3WHUB

Crystal structure of ergic-53/mcfd2, calcium/man2-bound form
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
71
structure length
58
Chain Sequence
QLHYFKMHDYDGNNLLDGLELSTAITMSEDELINIIDGVLRDDDKNNDGYIDYAEFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein ERGIC-53
publication title Structural Basis for Disparate Sugar-Binding Specificities in the Homologous Cargo Receptors ERGIC-53 and VIP36
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 18
structure length 58
sequence length 71
ec nomenclature
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3whuB00
1KK8B 2IS9A 3M0WA 5PALA 3RM1A 1MQ1A 2A4JA 3I5FB 4C0JA 1XVJA 1MR8A 1XFXO 3CS1A 4E68A 4NDBA 1M39A 2WOSA 2F2PA 3CR5X 3DVJA 2K2FA 2K7CA 1PVAA 2SASA 4PALA 1F8HA 1QLKA 1DGUA 1Y6WA 1F55A 1J7QA 4N1FA 3AKBA 1L2OC 1WRZA 4BY4A 5K89A 2ISDA 4AOMA 4GGFA 2JULA 3VRNA 3AAJA 2LLSA 3IQOA 4TNCA 1G4YR 2AAOA 3ICBA 1QV1A 4MN0A 4DS7A 4YI9A 4YI8A 1RFJA 1FPWA 1U5IA 4YBHB 1CB1A 1YVHA 1BLQA 3PSRA 2CXJA 1QIWA 2LC5A 4HSZA 2KGRA 4MRXA 1QVIY 1S6IA 3TS5B 2H2KA 4XYNA 3HCMA 1B47A 1QX5B 1R2UA 1DT7B 1QASA 1UUSA 2WORA 1B8CA 2M3WA 1Y0VH 3TDIA 1WY9A 2KI6D 1MXLC 3CZTX 1K9KA 1GGWA 3JVTB 5DKNA 1SNLA 2OTGC 1YTZC 1AJ4A 1S3PA 4P2YB 1K9UA 2KAXA 2WCBA 1OMVA 1YUUA 5CSNA 5AERA 3EVRA 3EK4A 2LUCA 5D7FA 1W7IB 1B7TZ 1S1EA 1DJGA 3AKAA 4OR9B 1KQVA 4DCKA 2LHIA 1FI5A 2M1KB 3PLFB 5HLOA 1UHHA 2G2BA 4U8DA 1TNQA 3JTDB 3BXKA 3PN7C 1CFCA 1FF1A 2LMTA 2ZN9A 3DVKA 3CR2A 2I2RE 1X02A 3GK4X 1SCMC 2LVKA 4GGNA 4MZJA 3F45A 2TN4A 1XFYO 4MLWA 3OX6A 1J1EA 2L0PA 2LMUA 3PFVA 4GNKB 4USLA 2Y5IA 4PCWA 1IGVA 4A4BA 3LL8B 3BUXB 1YX8A 3FS7A 2K2AA 2JWWA 1LKJA 2D8NA 4N5XA 1CLLA 2PMYA 2M7LA 3EVVA 5I2QA 3O2PA 4PHJA 3SIBA 1TN4A 2F3YA 2H61A 2FJUB 3A4UB 4QJ4B 2EGDA 3SIAA 1A75B 1AVSA 1A4PA 5BPJA 2OPOA 4MBEA 5AXIA 3VRRA 1NSHA 2KFHA 2M1UA 3CWGA 1EG3A 4MVFA 2F8PA 2KNEA 2Y1NA 1OOJA 2V53A 1DJZA 1F4OA 1KCYA 2KGBC 2ZNDA 1KWOB 5HKYA 1JFKA 1S5GZ 1ZOTB 2HQ8A 2I94A 4HREE 1DJYA 5GQQC 1Y1XA 5AEQA 3GK1A 1UP5A 4OV2A 1H4BA 1K8UA 1NCYA 2GGZA 2LLUA 1WDCC 1KSMA 2PSRA 2BL0C 2SCPA 2L98A 2LV7A 1F54A 1KSOA 1XFZO 2G9BA 1S6CA 2KYFA 3TZ1A 5ER4X 4ETOA 1FW4A 4YGEB 1A2XA 1HQVA 4BY5A 4YGDB 4YGAA 1QXPA 4AQIA 2B1UA 1F70A 1WLMA 1D1OA 1IG5A 1QJTA 2EC6B 1GJYA 3SG7A 1L2OB 2MRDA 2JTZA 2K61A 1B1GA 1OSAA 1ODBA 2BBMA 1M63B 2EHBA 5DKQA 2KQ6A 2LVIA 4C0LA 2KYCA 1G33A 3OB2B 1XK4A 2KAVA 1K95A 1IQ5A 3O78A 3AAKA 2ZRSA 3WXAA 1RTP1 2JOJA 1QVIZ 1SMGA 3I5GC 1EXRA 2L4IA 3EVUA 1XFUO 1TIZA 1W7JB 1OQPA 5I8NA 3CGAA 5G08A 2COLB 4JQ0D 1G8IA 1DJHA 4NQGA 1TOPA 2HETA 3PATA 1BU3A 1H8BA 1YVLA 1Y1AA 2E6WA 1AK8A 3VROA 1JC2A 1SR6C 3VRQA 1CM4A 1NYAA 1CKKA 1RECA 5CPVA 2F2OA 2FOTA 2L2EA 3EKHA 5HKZA 1MXEA 2OTGB 3KF9A 2LUXA 2NXQA 2OS8B 4QJ3B 2JPTA 4WRIA 2JXCA 1DF0A 4NDCA 1OMRA 2FCEA 1IWQA 1IQ3A 2KFGA 1BMOA 3KO0A 1BODA 2KHNA 2AMIA 3LLEA 2KAYA 4CFQA 1XFWO 2H61C 1CDMA 3GOFA 4MZKA 3I5FC 4PHMA 4HRGA 2K7OA 1KFUL 2LHLA 3FIAA 4PHNA 1K96A 1CLBA 1A03A 1NUBA 1V1GA 1SCMB 1PALA 1A75A 2JT3A 1CFPA 5TNCA 2LVVA 1CMFA 1QIVA 2O60A 1UWOA 2Y1MA 5JJGA 1ZUZA 1J7PA 4GUKA 1LVCD 2LCPA 5JOLA 1NCZA 1V1FA 1BT6A 2JXLA 2LMVA 2WNDA 2QPTA 4YGCB 3LCPC 1FI6A 2HQWA 4M2QA 1BG1A 4ORBB 2LVJA 1ALVA 2JU0A 3SJSA 3WHUB 1PRWA 1B9AA 3WNXB 1LINA 1Q80A 3NSOA 2BECA 1AHRA 1C07A 1RROA 1SL9A 2MLEC 4JPZB 3TDZA 3NSLA 2JNFA 2WCEA 3DVMA 1CLMA 3K21A 3LK1A 3RLZA 1A29A 2M49B 1UURA 2HF5A 2CNPA 1KFXS 4DIRA 1F4QA 3NXAA 5HKWA 1PVBA 1S6JA 3FWBA 1UHJA 3SG6A 4DRWA 2M97A 1YR5A 2M0RA 3TUYB 2MBXA 1XK4C 1KK7Y 2MLFC 1OZSA 5AFPA 1M31A 1DTLA 1BOCA 3EK8A 4YGBB 1JFJA 1K94A 1WDCB 2BL0B 1GGZA 1RWYA 1JSAA 3DF0B 4M2PA 5I2OA 1ZMZA 1J1DA 1AJ5A 4JWQA 2JTTA 1NWDA 3BOWB 4M2OA 4PE4A 2AUCA 2Q91A 5CSFA 2JQ6A 4GGFC 5HLVA 1ZACA 2RGIA 5CSJA 1EG4A 1SPYA 1TRFA 1YUSA 3E3RA 1OMDA 1EH2A 1N2DA 3IQQA 3LK0A 4QJ5B 1EL4A 3KEVA 1TTXA 2M29A 2K7BA 4L9MA 2GGMA 2BBNA 2JNXA 2K8MB 1EJ3A 2BKHB 1OZOA 4F0ZB 2LAPA 1DMOA 1MUXA 3I5GB 1PSRA 4PE1A 1JF2A 1IJ5A 5ER5A 1YX7A 3A8RA 4D1EA 3O4YA 3FWCA 1NIWA 3I5IC 3EKJA 1NX1A 1XFVO 4UPGA 1XYDA 2BCXA 4AQJA 2L5XB 5CSIA 2CTNA 5KU1A 2KQYA 1UHNA 1ZFSA 1NPQA 3DD4A 4DUQA 5KTYA 2NCOA 4CIDA 2CT9A 1XA5A 5B8IB 4ORAB 3HX4A 1AUIB 1SCVA 2PRUA 4ICBA 4ZCVA 2KI4C 2JT8A 5J3XA 1N65A 1J7RA 4WQ3A 3I5HC 1S36A 1M46A 2O5GA 1M45A 2NLNA 1SL8A 1ALWA 2LP3A 1BR4B 2ZN8A 1CDPA 2QACA 3OHMB 2JT0A 2KFFA 3MSEB 3DVEA 2KOTA 4OCIA 3BYAA 3ZNIA 1KQMC 1PSBA 2BKIB 1QTXA 3SG3A 3O6BA 1DJWA 5I2LA 1IKUA 1SL7A 1LA0A 1YRUB 3ZWHA 1PULA 1RJVA 4OVNF 1TCFA 5D69A 2KI6C 4CLNA 3H4SE 4MZLA 2PALA 3D0YB 4XJKB 4FQOA 2EC6C 3SG2A 1MHOA 2I18A 1AP4A 1TNWA 4IL1A 3CTNA 4GFTA 5AANA 1JUOA 2DOQA 3CR4X 4GBAA 4GPLB 2CBLA 1SKTA 2HPSA 5KSZA 1C7WA 1RK9A 1CMGA 4I5NB 1KK8C 2KBMA 1PK0D 1IH0A 1SBJA 3PN7B 2BCBA 2LP2A 2BCAA 3DF0A 2LLTA 1MWNA 2M7NA 4MSPA 1JWDA 4GAOA 2LNKA 2KDHA 2KSPA 2MAZA 1J7OA 1SYMA 3BOWA 3GK2A 2P6BB 1GQMA 1B8LA 1KK7Z 1TNPA 4MEWA 2CCMA 1CDLA 2L4HA 1JF0A 1BJFA 2R2IA 1VRKA 4I5JA 3OB1B 1C7VA 1E8AA 1QLSA 3PALA 1B4CA 1NP8A 2OS8C 4N1GA 1TNXA 1QS7A 3TS5C 4CPVA 2NZ0A 1SRAA 3QRXA 4YRUA 1LXFC 4HRHA 2FCDA 2JC2A 2GV5A 3SG5A 1S26D 1N0YA 4ORCB 3JVTC 1WRKA 1SW8A 2F33A 3BUWB 4P5OE 2MJWB 2I7AA 3BQ3A 4PDZA 1BR1B 1NCXA 1LA3A 1IRJA 4PHKA 5DKRA 1U5IB 2E30A 3PM8A 4A4CA 2K0JA 4FTGA 3VGOA 1HT9A 3D10A 1MF8B 1DF0B 2BE6A 2KBIA 3KHEA 2M8UA 3EK7A 4ZCUA 2LE9B 1JBAA 4R1EA 1CTRA 1CFFA 3NSIA 1B7TY 3C1VA 3JTDC 3KPXA 3SG4A 1DVIA 3I5IB 3WHTB 2JRFA 3OX5A 2F3ZA 2ZRTA 1OE9B 2MA2A 3IF7A 1Y1UA 1K93D 2WCFA 2ZFDA 1YUTA 1J55A 4MRYA 1CM1A 3BUOB 2LANA 1NX3A 3TDUA 1NX2A 1WRLA 4PE7A 4CFRA 5IBWA 3BUNB 3D0YA 4XJKA 1YURA 2K7DA 1UHIA 2KI4B 4PE0A 1DJIA 3TUYC 2ZNEA 3I5HB 4C0KA 1SK6D 1SY9A 2JZIA 1K2HA 2LM5A 1B8RA 1DGVA 1KFUS 2NCPA 1SR6B 1QV0A 2Y4QA 2MHHA 1FBVA 4Q04A 3BUMB 4WQ2A 2PVBA 2VRGA 1KQMB 1WLZA 5FYXA 2WC8A 4NDDA 5HYDA 1TCOB 1QX2A 3OP0A 1NX0A 2PASA 1DJXA 1IJ6A 2L50A 1KWOC 1BF5A 1XO5A 2M9GA 2ZKMX 1CFDA 2BE4A 4I5LB 1K90D 1L7ZA 3CLNA 1R6PA 1K9PA 1UHKA 1KFXL 2L51A 4OKHA 3NSKA 5F6TA 3VRPA 1QATA 1F71A 1YRTB 1CDNA 1CNPA 4I5KA 2Q4UA 1QX7A 1S5GY
chains in the Genus database with same CATH superfamily
1KK8B 2IS9A 2KPHA 3M0WA 5PALA 3RM1A 1MQ1A 2A4JA 3I5FB 4C0JA 1XVJA 1MR8A 1XFXO 3CS1A 4E68A 2WCHA 4NDBA 1M39A 2WOSA 2F2PA 3CR5X 3DVJA 4JKTA 5DICA 2K2FA 2K7CA 1PVAA 2SASA 4PALA 1F8HA 1QLKA 1DGUA 1Y6WA 1F55A 1J7QA 2WCJA 4N1FA 3AKBA 1L2OC 1WRZA 4BY4A 5K89A 2ISDA 4AOMA 4GGFA 5FI7A 2JULA 3VRNA 3AAJA 3NGVA 2LLSA 3IQOA 4TNCA 1G4YR 2AAOA 3D76A 1QV1A 3ICBA 4MN0A 4YI9A 4DS7A 4YI8A 3B86A 3S0BA 1RFJA 1FPWA 1U5IA 4YBHB 3L4LA 1CB1A 1YVHA 1BLQA 3PSRA 2CXJA 1QIWA 2LC5A 2JPOA 2KGRA 4HSZA 4MRXA 1QVIY 1S6IA 3TS5B 3S0GA 2H2KA 4XYNA 3HCMA 1B47A 1QX5B 1R2UA 3NHIA 1DT7B 1QASA 1OOFA 1UUSA 2WORA 1B8CA 2M3WA 1Y0VH 3PM2A 3TDIA 1WY9A 2KI6D 1MXLC 3CZTX 1K9KA 1GGWA 3JVTB 5DKNA 1SNLA 2OTGC 1YTZC 1AJ4A 1S3PA 4P2YB 1K9UA 2KAXA 2WCBA 1OMVA 1YUUA 5CSNA 5AERA 3EVRA 3EK4A 5FI6A 3DY9A 2LUCA 5D7FA 1W7IB 1B7TZ 1S1EA 1DJGA 3AKAA 4OR9B 1KQVA 4DCKA 2LHIA 1FI5A 2M1KB 3PLFB 5HLOA 1UHHA 2G2BA 4U8DA 3BFHA 1TNQA 3JTDB 3BXKA 3PN7C 1CFCA 1FF1A 2LMTA 2FJYA 2ZN9A 3DVKA 3CR2A 2I2RE 1X02A 3GK4X 1SCMC 2LVKA 4GGNA 4MZJA 3F45A 2TN4A 1XFYO 4MLWA 3FE9A 3OX6A 1J1EA 2L0PA 2LMUA 3PFVA 4GNKB 3RZSA 4USLA 2Y5IA 3BJHA 4PCWA 1IGVA 4A4BA 3LL8B 3BUXB 1YX8A 2P70A 3FS7A 3D75A 2K2AA 2JWWA 1LKJA 2D8NA 4N5XA 1CLLA 2PMYA 2M7LA 3EVVA 5I2QA 3O2PA 4PHJA 3SIBA 1TN4A 2F3YA 2H61A 2FJUB 3A4UB 4QJ4B 2EGDA 3SIAA 1A75B 1AVSA 1A4PA 5BPJA 2OPOA 4MBEA 5AXIA 3VRRA 1NSHA 2KFHA 2M1UA 3CWGA 1EG3A 4MVFA 2F8PA 2KNEA 2Y1NA 1OOJA 2V53A 1DJZA 1F4OA 4OZDA 1KCYA 2KGBC 2ZNDA 1KWOB 5HKYA 1JFKA 1S5GZ 1ZOTB 1OOIX 2HQ8A 2I94A 4HREE 1DJYA 5GQQC 1Y1XA 5AEQA 3GK1A 1UP5A 4OV2A 3UNWA 3L47A 3V2LA 1H4BA 1K8UA 1NCYA 2GGZA 2LLUA 1WDCC 1KSMA 2GTEA 2BL0C 2PSRA 2SCPA 2L98A 2LV7A 1F54A 1KSOA 1XFZO 2G9BA 1S6CA 2KYFA 3TZ1A 5ER4X 4ETOA 1FW4A 4YGEB 1C3YA 2YGUA 1A2XA 1HQVA 4BY5A 4YGDB 4YGAA 1QXPA 4AQIA 2B1UA 1F70A 1WLMA 1D1OA 1IG5A 3QMEA 1QJTA 2EC6B 1GJYA 3SG7A 1L2OB 2MRDA 2JTZA 2K61A 1B1GA 3O4XA 1OSAA 1ODBA 2BBMA 1M63B 2EHBA 5DKQA 2KQ6A 2LVIA 4C0LA 2KYCA 1G33A 3OB2B 1XK4A 2KAVA 1K95A 1IQ5A 3O78A 3AAKA 2ZRSA 3WXAA 1RTP1 2JOJA 1QVIZ 1SMGA 3I5GC 2QEOA 1EXRA 2L4IA 3EVUA 2KLDA 1XFUO 1TIZA 1W7JB 1OQPA 5I8NA 3CGAA 1Z4HA 2COLB 5G08A 4JQ0D 1G8IA 1DJHA 4NQGA 5I94A 1TOPA 2HETA 3PATA 1QWVA 1BU3A 4INWA 1H8BA 1YVLA 1Y1AA 2E6WA 1AK8A 3VROA 1JC2A 1SR6C 3VRQA 3I5HC 1CM4A 1NYAA 1CKKA 1RECA 5CPVA 2F2OA 2FOTA 2L2EA 3EKHA 5HKZA 1MXEA 2OTGB 3KF9A 2LUXA 2NXQA 2OS8B 4QJ3B 2JPTA 4WRIA 2JXCA 1DF0A 1DQEA 4NDCA 1OMRA 2FCEA 1IWQA 1IQ3A 2KFGA 1BMOA 3KO0A 1BODA 2KHNA 2AMIA 5D3OA 3SS3A 3LLEA 2KAYA 4CFQA 1XFWO 2H61C 1CDMA 3GOFA 4MZKA 3I5FC 4PHMA 1TUZA 4HRGA 2K7OA 1KFUL 2LHLA 3FIAA 2QEVA 4PHNA 1K96A 1CLBA 1A03A 1NUBA 1V1GA 1SCMB 1PALA 1A75A 2JT3A 1CFPA 5TNCA 2LVVA 1CMFA 1QIVA 2O60A 1UWOA 2Y1MA 5JJGA 1ZUZA 1J7PA 4GUKA 1LVCD 3SS5A 1ORGA 2LCPA 5JOLA 1NCZA 1V1FA 1BT6A 2JXLA 2LMVA 2WNDA 2QPTA 4YGCB 3LCPC 1FI6A 2HQWA 4M2QA 1BG1A 4ORBB 2LVJA 1ALVA 2JU0A 4JD9A 3SJSA 3WHUB 1PRWA 1B9AA 3WNXB 1LINA 1Q80A 3FE8A 3NSOA 1AHRA 2BECA 1C07A 1RROA 1SL9A 2MLEC 1Z2CB 4JPZB 1SSEB 3CABA 3TDZA 3NSLA 2JNFA 2WCEA 3DVMA 1CLMA 3K21A 3LK1A 3RLZA 1A29A 2M49B 1UURA 2HF5A 2CNPA 1KFXS 4DIRA 1F4QA 3NXAA 4INXA 1DELA 1PVBA 1S6JA 3FWBA 5FI2A 5HKWA 1UHJA 3SG6A 3CZ0A 4DRWA 2M97A 1YR5A 2M0RA 3TUYB 4PT1A 2MBXA 1XK4C 1KK7Y 2MLFC 1C3ZA 1OZSA 3D78A 1M31A 1DTLA 3S0DA 3EK8A 4YGBB 5AFPA 1BOCA 1JFJA 1K94A 1WDCB 2BL0B 1GGZA 1RWYA 1JSAA 3DF0B 4M2PA 5I2OA 1ZMZA 1J1DA 1AJ5A 4FQTA 1OOHA 2JTTA 1NWDA 3BOWB 4JWQA 4M2OA 2AUCA 4PE4A 2Q91A 3NHTA 3FE6A 5CSFA 1TWOA 2JQ6A 4GGFC 5HLVA 1ZACA 2RGIA 3BFBA 5CSJA 1EG4A 1SPYA 1TRFA 1YUSA 3E3RA 1OMDA 2L2CA 1EH2A 1N2DA 3IQQA 3LK0A 4QJ5B 1EL4A 3KEVA 1TTXA 2M29A 5HL1A 2K7BA 4L9MA 2GGMA 2BBNA 2JNXA 2K8MB 1EJ3A 2BKHB 1OZOA 4F0ZB 2LAPA 1DMOA 1MUXA 3I5GB 1PSRA 4PE1A 1JF2A 3EG5B 1IJ5A 5ER5A 1YX7A 3A8RA 4D1EA 3O4YA 3FWCA 1NIWA 1OOGA 3I5IC 3EKJA 1NX1A 1XFVO 4UPGA 1XYDA 2BCXA 3CZ1A 4AQJA 3SS4A 2L5XB 5CSIA 2CTNA 5KU1A 3B87A 1GM0A 2KQYA 1UHNA 1OW4A 3VB1A 2PQLA 1ZFSA 1NPQA 3DD4A 4DUQA 3B7AA 2NCOA 5KTYA 4CIDA 2CT9A 1XA5A 5B8IB 4ORAB 3HX4A 1AUIB 1SCVA 2PRUA 4ICBA 4ZCVA 2KI4C 2JT8A 3PJIA 5J3XA 1N65A 1J7RA 4WQ3A 1T14A 1S36A 1M46A 2O5GA 1M45A 2NLNA 1SL8A 1ALWA 2LP3A 2QDIA 1LS8A 1BR4B 2ZN8A 1CDPA 2QACA 3OHMB 3BFAA 2JT0A 5EL2A 2KFFA 3MSEB 3DVEA 2KOTA 3D73A 4OCIA 3BYAA 3ZNIA 1KQMC 3OBVA 3CDNA 1PSBA 2BKIB 1QTXA 3SG3A 3O6BA 1DJWA 5I2LA 1IKUA 1SL7A 1LA0A 1YRUB 3ZWHA 1PULA 1RJVA 4OVNF 1TCFA 5D69A 2KI6C 4CLNA 3H4SE 4MZLA 1TUJA 2PALA 3D0YB 4XJKB 4FQOA 2EC6C 3SG2A 1MHOA 2I18A 1AP4A 1TNWA 4IL1A 3CTNA 4GFTA 5AANA 1JUOA 2DOQA 3CR4X 4GBAA 4GPLB 2CBLA 3S0AA 1SKTA 2HPSA 5KSZA 1C7WA 1RK9A 1CMGA 4I5NB 1KK8C 2KBMA 3N7HA 1PK0D 1IH0A 1SBJA 2WCKA 2BNXA 3D74A 3PN7B 2QEBA 3Q8IA 4KYNA 2BCBA 2LP2A 2BCAA 3DF0A 2LLTA 1MWNA 2M7NA 4MSPA 1JWDA 4GAOA 2LNKA 2KDHA 2KSPA 2MAZA 3DXLA 3R72A 1J7OA 1SYMA 3BOWA 3GK2A 2ERBA 2P6BB 1GQMA 1B8LA 2L5YA 1KK7Z 1TNPA 4MEWA 2CCMA 1CDLA 2L4HA 1JF0A 1BJFA 1P28A 2R2IA 1VRKA 4I5JA 3OB1B 1C7VA 1E8AA 1QLSA 3PALA 2P71A 1B4CA 1NP8A 2OS8C 1IIOA 4N1GA 1TNXA 1QS7A 3CYZA 3TS5C 4CPVA 2NZ0A 1SRAA 3QRXA 4YRUA 1LXFC 4HRHA 1W9ZA 2FCDA 2JC2A 2GV5A 3SG5A 1S26D 1N0YA 4ORCB 3JVTC 1WRKA 1SW8A 3IVTA 2K60A 2F33A 3BUWB 4P5OE 2MJWB 2I7AA 3OGNA 3BQ3A 4PDZA 1BR1B 1NCXA 1LA3A 1IRJA 2WCMA 4PHKA 5DKRA 1U5IB 2BAPA 2E30A 3PM8A 4A4CA 2K0JA 3DZTA 3K1EA 4FTGA 2WCLA 3VGOA 1HT9A 3D10A 3S0EA 1MF8B 1DF0B 2BE6A 2KBIA 3KHEA 2M8UA 3EK7A 4ZCUA 2LE9B 1JBAA 2QEHA 4R1EA 1CTRA 1CFFA 3NSIA 1B7TY 2H8VA 3C1VA 3JTDC 3KPXA 3SG4A 1DVIA 3I5IB 3WHTB 2JRFA 3D77A 3OX5A 4F7FA 2PYQA 3B88A 2F3ZA 4IJ7A 2ZRTA 1OE9B 2MA2A 3IF7A 1Y1UA 1K93D 2WCFA 2ZFDA 1YUTA 1J55A 4MRYA 1CM1A 3BUOB 2LANA 1NX3A 3TDUA 2WC5A 1NX2A 1WRLA 4PE7A 4CFRA 5IBWA 3BUNB 3D0YA 4XJKA 1YURA 2K7DA 1UHIA 2KI4B 4PE0A 1DJIA 3TUYC 2KLEA 3CZ2A 2ZNEA 3I5HB 4C0KA 1SK6D 1SY9A 2JZIA 1K2HA 2LM5A 1B8RA 1DGVA 1KFUS 2NCPA 3B6XA 1SR6B 3R1OA 1QV0A 2Y4QA 3R1VA 3R1PA 2MHHA 3UO9A 1FBVA 4Q04A 3BUMB 4WQ2A 2PVBA 2VRGA 1KQMB 1WLZA 5FYXA 2WC8A 4NDDA 5HYDA 1TCOB 1QX2A 3OP0A 1NX0A 2PASA 1XFRA 1DJXA 1IJ6A 3L4AA 2L50A 1KWOC 2WC6A 1XO5A 1BF5A 3DYEA 2M9GA 2ZKMX 1CFDA 2BE4A 4I5LB 1K90D 1L7ZA 3CLNA 1R6PA 1K9PA 1UHKA 1KFXL 2L51A 4OKHA 3NSKA 5F6TA 3VRPA 1DEKA 1DC1A 1QATA 1F71A 1YRTB 1CDNA 1CNPA 4I5KA 2Q4UA 1QX7A 3S0FA 1S5GY
chains in the Genus database with same CATH topology
1KK8B 2IS9A 3M0WA 5PALA 3RM1A 1MQ1A 2A4JA 3I5FB 4C0JA 1XVJA 1MR8A 1XFXO 3CS1A 4E68A 4NDBA 1M39A 2WOSA 2F2PA 3CR5X 3DVJA 2K2FA 2K7CA 1PVAA 2SASA 4PALA 1F8HA 1QLKA 1DGUA 1Y6WA 1F55A 1J7QA 4N1FA 3AKBA 1L2OC 1WRZA 4BY4A 5K89A 2ISDA 4AOMA 4GGFA 2JULA 3VRNA 3AAJA 2LLSA 3IQOA 4TNCA 1G4YR 2AAOA 3ICBA 1QV1A 4MN0A 4DS7A 4YI9A 4YI8A 1RFJA 1FPWA 1U5IA 4YBHB 1CB1A 1YVHA 1BLQA 3PSRA 2CXJA 1QIWA 2LC5A 4HSZA 2KGRA 4MRXA 1QVIY 1S6IA 3TS5B 2H2KA 4XYNA 3HCMA 1B47A 1QX5B 1R2UA 1DT7B 1QASA 1UUSA 2WORA 1B8CA 2M3WA 1Y0VH 3TDIA 1WY9A 2KI6D 1MXLC 3CZTX 1K9KA 1GGWA 3JVTB 5DKNA 1SNLA 2OTGC 1YTZC 1AJ4A 1S3PA 4P2YB 1K9UA 2KAXA 2WCBA 1OMVA 1YUUA 5CSNA 5AERA 3EVRA 3EK4A 2LUCA 5D7FA 1W7IB 1B7TZ 1S1EA 1DJGA 3AKAA 4OR9B 1KQVA 4DCKA 2LHIA 1FI5A 2M1KB 3PLFB 5HLOA 1UHHA 2G2BA 4U8DA 1TNQA 3JTDB 3BXKA 3PN7C 1CFCA 1FF1A 2LMTA 2ZN9A 3DVKA 3CR2A 2I2RE 1X02A 3GK4X 1SCMC 2LVKA 4GGNA 4MZJA 3F45A 2TN4A 1XFYO 4MLWA 3OX6A 1J1EA 2L0PA 2LMUA 3PFVA 4GNKB 4USLA 2Y5IA 4PCWA 1IGVA 4A4BA 3LL8B 3BUXB 1YX8A 3FS7A 2K2AA 2JWWA 1LKJA 2D8NA 4N5XA 1CLLA 2PMYA 2M7LA 3EVVA 5I2QA 3O2PA 4PHJA 3SIBA 1TN4A 2F3YA 2H61A 2FJUB 3A4UB 4QJ4B 2EGDA 3SIAA 1A75B 1AVSA 1A4PA 5BPJA 2OPOA 4MBEA 5AXIA 3VRRA 1NSHA 2KFHA 2M1UA 3CWGA 1EG3A 4MVFA 2F8PA 2KNEA 2Y1NA 1OOJA 2V53A 1DJZA 1F4OA 1KCYA 2KGBC 2ZNDA 1KWOB 5HKYA 1JFKA 1S5GZ 1ZOTB 2HQ8A 2I94A 4HREE 1DJYA 5GQQC 1Y1XA 5AEQA 3GK1A 1UP5A 4OV2A 1H4BA 1K8UA 1NCYA 2GGZA 2LLUA 1WDCC 1KSMA 2PSRA 2BL0C 2SCPA 2L98A 2LV7A 1F54A 1KSOA 1XFZO 2G9BA 1S6CA 2KYFA 3TZ1A 5ER4X 4ETOA 1FW4A 4YGEB 1A2XA 1HQVA 4BY5A 4YGDB 4YGAA 1QXPA 4AQIA 2B1UA 1F70A 1WLMA 1D1OA 1IG5A 1QJTA 2EC6B 1GJYA 3SG7A 1L2OB 2MRDA 2JTZA 2K61A 1B1GA 1OSAA 1ODBA 2BBMA 1M63B 2EHBA 5DKQA 2KQ6A 2LVIA 4C0LA 2KYCA 1G33A 3OB2B 1XK4A 2KAVA 1K95A 1IQ5A 3O78A 3AAKA 2ZRSA 3WXAA 1RTP1 2JOJA 1QVIZ 1SMGA 3I5GC 1EXRA 2L4IA 3EVUA 1XFUO 1TIZA 1W7JB 1OQPA 5I8NA 3CGAA 5G08A 2COLB 4JQ0D 1G8IA 1DJHA 4NQGA 1TOPA 2HETA 3PATA 1BU3A 1H8BA 1YVLA 1Y1AA 2E6WA 1AK8A 3VROA 1JC2A 1SR6C 3VRQA 1CM4A 1NYAA 1CKKA 1RECA 5CPVA 2F2OA 2FOTA 2L2EA 3EKHA 5HKZA 1MXEA 2OTGB 3KF9A 2LUXA 2NXQA 2OS8B 4QJ3B 2JPTA 4WRIA 2JXCA 1DF0A 4NDCA 1OMRA 2FCEA 1IWQA 1IQ3A 2KFGA 1BMOA 3KO0A 1BODA 2KHNA 2AMIA 3LLEA 2KAYA 4CFQA 1XFWO 2H61C 1CDMA 3GOFA 4MZKA 3I5FC 4PHMA 4HRGA 2K7OA 1KFUL 2LHLA 3FIAA 4PHNA 1K96A 1CLBA 1A03A 1NUBA 1V1GA 1SCMB 1PALA 1A75A 2JT3A 1CFPA 5TNCA 2LVVA 1CMFA 1QIVA 2O60A 1UWOA 2Y1MA 5JJGA 1ZUZA 1J7PA 4GUKA 1LVCD 2LCPA 5JOLA 1NCZA 1V1FA 1BT6A 2JXLA 2LMVA 2WNDA 2QPTA 4YGCB 3LCPC 1FI6A 2HQWA 4M2QA 1BG1A 4ORBB 2LVJA 1ALVA 2JU0A 3SJSA 3WHUB 1PRWA 1B9AA 3WNXB 1LINA 1Q80A 3NSOA 2BECA 1AHRA 1C07A 1RROA 1SL9A 2MLEC 4JPZB 3TDZA 3NSLA 2JNFA 2WCEA 3DVMA 1CLMA 3K21A 3LK1A 3RLZA 1A29A 2M49B 1UURA 2HF5A 2CNPA 1KFXS 4DIRA 1F4QA 3NXAA 5HKWA 1PVBA 1S6JA 3FWBA 1UHJA 3SG6A 4DRWA 2M97A 1YR5A 2M0RA 3TUYB 2MBXA 1XK4C 1KK7Y 2MLFC 1OZSA 5AFPA 1M31A 1DTLA 1BOCA 3EK8A 4YGBB 1JFJA 1K94A 1WDCB 2BL0B 1GGZA 1RWYA 1JSAA 3DF0B 4M2PA 5I2OA 1ZMZA 1J1DA 1AJ5A 4JWQA 2JTTA 1NWDA 3BOWB 4M2OA 4PE4A 2AUCA 2Q91A 5CSFA 2JQ6A 4GGFC 5HLVA 1ZACA 2RGIA 5CSJA 1EG4A 1SPYA 1TRFA 1YUSA 3E3RA 1OMDA 1EH2A 1N2DA 3IQQA 3LK0A 4QJ5B 1EL4A 3KEVA 1TTXA 2M29A 2K7BA 4L9MA 2GGMA 2BBNA 2JNXA 2K8MB 1EJ3A 2BKHB 1OZOA 4F0ZB 2LAPA 1DMOA 1MUXA 3I5GB 1PSRA 4PE1A 1JF2A 1IJ5A 5ER5A 1YX7A 3A8RA 4D1EA 3O4YA 3FWCA 1NIWA 3I5IC 3EKJA 1NX1A 1XFVO 4UPGA 1XYDA 2BCXA 4AQJA 2L5XB 5CSIA 2CTNA 5KU1A 2KQYA 1UHNA 1ZFSA 1NPQA 3DD4A 4DUQA 5KTYA 2NCOA 4CIDA 2CT9A 1XA5A 5B8IB 4ORAB 3HX4A 1AUIB 1SCVA 2PRUA 4ICBA 4ZCVA 2KI4C 2JT8A 5J3XA 1N65A 1J7RA 4WQ3A 3I5HC 1S36A 1M46A 2O5GA 1M45A 2NLNA 1SL8A 1ALWA 2LP3A 1BR4B 2ZN8A 1CDPA 2QACA 3OHMB 2JT0A 2KFFA 3MSEB 3DVEA 2KOTA 4OCIA 3BYAA 3ZNIA 1KQMC 1PSBA 2BKIB 1QTXA 3SG3A 3O6BA 1DJWA 5I2LA 1IKUA 1SL7A 1LA0A 1YRUB 3ZWHA 1PULA 1RJVA 4OVNF 1TCFA 5D69A 2KI6C 4CLNA 3H4SE 4MZLA 2PALA 3D0YB 4XJKB 4FQOA 2EC6C 3SG2A 1MHOA 2I18A 1AP4A 1TNWA 4IL1A 3CTNA 4GFTA 5AANA 1JUOA 2DOQA 3CR4X 4GBAA 4GPLB 2CBLA 1SKTA 2HPSA 5KSZA 1C7WA 1RK9A 1CMGA 4I5NB 1KK8C 2KBMA 1PK0D 1IH0A 1SBJA 3PN7B 2BCBA 2LP2A 2BCAA 3DF0A 2LLTA 1MWNA 2M7NA 4MSPA 1JWDA 4GAOA 2LNKA 2KDHA 2KSPA 2MAZA 1J7OA 1SYMA 3BOWA 3GK2A 2P6BB 1GQMA 1B8LA 1KK7Z 1TNPA 4MEWA 2CCMA 1CDLA 2L4HA 1JF0A 1BJFA 2R2IA 1VRKA 4I5JA 3OB1B 1C7VA 1E8AA 1QLSA 3PALA 1B4CA 1NP8A 2OS8C 4N1GA 1TNXA 1QS7A 3TS5C 4CPVA 2NZ0A 1SRAA 3QRXA 4YRUA 1LXFC 4HRHA 2FCDA 2JC2A 2GV5A 3SG5A 1S26D 1N0YA 4ORCB 3JVTC 1WRKA 1SW8A 2F33A 3BUWB 4P5OE 2MJWB 2I7AA 3BQ3A 4PDZA 1BR1B 1NCXA 1LA3A 1IRJA 4PHKA 5DKRA 1U5IB 2E30A 3PM8A 4A4CA 2K0JA 4FTGA 3VGOA 1HT9A 3D10A 1MF8B 1DF0B 2BE6A 2KBIA 3KHEA 2M8UA 3EK7A 4ZCUA 2LE9B 1JBAA 4R1EA 1CTRA 1CFFA 3NSIA 1B7TY 3C1VA 3JTDC 3KPXA 3SG4A 1DVIA 3I5IB 3WHTB 2JRFA 3OX5A 2F3ZA 2ZRTA 1OE9B 2MA2A 3IF7A 1Y1UA 1K93D 2WCFA 2ZFDA 1YUTA 1J55A 4MRYA 1CM1A 3BUOB 2LANA 1NX3A 3TDUA 1NX2A 1WRLA 4PE7A 4CFRA 5IBWA 3BUNB 3D0YA 4XJKA 1YURA 2K7DA 1UHIA 2KI4B 4PE0A 1DJIA 3TUYC 2ZNEA 3I5HB 4C0KA 1SK6D 1SY9A 2JZIA 1K2HA 2LM5A 1B8RA 1DGVA 1KFUS 2NCPA 1SR6B 1QV0A 2Y4QA 2MHHA 1FBVA 4Q04A 3BUMB 4WQ2A 2PVBA 2VRGA 1KQMB 1WLZA 5FYXA 2WC8A 4NDDA 5HYDA 1TCOB 1QX2A 3OP0A 1NX0A 2PASA 1DJXA 1IJ6A 2L50A 1KWOC 1BF5A 1XO5A 2M9GA 2ZKMX 1CFDA 2BE4A 4I5LB 1K90D 1L7ZA 3CLNA 1R6PA 1K9PA 1UHKA 1KFXL 2L51A 4OKHA 3NSKA 5F6TA 3VRPA 1QATA 1F71A 1YRTB 1CDNA 1CNPA 4I5KA 2Q4UA 1QX7A 1S5GY
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KK8 B;  2IS9 A;  3M0W A;  5PAL A;  3RM1 A;  1MQ1 A;  2A4J A;  3I5F B;  4C0J A;  1XVJ A;  1MR8 A;  1XFX O;  3CS1 A;  4E68 A;  4NDB A;  1M39 A;  2WOS A;  2F2P A;  3CR5 X;  3DVJ A;  2K2F A;  2K7C A;  1PVA A;  2SAS A;  4PAL A;  1F8H A;  1QLK A;  1DGU A;  1Y6W A;  1F55 A;  1J7Q A;  4N1F A;  3AKB A;  1L2O C;  1WRZ A;  4BY4 A;  5K89 A;  2ISD A;  4AOM A;  4GGF A;  2JUL A;  3VRN A;  3AAJ A;  2LLS A;  3IQO A;  4TNC A;  1G4Y R;  2AAO A;  3ICB A;  1QV1 A;  4MN0 A;  4DS7 A;  4YI9 A;  4YI8 A;  1RFJ A;  1FPW A;  1U5I A;  4YBH B;  1CB1 A;  1YVH A;  1BLQ A;  3PSR A;  2CXJ A;  1QIW A;  2LC5 A;  4HSZ A;  2KGR A;  4MRX A;  1QVI Y;  1S6I A;  3TS5 B;  2H2K A;  4XYN A;  3HCM A;  1B47 A;  1QX5 B;  1R2U A;  1DT7 B;  1QAS A;  1UUS A;  2WOR A;  1B8C A;  2M3W A;  1Y0V H;  3TDI A;  1WY9 A;  2KI6 D;  1MXL C;  3CZT X;  1K9K A;  1GGW A;  3JVT B;  5DKN A;  1SNL A;  2OTG C;  1YTZ C;  1AJ4 A;  1S3P A;  4P2Y B;  1K9U A;  2KAX A;  2WCB A;  1OMV A;  1YUU A;  5CSN A;  5AER A;  3EVR A;  3EK4 A;  2LUC A;  5D7F A;  1W7I B;  1B7T Z;  1S1E A;  1DJG A;  3AKA A;  4OR9 B;  1KQV A;  4DCK A;  2LHI A;  1FI5 A;  2M1K B;  3PLF B;  5HLO A;  1UHH A;  2G2B A;  4U8D A;  1TNQ A;  3JTD B;  3BXK A;  3PN7 C;  1CFC A;  1FF1 A;  2LMT A;  2ZN9 A;  3DVK A;  3CR2 A;  2I2R E;  1X02 A;  3GK4 X;  1SCM C;  2LVK A;  4GGN A;  4MZJ A;  3F45 A;  2TN4 A;  1XFY O;  4MLW A;  3OX6 A;  1J1E A;  2L0P A;  2LMU A;  3PFV A;  4GNK B;  4USL A;  2Y5I A;  4PCW A;  1IGV A;  4A4B A;  3LL8 B;  3BUX B;  1YX8 A;  3FS7 A;  2K2A A;  2JWW A;  1LKJ A;  2D8N A;  4N5X A;  1CLL A;  2PMY A;  2M7L A;  3EVV A;  5I2Q A;  3O2P A;  4PHJ A;  3SIB A;  1TN4 A;  2F3Y A;  2H61 A;  2FJU B;  3A4U B;  4QJ4 B;  2EGD A;  3SIA A;  1A75 B;  1AVS A;  1A4P A;  5BPJ A;  2OPO A;  4MBE A;  5AXI A;  3VRR A;  1NSH A;  2KFH A;  2M1U A;  3CWG A;  1EG3 A;  4MVF A;  2F8P A;  2KNE A;  2Y1N A;  1OOJ A;  2V53 A;  1DJZ A;  1F4O A;  1KCY A;  2KGB C;  2ZND A;  1KWO B;  5HKY A;  1JFK A;  1S5G Z;  1ZOT B;  2HQ8 A;  2I94 A;  4HRE E;  1DJY A;  5GQQ C;  1Y1X A;  5AEQ A;  3GK1 A;  1UP5 A;  4OV2 A;  1H4B A;  1K8U A;  1NCY A;  2GGZ A;  2LLU A;  1WDC C;  1KSM A;  2PSR A;  2BL0 C;  2SCP A;  2L98 A;  2LV7 A;  1F54 A;  1KSO A;  1XFZ O;  2G9B A;  1S6C A;  2KYF A;  3TZ1 A;  5ER4 X;  4ETO A;  1FW4 A;  4YGE B;  1A2X A;  1HQV A;  4BY5 A;  4YGD B;  4YGA A;  1QXP A;  4AQI A;  2B1U A;  1F70 A;  1WLM A;  1D1O A;  1IG5 A;  1QJT A;  2EC6 B;  1GJY A;  3SG7 A;  1L2O B;  2MRD A;  2JTZ A;  2K61 A;  1B1G A;  1OSA A;  1ODB A;  2BBM A;  1M63 B;  2EHB A;  5DKQ A;  2KQ6 A;  2LVI A;  4C0L A;  2KYC A;  1G33 A;  3OB2 B;  1XK4 A;  2KAV A;  1K95 A;  1IQ5 A;  3O78 A;  3AAK A;  2ZRS A;  3WXA A;  1RTP 1;  2JOJ A;  1QVI Z;  1SMG A;  3I5G C;  1EXR A;  2L4I A;  3EVU A;  1XFU O;  1TIZ A;  1W7J B;  1OQP A;  5I8N A;  3CGA A;  5G08 A;  2COL B;  4JQ0 D;  1G8I A;  1DJH A;  4NQG A;  1TOP A;  2HET A;  3PAT A;  1BU3 A;  1H8B A;  1YVL A;  1Y1A A;  2E6W A;  1AK8 A;  3VRO A;  1JC2 A;  1SR6 C;  3VRQ A;  1CM4 A;  1NYA A;  1CKK A;  1REC A;  5CPV A;  2F2O A;  2FOT A;  2L2E A;  3EKH A;  5HKZ A;  1MXE A;  2OTG B;  3KF9 A;  2LUX A;  2NXQ A;  2OS8 B;  4QJ3 B;  2JPT A;  4WRI A;  2JXC A;  1DF0 A;  4NDC A;  1OMR A;  2FCE A;  1IWQ A;  1IQ3 A;  2KFG A;  1BMO A;  3KO0 A;  1BOD A;  2KHN A;  2AMI A;  3LLE A;  2KAY A;  4CFQ A;  1XFW O;  2H61 C;  1CDM A;  3GOF A;  4MZK A;  3I5F C;  4PHM A;  4HRG A;  2K7O A;  1KFU L;  2LHL A;  3FIA A;  4PHN A;  1K96 A;  1CLB A;  1A03 A;  1NUB A;  1V1G A;  1SCM B;  1PAL A;  1A75 A;  2JT3 A;  1CFP A;  5TNC A;  2LVV A;  1CMF A;  1QIV A;  2O60 A;  1UWO A;  2Y1M A;  5JJG A;  1ZUZ A;  1J7P A;  4GUK A;  1LVC D;  2LCP A;  5JOL A;  1NCZ A;  1V1F A;  1BT6 A;  2JXL A;  2LMV A;  2WND A;  2QPT A;  4YGC B;  3LCP C;  1FI6 A;  2HQW A;  4M2Q A;  1BG1 A;  4ORB B;  2LVJ A;  1ALV A;  2JU0 A;  3SJS A;  3WHU B;  1PRW A;  1B9A A;  3WNX B;  1LIN A;  1Q80 A;  3NSO A;  2BEC A;  1AHR A;  1C07 A;  1RRO A;  1SL9 A;  2MLE C;  4JPZ B;  3TDZ A;  3NSL A;  2JNF A;  2WCE A;  3DVM A;  1CLM A;  3K21 A;  3LK1 A;  3RLZ A;  1A29 A;  2M49 B;  1UUR A;  2HF5 A;  2CNP A;  1KFX S;  4DIR A;  1F4Q A;  3NXA A;  5HKW A;  1PVB A;  1S6J A;  3FWB A;  1UHJ A;  3SG6 A;  4DRW A;  2M97 A;  1YR5 A;  2M0R A;  3TUY B;  2MBX A;  1XK4 C;  1KK7 Y;  2MLF C;  1OZS A;  5AFP A;  1M31 A;  1DTL A;  1BOC A;  3EK8 A;  4YGB B;  1JFJ A;  1K94 A;  1WDC B;  2BL0 B;  1GGZ A;  1RWY A;  1JSA A;  3DF0 B;  4M2P A;  5I2O A;  1ZMZ A;  1J1D A;  1AJ5 A;  4JWQ A;  2JTT A;  1NWD A;  3BOW B;  4M2O A;  4PE4 A;  2AUC A;  2Q91 A;  5CSF A;  2JQ6 A;  4GGF C;  5HLV A;  1ZAC A;  2RGI A;  5CSJ A;  1EG4 A;  1SPY A;  1TRF A;  1YUS A;  3E3R A;  1OMD A;  1EH2 A;  1N2D A;  3IQQ A;  3LK0 A;  4QJ5 B;  1EL4 A;  3KEV A;  1TTX A;  2M29 A;  2K7B A;  4L9M A;  2GGM A;  2BBN A;  2JNX A;  2K8M B;  1EJ3 A;  2BKH B;  1OZO A;  4F0Z B;  2LAP A;  1DMO A;  1MUX A;  3I5G B;  1PSR A;  4PE1 A;  1JF2 A;  1IJ5 A;  5ER5 A;  1YX7 A;  3A8R A;  4D1E A;  3O4Y A;  3FWC A;  1NIW A;  3I5I C;  3EKJ A;  1NX1 A;  1XFV O;  4UPG A;  1XYD A;  2BCX A;  4AQJ A;  2L5X B;  5CSI A;  2CTN A;  5KU1 A;  2KQY A;  1UHN A;  1ZFS A;  1NPQ A;  3DD4 A;  4DUQ A;  5KTY A;  2NCO A;  4CID A;  2CT9 A;  1XA5 A;  5B8I B;  4ORA B;  3HX4 A;  1AUI B;  1SCV A;  2PRU A;  4ICB A;  4ZCV A;  2KI4 C;  2JT8 A;  5J3X A;  1N65 A;  1J7R A;  4WQ3 A;  3I5H C;  1S36 A;  1M46 A;  2O5G A;  1M45 A;  2NLN A;  1SL8 A;  1ALW A;  2LP3 A;  1BR4 B;  2ZN8 A;  1CDP A;  2QAC A;  3OHM B;  2JT0 A;  2KFF A;  3MSE B;  3DVE A;  2KOT A;  4OCI A;  3BYA A;  3ZNI A;  1KQM C;  1PSB A;  2BKI B;  1QTX A;  3SG3 A;  3O6B A;  1DJW A;  5I2L A;  1IKU A;  1SL7 A;  1LA0 A;  1YRU B;  3ZWH A;  1PUL A;  1RJV A;  4OVN F;  1TCF A;  5D69 A;  2KI6 C;  4CLN A;  3H4S E;  4MZL A;  2PAL A;  3D0Y B;  4XJK B;  4FQO A;  2EC6 C;  3SG2 A;  1MHO A;  2I18 A;  1AP4 A;  1TNW A;  4IL1 A;  3CTN A;  4GFT A;  5AAN A;  1JUO A;  2DOQ A;  3CR4 X;  4GBA A;  4GPL B;  2CBL A;  1SKT A;  2HPS A;  5KSZ A;  1C7W A;  1RK9 A;  1CMG A;  4I5N B;  1KK8 C;  2KBM A;  1PK0 D;  1IH0 A;  1SBJ A;  3PN7 B;  2BCB A;  2LP2 A;  2BCA A;  3DF0 A;  2LLT A;  1MWN A;  2M7N A;  4MSP A;  1JWD A;  4GAO A;  2LNK A;  2KDH A;  2KSP A;  2MAZ A;  1J7O A;  1SYM A;  3BOW A;  3GK2 A;  2P6B B;  1GQM A;  1B8L A;  1KK7 Z;  1TNP A;  4MEW A;  2CCM A;  1CDL A;  2L4H A;  1JF0 A;  1BJF A;  2R2I A;  1VRK A;  4I5J A;  3OB1 B;  1C7V A;  1E8A A;  1QLS A;  3PAL A;  1B4C A;  1NP8 A;  2OS8 C;  4N1G A;  1TNX A;  1QS7 A;  3TS5 C;  4CPV A;  2NZ0 A;  1SRA A;  3QRX A;  4YRU A;  1LXF C;  4HRH A;  2FCD A;  2JC2 A;  2GV5 A;  3SG5 A;  1S26 D;  1N0Y A;  4ORC B;  3JVT C;  1WRK A;  1SW8 A;  2F33 A;  3BUW B;  4P5O E;  2MJW B;  2I7A A;  3BQ3 A;  4PDZ A;  1BR1 B;  1NCX A;  1LA3 A;  1IRJ A;  4PHK A;  5DKR A;  1U5I B;  2E30 A;  3PM8 A;  4A4C A;  2K0J A;  4FTG A;  3VGO A;  1HT9 A;  3D10 A;  1MF8 B;  1DF0 B;  2BE6 A;  2KBI A;  3KHE A;  2M8U A;  3EK7 A;  4ZCU A;  2LE9 B;  1JBA A;  4R1E A;  1CTR A;  1CFF A;  3NSI A;  1B7T Y;  3C1V A;  3JTD C;  3KPX A;  3SG4 A;  1DVI A;  3I5I B;  3WHT B;  2JRF A;  3OX5 A;  2F3Z A;  2ZRT A;  1OE9 B;  2MA2 A;  3IF7 A;  1Y1U A;  1K93 D;  2WCF A;  2ZFD A;  1YUT A;  1J55 A;  4MRY A;  1CM1 A;  3BUO B;  2LAN A;  1NX3 A;  3TDU A;  1NX2 A;  1WRL A;  4PE7 A;  4CFR A;  5IBW A;  3BUN B;  3D0Y A;  4XJK A;  1YUR A;  2K7D A;  1UHI A;  2KI4 B;  4PE0 A;  1DJI A;  3TUY C;  2ZNE A;  3I5H B;  4C0K A;  1SK6 D;  1SY9 A;  2JZI A;  1K2H A;  2LM5 A;  1B8R A;  1DGV A;  1KFU S;  2NCP A;  1SR6 B;  1QV0 A;  2Y4Q A;  2MHH A;  1FBV A;  4Q04 A;  3BUM B;  4WQ2 A;  2PVB A;  2VRG A;  1KQM B;  1WLZ A;  5FYX A;  2WC8 A;  4NDD A;  5HYD A;  1TCO B;  1QX2 A;  3OP0 A;  1NX0 A;  2PAS A;  1DJX A;  1IJ6 A;  2L50 A;  1KWO C;  1BF5 A;  1XO5 A;  2M9G A;  2ZKM X;  1CFD A;  2BE4 A;  4I5L B;  1K90 D;  1L7Z A;  3CLN A;  1R6P A;  1K9P A;  1UHK A;  1KFX L;  2L51 A;  4OKH A;  3NSK A;  5F6T A;  3VRP A;  1QAT A;  1F71 A;  1YRT B;  1CDN A;  1CNP A;  4I5K A;  2Q4U A;  1QX7 A;  1S5G Y; 
#chains in the Genus database with same CATH topology
 1KK8 B;  2IS9 A;  2KPH A;  3M0W A;  5PAL A;  3RM1 A;  1MQ1 A;  2A4J A;  3I5F B;  4C0J A;  1XVJ A;  1MR8 A;  1XFX O;  3CS1 A;  4E68 A;  2WCH A;  4NDB A;  1M39 A;  2WOS A;  2F2P A;  3CR5 X;  3DVJ A;  4JKT A;  5DIC A;  2K2F A;  2K7C A;  1PVA A;  2SAS A;  4PAL A;  1F8H A;  1QLK A;  1DGU A;  1Y6W A;  1F55 A;  1J7Q A;  2WCJ A;  4N1F A;  3AKB A;  1L2O C;  1WRZ A;  4BY4 A;  5K89 A;  2ISD A;  4AOM A;  4GGF A;  5FI7 A;  2JUL A;  3VRN A;  3AAJ A;  3NGV A;  2LLS A;  3IQO A;  4TNC A;  1G4Y R;  2AAO A;  3D76 A;  1QV1 A;  3ICB A;  4MN0 A;  4YI9 A;  4DS7 A;  4YI8 A;  3B86 A;  3S0B A;  1RFJ A;  1FPW A;  1U5I A;  4YBH B;  3L4L A;  1CB1 A;  1YVH A;  1BLQ A;  3PSR A;  2CXJ A;  1QIW A;  2LC5 A;  2JPO A;  2KGR A;  4HSZ A;  4MRX A;  1QVI Y;  1S6I A;  3TS5 B;  3S0G A;  2H2K A;  4XYN A;  3HCM A;  1B47 A;  1QX5 B;  1R2U A;  3NHI A;  1DT7 B;  1QAS A;  1OOF A;  1UUS A;  2WOR A;  1B8C A;  2M3W A;  1Y0V H;  3PM2 A;  3TDI A;  1WY9 A;  2KI6 D;  1MXL C;  3CZT X;  1K9K A;  1GGW A;  3JVT B;  5DKN A;  1SNL A;  2OTG C;  1YTZ C;  1AJ4 A;  1S3P A;  4P2Y B;  1K9U A;  2KAX A;  2WCB A;  1OMV A;  1YUU A;  5CSN A;  5AER A;  3EVR A;  3EK4 A;  5FI6 A;  3DY9 A;  2LUC A;  5D7F A;  1W7I B;  1B7T Z;  1S1E A;  1DJG A;  3AKA A;  4OR9 B;  1KQV A;  4DCK A;  2LHI A;  1FI5 A;  2M1K B;  3PLF B;  5HLO A;  1UHH A;  2G2B A;  4U8D A;  3BFH A;  1TNQ A;  3JTD B;  3BXK A;  3PN7 C;  1CFC A;  1FF1 A;  2LMT A;  2FJY A;  2ZN9 A;  3DVK A;  3CR2 A;  2I2R E;  1X02 A;  3GK4 X;  1SCM C;  2LVK A;  4GGN A;  4MZJ A;  3F45 A;  2TN4 A;  1XFY O;  4MLW A;  3FE9 A;  3OX6 A;  1J1E A;  2L0P A;  2LMU A;  3PFV A;  4GNK B;  3RZS A;  4USL A;  2Y5I A;  3BJH A;  4PCW A;  1IGV A;  4A4B A;  3LL8 B;  3BUX B;  1YX8 A;  2P70 A;  3FS7 A;  3D75 A;  2K2A A;  2JWW A;  1LKJ A;  2D8N A;  4N5X A;  1CLL A;  2PMY A;  2M7L A;  3EVV A;  5I2Q A;  3O2P A;  4PHJ A;  3SIB A;  1TN4 A;  2F3Y A;  2H61 A;  2FJU B;  3A4U B;  4QJ4 B;  2EGD A;  3SIA A;  1A75 B;  1AVS A;  1A4P A;  5BPJ A;  2OPO A;  4MBE A;  5AXI A;  3VRR A;  1NSH A;  2KFH A;  2M1U A;  3CWG A;  1EG3 A;  4MVF A;  2F8P A;  2KNE A;  2Y1N A;  1OOJ A;  2V53 A;  1DJZ A;  1F4O A;  4OZD A;  1KCY A;  2KGB C;  2ZND A;  1KWO B;  5HKY A;  1JFK A;  1S5G Z;  1ZOT B;  1OOI X;  2HQ8 A;  2I94 A;  4HRE E;  1DJY A;  5GQQ C;  1Y1X A;  5AEQ A;  3GK1 A;  1UP5 A;  4OV2 A;  3UNW A;  3L47 A;  3V2L A;  1H4B A;  1K8U A;  1NCY A;  2GGZ A;  2LLU A;  1WDC C;  1KSM A;  2GTE A;  2BL0 C;  2PSR A;  2SCP A;  2L98 A;  2LV7 A;  1F54 A;  1KSO A;  1XFZ O;  2G9B A;  1S6C A;  2KYF A;  3TZ1 A;  5ER4 X;  4ETO A;  1FW4 A;  4YGE B;  1C3Y A;  2YGU A;  1A2X A;  1HQV A;  4BY5 A;  4YGD B;  4YGA A;  1QXP A;  4AQI A;  2B1U A;  1F70 A;  1WLM A;  1D1O A;  1IG5 A;  3QME A;  1QJT A;  2EC6 B;  1GJY A;  3SG7 A;  1L2O B;  2MRD A;  2JTZ A;  2K61 A;  1B1G A;  3O4X A;  1OSA A;  1ODB A;  2BBM A;  1M63 B;  2EHB A;  5DKQ A;  2KQ6 A;  2LVI A;  4C0L A;  2KYC A;  1G33 A;  3OB2 B;  1XK4 A;  2KAV A;  1K95 A;  1IQ5 A;  3O78 A;  3AAK A;  2ZRS A;  3WXA A;  1RTP 1;  2JOJ A;  1QVI Z;  1SMG A;  3I5G C;  2QEO A;  1EXR A;  2L4I A;  3EVU A;  2KLD A;  1XFU O;  1TIZ A;  1W7J B;  1OQP A;  5I8N A;  3CGA A;  1Z4H A;  2COL B;  5G08 A;  4JQ0 D;  1G8I A;  1DJH A;  4NQG A;  5I94 A;  1TOP A;  2HET A;  3PAT A;  1QWV A;  1BU3 A;  4INW A;  1H8B A;  1YVL A;  1Y1A A;  2E6W A;  1AK8 A;  3VRO A;  1JC2 A;  1SR6 C;  3VRQ A;  3I5H C;  1CM4 A;  1NYA A;  1CKK A;  1REC A;  5CPV A;  2F2O A;  2FOT A;  2L2E A;  3EKH A;  5HKZ A;  1MXE A;  2OTG B;  3KF9 A;  2LUX A;  2NXQ A;  2OS8 B;  4QJ3 B;  2JPT A;  4WRI A;  2JXC A;  1DF0 A;  1DQE A;  4NDC A;  1OMR A;  2FCE A;  1IWQ A;  1IQ3 A;  2KFG A;  1BMO A;  3KO0 A;  1BOD A;  2KHN A;  2AMI A;  5D3O A;  3SS3 A;  3LLE A;  2KAY A;  4CFQ A;  1XFW O;  2H61 C;  1CDM A;  3GOF A;  4MZK A;  3I5F C;  4PHM A;  1TUZ A;  4HRG A;  2K7O A;  1KFU L;  2LHL A;  3FIA A;  2QEV A;  4PHN A;  1K96 A;  1CLB A;  1A03 A;  1NUB A;  1V1G A;  1SCM B;  1PAL A;  1A75 A;  2JT3 A;  1CFP A;  5TNC A;  2LVV A;  1CMF A;  1QIV A;  2O60 A;  1UWO A;  2Y1M A;  5JJG A;  1ZUZ A;  1J7P A;  4GUK A;  1LVC D;  3SS5 A;  1ORG A;  2LCP A;  5JOL A;  1NCZ A;  1V1F A;  1BT6 A;  2JXL A;  2LMV A;  2WND A;  2QPT A;  4YGC B;  3LCP C;  1FI6 A;  2HQW A;  4M2Q A;  1BG1 A;  4ORB B;  2LVJ A;  1ALV A;  2JU0 A;  4JD9 A;  3SJS A;  3WHU B;  1PRW A;  1B9A A;  3WNX B;  1LIN A;  1Q80 A;  3FE8 A;  3NSO A;  1AHR A;  2BEC A;  1C07 A;  1RRO A;  1SL9 A;  2MLE C;  1Z2C B;  4JPZ B;  1SSE B;  3CAB A;  3TDZ A;  3NSL A;  2JNF A;  2WCE A;  3DVM A;  1CLM A;  3K21 A;  3LK1 A;  3RLZ A;  1A29 A;  2M49 B;  1UUR A;  2HF5 A;  2CNP A;  1KFX S;  4DIR A;  1F4Q A;  3NXA A;  4INX A;  1DEL A;  1PVB A;  1S6J A;  3FWB A;  5FI2 A;  5HKW A;  1UHJ A;  3SG6 A;  3CZ0 A;  4DRW A;  2M97 A;  1YR5 A;  2M0R A;  3TUY B;  4PT1 A;  2MBX A;  1XK4 C;  1KK7 Y;  2MLF C;  1C3Z A;  1OZS A;  3D78 A;  1M31 A;  1DTL A;  3S0D A;  3EK8 A;  4YGB B;  5AFP A;  1BOC A;  1JFJ A;  1K94 A;  1WDC B;  2BL0 B;  1GGZ A;  1RWY A;  1JSA A;  3DF0 B;  4M2P A;  5I2O A;  1ZMZ A;  1J1D A;  1AJ5 A;  4FQT A;  1OOH A;  2JTT A;  1NWD A;  3BOW B;  4JWQ A;  4M2O A;  2AUC A;  4PE4 A;  2Q91 A;  3NHT A;  3FE6 A;  5CSF A;  1TWO A;  2JQ6 A;  4GGF C;  5HLV A;  1ZAC A;  2RGI A;  3BFB A;  5CSJ A;  1EG4 A;  1SPY A;  1TRF A;  1YUS A;  3E3R A;  1OMD A;  2L2C A;  1EH2 A;  1N2D A;  3IQQ A;  3LK0 A;  4QJ5 B;  1EL4 A;  3KEV A;  1TTX A;  2M29 A;  5HL1 A;  2K7B A;  4L9M A;  2GGM A;  2BBN A;  2JNX A;  2K8M B;  1EJ3 A;  2BKH B;  1OZO A;  4F0Z B;  2LAP A;  1DMO A;  1MUX A;  3I5G B;  1PSR A;  4PE1 A;  1JF2 A;  3EG5 B;  1IJ5 A;  5ER5 A;  1YX7 A;  3A8R A;  4D1E A;  3O4Y A;  3FWC A;  1NIW A;  1OOG A;  3I5I C;  3EKJ A;  1NX1 A;  1XFV O;  4UPG A;  1XYD A;  2BCX A;  3CZ1 A;  4AQJ A;  3SS4 A;  2L5X B;  5CSI A;  2CTN A;  5KU1 A;  3B87 A;  1GM0 A;  2KQY A;  1UHN A;  1OW4 A;  3VB1 A;  2PQL A;  1ZFS A;  1NPQ A;  3DD4 A;  4DUQ A;  3B7A A;  2NCO A;  5KTY A;  4CID A;  2CT9 A;  1XA5 A;  5B8I B;  4ORA B;  3HX4 A;  1AUI B;  1SCV A;  2PRU A;  4ICB A;  4ZCV A;  2KI4 C;  2JT8 A;  3PJI A;  5J3X A;  1N65 A;  1J7R A;  4WQ3 A;  1T14 A;  1S36 A;  1M46 A;  2O5G A;  1M45 A;  2NLN A;  1SL8 A;  1ALW A;  2LP3 A;  2QDI A;  1LS8 A;  1BR4 B;  2ZN8 A;  1CDP A;  2QAC A;  3OHM B;  3BFA A;  2JT0 A;  5EL2 A;  2KFF A;  3MSE B;  3DVE A;  2KOT A;  3D73 A;  4OCI A;  3BYA A;  3ZNI A;  1KQM C;  3OBV A;  3CDN A;  1PSB A;  2BKI B;  1QTX A;  3SG3 A;  3O6B A;  1DJW A;  5I2L A;  1IKU A;  1SL7 A;  1LA0 A;  1YRU B;  3ZWH A;  1PUL A;  1RJV A;  4OVN F;  1TCF A;  5D69 A;  2KI6 C;  4CLN A;  3H4S E;  4MZL A;  1TUJ A;  2PAL A;  3D0Y B;  4XJK B;  4FQO A;  2EC6 C;  3SG2 A;  1MHO A;  2I18 A;  1AP4 A;  1TNW A;  4IL1 A;  3CTN A;  4GFT A;  5AAN A;  1JUO A;  2DOQ A;  3CR4 X;  4GBA A;  4GPL B;  2CBL A;  3S0A A;  1SKT A;  2HPS A;  5KSZ A;  1C7W A;  1RK9 A;  1CMG A;  4I5N B;  1KK8 C;  2KBM A;  3N7H A;  1PK0 D;  1IH0 A;  1SBJ A;  2WCK A;  2BNX A;  3D74 A;  3PN7 B;  2QEB A;  3Q8I A;  4KYN A;  2BCB A;  2LP2 A;  2BCA A;  3DF0 A;  2LLT A;  1MWN A;  2M7N A;  4MSP A;  1JWD A;  4GAO A;  2LNK A;  2KDH A;  2KSP A;  2MAZ A;  3DXL A;  3R72 A;  1J7O A;  1SYM A;  3BOW A;  3GK2 A;  2ERB A;  2P6B B;  1GQM A;  1B8L A;  2L5Y A;  1KK7 Z;  1TNP A;  4MEW A;  2CCM A;  1CDL A;  2L4H A;  1JF0 A;  1BJF A;  1P28 A;  2R2I A;  1VRK A;  4I5J A;  3OB1 B;  1C7V A;  1E8A A;  1QLS A;  3PAL A;  2P71 A;  1B4C A;  1NP8 A;  2OS8 C;  1IIO A;  4N1G A;  1TNX A;  1QS7 A;  3CYZ A;  3TS5 C;  4CPV A;  2NZ0 A;  1SRA A;  3QRX A;  4YRU A;  1LXF C;  4HRH A;  1W9Z A;  2FCD A;  2JC2 A;  2GV5 A;  3SG5 A;  1S26 D;  1N0Y A;  4ORC B;  3JVT C;  1WRK A;  1SW8 A;  3IVT A;  2K60 A;  2F33 A;  3BUW B;  4P5O E;  2MJW B;  2I7A A;  3OGN A;  3BQ3 A;  4PDZ A;  1BR1 B;  1NCX A;  1LA3 A;  1IRJ A;  2WCM A;  4PHK A;  5DKR A;  1U5I B;  2BAP A;  2E30 A;  3PM8 A;  4A4C A;  2K0J A;  3DZT A;  3K1E A;  4FTG A;  2WCL A;  3VGO A;  1HT9 A;  3D10 A;  3S0E A;  1MF8 B;  1DF0 B;  2BE6 A;  2KBI A;  3KHE A;  2M8U A;  3EK7 A;  4ZCU A;  2LE9 B;  1JBA A;  2QEH A;  4R1E A;  1CTR A;  1CFF A;  3NSI A;  1B7T Y;  2H8V A;  3C1V A;  3JTD C;  3KPX A;  3SG4 A;  1DVI A;  3I5I B;  3WHT B;  2JRF A;  3D77 A;  3OX5 A;  4F7F A;  2PYQ A;  3B88 A;  2F3Z A;  4IJ7 A;  2ZRT A;  1OE9 B;  2MA2 A;  3IF7 A;  1Y1U A;  1K93 D;  2WCF A;  2ZFD A;  1YUT A;  1J55 A;  4MRY A;  1CM1 A;  3BUO B;  2LAN A;  1NX3 A;  3TDU A;  2WC5 A;  1NX2 A;  1WRL A;  4PE7 A;  4CFR A;  5IBW A;  3BUN B;  3D0Y A;  4XJK A;  1YUR A;  2K7D A;  1UHI A;  2KI4 B;  4PE0 A;  1DJI A;  3TUY C;  2KLE A;  3CZ2 A;  2ZNE A;  3I5H B;  4C0K A;  1SK6 D;  1SY9 A;  2JZI A;  1K2H A;  2LM5 A;  1B8R A;  1DGV A;  1KFU S;  2NCP A;  3B6X A;  1SR6 B;  3R1O A;  1QV0 A;  2Y4Q A;  3R1V A;  3R1P A;  2MHH A;  3UO9 A;  1FBV A;  4Q04 A;  3BUM B;  4WQ2 A;  2PVB A;  2VRG A;  1KQM B;  1WLZ A;  5FYX A;  2WC8 A;  4NDD A;  5HYD A;  1TCO B;  1QX2 A;  3OP0 A;  1NX0 A;  2PAS A;  1XFR A;  1DJX A;  1IJ6 A;  3L4A A;  2L50 A;  1KWO C;  2WC6 A;  1XO5 A;  1BF5 A;  3DYE A;  2M9G A;  2ZKM X;  1CFD A;  2BE4 A;  4I5L B;  1K90 D;  1L7Z A;  3CLN A;  1R6P A;  1K9P A;  1UHK A;  1KFX L;  2L51 A;  4OKH A;  3NSK A;  5F6T A;  3VRP A;  1DEK A;  1DC1 A;  1QAT A;  1F71 A;  1YRT B;  1CDN A;  1CNP A;  4I5K A;  2Q4U A;  1QX7 A;  3S0F A;  1S5G Y; 
#chains in the Genus database with same CATH homology
 1KK8 B;  2IS9 A;  3M0W A;  5PAL A;  3RM1 A;  1MQ1 A;  2A4J A;  3I5F B;  4C0J A;  1XVJ A;  1MR8 A;  1XFX O;  3CS1 A;  4E68 A;  4NDB A;  1M39 A;  2WOS A;  2F2P A;  3CR5 X;  3DVJ A;  2K2F A;  2K7C A;  1PVA A;  2SAS A;  4PAL A;  1F8H A;  1QLK A;  1DGU A;  1Y6W A;  1F55 A;  1J7Q A;  4N1F A;  3AKB A;  1L2O C;  1WRZ A;  4BY4 A;  5K89 A;  2ISD A;  4AOM A;  4GGF A;  2JUL A;  3VRN A;  3AAJ A;  2LLS A;  3IQO A;  4TNC A;  1G4Y R;  2AAO A;  3ICB A;  1QV1 A;  4MN0 A;  4DS7 A;  4YI9 A;  4YI8 A;  1RFJ A;  1FPW A;  1U5I A;  4YBH B;  1CB1 A;  1YVH A;  1BLQ A;  3PSR A;  2CXJ A;  1QIW A;  2LC5 A;  4HSZ A;  2KGR A;  4MRX A;  1QVI Y;  1S6I A;  3TS5 B;  2H2K A;  4XYN A;  3HCM A;  1B47 A;  1QX5 B;  1R2U A;  1DT7 B;  1QAS A;  1UUS A;  2WOR A;  1B8C A;  2M3W A;  1Y0V H;  3TDI A;  1WY9 A;  2KI6 D;  1MXL C;  3CZT X;  1K9K A;  1GGW A;  3JVT B;  5DKN A;  1SNL A;  2OTG C;  1YTZ C;  1AJ4 A;  1S3P A;  4P2Y B;  1K9U A;  2KAX A;  2WCB A;  1OMV A;  1YUU A;  5CSN A;  5AER A;  3EVR A;  3EK4 A;  2LUC A;  5D7F A;  1W7I B;  1B7T Z;  1S1E A;  1DJG A;  3AKA A;  4OR9 B;  1KQV A;  4DCK A;  2LHI A;  1FI5 A;  2M1K B;  3PLF B;  5HLO A;  1UHH A;  2G2B A;  4U8D A;  1TNQ A;  3JTD B;  3BXK A;  3PN7 C;  1CFC A;  1FF1 A;  2LMT A;  2ZN9 A;  3DVK A;  3CR2 A;  2I2R E;  1X02 A;  3GK4 X;  1SCM C;  2LVK A;  4GGN A;  4MZJ A;  3F45 A;  2TN4 A;  1XFY O;  4MLW A;  3OX6 A;  1J1E A;  2L0P A;  2LMU A;  3PFV A;  4GNK B;  4USL A;  2Y5I A;  4PCW A;  1IGV A;  4A4B A;  3LL8 B;  3BUX B;  1YX8 A;  3FS7 A;  2K2A A;  2JWW A;  1LKJ A;  2D8N A;  4N5X A;  1CLL A;  2PMY A;  2M7L A;  3EVV A;  5I2Q A;  3O2P A;  4PHJ A;  3SIB A;  1TN4 A;  2F3Y A;  2H61 A;  2FJU B;  3A4U B;  4QJ4 B;  2EGD A;  3SIA A;  1A75 B;  1AVS A;  1A4P A;  5BPJ A;  2OPO A;  4MBE A;  5AXI A;  3VRR A;  1NSH A;  2KFH A;  2M1U A;  3CWG A;  1EG3 A;  4MVF A;  2F8P A;  2KNE A;  2Y1N A;  1OOJ A;  2V53 A;  1DJZ A;  1F4O A;  1KCY A;  2KGB C;  2ZND A;  1KWO B;  5HKY A;  1JFK A;  1S5G Z;  1ZOT B;  2HQ8 A;  2I94 A;  4HRE E;  1DJY A;  5GQQ C;  1Y1X A;  5AEQ A;  3GK1 A;  1UP5 A;  4OV2 A;  1H4B A;  1K8U A;  1NCY A;  2GGZ A;  2LLU A;  1WDC C;  1KSM A;  2PSR A;  2BL0 C;  2SCP A;  2L98 A;  2LV7 A;  1F54 A;  1KSO A;  1XFZ O;  2G9B A;  1S6C A;  2KYF A;  3TZ1 A;  5ER4 X;  4ETO A;  1FW4 A;  4YGE B;  1A2X A;  1HQV A;  4BY5 A;  4YGD B;  4YGA A;  1QXP A;  4AQI A;  2B1U A;  1F70 A;  1WLM A;  1D1O A;  1IG5 A;  1QJT A;  2EC6 B;  1GJY A;  3SG7 A;  1L2O B;  2MRD A;  2JTZ A;  2K61 A;  1B1G A;  1OSA A;  1ODB A;  2BBM A;  1M63 B;  2EHB A;  5DKQ A;  2KQ6 A;  2LVI A;  4C0L A;  2KYC A;  1G33 A;  3OB2 B;  1XK4 A;  2KAV A;  1K95 A;  1IQ5 A;  3O78 A;  3AAK A;  2ZRS A;  3WXA A;  1RTP 1;  2JOJ A;  1QVI Z;  1SMG A;  3I5G C;  1EXR A;  2L4I A;  3EVU A;  1XFU O;  1TIZ A;  1W7J B;  1OQP A;  5I8N A;  3CGA A;  5G08 A;  2COL B;  4JQ0 D;  1G8I A;  1DJH A;  4NQG A;  1TOP A;  2HET A;  3PAT A;  1BU3 A;  1H8B A;  1YVL A;  1Y1A A;  2E6W A;  1AK8 A;  3VRO A;  1JC2 A;  1SR6 C;  3VRQ A;  1CM4 A;  1NYA A;  1CKK A;  1REC A;  5CPV A;  2F2O A;  2FOT A;  2L2E A;  3EKH A;  5HKZ A;  1MXE A;  2OTG B;  3KF9 A;  2LUX A;  2NXQ A;  2OS8 B;  4QJ3 B;  2JPT A;  4WRI A;  2JXC A;  1DF0 A;  4NDC A;  1OMR A;  2FCE A;  1IWQ A;  1IQ3 A;  2KFG A;  1BMO A;  3KO0 A;  1BOD A;  2KHN A;  2AMI A;  3LLE A;  2KAY A;  4CFQ A;  1XFW O;  2H61 C;  1CDM A;  3GOF A;  4MZK A;  3I5F C;  4PHM A;  4HRG A;  2K7O A;  1KFU L;  2LHL A;  3FIA A;  4PHN A;  1K96 A;  1CLB A;  1A03 A;  1NUB A;  1V1G A;  1SCM B;  1PAL A;  1A75 A;  2JT3 A;  1CFP A;  5TNC A;  2LVV A;  1CMF A;  1QIV A;  2O60 A;  1UWO A;  2Y1M A;  5JJG A;  1ZUZ A;  1J7P A;  4GUK A;  1LVC D;  2LCP A;  5JOL A;  1NCZ A;  1V1F A;  1BT6 A;  2JXL A;  2LMV A;  2WND A;  2QPT A;  4YGC B;  3LCP C;  1FI6 A;  2HQW A;  4M2Q A;  1BG1 A;  4ORB B;  2LVJ A;  1ALV A;  2JU0 A;  3SJS A;  3WHU B;  1PRW A;  1B9A A;  3WNX B;  1LIN A;  1Q80 A;  3NSO A;  2BEC A;  1AHR A;  1C07 A;  1RRO A;  1SL9 A;  2MLE C;  4JPZ B;  3TDZ A;  3NSL A;  2JNF A;  2WCE A;  3DVM A;  1CLM A;  3K21 A;  3LK1 A;  3RLZ A;  1A29 A;  2M49 B;  1UUR A;  2HF5 A;  2CNP A;  1KFX S;  4DIR A;  1F4Q A;  3NXA A;  5HKW A;  1PVB A;  1S6J A;  3FWB A;  1UHJ A;  3SG6 A;  4DRW A;  2M97 A;  1YR5 A;  2M0R A;  3TUY B;  2MBX A;  1XK4 C;  1KK7 Y;  2MLF C;  1OZS A;  5AFP A;  1M31 A;  1DTL A;  1BOC A;  3EK8 A;  4YGB B;  1JFJ A;  1K94 A;  1WDC B;  2BL0 B;  1GGZ A;  1RWY A;  1JSA A;  3DF0 B;  4M2P A;  5I2O A;  1ZMZ A;  1J1D A;  1AJ5 A;  4JWQ A;  2JTT A;  1NWD A;  3BOW B;  4M2O A;  4PE4 A;  2AUC A;  2Q91 A;  5CSF A;  2JQ6 A;  4GGF C;  5HLV A;  1ZAC A;  2RGI A;  5CSJ A;  1EG4 A;  1SPY A;  1TRF A;  1YUS A;  3E3R A;  1OMD A;  1EH2 A;  1N2D A;  3IQQ A;  3LK0 A;  4QJ5 B;  1EL4 A;  3KEV A;  1TTX A;  2M29 A;  2K7B A;  4L9M A;  2GGM A;  2BBN A;  2JNX A;  2K8M B;  1EJ3 A;  2BKH B;  1OZO A;  4F0Z B;  2LAP A;  1DMO A;  1MUX A;  3I5G B;  1PSR A;  4PE1 A;  1JF2 A;  1IJ5 A;  5ER5 A;  1YX7 A;  3A8R A;  4D1E A;  3O4Y A;  3FWC A;  1NIW A;  3I5I C;  3EKJ A;  1NX1 A;  1XFV O;  4UPG A;  1XYD A;  2BCX A;  4AQJ A;  2L5X B;  5CSI A;  2CTN A;  5KU1 A;  2KQY A;  1UHN A;  1ZFS A;  1NPQ A;  3DD4 A;  4DUQ A;  5KTY A;  2NCO A;  4CID A;  2CT9 A;  1XA5 A;  5B8I B;  4ORA B;  3HX4 A;  1AUI B;  1SCV A;  2PRU A;  4ICB A;  4ZCV A;  2KI4 C;  2JT8 A;  5J3X A;  1N65 A;  1J7R A;  4WQ3 A;  3I5H C;  1S36 A;  1M46 A;  2O5G A;  1M45 A;  2NLN A;  1SL8 A;  1ALW A;  2LP3 A;  1BR4 B;  2ZN8 A;  1CDP A;  2QAC A;  3OHM B;  2JT0 A;  2KFF A;  3MSE B;  3DVE A;  2KOT A;  4OCI A;  3BYA A;  3ZNI A;  1KQM C;  1PSB A;  2BKI B;  1QTX A;  3SG3 A;  3O6B A;  1DJW A;  5I2L A;  1IKU A;  1SL7 A;  1LA0 A;  1YRU B;  3ZWH A;  1PUL A;  1RJV A;  4OVN F;  1TCF A;  5D69 A;  2KI6 C;  4CLN A;  3H4S E;  4MZL A;  2PAL A;  3D0Y B;  4XJK B;  4FQO A;  2EC6 C;  3SG2 A;  1MHO A;  2I18 A;  1AP4 A;  1TNW A;  4IL1 A;  3CTN A;  4GFT A;  5AAN A;  1JUO A;  2DOQ A;  3CR4 X;  4GBA A;  4GPL B;  2CBL A;  1SKT A;  2HPS A;  5KSZ A;  1C7W A;  1RK9 A;  1CMG A;  4I5N B;  1KK8 C;  2KBM A;  1PK0 D;  1IH0 A;  1SBJ A;  3PN7 B;  2BCB A;  2LP2 A;  2BCA A;  3DF0 A;  2LLT A;  1MWN A;  2M7N A;  4MSP A;  1JWD A;  4GAO A;  2LNK A;  2KDH A;  2KSP A;  2MAZ A;  1J7O A;  1SYM A;  3BOW A;  3GK2 A;  2P6B B;  1GQM A;  1B8L A;  1KK7 Z;  1TNP A;  4MEW A;  2CCM A;  1CDL A;  2L4H A;  1JF0 A;  1BJF A;  2R2I A;  1VRK A;  4I5J A;  3OB1 B;  1C7V A;  1E8A A;  1QLS A;  3PAL A;  1B4C A;  1NP8 A;  2OS8 C;  4N1G A;  1TNX A;  1QS7 A;  3TS5 C;  4CPV A;  2NZ0 A;  1SRA A;  3QRX A;  4YRU A;  1LXF C;  4HRH A;  2FCD A;  2JC2 A;  2GV5 A;  3SG5 A;  1S26 D;  1N0Y A;  4ORC B;  3JVT C;  1WRK A;  1SW8 A;  2F33 A;  3BUW B;  4P5O E;  2MJW B;  2I7A A;  3BQ3 A;  4PDZ A;  1BR1 B;  1NCX A;  1LA3 A;  1IRJ A;  4PHK A;  5DKR A;  1U5I B;  2E30 A;  3PM8 A;  4A4C A;  2K0J A;  4FTG A;  3VGO A;  1HT9 A;  3D10 A;  1MF8 B;  1DF0 B;  2BE6 A;  2KBI A;  3KHE A;  2M8U A;  3EK7 A;  4ZCU A;  2LE9 B;  1JBA A;  4R1E A;  1CTR A;  1CFF A;  3NSI A;  1B7T Y;  3C1V A;  3JTD C;  3KPX A;  3SG4 A;  1DVI A;  3I5I B;  3WHT B;  2JRF A;  3OX5 A;  2F3Z A;  2ZRT A;  1OE9 B;  2MA2 A;  3IF7 A;  1Y1U A;  1K93 D;  2WCF A;  2ZFD A;  1YUT A;  1J55 A;  4MRY A;  1CM1 A;  3BUO B;  2LAN A;  1NX3 A;  3TDU A;  1NX2 A;  1WRL A;  4PE7 A;  4CFR A;  5IBW A;  3BUN B;  3D0Y A;  4XJK A;  1YUR A;  2K7D A;  1UHI A;  2KI4 B;  4PE0 A;  1DJI A;  3TUY C;  2ZNE A;  3I5H B;  4C0K A;  1SK6 D;  1SY9 A;  2JZI A;  1K2H A;  2LM5 A;  1B8R A;  1DGV A;  1KFU S;  2NCP A;  1SR6 B;  1QV0 A;  2Y4Q A;  2MHH A;  1FBV A;  4Q04 A;  3BUM B;  4WQ2 A;  2PVB A;  2VRG A;  1KQM B;  1WLZ A;  5FYX A;  2WC8 A;  4NDD A;  5HYD A;  1TCO B;  1QX2 A;  3OP0 A;  1NX0 A;  2PAS A;  1DJX A;  1IJ6 A;  2L50 A;  1KWO C;  1BF5 A;  1XO5 A;  2M9G A;  2ZKM X;  1CFD A;  2BE4 A;  4I5L B;  1K90 D;  1L7Z A;  3CLN A;  1R6P A;  1K9P A;  1UHK A;  1KFX L;  2L51 A;  4OKH A;  3NSK A;  5F6T A;  3VRP A;  1QAT A;  1F71 A;  1YRT B;  1CDN A;  1CNP A;  4I5K A;  2Q4U A;  1QX7 A;  1S5G Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...