;  1XFW O;  5DKR A;  1J7R A;  1QLS A;  2OTG C;  3TDZ A;  5I8N A;  1IH0 A;  1K96 A;  1KFX L;  1U5I B;  2K2F A;  2ZN8 A;  3A8R A;  1NP8 A;  2LCP A;  4GNK B;  1BU3 A;  2K2A A;  2JU0 A;  1BOD A;  1WLZ A;  3SG4 A;  1F8H A;  1SW8 A;  3A4U B;  3JVT B;  4A4B A;  1OMD A;  1E8A A;  2KFH A;  1LA3 A;  3FWC A;  1SBJ A;  1SCM B;  3GOF A;  2GGM A;  3PAT A;  3I5I C;  4Q04 A;  5CPV A;  1J55 A;  2MAZ A;  4WQ2 A;  1PVA A;  1H8B A;  3ICB A;  2OTG B;  2LVK A;  4ETO A;  1QJT A;  1IJ5 A;  2K7O A;  3EVR A;  1UHI A;  2LP2 A;  1YRU B;  1NX1 A;  4M2Q A;  1EH2 A;  2SAS A;  1PVB A;  3D10 A;  1G8I A;  1GQM A;  4QJ4 B;  4CID A;  4AQI A;  4PAL A;  1DGV A;  2FOT A;  4I5K A;  1BR4 B;  1JFJ A;  3I5F C;  1DJX A;  1XK4 C;  1Y1A A;  3FS7 A;  3I5I B;  4NQG A;  3QRX A;  3VRO A;  5CSF A;  1PSB A;  1F55 A;  2KGB C;  2PSR A;  2KYC A;  3JTD C;  1WRK A;  3O4Y A;  4E68 A;  1B8L A;  3IF7 A;  2BBM A;  3GK2 A;  3KPX A;  1C7W A;  5AEQ A;  4DIR A;  2JUL A;  3NXA A;  3VGO A;  2K7C A;  4YBH B;  2MBX A;  1BLQ A;  1A2X A;  1B9A A;  2JT8 A;  2PAL A;  3SG2 A;  1A03 A;  4BY5 A;  1SL8 A;  4ORA B;  3WHT B;  1IQ5 A;  2MLE C;  2KAV A;  1TNQ A;  4L9M A;  3CZT X;  4QJ3 B;  2WOS A;  1KK7 Z;  2KBM A;  2M0R A;  3I5F B;  1A29 A;  1S5G Y;  1SRA A;  4DRW A;  3OHM B;  1NWD A;  3PN7 C;  1KWO C;  1FI6 A;  1DJI A;  1RWY A;  3JTD B;  5F6T A;  3PLF B;  4YGE B;  1YX7 A;  2LAN A;  3WNX B;  1PK0 D;  1UP5 A;  1EXR A;  2LNK A;  1CLB A;  1WRL A;  2A4J A;  4ICB A;  2L5X B;  3K21 A;  1B8C A;  1AHR A;  1AK8 A;  1BJF A;  2P6B B;  4F0Z B;  1J7P A;  1OSA A;  2WCF A;  1EG4 A;  3WXA A;  1CKK A;  1CM1 A;  1M31 A;  2KI4 B;  1M39 A;  3ZWH A;  1QAT A;  3PN7 B;  4XYN A;  1KWO B;  2LV7 A;  4GFT A;  2F2P A;  3BUN B;  1U5I A;  1XFY O;  2QPT A;  1FPW A;  1CFC A;  2L98 A;  4FQO A;  3MSE B;  4GUK A;  1KFU S;  2M3W A;  2KGR A;  1CDP A;  1B4C A;  3OX5 A;  1RFJ A;  3TUY C;  1MF8 B;  1ZAC A;  3OX6 A;  3SG6 A;  5HLO A;  2BEC A;  3EK4 A;  2LMU A;  2EHB A;  1NCX A;  1LVC D;  1JC2 A;  3OP0 A;  2L0P A;  2KFG A;  2NLN A;  4OVN F;  1N2D A;  2K61 A;  3PM8 A;  2KNE A;  2VRG A;  1OZO A;  4AOM A;  3CLN A;  1DTL A;  3H4S E;  3AAJ A;  3NSK A;  2H61 C;  5ER4 X;  1OQP A;  1YUS A;  2KI6 D;  1QV0 A;  2NCP A;  1ZFS A;  4ORB B;  1QVI Z;  1TOP A;  2WOR A;  3TUY B;  5I2O A;  2KI6 C;  2ZN9 A;  5I2L A;  3TZ1 A;  2HPS A;  2LLU A;  2NZ0 A;  2M1K B;  4C0J A;  4UPG A;  1EG3 A;  4HRE E;  2PMY A;  3SIA A;  4JPZ B;  3RM1 A;  2BE6 A;  1SL7 A;  4GBA A;  4A4C A;  1CDN A;  1JF2 A;  1K9K A;  1QTX A;  1YRT B;  1YUR A;  5D69 A;  1MWN A;  5HKZ A;  1JBA A;  1QX5 B;  1F71 A;  3BXK A;  3DVM A;  1WDC B;  1MXE A;  3BUW B;  3O2P A;  1BF5 A;  1M63 B;  1MQ1 A;  3TDU A;  1L2O C;  5JOL A;  1RRO A;  1KK8 C;  1CDL A;  1CFP A;  1XK4 A;  2JC2 A;  5D7F A;  1TCO B;  4PHN A;  2FCD A;  1OOJ A;  2JXC A;  2M49 B;  3I5H C;  3OB1 B;  1QAS A;  2FCE A;  3LK0 A;  3KO0 A;  1NCY A;  1WLM A;  2HET A;  2KAY A;  5HKY A;  1K94 A;  2HQ8 A;  1KFX S;  2JNF A;  5I2Q A;  1C07 A;  1G4Y R;  4OCI A;  3DVK A;  3DVJ A;  3C1V A;  2LHI A;  1KK7 Y;  5AFP A;  4QJ5 B;  1IRJ A;  4MVF A;  1JUO A;  2LM5 A;  4FTG A;  5KSZ A;  1KQM C;  3BUX B;  1KK8 B;  3EVV A;  2JRF A;  1S26 D;  2COL B;  4MBE A;  2L50 A;  4N1G A;  4BY4 A;  4P5O E;  2K0J A;  4PE4 A;  4CFR A;  3FIA A;  2CXJ A;  1S6J A;  3CWG A;  2I2R E;  4MZL A;  4GGN A;  3I5H B;  2F33 A;  1DJY A;  1QXP A;  5TNC A;  1IQ3 A;  1B8R A;  2CTN A;  2AMI A;  2M8U A;  1XFU O;  1DGU A;  2O60 A;  3KHE A;  4MN0 A;  1CFD A;  4NDB A;  3LL8 B;  5KU1 A;  2H2K A;  1ALW A;  1HQV A;  1NX0 A;  1QS7 A;  1FF1 A;  3BUO B;  2Q4U A;  3PSR A;  2JQ6 A;  1KQM B;  1UUS A;  3F45 A;  4M2P A;  1D1O A;  1UHH A;  1FI5 A;  1TCF A;  1ALV A;  4PHJ A;  3LCP C;  1QIW A;  1L7Z A;  2JXL A;  3EKJ A;  3CR2 A;  1RK9 A;  1B7T Z;  4OKH A;  1CFF A;  3KEV A;  2LUX A;  1PSR A;  1TIZ A;  2DOQ A;  2M7N A;  1BOC A;  2JNX A;  1TNW A;  1S6C A;  1R6P A;  1AP4 A;  4DUQ A;  1J1D A;  4GAO A;  4WQ3 A;  2LVI A;  3O6B A;  1Y6W A;  4XJK B;  4C0L A;  5IBW A;  1K9U A;  4PHK A;  1YUU A;  3DD4 A;  4R1E A;  1XVJ A;  2Y1M A;  1F4O A;  3EKH A;  2L2E A;  5FYX A;  4AQJ A;  1XFZ O;  1IG5 A;  1YR5 A;  2JTT A;  1JSA A;  5BPJ A;  4CLN A;  1HT9 A;  2GV5 A;  3HCM A;  1LA0 A;  2ZRT A;  1KFU L;  3TS5 C;  1W7J B;  2H61 A;  2CCM A;  2R2I A;  1SR6 C;  1ODB A;  2BBN A;  1N65 A;  1S6I A;  4USL A;  1AUI B;  1TRF A;  1K93 D;  4P2Y B;  5CSI A;  3D0Y B;  2KYF A;  2G2B A;  2OPO A;  2WC8 A;  5AER A;  1TN4 A;  2MHH A;  4TNC A;  1Q80 A;  2CT9 A;  1YUT A;  1KQV A;  1WY9 A;  4HSZ A;  2QAC A;  2LVJ A;  2I7A A;  1BT6 A;  2K7B A;  3BQ3 A;  3SG7 A;  1QLK A;  1A4P A;  3M0W A;  1B47 A;  2D8N A;  1S5G Z;  3GK4 X;  4OR9 B;  3LK1 A;  1UWO A;  1DF0 B;  1SR6 B;  3VRQ A;  1XFX O;  2AUC A;  4ZCU A;  2LAP A;  4MLW A;  5JJG A;  2CBL A;  2LE9 B;  1F54 A;  2WND A;  1GJY A;  2M29 A;  2KDH A;  4MZJ A;  3I5G C;  1NCZ A;  5PAL A; 
#chains in the Genus database with same CATH topology
 1DJW A;  1QX2 A;  1CM4 A;  1YTZ C;  3D73 A;  3N7H A;  4PE0 A;  1H4B A;  2F3Y A;  1KCY A;  1TTX A;  3DF0 B;  1C7V A;  1JFK A;  2PVB A;  4MEW A;  1WRZ A;  4PT1 A;  2LMV A;  4INW A;  4PHM A;  1OOI X;  1UHN A;  4I5J A;  2MRD A;  5B8I B;  1OE9 B;  5G08 A;  1K2H A;  1TWO A;  1A75 B;  2L4I A;  2ZFD A;  1J1E A;  1RTP 1;  3OGN A;  1X02 A;  2BKH B;  4NDC A;  2K7D A;  2KHN A;  2Y4Q A;  3BFB A;  5CSN A;  3HX4 A;  2MJW B;  2MA2 A;  4CPV A;  3E3R A;  2HF5 A;  3L4L A;  3I5G B;  2TN4 A;  4NDD A;  1NX2 A;  1DJH A;  1K95 A;  2BL0 C;  1W7I B;  1TNP A;  2LUC A;  2O5G A;  4MRY A;  2E30 A;  1AJ4 A;  1BMO A;  2FJU B;  3CDN A;  3CZ0 A;  3IQO A;  4U8D A;  5AAN A;  1QWV A;  2JOJ A;  1REC A;  1QIV A;  2BKI B;  4JQ0 D;  1LIN A;  4I5N B;  2EGD A;  1S36 A;  5ER5 A;  1R2U A;  2LLS A;  4PE1 A;  2M7L A;  1EL4 A;  1XA5 A;  2CNP A;  2BCX A;  1DVI A;  4GGF C;  1CB1 A;  4YGB B;  2G9B A;  4N5X A;  4XJK A;  1SY9 A;  1MUX A;  3SS3 A;  1BR1 B;  2I18 A;  2RGI A;  1L2O B;  2LHL A;  3EK8 A;  3OB2 B;  4F7F A;  1B7T Y;  3AKB A;  3GK1 A;  4HRH A;  5J3X A;  2BL0 B;  4C0K A;  2BE4 A;  3S0D A;  3VRR A;  1G33 A;  1NUB A;  2AAO A;  2JWW A;  2ZND A;  1TUZ A;  2I94 A;  3PM2 A;  1SSE B;  3CTN A;  1AVS A;  5HLV A;  3FWB A;  1IKU A;  1NSH A;  1LKJ A;  3BYA A;  3SG3 A;  2KOT A;  1SMG A;  1S1E A;  2KQY A;  1XFR A;  2WC5 A;  5HL1 A;  4ORC B;  2JT3 A;  4IL1 A;  4WRI A;  2KBI A;  3S0B A;  4DS7 A;  1SCV A;  1MXL C;  3D0Y A;  3PAL A;  3DVE A;  1KSM A;  1QX7 A;  2KAX A;  1ZOT B;  3FE8 A;  1EJ3 A;  1K8U A;  1NIW A;  2QEO A;  3ZNI A;  1SNL A;  1Y1X A;  1J7Q A;  1QV1 A;  1CMF A;  1YX8 A;  2Q91 A;  1VRK A;  4DCK A;  4N1F A;  1FW4 A;  3CZ1 A;  3PFV A;  2M1U A;  2NCO A;  2NXQ A;  1N0Y A;  5DKN A;  3DZT A;  2MLF C;  1Y1U A;  4JWQ A;  1M46 A;  4MRX A;  1DF0 A;  4MZK A;  5K89 A;  1DMO A;  2PAS A;  5DKQ A;  3DY9 A;  2QEH A;  1CMG A;  2JTZ A;  4YGC B;  3D77 A;  2ISD A;  2GTE A;  2M97 A;  1ZUZ A;  2QEV A;  2H8V A;  3NHT A;  1SYM A;  1DT7 B;  1CDM A;  2L51 A;  1K9P A;  2OS8 C;  3EVU A;  1SL9 A;  4YRU A;  1JWD A;  3NSO A;  1YVL A;  2KI4 C;  3DF0 A;  1UHK A;  2WCE A;  4FQT A;  5HYD A;  1PUL A;  2Y5I A;  4I5L B;  1OMV A;  1PRW A;  1ZMZ A;  1B1G A;  2ZRS A;  1A75 A;  1QVI Y;  3BOW A;  4ZCV A;  1MR8 A;  1MHO A;  5HKW A;  4OV2 A;  2L4H A;  2LLT A;  1UHJ A;  1V1F A;  2JT0 A;  1P28 A;  3CS1 A;  2F8P A;  1IJ6 A;  1Y0V H;  1SPY A;  4IJ7 A;  3VRN A;  2OS8 B;  3OBV A;  5KTY A;  3KF9 A;  2KFF A;  3CZ2 A;  1TNX A;  4OZD A;  2L5Y A;  1JF0 A;  2WCB A;  2ERB A;  3V2L A;  4D1E A;  3R1P A;  1J7O A;  2HQW A;  1IWQ A;  3SG5 A;  1DJG A;  1CTR A;  3SIB A;  1F70 A;  3NSI A;  2LC5 A;  3CGA A;  3TDI A;  1OMR A;  2WCL A;  3TS5 B;  3S0G A;  1DJZ A;  2LVV A;  2KSP A;  2Y1N A;  5GQQ C;  1SK6 D;  2B1U A;  3VRP A;  1CLL A;  4YGD B;  1CLM A;  1NPQ A;  1V1G A;  2WCM A;  3AAK A;  1K90 D;  2BCA A;  2PQL A;  3BUM B;  1S3P A;  3R72 A;  2JPT A;  4PDZ A;  3O78 A;  3RLZ A;  4GPL B;  2F2O A;  1CNP A;  3IQQ A;  1BG1 A;  1OZS A;  2LP3 A;  2WCJ A;  2P71 A;  2JZI A;  3K1E A;  2EC6 C;  3L47 A;  4YI9 A;  4M2O A;  1LXF C;  1NYA A;  1UUR A;  1PAL A;  2SCP A;  3D74 A;  2IS9 A;  3D76 A;  1RJV A;  4YI8 A;  3AKA A;  1YVH A;  1IGV A;  2K8M B;  3BOW B;  4GGF A;  2F3Z A;  4MSP A;  2ZNE A;  1AJ5 A;  2M9G A;  4PE7 A;  1XYD A;  3S0A A;  2PRU A;  3WHU B;  2GGZ A;  1XFV O;  1M45 A;  1WDC C;  2ZKM X;  4CFQ A;  1FBV A;  3LLE A;  5CSJ A;  1F4Q A;  1GGZ A;  3CR5 X;  3JVT C;  3L4A A;  3NSL A;  4HRG A;  1GM0 A;  2E6W A;  1KSO A;  1XO5 A;  3CR4 X;  4YGA A;  1SCM C;  2EC6 B;  1NX3 A;  2KQ6 A;  1GGW A;  5AXI A;  4PCW A;  2KPH A;  3EK7 A;  3SJS A;  2BCB A;  1SKT A;  2LMT A;  2V53 A;  1XFW O;  5DKR A;  1J7R A;  1QLS A;  2OTG C;  3TDZ A;  5I8N A;  1IH0 A;  1K96 A;  1KFX L;  1U5I B;  2WC6 A;  2K2F A;  5D3O A;  2ZN8 A;  3A8R A;  1NP8 A;  2LCP A;  4GNK B;  1BU3 A;  2K2A A;  2JU0 A;  1BOD A;  1WLZ A;  3SG4 A;  1F8H A;  1SW8 A;  3A4U B;  3JVT B;  4A4B A;  5EL2 A;  1OMD A;  1E8A A;  2KFH A;  1LA3 A;  3R1V A;  3FWC A;  1SBJ A;  1SCM B;  3GOF A;  2GGM A;  1OOF A;  3I5I C;  3PAT A;  4Q04 A;  1J55 A;  2MAZ A;  5CPV A;  1T14 A;  4WQ2 A;  1PVA A;  1H8B A;  3ICB A;  2OTG B;  2LVK A;  1OOG A;  4ETO A;  1QJT A;  1IJ5 A;  2K7O A;  3EVR A;  1UHI A;  3UO9 A;  2LP2 A;  1Z4H A;  1YRU B;  1DC1 A;  1NX1 A;  4M2Q A;  1EH2 A;  2SAS A;  1PVB A;  3D10 A;  1G8I A;  1GQM A;  4QJ4 B;  4CID A;  4AQI A;  4PAL A;  4JKT A;  1DGV A;  2FOT A;  4I5K A;  1BR4 B;  3BJH A;  3RZS A;  3NGV A;  1JFJ A;  3I5F C;  1DJX A;  1XK4 C;  1Y1A A;  3FS7 A;  3I5I B;  4NQG A;  3QRX A;  3VRO A;  2FJY A;  5CSF A;  3B87 A;  1PSB A;  1F55 A;  2KGB C;  2PSR A;  2KYC A;  3JTD C;  1WRK A;  3O4Y A;  4E68 A;  3CYZ A;  1B8L A;  3IF7 A;  2BBM A;  3GK2 A;  3KPX A;  1C7W A;  5AEQ A;  4DIR A;  2JUL A;  3NXA A;  3VGO A;  2K7C A;  4YBH B;  2MBX A;  1BLQ A;  1A2X A;  1B9A A;  2JT8 A;  2PAL A;  3SG2 A;  1A03 A;  4BY5 A;  1SL8 A;  4ORA B;  3WHT B;  1IQ5 A;  2MLE C;  2KAV A;  3B7A A;  1TNQ A;  4L9M A;  3CZT X;  1ORG A;  2WOS A;  4QJ3 B;  1KK7 Z;  2KBM A;  2M0R A;  3I5F B;  2KLE A;  1A29 A;  1S5G Y;  1SRA A;  4DRW A;  3OHM B;  1NWD A;  3PN7 C;  1KWO C;  1FI6 A;  1DJI A;  1RWY A;  3JTD B;  5F6T A;  3PLF B;  3B88 A;  1YX7 A;  2K60 A;  4YGE B;  2LAN A;  3WNX B;  1PK0 D;  1UP5 A;  1EXR A;  2LNK A;  1CLB A;  1WRL A;  3NHI A;  2P70 A;  2A4J A;  4ICB A;  2L5X B;  1DEK A;  3K21 A;  1B8C A;  3CAB A;  1AHR A;  5I94 A;  1AK8 A;  1BJF A;  2P6B B;  5DIC A;  4F0Z B;  1OSA A;  2WCF A;  1EG4 A;  3WXA A;  1CKK A;  1J7P A;  1CM1 A;  1M31 A;  2KI4 B;  1M39 A;  3ZWH A;  1QAT A;  3PN7 B;  4XYN A;  1KWO B;  2LV7 A;  4GFT A;  2F2P A;  3BUN B;  5FI2 A;  1U5I A;  1XFY O;  2QPT A;  1C3Z A;  1FPW A;  1CFC A;  2L98 A;  4FQO A;  3MSE B;  4GUK A;  1KFU S;  2M3W A;  2KGR A;  1CDP A;  1B4C A;  3OX5 A;  1RFJ A;  3TUY C;  1MF8 B;  1ZAC A;  3OX6 A;  3SG6 A;  5HLO A;  2BEC A;  1Z2C B;  2LMU A;  2EHB A;  1NCX A;  3EK4 A;  1LVC D;  3SS4 A;  1JC2 A;  3OP0 A;  2L0P A;  2KFG A;  2NLN A;  4OVN F;  1N2D A;  2K61 A;  3PM8 A;  3S0E A;  2KNE A;  2VRG A;  1OZO A;  3SS5 A;  4AOM A;  3CLN A;  2QDI A;  1DTL A;  4KYN A;  2L2C A;  3H4S E;  3AAJ A;  3NSK A;  2H61 C;  5ER4 X;  1OQP A;  1YUS A;  2KI6 D;  1QV0 A;  2NCP A;  1ZFS A;  2QEB A;  4ORB B;  1QVI Z;  1TOP A;  2WOR A;  3TUY B;  3D78 A;  5I2O A;  3B86 A;  2KI6 C;  2ZN9 A;  5I2L A;  3TZ1 A;  2HPS A;  2LLU A;  2NZ0 A;  2M1K B;  4C0J A;  4UPG A;  1EG3 A;  4HRE E;  2PMY A;  3SIA A;  4JPZ B;  3RM1 A;  2BE6 A;  1SL7 A;  4GBA A;  4A4C A;  1CDN A;  1JF2 A;  1K9K A;  1QTX A;  1YRT B;  2BAP A;  1YUR A;  2WCH A;  1MWN A;  5D69 A;  5HKZ A;  1JBA A;  1QX5 B;  1F71 A;  3BXK A;  3DVM A;  1WDC B;  1DQE A;  1MXE A;  3BUW B;  3O2P A;  4INX A;  1BF5 A;  1M63 B;  1MQ1 A;  3TDU A;  1L2O C;  5JOL A;  1RRO A;  1KK8 C;  1CDL A;  1CFP A;  1XK4 A;  2JC2 A;  3S0F A;  2PYQ A;  5D7F A;  1TCO B;  4PHN A;  3EG5 B;  3Q8I A;  2FCD A;  1OOJ A;  2JXC A;  2M49 B;  3I5H C;  3OB1 B;  1QAS A;  2FCE A;  2WCK A;  3LK0 A;  3KO0 A;  1NCY A;  1WLM A;  2HET A;  2KAY A;  5HKY A;  1K94 A;  2HQ8 A;  1KFX S;  1DEL A;  2JNF A;  5I2Q A;  1G4Y R;  3B6X A;  3DVK A;  3DVJ A;  4OCI A;  1C07 A;  3C1V A;  1W9Z A;  1KK7 Y;  2LHI A;  5AFP A;  4QJ5 B;  1IRJ A;  4MVF A;  1JUO A;  2LM5 A;  4FTG A;  5KSZ A;  1KQM C;  3BUX B;  1KK8 B;  3EVV A;  2JRF A;  1S26 D;  2COL B;  4MBE A;  3UNW A;  2L50 A;  4N1G A;  4BY4 A;  1LS8 A;  2K0J A;  4P5O E;  4PE4 A;  4CFR A;  3FIA A;  2CXJ A;  1S6J A;  3CWG A;  2I2R E;  4MZL A;  4GGN A;  3I5H B;  2F33 A;  3PJI A;  1DJY A;  1QXP A;  5TNC A;  1IQ3 A;  1B8R A;  2CTN A;  2AMI A;  2M8U A;  1XFU O;  1DGU A;  2O60 A;  3KHE A;  3IVT A;  1CFD A;  4MN0 A;  4NDB A;  3LL8 B;  5KU1 A;  2H2K A;  1ALW A;  1HQV A;  1NX0 A;  1QS7 A;  1FF1 A;  3BUO B;  2Q4U A;  3PSR A;  2JQ6 A;  1OOH A;  1KQM B;  1UUS A;  3F45 A;  4M2P A;  3R1O A;  1D1O A;  1UHH A;  2KLD A;  1TCF A;  1FI5 A;  1ALV A;  4PHJ A;  3LCP C;  1QIW A;  1L7Z A;  2JXL A;  1IIO A;  3EKJ A;  3CR2 A;  1RK9 A;  1B7T Z;  4OKH A;  1CFF A;  3KEV A;  2LUX A;  1PSR A;  1TIZ A;  2DOQ A;  2M7N A;  1C3Y A;  1BOC A;  2JNX A;  1TNW A;  1S6C A;  1R6P A;  1AP4 A;  4DUQ A;  1J1D A;  4JD9 A;  4GAO A;  4WQ3 A;  2LVI A;  3O6B A;  1Y6W A;  4XJK B;  4C0L A;  5IBW A;  1K9U A;  4PHK A;  1YUU A;  3DD4 A;  4R1E A;  1XVJ A;  3FE6 A;  1TUJ A;  1F4O A;  2Y1M A;  3FE9 A;  3EKH A;  2L2E A;  2YGU A;  5FYX A;  4AQJ A;  1XFZ O;  3DXL A;  1IG5 A;  1YR5 A;  2JTT A;  1JSA A;  5BPJ A;  4CLN A;  1HT9 A;  2GV5 A;  3O4X A;  3HCM A;  5FI7 A;  1LA0 A;  2ZRT A;  1KFU L;  3TS5 C;  1W7J B;  2H61 A;  2CCM A;  2R2I A;  1SR6 C;  1ODB A;  2BBN A;  3BFH A;  1N65 A;  5FI6 A;  1S6I A;  4USL A;  1AUI B;  3DYE A;  1TRF A;  1K93 D;  4P2Y B;  5CSI A;  3D0Y B;  2KYF A;  2G2B A;  2OPO A;  2WC8 A;  5AER A;  1TN4 A;  2MHH A;  4TNC A;  1Q80 A;  2CT9 A;  1YUT A;  3BFA A;  1KQV A;  1WY9 A;  4HSZ A;  2QAC A;  2LVJ A;  2I7A A;  1BT6 A;  2K7B A;  3BQ3 A;  3SG7 A;  1QLK A;  1A4P A;  3M0W A;  1B47 A;  2D8N A;  3D75 A;  2BNX A;  1S5G Z;  3GK4 X;  4OR9 B;  3LK1 A;  1UWO A;  1DF0 B;  1SR6 B;  3VRQ A;  1XFX O;  2AUC A;  1OW4 A;  4ZCU A;  2LAP A;  4MLW A;  5JJG A;  2CBL A;  2LE9 B;  1F54 A;  2JPO A;  2WND A;  1GJY A;  3QME A;  2M29 A;  3VB1 A;  2KDH A;  4MZJ A;  3I5G C;  1NCZ A;  5PAL A; 
#chains in the Genus database with same CATH homology
 1DJW A;  1QX2 A;  1CM4 A;  1YTZ C;  1H4B A;  4PE0 A;  1KCY A;  2F3Y A;  1TTX A;  3DF0 B;  1C7V A;  1JFK A;  2PVB A;  4MEW A;  1WRZ A;  2LMV A;  4PHM A;  4I5J A;  1UHN A;  5B8I B;  2MRD A;  1K2H A;  1OE9 B;  5G08 A;  1A75 B;  2L4I A;  2ZFD A;  1J1E A;  1RTP 1;  1X02 A;  2BKH B;  4NDC A;  2K7D A;  2KHN A;  2Y4Q A;  5CSN A;  3HX4 A;  2MJW B;  2MA2 A;  4CPV A;  3E3R A;  2HF5 A;  3I5G B;  2TN4 A;  4NDD A;  1NX2 A;  1DJH A;  1K95 A;  2BL0 C;  1W7I B;  1TNP A;  2LUC A;  2O5G A;  4MRY A;  2E30 A;  1AJ4 A;  1BMO A;  2FJU B;  3IQO A;  4U8D A;  5AAN A;  2JOJ A;  1REC A;  1QIV A;  2BKI B;  4JQ0 D;  1LIN A;  4I5N B;  2EGD A;  1S36 A;  5ER5 A;  1R2U A;  2LLS A;  4PE1 A;  2M7L A;  1EL4 A;  1XA5 A;  2CNP A;  2BCX A;  1DVI A;  4GGF C;  1CB1 A;  4YGB B;  2G9B A;  4N5X A;  4XJK A;  1SY9 A;  1MUX A;  1BR1 B;  2I18 A;  2RGI A;  1L2O B;  2LHL A;  3EK8 A;  3OB2 B;  1B7T Y;  3AKB A;  3GK1 A;  4HRH A;  5J3X A;  2BL0 B;  4C0K A;  2BE4 A;  3VRR A;  1G33 A;  1NUB A;  2AAO A;  2JWW A;  2ZND A;  2I94 A;  3CTN A;  1AVS A;  5HLV A;  3FWB A;  1IKU A;  1NSH A;  1LKJ A;  3BYA A;  3SG3 A;  2KOT A;  1SMG A;  1S1E A;  2KQY A;  4ORC B;  2JT3 A;  4IL1 A;  4WRI A;  2KBI A;  4DS7 A;  1SCV A;  1MXL C;  3D0Y A;  3PAL A;  3DVE A;  1KSM A;  1QX7 A;  2KAX A;  1ZOT B;  1EJ3 A;  1K8U A;  1NIW A;  3ZNI A;  1SNL A;  1Y1X A;  1J7Q A;  1QV1 A;  1CMF A;  1YX8 A;  2Q91 A;  1VRK A;  4DCK A;  4N1F A;  1FW4 A;  3PFV A;  2M1U A;  2NCO A;  2NXQ A;  1N0Y A;  5DKN A;  2MLF C;  1Y1U A;  4JWQ A;  1M46 A;  4MRX A;  1DF0 A;  4MZK A;  5K89 A;  1DMO A;  2PAS A;  5DKQ A;  1CMG A;  2JTZ A;  4YGC B;  2ISD A;  2M97 A;  1ZUZ A;  1SYM A;  1DT7 B;  1CDM A;  2L51 A;  1K9P A;  2OS8 C;  3EVU A;  1SL9 A;  4YRU A;  1JWD A;  3NSO A;  1YVL A;  2KI4 C;  3DF0 A;  1UHK A;  2WCE A;  5HYD A;  1PUL A;  2Y5I A;  4I5L B;  1OMV A;  1PRW A;  1ZMZ A;  1B1G A;  2ZRS A;  1A75 A;  1QVI Y;  3BOW A;  4ZCV A;  1MR8 A;  1MHO A;  5HKW A;  4OV2 A;  2L4H A;  2LLT A;  1UHJ A;  1V1F A;  2JT0 A;  3CS1 A;  2F8P A;  1IJ6 A;  1Y0V H;  1SPY A;  3VRN A;  2OS8 B;  5KTY A;  3KF9 A;  2KFF A;  1TNX A;  1JF0 A;  2WCB A;  1J7O A;  4D1E A;  2HQW A;  1IWQ A;  3SG5 A;  1DJG A;  1CTR A;  3SIB A;  1F70 A;  3NSI A;  2LC5 A;  3CGA A;  3TDI A;  1OMR A;  3TS5 B;  1DJZ A;  2LVV A;  2KSP A;  2Y1N A;  5GQQ C;  1SK6 D;  2B1U A;  3VRP A;  1CLL A;  4YGD B;  1CLM A;  1NPQ A;  1V1G A;  3AAK A;  1K90 D;  2BCA A;  3BUM B;  1S3P A;  4PDZ A;  2JPT A;  3O78 A;  3RLZ A;  4GPL B;  2F2O A;  1CNP A;  3IQQ A;  1BG1 A;  1OZS A;  2LP3 A;  4YI9 A;  2JZI A;  2EC6 C;  4M2O A;  1LXF C;  1NYA A;  1UUR A;  1PAL A;  2SCP A;  2IS9 A;  1RJV A;  4YI8 A;  3AKA A;  1YVH A;  1IGV A;  2K8M B;  3BOW B;  4GGF A;  2F3Z A;  4MSP A;  2ZNE A;  1AJ5 A;  2M9G A;  4PE7 A;  1XYD A;  2PRU A;  3WHU B;  2GGZ A;  1XFV O;  1M45 A;  1WDC C;  2ZKM X;  4CFQ A;  1FBV A;  3LLE A;  5CSJ A;  1F4Q A;  1GGZ A;  3CR5 X;  3JVT C;  3NSL A;  4HRG A;  2E6W A;  1KSO A;  1XO5 A;  3CR4 X;  4YGA A;  1SCM C;  2EC6 B;  1NX3 A;  2KQ6 A;  1GGW A;  5AXI A;  4PCW A;  3EK7 A;  3SJS A;  2BCB A;  1SKT A;  2LMT A;  2V53 A;  1XFW O;  5DKR A;  1J7R A;  1QLS A;  2OTG C;  3TDZ A;  5I8N A;  1IH0 A;  1K96 A;  1KFX L;  1U5I B;  2K2F A;  2ZN8 A;  3A8R A;  1NP8 A;  2LCP A;  4GNK B;  1BU3 A;  2K2A A;  2JU0 A;  1BOD A;  1WLZ A;  3SG4 A;  1F8H A;  1SW8 A;  3A4U B;  3JVT B;  4A4B A;  1OMD A;  1E8A A;  2KFH A;  1LA3 A;  3FWC A;  1SBJ A;  1SCM B;  3GOF A;  2GGM A;  3PAT A;  3I5I C;  4Q04 A;  5CPV A;  1J55 A;  2MAZ A;  4WQ2 A;  1PVA A;  1H8B A;  3ICB A;  2OTG B;  2LVK A;  4ETO A;  1QJT A;  1IJ5 A;  2K7O A;  3EVR A;  1UHI A;  2LP2 A;  1YRU B;  1NX1 A;  4M2Q A;  1EH2 A;  2SAS A;  1PVB A;  3D10 A;  1G8I A;  1GQM A;  4QJ4 B;  4CID A;  4AQI A;  4PAL A;  1DGV A;  2FOT A;  4I5K A;  1BR4 B;  1JFJ A;  3I5F C;  1DJX A;  1XK4 C;  1Y1A A;  3FS7 A;  3I5I B;  4NQG A;  3QRX A;  3VRO A;  5CSF A;  1PSB A;  1F55 A;  2KGB C;  2PSR A;  2KYC A;  3JTD C;  1WRK A;  3O4Y A;  4E68 A;  1B8L A;  3IF7 A;  2BBM A;  3GK2 A;  3KPX A;  1C7W A;  5AEQ A;  4DIR A;  2JUL A;  3NXA A;  3VGO A;  2K7C A;  4YBH B;  2MBX A;  1BLQ A;  1A2X A;  1B9A A;  2JT8 A;  2PAL A;  3SG2 A;  1A03 A;  4BY5 A;  1SL8 A;  4ORA B;  3WHT B;  1IQ5 A;  2MLE C;  2KAV A;  1TNQ A;  4L9M A;  3CZT X;  4QJ3 B;  2WOS A;  1KK7 Z;  2KBM A;  2M0R A;  3I5F B;  1A29 A;  1S5G Y;  1SRA A;  4DRW A;  3OHM B;  1NWD A;  3PN7 C;  1KWO C;  1FI6 A;  1DJI A;  1RWY A;  3JTD B;  5F6T A;  3PLF B;  4YGE B;  1YX7 A;  2LAN A;  3WNX B;  1PK0 D;  1UP5 A;  1EXR A;  2LNK A;  1CLB A;  1WRL A;  2A4J A;  4ICB A;  2L5X B;  3K21 A;  1B8C A;  1AHR A;  1AK8 A;  1BJF A;  2P6B B;  4F0Z B;  1J7P A;  1OSA A;  2WCF A;  1EG4 A;  3WXA A;  1CKK A;  1CM1 A;  1M31 A;  2KI4 B;  1M39 A;  3ZWH A;  1QAT A;  3PN7 B;  4XYN A;  1KWO B;  2LV7 A;  4GFT A;  2F2P A;  3BUN B;  1U5I A;  1XFY O;  2QPT A;  1FPW A;  1CFC A;  2L98 A;  4FQO A;  3MSE B;  4GUK A;  1KFU S;  2M3W A;  2KGR A;  1CDP A;  1B4C A;  3OX5 A;  1RFJ A;  3TUY C;  1MF8 B;  1ZAC A;  3OX6 A;  3SG6 A;  5HLO A;  2BEC A;  3EK4 A;  2LMU A;  2EHB A;  1NCX A;  1LVC D;  1JC2 A;  3OP0 A;  2L0P A;  2KFG A;  2NLN A;  4OVN F;  1N2D A;  2K61 A;  3PM8 A;  2KNE A;  2VRG A;  1OZO A;  4AOM A;  3CLN A;  1DTL A;  3H4S E;  3AAJ A;  3NSK A;  2H61 C;  5ER4 X;  1OQP A;  1YUS A;  2KI6 D;  1QV0 A;  2NCP A;  1ZFS A;  4ORB B;  1QVI Z;  1TOP A;  2WOR A;  3TUY B;  5I2O A;  2KI6 C;  2ZN9 A;  5I2L A;  3TZ1 A;  2HPS A;  2LLU A;  2NZ0 A;  2M1K B;  4C0J A;  4UPG A;  1EG3 A;  4HRE E;  2PMY A;  3SIA A;  4JPZ B;  3RM1 A;  2BE6 A;  1SL7 A;  4GBA A;  4A4C A;  1CDN A;  1JF2 A;  1K9K A;  1QTX A;  1YRT B;  1YUR A;  5D69 A;  1MWN A;  5HKZ A;  1JBA A;  1QX5 B;  1F71 A;  3BXK A;  3DVM A;  1WDC B;  1MXE A;  3BUW B;  3O2P A;  1BF5 A;  1M63 B;  1MQ1 A;  3TDU A;  1L2O C;  5JOL A;  1RRO A;  1KK8 C;  1CDL A;  1CFP A;  1XK4 A;  2JC2 A;  5D7F A;  1TCO B;  4PHN A;  2FCD A;  1OOJ A;  2JXC A;  2M49 B;  3I5H C;  3OB1 B;  1QAS A;  2FCE A;  3LK0 A;  3KO0 A;  1NCY A;  1WLM A;  2HET A;  2KAY A;  5HKY A;  1K94 A;  2HQ8 A;  1KFX S;  2JNF A;  5I2Q A;  1C07 A;  1G4Y R;  4OCI A;  3DVK A;  3DVJ A;  3C1V A;  2LHI A;  1KK7 Y;  5AFP A;  4QJ5 B;  1IRJ A;  4MVF A;  1JUO A;  2LM5 A;  4FTG A;  5KSZ A;  1KQM C;  3BUX B;  1KK8 B;  3EVV A;  2JRF A;  1S26 D;  2COL B;  4MBE A;  2L50 A;  4N1G A;  4BY4 A;  4P5O E;  2K0J A;  4PE4 A;  4CFR A;  3FIA A;  2CXJ A;  1S6J A;  3CWG A;  2I2R E;  4MZL A;  4GGN A;  3I5H B;  2F33 A;  1DJY A;  1QXP A;  5TNC A;  1IQ3 A;  1B8R A;  2CTN A;  2AMI A;  2M8U A;  1XFU O;  1DGU A;  2O60 A;  3KHE A;  4MN0 A;  1CFD A;  4NDB A;  3LL8 B;  5KU1 A;  2H2K A;  1ALW A;  1HQV A;  1NX0 A;  1QS7 A;  1FF1 A;  3BUO B;  2Q4U A;  3PSR A;  2JQ6 A;  1KQM B;  1UUS A;  3F45 A;  4M2P A;  1D1O A;  1UHH A;  1FI5 A;  1TCF A;  1ALV A;  4PHJ A;  3LCP C;  1QIW A;  1L7Z A;  2JXL A;  3EKJ A;  3CR2 A;  1RK9 A;  1B7T Z;  4OKH A;  1CFF A;  3KEV A;  2LUX A;  1PSR A;  1TIZ A;  2DOQ A;  2M7N A;  1BOC A;  2JNX A;  1TNW A;  1S6C A;  1R6P A;  1AP4 A;  4DUQ A;  1J1D A;  4GAO A;  4WQ3 A;  2LVI A;  3O6B A;  1Y6W A;  4XJK B;  4C0L A;  5IBW A;  1K9U A;  4PHK A;  1YUU A;  3DD4 A;  4R1E A;  1XVJ A;  2Y1M A;  1F4O A;  3EKH A;  2L2E A;  5FYX A;  4AQJ A;  1XFZ O;  1IG5 A;  1YR5 A;  2JTT A;  1JSA A;  5BPJ A;  4CLN A;  1HT9 A;  2GV5 A;  3HCM A;  1LA0 A;  2ZRT A;  1KFU L;  3TS5 C;  1W7J B;  2H61 A;  2CCM A;  2R2I A;  1SR6 C;  1ODB A;  2BBN A;  1N65 A;  1S6I A;  4USL A;  1AUI B;  1TRF A;  1K93 D;  4P2Y B;  5CSI A;  3D0Y B;  2KYF A;  2G2B A;  2OPO A;  2WC8 A;  5AER A;  1TN4 A;  2MHH A;  4TNC A;  1Q80 A;  2CT9 A;  1YUT A;  1KQV A;  1WY9 A;  4HSZ A;  2QAC A;  2LVJ A;  2I7A A;  1BT6 A;  2K7B A;  3BQ3 A;  3SG7 A;  1QLK A;  1A4P A;  3M0W A;  1B47 A;  2D8N A;  1S5G Z;  3GK4 X;  4OR9 B;  3LK1 A;  1UWO A;  1DF0 B;  1SR6 B;  3VRQ A;  1XFX O;  2AUC A;  4ZCU A;  2LAP A;  4MLW A;  5JJG A;  2CBL A;  2LE9 B;  1F54 A;  2WND A;  1GJY A;  2M29 A;  2KDH A;  4MZJ A;  3I5G C;  1NCZ A;  5PAL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...