3WHUB

Crystal structure of ergic-53/mcfd2, calcium/man2-bound form
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
71
structure length
58
Chain Sequence
QLHYFKMHDYDGNNLLDGLELSTAITMSEDELINIIDGVLRDDDKNNDGYIDYAEFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein ERGIC-53
publication title Structural Basis for Disparate Sugar-Binding Specificities in the Homologous Cargo Receptors ERGIC-53 and VIP36
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 18
structure length 58
sequence length 71
ec nomenclature
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3whuB00
1YURA 2K7BA 1IH0A 1F4OA 2ZN9A 2BBMA 2JU0A 2V53A 1AUIB 5HKWA 2P6BB 4MVFA 3PSRA 1A2XA 3FWCA 1AJ4A 3BOWA 1KK8C 2HQ8A 1SMGA 3JTDC 4FTGA 1A75B 1QLKA 2Y4QA 1L2OC 3JVTC 1XK4C 2SCPA 5PALA 3VRRA 1B1GA 3AAKA 1KSOA 2KFHA 1NUBA 1FBVA 1QX5B 4YGCB 1B7TY 2VRGA 4QJ3B 2LVKA 1AVSA 3BUMB 3LK0A 1OQPA 1WRLA 2R2IA 1FW4A 3FWBA 1UUSA 4PHJA 4MRYA 1A75A 1BMOA 1HT9A 1SRAA 1SY9A 2CBLA 2NXQA 2WCFA 4D1EA 1NCYA 1X02A 1J1EA 2WOSA 3DD4A 4PHNA 1PVBA 3SIBA 4ZCVA 2MJWB 1C7VA 1GGWA 2BECA 2JOJA 4NDDA 1PVAA 4YI9A 1JFJA 4M2QA 1CFCA 3LCPC 1CTRA 2KYCA 2L2EA 4GNKB 4GFTA 1NX3A 4NDBA 5CSJA 3RM1A 2GGZA 1SL7A 1SW8A 4C0KA 4UPGA 2L0PA 1J7PA 3ZNIA 4AOMA 3K21A 1U5IA 2HETA 3I5FB 2BKHB 4JQ0D 4I5JA 1N0YA 1YR5A 2CXJA 2NZ0A 2WCBA 3CR2A 2KSPA 1KCYA 4F0ZB 1TIZA 2EGDA 1NIWA 1LVCD 4GBAA 3BUOB 1AK8A 2K7CA 3TUYC 2MLEC 3CR4X 3I5IC 2JT0A 2JC2A 1F8HA 1DGVA 2KQYA 2ISDA 4OKHA 1EG3A 4PALA 4Q04A 2WNDA 2ZKMX 2JQ6A 2JTTA 2ZRTA 1QVIZ 4GPLB 4ORAB 2BCXA 4PCWA 1DJZA 1SCMC 1RECA 1M45A 5DKNA 4YGBB 2M49B 3PN7C 2QACA 1IJ5A 2F8PA 1EH2A 4I5KA 2NCOA 3OP0A 3AAJA 1SL9A 3BXKA 1PK0D 4FQOA 5HLOA 1DJHA 5I2LA 1RWYA 1OE9B 2D8NA 2KBMA 1YVHA 1TCFA 1DJXA 4GGNA 1B47A 1BODA 1D1OA 2EHBA 4E68A 2M0RA 2MRDA 4WQ2A 4PE7A 5G08A 1QTXA 1MXEA 3M0WA 4I5NB 1G4YR 5HKZA 1K93D 4U8DA 1R2UA 1LINA 2JRFA 2M7NA 4IL1A 3AKAA 3SG6A 1QIVA 2KBIA 1CFFA 2M97A 1F55A 1QVIY 1LA3A 4DIRA 5I2QA 4TNCA 3VGOA 1KWOB 3D10A 4PE4A 3SIAA 4DS7A 1CNPA 2KYFA 1H4BA 3BUNB 2AAOA 2CCMA 2LE9B 1PSRA 3NSLA 2BE4A 2K8MB 4PHKA 1ODBA 5FYXA 1IGVA 5D7FA 4WRIA 1KFUL 1WLMA 2K0JA 2BBNA 1CDPA 2BL0B 2NCPA 2M8UA 1BOCA 1W7JB 2H61C 4M2PA 1B7TZ 3EVRA 4P2YB 2E30A 1JSAA 1DGUA 3ZWHA 1QXPA 2K7DA 2KI6D 2LMVA 4YRUA 1JWDA 2LLTA 2JXLA 1KFXL 2RGIA 3LL8B 1CLLA 1ALVA 2LUXA 2MHHA 1CM1A 3PFVA 1XFUO 4YBHB 4A4BA 2LVJA 2KOTA 2M3WA 1K9UA 3PM8A 1S3PA 1MUXA 2TN4A 1TCOB 4CPVA 2OTGC 1S5GZ 1UHNA 2K61A 1BG1A 1R6PA 2KI4B 1G33A 4GGFC 2M1KB 5CSNA 3LK1A 1UURA 2LMUA 1JUOA 1KQMC 2LCPA 3FS7A 1XFXO 1JF0A 3NSOA 1M31A 1UHIA 2K2AA 1SCVA 2PASA 2GV5A 5B8IB 1OMRA 3WNXB 1NWDA 1SR6B 3DVMA 1BR4B 4MZLA 1B4CA 1KSMA 1N65A 2AUCA 2CTNA 1IG5A 4R1EA 1MXLC 1YX8A 1CDMA 1UWOA 1YTZC 2KAYA 1EG4A 5AERA 3GK4X 2MA2A 4YGDB 3KF9A 1MQ1A 2FCDA 1JC2A 4MLWA 1H8BA 2Q4UA 5D69A 3TS5C 1WDCC 1S5GY 1NCXA 2LHLA 1CMGA 1ZACA 2COLB 3F45A 5DKRA 4CFRA 1CFDA 3AKBA 2EC6C 4DCKA 2FOTA 5CPVA 3KEVA 1IQ3A 1DVIA 3I5HB 4BY5A 1DT7B 1CB1A 3CS1A 1KQVA 1OSAA 3C1VA 1TNXA 3EK4A 5DKQA 1M39A 1RTP1 5HYDA 1PULA 1K96A 4CIDA 3I5GB 1C7WA 1TNWA 1SKTA 2H2KA 2OS8B 4QJ4B 3CGAA 1BU3A 1B8LA 1DJIA 1BT6A 4AQJA 2PMYA 3EVVA 4I5LB 1PRWA 2WC8A 2AMIA 1CMFA 5ER4X 2BCAA 1JF2A 3BQ3A 3EKJA 1IRJA 2JZIA 5CSIA 2F3ZA 2ZRSA 4NDCA 2JXCA 3RLZA 2Y1MA 1OZOA 1YUUA 3O6BA 3WXAA 2PALA 1UP5A 1NX2A 4PDZA 1QS7A 1A03A 3CLNA 2HQWA 2OPOA 3MSEB 3CWGA 1FI5A 1FI6A 2KAXA 3KPXA 1RROA 2M7LA 2LP3A 1S36A 1QATA 2KAVA 1PALA 3DF0B 4GUKA 2F3YA 2Y5IA 1YRTB 3BYAA 3O78A 1ZUZA 1S6IA 1SPYA 2JT8A 4M2OA 1SK6D 1S26D 3NSIA 1C07A 1XFWO 1EJ3A 1QASA 1XFZO 3OX5A 1KK8B 3IQQA 3HX4A 1CM4A 3JTDB 1BJFA 3DVKA 2LAPA 1L2OB 1MWNA 3JVTB 1RJVA 1WLZA 5K89A 3DF0A 2I2RE 2JTZA 3KHEA 4GAOA 3I5FC 2LUCA 4YGEB 4AQIA 1K94A 2HPSA 5HKYA 2K2FA 2KQ6A 1IJ6A 3QRXA 1QV1A 1NCZA 1FF1A 2FCEA 2CNPA 4N5XA 1OZSA 4XYNA 5AFPA 1WRZA 2E6WA 3SG3A 1TNQA 3TDUA 1XK4A 2JWWA 4PE1A 1F70A 5KTYA 1B9AA 1DJGA 5AEQA 2LV7A 1OMVA 4JWQA 4ZCUA 1MF8B 1NYAA 2LNKA 3EK7A 1KFUS 1M63B 2OS8C 3CZTX 1MR8A 2ZNDA 2IS9A 2ZN8A 4OV2A 2ZFDA 1TTXA 3HCMA 1J7OA 3SJSA 1NX0A 1TNPA 5J3XA 4OR9B 2B1UA 2F2PA 5TNCA 2BKIB 3LLEA 2KHNA 1IQ5A 1QX7A 3SG7A 2KDHA 3OHMB 2KNEA 1WY9A 2JPTA 1J7QA 1NP8A 1OMDA 1XO5A 1KFXS 1EXRA 1S1EA 1TN4A 1W7IB 4HSZA 4MRXA 1IWQA 1NPQA 2CT9A 5GQQC 1AP4A 3NSKA 1BR1B 1YUTA 1CDLA 1F71A 3TUYB 3I5IB 1KK7Y 2LANA 2M9GA 3OX6A 1A29A 1DMOA 4HREE 3ICBA 3PLFB 2G2BA 1K9PA 3VRPA 3EKHA 1K2HA 1JBAA 1K90D 1ZMZA 4BY4A 3SG5A 1SCMB 2LMTA 2I7AA 2LVIA 5F6TA 5AANA 1KWOC 1XA5A 4ORBB 3PN7B 2F33A 2I18A 2O60A 5BPJA 5CSFA 1K8UA 2M1UA 3OB2B 2Y1NA 5I2OA 1CKKA 2JNFA 2LP2A 3CTNA 4MEWA 2BL0C 1YRUB 5I8NA 4HRHA 2KGRA 2PSRA 3D0YB 1Y1UA 3H4SE 2K7OA 2BE6A 5ER5A 1B8RA 1DTLA 1SBJA 4N1GA 3WHUB 1S6JA 1AJ5A 1V1GA 2KFFA 1U5IB 1CLMA 1LXFC 1XVJA 1E8AA 2FJUB 1XFVO 1YUSA 4DRWA 3D0YA 1PSBA 1M46A 2MLFC 1LKJA 1AHRA 2I94A 2ZNEA 2PVBA 3E3RA 5JOLA 2MBXA 1J7RA 1V1FA 4OCIA 3DVEA 2KGBC 1B8CA 4A4CA 2KI4C 4ICBA 4HRGA 4JPZB 5HLVA 4USLA 1QLSA 4PHMA 3TDZA 1CFPA 2NLNA 3GK1A 2WORA 4MBEA 2JNXA 2DOQA 3BUWB 3PATA 4OVNF 3EVUA 2L5XB 2LM5A 2L50A 4C0LA 1SR6C 1Y1AA 2A4JA 4YI8A 1QX2A 3A8RA 3A4UB 3OB1B 3KO0A 1JFKA 2LVVA 2PRUA 1L7ZA 4MSPA 1Y6WA 1DJYA 5AXIA 2H61A 3BUXB 1QJTA 3DVJA 1CDNA 4N1FA 1UHJA 2L98A 4WQ3A 3SG4A 4P5OE 3O2PA 1DF0B 3IF7A 1ZFSA 4NQGA 5KU1A 3CR5X 1QV0A 1F4QA 1SYMA 1DJWA 2OTGB 1SL8A 1J55A 1NX1A 2F2OA 1GGZA 3FIAA 3IQOA 1XYDA 1FPWA 3GK2A 1S6CA 2WCEA 1QIWA 3SG2A 1SNLA 2M29A 1CLBA 2SASA 1KQMB 1DF0A 1G8IA 2Q91A 1WRKA 3I5HC 2HF5A 1TRFA 4MZKA 2L51A 4ETOA 1BLQA 2QPTA 4L9MA 1UHHA 4ORCB 3WHTB 2O5GA 3VROA 2MAZA 1KK7Z 2LLUA 4GGFA 2GGMA 1F54A 1YX7A 1XFYO 1NSHA 2JULA 2JT3A 3NXAA 3I5GC 1BF5A 1N2DA 2KFGA 1HQVA 1J1DA 1UHKA 4MN0A 4YGAA 2L4HA 4MZJA 2LHIA 1TOPA 4XJKB 3EK8A 2LLSA 2G9BA 3TDIA 3VRNA 1RFJA 3TS5B 3VRQA 1Q80A 1A4PA 1WDCB 1GQMA 3PALA 4QJ5B 1K95A 1Y0VH 5KSZA 3GOFA 2EC6B 4CFQA 1IKUA 3O4YA 1YVLA 2KI6C 4C0JA 3TZ1A 1Y1XA 1ALWA 4PE0A 1RK9A 1ZOTB 2BCBA 1LA0A 1OOJA 1EL4A 1VRKA 2LC5A 4XJKA 4CLNA 1K9KA 3BOWB 4DUQA 5IBWA 5JJGA 1GJYA 1MHOA 2L4IA
chains in the Genus database with same CATH superfamily
1YURA 2K7BA 4JD9A 1IH0A 1F4OA 3R1VA 2ZN9A 2BBMA 2JU0A 2V53A 3DXLA 1AUIB 5HKWA 2P6BB 4MVFA 3PSRA 1A2XA 3FWCA 1AJ4A 3BOWA 1KK8C 4FQTA 2HQ8A 1SMGA 3JTDC 4FTGA 1A75B 1QLKA 2Y4QA 1L2OC 2FJYA 3JVTC 1XK4C 2SCPA 5PALA 3VRRA 1B1GA 3AAKA 1KSOA 2KFHA 1NUBA 1C3YA 1FBVA 1QX5B 2K60A 4YGCB 1B7TY 2VRGA 4QJ3B 2LVKA 1AVSA 3BUMB 3LK0A 1OQPA 1WRLA 2R2IA 1FW4A 3FWBA 1UUSA 4PHJA 4MRYA 1A75A 1BMOA 1HT9A 1SRAA 1SY9A 2CBLA 2NXQA 2WCFA 4D1EA 1NCYA 1X02A 1J1EA 2WCHA 2WOSA 3DD4A 4PHNA 1PVBA 3SIBA 4ZCVA 1TWOA 2MJWB 1C7VA 1GGWA 2BECA 2JOJA 3BFBA 4NDDA 1PVAA 3B87A 4YI9A 1JFJA 3NHTA 4M2QA 3SS4A 1CFCA 3LCPC 2YGUA 1CTRA 2KYCA 1SSEB 2L2EA 4GNKB 4GFTA 3NHIA 1NX3A 4NDBA 5CSJA 3RM1A 3O4XA 2GGZA 3DY9A 1SL7A 1SW8A 4C0KA 4UPGA 2L0PA 1J7PA 3DYEA 3ZNIA 4AOMA 3K21A 1U5IA 2HETA 3I5FB 2BKHB 4JQ0D 4I5JA 1YR5A 1N0YA 2CXJA 2NZ0A 2WCBA 3CR2A 2KSPA 1KCYA 4F0ZB 1TIZA 2EGDA 1NIWA 1LVCD 4GBAA 3BUOB 1AK8A 2K7CA 2QEOA 2MLEC 3CR4X 3I5IC 3TUYC 2JT0A 2JC2A 2L5YA 1F8HA 5FI7A 1DGVA 2KQYA 2ISDA 4OKHA 1EG3A 4PALA 4Q04A 2WNDA 2ZKMX 2JQ6A 2JTTA 2ZRTA 1QVIZ 4GPLB 5HL1A 4KYNA 3S0DA 3SS5A 4ORAB 2BCXA 4PCWA 1DJZA 1SCMC 1RECA 2H8VA 1M45A 2KLDA 5DKNA 4YGBB 2M49B 3PN7C 2QACA 1IJ5A 2F8PA 1TUJA 1EH2A 4I5KA 2NCOA 3OP0A 3AAJA 1SL9A 3BXKA 1PK0D 4FQOA 1ORGA 5HLOA 1DJHA 5I2LA 1RWYA 1OE9B 2D8NA 2KBMA 1YVHA 1TCFA 1DJXA 4GGNA 1B47A 1BODA 2WCJA 1D1OA 2L2CA 2EHBA 4E68A 2M0RA 2MRDA 4WQ2A 4PE7A 5G08A 1QTXA 1MXEA 3M0WA 4I5NB 1G4YR 5HKZA 1K93D 2PYQA 3Q8IA 1R2UA 4U8DA 1LINA 2JRFA 2M7NA 4IL1A 3AKAA 3SG6A 1QIVA 2KBIA 1CFFA 2M97A 1F55A 1QVIY 1LA3A 3B6XA 4DIRA 5I2QA 4TNCA 3VGOA 3D74A 1KWOB 3D10A 4PE4A 3SIAA 4DS7A 1CNPA 2KYFA 1H4BA 3BUNB 2AAOA 2CCMA 2LE9B 3D75A 1PSRA 2JPOA 2BE4A 2K8MB 3NSLA 1ODBA 4PHKA 5FYXA 1IGVA 3L47A 5D7FA 4OZDA 4WRIA 1KFUL 1WLMA 2K0JA 5FI2A 2BBNA 2QEVA 1CDPA 2BL0B 2NCPA 2M8UA 1BOCA 1W7JB 2H61C 4M2PA 1B7TZ 3B88A 3EVRA 4P2YB 2E30A 2KPHA 1JSAA 1DGUA 2WCKA 3DZTA 3ZWHA 1QXPA 2K7DA 2KI6D 2LMVA 4YRUA 1JWDA 2LLTA 2JXLA 1KFXL 2RGIA 3L4LA 1CLLA 1ALVA 2LUXA 3LL8B 2MHHA 1CM1A 3PFVA 1XFUO 4YBHB 4A4BA 2LVJA 2KOTA 2M3WA 1K9UA 3PM8A 1S3PA 1OOIX 1MUXA 2TN4A 1TCOB 4CPVA 2OTGC 1S5GZ 1UHNA 2K61A 1BG1A 1R6PA 2KI4B 3S0AA 1G33A 4GGFC 2M1KB 5CSNA 3LK1A 1UURA 2LMUA 1OOHA 1JUOA 1KQMC 2LCPA 3FS7A 1XFXO 3FE6A 1JF0A 3NSOA 5I94A 1M31A 1UHIA 2K2AA 1SCVA 2PASA 3D73A 2GV5A 3BFHA 5B8IB 1OMRA 3WNXB 1NWDA 1SR6B 3DVMA 1BR4B 1QWVA 4MZLA 1B4CA 1KSMA 1N65A 2AUCA 2CTNA 1IG5A 4R1EA 1MXLC 1YX8A 1CDMA 1UWOA 1YTZC 2KAYA 1EG4A 5AERA 3GK4X 2MA2A 4YGDB 3KF9A 1MQ1A 2BAPA 2FCDA 2WCMA 1JC2A 4MLWA 3CYZA 1H8BA 3BFAA 2Q4UA 5D69A 3TS5C 1WDCC 1S5GY 1NCXA 3B86A 2LHLA 1CMGA 1ZACA 2COLB 3F45A 5DKRA 4CFRA 1CFDA 3AKBA 2EC6C 2QEHA 4DCKA 2FOTA 5CPVA 3KEVA 1IQ3A 1DVIA 3I5HB 3D78A 3OGNA 4BY5A 1DT7B 4IJ7A 2WCLA 3CS1A 1CB1A 1KQVA 3D76A 1OSAA 3C1VA 3S0GA 1TNXA 3EK4A 5DKQA 1M39A 1RTP1 5HYDA 1PULA 1K96A 4CIDA 3I5GB 1C7WA 1TNWA 3R1PA 1SKTA 2H2KA 2OS8B 4QJ4B 3CGAA 1BU3A 1B8LA 1DJIA 1BT6A 4AQJA 2PMYA 3EVVA 3N7HA 4I5LB 1PRWA 1Z4HA 2WC8A 2AMIA 1CMFA 5ER4X 2BCAA 1JF2A 3BQ3A 3EKJA 1IRJA 2JZIA 3CABA 2F3ZA 2ZRSA 5CSIA 4NDCA 2JXCA 3RLZA 1T14A 2Y1MA 1OZOA 1YUUA 3O6BA 3WXAA 2PALA 1UP5A 1NX2A 4PDZA 1QS7A 3FE9A 1A03A 3S0EA 3CLNA 2HQWA 2OPOA 3MSEB 3CWGA 1FI5A 1FI6A 2KAXA 3KPXA 1RROA 2M7LA 2LP3A 3K1EA 1S36A 1QATA 2KAVA 1PALA 3DF0B 4GUKA 5DICA 2F3YA 2Y5IA 1XFRA 3OBVA 1YRTB 3BYAA 3O78A 1ZUZA 1S6IA 1SPYA 2JT8A 4M2OA 1SK6D 1S26D 3NSIA 1C07A 1XFWO 1EJ3A 1QASA 1XFZO 3OX5A 1KK8B 3IQQA 3HX4A 1CM4A 3JTDB 1BJFA 2BNXA 3CZ1A 3DVKA 2LAPA 1L2OB 1MWNA 3JVTB 1RJVA 1WLZA 5K89A 3DF0A 2I2RE 2JTZA 3KHEA 4GAOA 3I5FC 2LUCA 4YGEB 4AQIA 1K94A 1C3ZA 2HPSA 5HKYA 2K2FA 2KQ6A 1IJ6A 3QRXA 1QV1A 1NCZA 1FF1A 2FCEA 3EG5B 2CNPA 4N5XA 1DEKA 1OZSA 4XYNA 5AFPA 1WRZA 2E6WA 3SG3A 1TNQA 3TDUA 1XK4A 2JWWA 4PE1A 1F70A 5KTYA 1B9AA 1DJGA 5AEQA 2LV7A 1OMVA 4JWQA 4ZCUA 1MF8B 1NYAA 5EL2A 2LNKA 3EK7A 1KFUS 1M63B 2OS8C 3CZTX 3S0BA 1MR8A 2ZNDA 3VB1A 3L4AA 2IS9A 2ZN8A 3CZ0A 3S0FA 4OV2A 2ZFDA 1IIOA 1TTXA 3HCMA 1J7OA 3SJSA 1NX0A 1TNPA 3R1OA 5J3XA 4OR9B 2B1UA 2F2PA 5TNCA 2BKIB 1P28A 3LLEA 2KHNA 1IQ5A 1QX7A 3SG7A 2KLEA 2KDHA 3OHMB 2KNEA 1WY9A 2JPTA 1J7QA 1NP8A 1OMDA 1XO5A 1KFXS 1EXRA 1S1EA 1TN4A 1W7IB 4HSZA 4MRXA 1IWQA 1NPQA 2CT9A 5GQQC 3SS3A 1AP4A 3NSKA 1BR1B 3IVTA 1YUTA 1CDLA 1F71A 3TUYB 3I5IB 1KK7Y 2LANA 2M9GA 3OX6A 1A29A 1DMOA 4HREE 3ICBA 3PLFB 2G2BA 1K9PA 3VRPA 3EKHA 1K2HA 1JBAA 1K90D 1ZMZA 4BY4A 3SG5A 1SCMB 2LMTA 2I7AA 2LVIA 5F6TA 5AANA 1KWOC 1XA5A 3D77A 4ORBB 3PN7B 2F33A 1DC1A 2I18A 2O60A 5BPJA 5CSFA 1K8UA 2M1UA 3OB2B 2Y1NA 5I2OA 1CKKA 2JNFA 2LP2A 3CTNA 4MEWA 2BL0C 1YRUB 5I8NA 4HRHA 2GTEA 2KGRA 1OW4A 2PSRA 3D0YB 1Y1UA 3BJHA 3H4SE 2K7OA 2BE6A 5ER5A 3V2LA 1B8RA 1DTLA 1SBJA 4N1GA 3WHUB 1S6JA 1AJ5A 1V1GA 2KFFA 1U5IB 1CLMA 1LXFC 1XVJA 1E8AA 2FJUB 1XFVO 1YUSA 4DRWA 3D0YA 1PSBA 4INWA 1M46A 2MLFC 1LKJA 1AHRA 3UO9A 2I94A 2ZNEA 2PVBA 3E3RA 5JOLA 2MBXA 1J7RA 3UNWA 1V1FA 2P71A 4OCIA 3DVEA 2KGBC 1B8CA 4A4CA 1TUZA 2KI4C 1OOGA 4ICBA 4HRGA 4JPZB 5HLVA 4USLA 1QLSA 4PHMA 3TDZA 1CFPA 2NLNA 3GK1A 2WORA 4MBEA 2JNXA 2DOQA 3BUWB 3PATA 4OVNF 3EVUA 2PQLA 2L5XB 2LM5A 2L50A 3R72A 4C0LA 1SR6C 1Y1AA 2A4JA 3CDNA 4YI8A 1QX2A 3A8RA 3A4UB 3OB1B 5D3OA 3KO0A 1JFKA 2LVVA 2PRUA 1L7ZA 4MSPA 4F7FA 1Y6WA 1DJYA 2ERBA 5AXIA 2H61A 3BUXB 1QJTA 3RZSA 3DVJA 3PM2A 1CDNA 4N1FA 1UHJA 3QMEA 2L98A 2WC6A 2QEBA 4WQ3A 3SG4A 4P5OE 3O2PA 1DF0B 3IF7A 1ZFSA 4NQGA 5KU1A 3CR5X 1QV0A 1F4QA 1SYMA 1DJWA 3NGVA 1DQEA 1OOFA 2OTGB 1SL8A 1J55A 1NX1A 1GM0A 2F2OA 1GGZA 3FIAA 3IQOA 1XYDA 1FPWA 2QDIA 3GK2A 1S6CA 2WCEA 1QIWA 3SG2A 1SNLA 2M29A 1CLBA 4INXA 2SASA 1KQMB 1DF0A 1G8IA 2Q91A 1WRKA 3I5HC 2HF5A 1TRFA 4MZKA 2L51A 4ETOA 1BLQA 4JKTA 2QPTA 4L9MA 1UHHA 4ORCB 3WHTB 2O5GA 3VROA 2MAZA 3FE8A 1KK7Z 1LS8A 2LLUA 4GGFA 2GGMA 1F54A 1YX7A 1W9ZA 1XFYO 1NSHA 2JULA 2JT3A 3NXAA 3I5GC 1BF5A 1N2DA 2KFGA 1DELA 1HQVA 3PJIA 1Z2CB 3CZ2A 1J1DA 1UHKA 4MN0A 4YGAA 2L4HA 4MZJA 2LHIA 1TOPA 4XJKB 3EK8A 2LLSA 2G9BA 3TDIA 3VRNA 1RFJA 3TS5B 3VRQA 1Q80A 1A4PA 1WDCB 3B7AA 1GQMA 3PALA 4QJ5B 1K95A 1Y0VH 5KSZA 3GOFA 2EC6B 4CFQA 1IKUA 3O4YA 1YVLA 2KI6C 2P70A 3TZ1A 1Y1XA 4C0JA 1ALWA 4PE0A 1RK9A 1ZOTB 1LA0A 1OOJA 1VRKA 1EL4A 2BCBA 2LC5A 4PT1A 4XJKA 1K9KA 3BOWB 5FI6A 4CLNA 4DUQA 5IBWA 5JJGA 1GJYA 1MHOA 2L4IA 2WC5A
chains in the Genus database with same CATH topology
1YURA 2K7BA 1IH0A 1F4OA 2ZN9A 2BBMA 2JU0A 2V53A 1AUIB 5HKWA 2P6BB 4MVFA 3PSRA 1A2XA 3FWCA 1AJ4A 3BOWA 1KK8C 2HQ8A 1SMGA 3JTDC 4FTGA 1A75B 1QLKA 2Y4QA 1L2OC 3JVTC 1XK4C 2SCPA 5PALA 3VRRA 1B1GA 3AAKA 1KSOA 2KFHA 1NUBA 1FBVA 1QX5B 4YGCB 1B7TY 2VRGA 4QJ3B 2LVKA 1AVSA 3BUMB 3LK0A 1OQPA 1WRLA 2R2IA 1FW4A 3FWBA 1UUSA 4PHJA 4MRYA 1A75A 1BMOA 1HT9A 1SRAA 1SY9A 2CBLA 2NXQA 2WCFA 4D1EA 1NCYA 1X02A 1J1EA 2WOSA 3DD4A 4PHNA 1PVBA 3SIBA 4ZCVA 2MJWB 1C7VA 1GGWA 2BECA 2JOJA 4NDDA 1PVAA 4YI9A 1JFJA 4M2QA 1CFCA 3LCPC 1CTRA 2KYCA 2L2EA 4GNKB 4GFTA 1NX3A 4NDBA 5CSJA 3RM1A 2GGZA 1SL7A 1SW8A 4C0KA 4UPGA 2L0PA 1J7PA 3ZNIA 4AOMA 3K21A 1U5IA 2HETA 3I5FB 2BKHB 4JQ0D 4I5JA 1N0YA 1YR5A 2CXJA 2NZ0A 2WCBA 3CR2A 2KSPA 1KCYA 4F0ZB 1TIZA 2EGDA 1NIWA 1LVCD 4GBAA 3BUOB 1AK8A 2K7CA 3TUYC 2MLEC 3CR4X 3I5IC 2JT0A 2JC2A 1F8HA 1DGVA 2KQYA 2ISDA 4OKHA 1EG3A 4PALA 4Q04A 2WNDA 2ZKMX 2JQ6A 2JTTA 2ZRTA 1QVIZ 4GPLB 4ORAB 2BCXA 4PCWA 1DJZA 1SCMC 1RECA 1M45A 5DKNA 4YGBB 2M49B 3PN7C 2QACA 1IJ5A 2F8PA 1EH2A 4I5KA 2NCOA 3OP0A 3AAJA 1SL9A 3BXKA 1PK0D 4FQOA 5HLOA 1DJHA 5I2LA 1RWYA 1OE9B 2D8NA 2KBMA 1YVHA 1TCFA 1DJXA 4GGNA 1B47A 1BODA 1D1OA 2EHBA 4E68A 2M0RA 2MRDA 4WQ2A 4PE7A 5G08A 1QTXA 1MXEA 3M0WA 4I5NB 1G4YR 5HKZA 1K93D 4U8DA 1R2UA 1LINA 2JRFA 2M7NA 4IL1A 3AKAA 3SG6A 1QIVA 2KBIA 1CFFA 2M97A 1F55A 1QVIY 1LA3A 4DIRA 5I2QA 4TNCA 3VGOA 1KWOB 3D10A 4PE4A 3SIAA 4DS7A 1CNPA 2KYFA 1H4BA 3BUNB 2AAOA 2CCMA 2LE9B 1PSRA 3NSLA 2BE4A 2K8MB 4PHKA 1ODBA 5FYXA 1IGVA 5D7FA 4WRIA 1KFUL 1WLMA 2K0JA 2BBNA 1CDPA 2BL0B 2NCPA 2M8UA 1BOCA 1W7JB 2H61C 4M2PA 1B7TZ 3EVRA 4P2YB 2E30A 1JSAA 1DGUA 3ZWHA 1QXPA 2K7DA 2KI6D 2LMVA 4YRUA 1JWDA 2LLTA 2JXLA 1KFXL 2RGIA 3LL8B 1CLLA 1ALVA 2LUXA 2MHHA 1CM1A 3PFVA 1XFUO 4YBHB 4A4BA 2LVJA 2KOTA 2M3WA 1K9UA 3PM8A 1S3PA 1MUXA 2TN4A 1TCOB 4CPVA 2OTGC 1S5GZ 1UHNA 2K61A 1BG1A 1R6PA 2KI4B 1G33A 4GGFC 2M1KB 5CSNA 3LK1A 1UURA 2LMUA 1JUOA 1KQMC 2LCPA 3FS7A 1XFXO 1JF0A 3NSOA 1M31A 1UHIA 2K2AA 1SCVA 2PASA 2GV5A 5B8IB 1OMRA 3WNXB 1NWDA 1SR6B 3DVMA 1BR4B 4MZLA 1B4CA 1KSMA 1N65A 2AUCA 2CTNA 1IG5A 4R1EA 1MXLC 1YX8A 1CDMA 1UWOA 1YTZC 2KAYA 1EG4A 5AERA 3GK4X 2MA2A 4YGDB 3KF9A 1MQ1A 2FCDA 1JC2A 4MLWA 1H8BA 2Q4UA 5D69A 3TS5C 1WDCC 1S5GY 1NCXA 2LHLA 1CMGA 1ZACA 2COLB 3F45A 5DKRA 4CFRA 1CFDA 3AKBA 2EC6C 4DCKA 2FOTA 5CPVA 3KEVA 1IQ3A 1DVIA 3I5HB 4BY5A 1DT7B 1CB1A 3CS1A 1KQVA 1OSAA 3C1VA 1TNXA 3EK4A 5DKQA 1M39A 1RTP1 5HYDA 1PULA 1K96A 4CIDA 3I5GB 1C7WA 1TNWA 1SKTA 2H2KA 2OS8B 4QJ4B 3CGAA 1BU3A 1B8LA 1DJIA 1BT6A 4AQJA 2PMYA 3EVVA 4I5LB 1PRWA 2WC8A 2AMIA 1CMFA 5ER4X 2BCAA 1JF2A 3BQ3A 3EKJA 1IRJA 2JZIA 5CSIA 2F3ZA 2ZRSA 4NDCA 2JXCA 3RLZA 2Y1MA 1OZOA 1YUUA 3O6BA 3WXAA 2PALA 1UP5A 1NX2A 4PDZA 1QS7A 1A03A 3CLNA 2HQWA 2OPOA 3MSEB 3CWGA 1FI5A 1FI6A 2KAXA 3KPXA 1RROA 2M7LA 2LP3A 1S36A 1QATA 2KAVA 1PALA 3DF0B 4GUKA 2F3YA 2Y5IA 1YRTB 3BYAA 3O78A 1ZUZA 1S6IA 1SPYA 2JT8A 4M2OA 1SK6D 1S26D 3NSIA 1C07A 1XFWO 1EJ3A 1QASA 1XFZO 3OX5A 1KK8B 3IQQA 3HX4A 1CM4A 3JTDB 1BJFA 3DVKA 2LAPA 1L2OB 1MWNA 3JVTB 1RJVA 1WLZA 5K89A 3DF0A 2I2RE 2JTZA 3KHEA 4GAOA 3I5FC 2LUCA 4YGEB 4AQIA 1K94A 2HPSA 5HKYA 2K2FA 2KQ6A 1IJ6A 3QRXA 1QV1A 1NCZA 1FF1A 2FCEA 2CNPA 4N5XA 1OZSA 4XYNA 5AFPA 1WRZA 2E6WA 3SG3A 1TNQA 3TDUA 1XK4A 2JWWA 4PE1A 1F70A 5KTYA 1B9AA 1DJGA 5AEQA 2LV7A 1OMVA 4JWQA 4ZCUA 1MF8B 1NYAA 2LNKA 3EK7A 1KFUS 1M63B 2OS8C 3CZTX 1MR8A 2ZNDA 2IS9A 2ZN8A 4OV2A 2ZFDA 1TTXA 3HCMA 1J7OA 3SJSA 1NX0A 1TNPA 5J3XA 4OR9B 2B1UA 2F2PA 5TNCA 2BKIB 3LLEA 2KHNA 1IQ5A 1QX7A 3SG7A 2KDHA 3OHMB 2KNEA 1WY9A 2JPTA 1J7QA 1NP8A 1OMDA 1XO5A 1KFXS 1EXRA 1S1EA 1TN4A 1W7IB 4HSZA 4MRXA 1IWQA 1NPQA 2CT9A 5GQQC 1AP4A 3NSKA 1BR1B 1YUTA 1CDLA 1F71A 3TUYB 3I5IB 1KK7Y 2LANA 2M9GA 3OX6A 1A29A 1DMOA 4HREE 3ICBA 3PLFB 2G2BA 1K9PA 3VRPA 3EKHA 1K2HA 1JBAA 1K90D 1ZMZA 4BY4A 3SG5A 1SCMB 2LMTA 2I7AA 2LVIA 5F6TA 5AANA 1KWOC 1XA5A 4ORBB 3PN7B 2F33A 2I18A 2O60A 5BPJA 5CSFA 1K8UA 2M1UA 3OB2B 2Y1NA 5I2OA 1CKKA 2JNFA 2LP2A 3CTNA 4MEWA 2BL0C 1YRUB 5I8NA 4HRHA 2KGRA 2PSRA 3D0YB 1Y1UA 3H4SE 2K7OA 2BE6A 5ER5A 1B8RA 1DTLA 1SBJA 4N1GA 3WHUB 1S6JA 1AJ5A 1V1GA 2KFFA 1U5IB 1CLMA 1LXFC 1XVJA 1E8AA 2FJUB 1XFVO 1YUSA 4DRWA 3D0YA 1PSBA 1M46A 2MLFC 1LKJA 1AHRA 2I94A 2ZNEA 2PVBA 3E3RA 5JOLA 2MBXA 1J7RA 1V1FA 4OCIA 3DVEA 2KGBC 1B8CA 4A4CA 2KI4C 4ICBA 4HRGA 4JPZB 5HLVA 4USLA 1QLSA 4PHMA 3TDZA 1CFPA 2NLNA 3GK1A 2WORA 4MBEA 2JNXA 2DOQA 3BUWB 3PATA 4OVNF 3EVUA 2L5XB 2LM5A 2L50A 4C0LA 1SR6C 1Y1AA 2A4JA 4YI8A 1QX2A 3A8RA 3A4UB 3OB1B 3KO0A 1JFKA 2LVVA 2PRUA 1L7ZA 4MSPA 1Y6WA 1DJYA 5AXIA 2H61A 3BUXB 1QJTA 3DVJA 1CDNA 4N1FA 1UHJA 2L98A 4WQ3A 3SG4A 4P5OE 3O2PA 1DF0B 3IF7A 1ZFSA 4NQGA 5KU1A 3CR5X 1QV0A 1F4QA 1SYMA 1DJWA 2OTGB 1SL8A 1J55A 1NX1A 2F2OA 1GGZA 3FIAA 3IQOA 1XYDA 1FPWA 3GK2A 1S6CA 2WCEA 1QIWA 3SG2A 1SNLA 2M29A 1CLBA 2SASA 1KQMB 1DF0A 1G8IA 2Q91A 1WRKA 3I5HC 2HF5A 1TRFA 4MZKA 2L51A 4ETOA 1BLQA 2QPTA 4L9MA 1UHHA 4ORCB 3WHTB 2O5GA 3VROA 2MAZA 1KK7Z 2LLUA 4GGFA 2GGMA 1F54A 1YX7A 1XFYO 1NSHA 2JULA 2JT3A 3NXAA 3I5GC 1BF5A 1N2DA 2KFGA 1HQVA 1J1DA 1UHKA 4MN0A 4YGAA 2L4HA 4MZJA 2LHIA 1TOPA 4XJKB 3EK8A 2LLSA 2G9BA 3TDIA 3VRNA 1RFJA 3TS5B 3VRQA 1Q80A 1A4PA 1WDCB 1GQMA 3PALA 4QJ5B 1K95A 1Y0VH 5KSZA 3GOFA 2EC6B 4CFQA 1IKUA 3O4YA 1YVLA 2KI6C 4C0JA 3TZ1A 1Y1XA 1ALWA 4PE0A 1RK9A 1ZOTB 2BCBA 1LA0A 1OOJA 1EL4A 1VRKA 2LC5A 4XJKA 4CLNA 1K9KA 3BOWB 4DUQA 5IBWA 5JJGA 1GJYA 1MHOA 2L4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YUR A;  2K7B A;  1IH0 A;  1F4O A;  2ZN9 A;  2BBM A;  2JU0 A;  2V53 A;  1AUI B;  5HKW A;  2P6B B;  4MVF A;  3PSR A;  1A2X A;  3FWC A;  1AJ4 A;  3BOW A;  1KK8 C;  2HQ8 A;  1SMG A;  3JTD C;  4FTG A;  1A75 B;  1QLK A;  2Y4Q A;  1L2O C;  3JVT C;  1XK4 C;  2SCP A;  5PAL A;  3VRR A;  1B1G A;  3AAK A;  1KSO A;  2KFH A;  1NUB A;  1FBV A;  1QX5 B;  4YGC B;  1B7T Y;  2VRG A;  4QJ3 B;  2LVK A;  1AVS A;  3BUM B;  3LK0 A;  1OQP A;  1WRL A;  2R2I A;  1FW4 A;  3FWB A;  1UUS A;  4PHJ A;  4MRY A;  1A75 A;  1BMO A;  1HT9 A;  1SRA A;  1SY9 A;  2CBL A;  2NXQ A;  2WCF A;  4D1E A;  1NCY A;  1X02 A;  1J1E A;  2WOS A;  3DD4 A;  4PHN A;  1PVB A;  3SIB A;  4ZCV A;  2MJW B;  1C7V A;  1GGW A;  2BEC A;  2JOJ A;  4NDD A;  1PVA A;  4YI9 A;  1JFJ A;  4M2Q A;  1CFC A;  3LCP C;  1CTR A;  2KYC A;  2L2E A;  4GNK B;  4GFT A;  1NX3 A;  4NDB A;  5CSJ A;  3RM1 A;  2GGZ A;  1SL7 A;  1SW8 A;  4C0K A;  4UPG A;  2L0P A;  1J7P A;  3ZNI A;  4AOM A;  3K21 A;  1U5I A;  2HET A;  3I5F B;  2BKH B;  4JQ0 D;  4I5J A;  1N0Y A;  1YR5 A;  2CXJ A;  2NZ0 A;  2WCB A;  3CR2 A;  2KSP A;  1KCY A;  4F0Z B;  1TIZ A;  2EGD A;  1NIW A;  1LVC D;  4GBA A;  3BUO B;  1AK8 A;  2K7C A;  3TUY C;  2MLE C;  3CR4 X;  3I5I C;  2JT0 A;  2JC2 A;  1F8H A;  1DGV A;  2KQY A;  2ISD A;  4OKH A;  1EG3 A;  4PAL A;  4Q04 A;  2WND A;  2ZKM X;  2JQ6 A;  2JTT A;  2ZRT A;  1QVI Z;  4GPL B;  4ORA B;  2BCX A;  4PCW A;  1DJZ A;  1SCM C;  1REC A;  1M45 A;  5DKN A;  4YGB B;  2M49 B;  3PN7 C;  2QAC A;  1IJ5 A;  2F8P A;  1EH2 A;  4I5K A;  2NCO A;  3OP0 A;  3AAJ A;  1SL9 A;  3BXK A;  1PK0 D;  4FQO A;  5HLO A;  1DJH A;  5I2L A;  1RWY A;  1OE9 B;  2D8N A;  2KBM A;  1YVH A;  1TCF A;  1DJX A;  4GGN A;  1B47 A;  1BOD A;  1D1O A;  2EHB A;  4E68 A;  2M0R A;  2MRD A;  4WQ2 A;  4PE7 A;  5G08 A;  1QTX A;  1MXE A;  3M0W A;  4I5N B;  1G4Y R;  5HKZ A;  1K93 D;  4U8D A;  1R2U A;  1LIN A;  2JRF A;  2M7N A;  4IL1 A;  3AKA A;  3SG6 A;  1QIV A;  2KBI A;  1CFF A;  2M97 A;  1F55 A;  1QVI Y;  1LA3 A;  4DIR A;  5I2Q A;  4TNC A;  3VGO A;  1KWO B;  3D10 A;  4PE4 A;  3SIA A;  4DS7 A;  1CNP A;  2KYF A;  1H4B A;  3BUN B;  2AAO A;  2CCM A;  2LE9 B;  1PSR A;  3NSL A;  2BE4 A;  2K8M B;  4PHK A;  1ODB A;  5FYX A;  1IGV A;  5D7F A;  4WRI A;  1KFU L;  1WLM A;  2K0J A;  2BBN A;  1CDP A;  2BL0 B;  2NCP A;  2M8U A;  1BOC A;  1W7J B;  2H61 C;  4M2P A;  1B7T Z;  3EVR A;  4P2Y B;  2E30 A;  1JSA A;  1DGU A;  3ZWH A;  1QXP A;  2K7D A;  2KI6 D;  2LMV A;  4YRU A;  1JWD A;  2LLT A;  2JXL A;  1KFX L;  2RGI A;  3LL8 B;  1CLL A;  1ALV A;  2LUX A;  2MHH A;  1CM1 A;  3PFV A;  1XFU O;  4YBH B;  4A4B A;  2LVJ A;  2KOT A;  2M3W A;  1K9U A;  3PM8 A;  1S3P A;  1MUX A;  2TN4 A;  1TCO B;  4CPV A;  2OTG C;  1S5G Z;  1UHN A;  2K61 A;  1BG1 A;  1R6P A;  2KI4 B;  1G33 A;  4GGF C;  2M1K B;  5CSN A;  3LK1 A;  1UUR A;  2LMU A;  1JUO A;  1KQM C;  2LCP A;  3FS7 A;  1XFX O;  1JF0 A;  3NSO A;  1M31 A;  1UHI A;  2K2A A;  1SCV A;  2PAS A;  2GV5 A;  5B8I B;  1OMR A;  3WNX B;  1NWD A;  1SR6 B;  3DVM A;  1BR4 B;  4MZL A;  1B4C A;  1KSM A;  1N65 A;  2AUC A;  2CTN A;  1IG5 A;  4R1E A;  1MXL C;  1YX8 A;  1CDM A;  1UWO A;  1YTZ C;  2KAY A;  1EG4 A;  5AER A;  3GK4 X;  2MA2 A;  4YGD B;  3KF9 A;  1MQ1 A;  2FCD A;  1JC2 A;  4MLW A;  1H8B A;  2Q4U A;  5D69 A;  3TS5 C;  1WDC C;  1S5G Y;  1NCX A;  2LHL A;  1CMG A;  1ZAC A;  2COL B;  3F45 A;  5DKR A;  4CFR A;  1CFD A;  3AKB A;  2EC6 C;  4DCK A;  2FOT A;  5CPV A;  3KEV A;  1IQ3 A;  1DVI A;  3I5H B;  4BY5 A;  1DT7 B;  1CB1 A;  3CS1 A;  1KQV A;  1OSA A;  3C1V A;  1TNX A;  3EK4 A;  5DKQ A;  1M39 A;  1RTP 1;  5HYD A;  1PUL A;  1K96 A;  4CID A;  3I5G B;  1C7W A;  1TNW A;  1SKT A;  2H2K A;  2OS8 B;  4QJ4 B;  3CGA A;  1BU3 A;  1B8L A;  1DJI A;  1BT6 A;  4AQJ A;  2PMY A;  3EVV A;  4I5L B;  1PRW A;  2WC8 A;  2AMI A;  1CMF A;  5ER4 X;  2BCA A;  1JF2 A;  3BQ3 A;  3EKJ A;  1IRJ A;  2JZI A;  5CSI A;  2F3Z A;  2ZRS A;  4NDC A;  2JXC A;  3RLZ A;  2Y1M A;  1OZO A;  1YUU A;  3O6B A;  3WXA A;  2PAL A;  1UP5 A;  1NX2 A;  4PDZ A;  1QS7 A;  1A03 A;  3CLN A;  2HQW A;  2OPO A;  3MSE B;  3CWG A;  1FI5 A;  1FI6 A;  2KAX A;  3KPX A;  1RRO A;  2M7L A;  2LP3 A;  1S36 A;  1QAT A;  2KAV A;  1PAL A;  3DF0 B;  4GUK A;  2F3Y A;  2Y5I A;  1YRT B;  3BYA A;  3O78 A;  1ZUZ A;  1S6I A;  1SPY A;  2JT8 A;  4M2O A;  1SK6 D;  1S26 D;  3NSI A;  1C07 A;  1XFW O;  1EJ3 A;  1QAS A;  1XFZ O;  3OX5 A;  1KK8 B;  3IQQ A;  3HX4 A;  1CM4 A;  3JTD B;  1BJF A;  3DVK A;  2LAP A;  1L2O B;  1MWN A;  3JVT B;  1RJV A;  1WLZ A;  5K89 A;  3DF0 A;  2I2R E;  2JTZ A;  3KHE A;  4GAO A;  3I5F C;  2LUC A;  4YGE B;  4AQI A;  1K94 A;  2HPS A;  5HKY A;  2K2F A;  2KQ6 A;  1IJ6 A;  3QRX A;  1QV1 A;  1NCZ A;  1FF1 A;  2FCE A;  2CNP A;  4N5X A;  1OZS A;  4XYN A;  5AFP A;  1WRZ A;  2E6W A;  3SG3 A;  1TNQ A;  3TDU A;  1XK4 A;  2JWW A;  4PE1 A;  1F70 A;  5KTY A;  1B9A A;  1DJG A;  5AEQ A;  2LV7 A;  1OMV A;  4JWQ A;  4ZCU A;  1MF8 B;  1NYA A;  2LNK A;  3EK7 A;  1KFU S;  1M63 B;  2OS8 C;  3CZT X;  1MR8 A;  2ZND A;  2IS9 A;  2ZN8 A;  4OV2 A;  2ZFD A;  1TTX A;  3HCM A;  1J7O A;  3SJS A;  1NX0 A;  1TNP A;  5J3X A;  4OR9 B;  2B1U A;  2F2P A;  5TNC A;  2BKI B;  3LLE A;  2KHN A;  1IQ5 A;  1QX7 A;  3SG7 A;  2KDH A;  3OHM B;  2KNE A;  1WY9 A;  2JPT A;  1J7Q A;  1NP8 A;  1OMD A;  1XO5 A;  1KFX S;  1EXR A;  1S1E A;  1TN4 A;  1W7I B;  4HSZ A;  4MRX A;  1IWQ A;  1NPQ A;  2CT9 A;  5GQQ C;  1AP4 A;  3NSK A;  1BR1 B;  1YUT A;  1CDL A;  1F71 A;  3TUY B;  3I5I B;  1KK7 Y;  2LAN A;  2M9G A;  3OX6 A;  1A29 A;  1DMO A;  4HRE E;  3ICB A;  3PLF B;  2G2B A;  1K9P A;  3VRP A;  3EKH A;  1K2H A;  1JBA A;  1K90 D;  1ZMZ A;  4BY4 A;  3SG5 A;  1SCM B;  2LMT A;  2I7A A;  2LVI A;  5F6T A;  5AAN A;  1KWO C;  1XA5 A;  4ORB B;  3PN7 B;  2F33 A;  2I18 A;  2O60 A;  5BPJ A;  5CSF A;  1K8U A;  2M1U A;  3OB2 B;  2Y1N A;  5I2O A;  1CKK A;  2JNF A;  2LP2 A;  3CTN A;  4MEW A;  2BL0 C;  1YRU B;  5I8N A;  4HRH A;  2KGR A;  2PSR A;  3D0Y B;  1Y1U A;  3H4S E;  2K7O A;  2BE6 A;  5ER5 A;  1B8R A;  1DTL A;  1SBJ A;  4N1G A;  3WHU B;  1S6J A;  1AJ5 A;  1V1G A;  2KFF A;  1U5I B;  1CLM A;  1LXF C;  1XVJ A;  1E8A A;  2FJU B;  1XFV O;  1YUS A;  4DRW A;  3D0Y A;  1PSB A;  1M46 A;  2MLF C;  1LKJ A;  1AHR A;  2I94 A;  2ZNE A;  2PVB A;  3E3R A;  5JOL A;  2MBX A;  1J7R A;  1V1F A;  4OCI A;  3DVE A;  2KGB C;  1B8C A;  4A4C A;  2KI4 C;  4ICB A;  4HRG A;  4JPZ B;  5HLV A;  4USL A;  1QLS A;  4PHM A;  3TDZ A;  1CFP A;  2NLN A;  3GK1 A;  2WOR A;  4MBE A;  2JNX A;  2DOQ A;  3BUW B;  3PAT A;  4OVN F;  3EVU A;  2L5X B;  2LM5 A;  2L50 A;  4C0L A;  1SR6 C;  1Y1A A;  2A4J A;  4YI8 A;  1QX2 A;  3A8R A;  3A4U B;  3OB1 B;  3KO0 A;  1JFK A;  2LVV A;  2PRU A;  1L7Z A;  4MSP A;  1Y6W A;  1DJY A;  5AXI A;  2H61 A;  3BUX B;  1QJT A;  3DVJ A;  1CDN A;  4N1F A;  1UHJ A;  2L98 A;  4WQ3 A;  3SG4 A;  4P5O E;  3O2P A;  1DF0 B;  3IF7 A;  1ZFS A;  4NQG A;  5KU1 A;  3CR5 X;  1QV0 A;  1F4Q A;  1SYM A;  1DJW A;  2OTG B;  1SL8 A;  1J55 A;  1NX1 A;  2F2O A;  1GGZ A;  3FIA A;  3IQO A;  1XYD A;  1FPW A;  3GK2 A;  1S6C A;  2WCE A;  1QIW A;  3SG2 A;  1SNL A;  2M29 A;  1CLB A;  2SAS A;  1KQM B;  1DF0 A;  1G8I A;  2Q91 A;  1WRK A;  3I5H C;  2HF5 A;  1TRF A;  4MZK A;  2L51 A;  4ETO A;  1BLQ A;  2QPT A;  4L9M A;  1UHH A;  4ORC B;  3WHT B;  2O5G A;  3VRO A;  2MAZ A;  1KK7 Z;  2LLU A;  4GGF A;  2GGM A;  1F54 A;  1YX7 A;  1XFY O;  1NSH A;  2JUL A;  2JT3 A;  3NXA A;  3I5G C;  1BF5 A;  1N2D A;  2KFG A;  1HQV A;  1J1D A;  1UHK A;  4MN0 A;  4YGA A;  2L4H A;  4MZJ A;  2LHI A;  1TOP A;  4XJK B;  3EK8 A;  2LLS A;  2G9B A;  3TDI A;  3VRN A;  1RFJ A;  3TS5 B;  3VRQ A;  1Q80 A;  1A4P A;  1WDC B;  1GQM A;  3PAL A;  4QJ5 B;  1K95 A;  1Y0V H;  5KSZ A;  3GOF A;  2EC6 B;  4CFQ A;  1IKU A;  3O4Y A;  1YVL A;  2KI6 C;  4C0J A;  3TZ1 A;  1Y1X A;  1ALW A;  4PE0 A;  1RK9 A;  1ZOT B;  2BCB A;  1LA0 A;  1OOJ A;  1EL4 A;  1VRK A;  2LC5 A;  4XJK A;  4CLN A;  1K9K A;  3BOW B;  4DUQ A;  5IBW A;  5JJG A;  1GJY A;  1MHO A;  2L4I A; 
#chains in the Genus database with same CATH topology
 1YUR A;  2K7B A;  4JD9 A;  1IH0 A;  1F4O A;  3R1V A;  2ZN9 A;  2BBM A;  2JU0 A;  2V53 A;  3DXL A;  1AUI B;  5HKW A;  2P6B B;  4MVF A;  3PSR A;  1A2X A;  3FWC A;  1AJ4 A;  3BOW A;  1KK8 C;  4FQT A;  2HQ8 A;  1SMG A;  3JTD C;  4FTG A;  1A75 B;  1QLK A;  2Y4Q A;  1L2O C;  2FJY A;  3JVT C;  1XK4 C;  2SCP A;  5PAL A;  3VRR A;  1B1G A;  3AAK A;  1KSO A;  2KFH A;  1NUB A;  1C3Y A;  1FBV A;  1QX5 B;  2K60 A;  4YGC B;  1B7T Y;  2VRG A;  4QJ3 B;  2LVK A;  1AVS A;  3BUM B;  3LK0 A;  1OQP A;  1WRL A;  2R2I A;  1FW4 A;  3FWB A;  1UUS A;  4PHJ A;  4MRY A;  1A75 A;  1BMO A;  1HT9 A;  1SRA A;  1SY9 A;  2CBL A;  2NXQ A;  2WCF A;  4D1E A;  1NCY A;  1X02 A;  1J1E A;  2WCH A;  2WOS A;  3DD4 A;  4PHN A;  1PVB A;  3SIB A;  4ZCV A;  1TWO A;  2MJW B;  1C7V A;  1GGW A;  2BEC A;  2JOJ A;  3BFB A;  4NDD A;  1PVA A;  3B87 A;  4YI9 A;  1JFJ A;  3NHT A;  4M2Q A;  3SS4 A;  1CFC A;  3LCP C;  2YGU A;  1CTR A;  2KYC A;  1SSE B;  2L2E A;  4GNK B;  4GFT A;  3NHI A;  1NX3 A;  4NDB A;  5CSJ A;  3RM1 A;  3O4X A;  2GGZ A;  3DY9 A;  1SL7 A;  1SW8 A;  4C0K A;  4UPG A;  2L0P A;  1J7P A;  3DYE A;  3ZNI A;  4AOM A;  3K21 A;  1U5I A;  2HET A;  3I5F B;  2BKH B;  4JQ0 D;  4I5J A;  1YR5 A;  1N0Y A;  2CXJ A;  2NZ0 A;  2WCB A;  3CR2 A;  2KSP A;  1KCY A;  4F0Z B;  1TIZ A;  2EGD A;  1NIW A;  1LVC D;  4GBA A;  3BUO B;  1AK8 A;  2K7C A;  2QEO A;  2MLE C;  3CR4 X;  3I5I C;  3TUY C;  2JT0 A;  2JC2 A;  2L5Y A;  1F8H A;  5FI7 A;  1DGV A;  2KQY A;  2ISD A;  4OKH A;  1EG3 A;  4PAL A;  4Q04 A;  2WND A;  2ZKM X;  2JQ6 A;  2JTT A;  2ZRT A;  1QVI Z;  4GPL B;  5HL1 A;  4KYN A;  3S0D A;  3SS5 A;  4ORA B;  2BCX A;  4PCW A;  1DJZ A;  1SCM C;  1REC A;  2H8V A;  1M45 A;  2KLD A;  5DKN A;  4YGB B;  2M49 B;  3PN7 C;  2QAC A;  1IJ5 A;  2F8P A;  1TUJ A;  1EH2 A;  4I5K A;  2NCO A;  3OP0 A;  3AAJ A;  1SL9 A;  3BXK A;  1PK0 D;  4FQO A;  1ORG A;  5HLO A;  1DJH A;  5I2L A;  1RWY A;  1OE9 B;  2D8N A;  2KBM A;  1YVH A;  1TCF A;  1DJX A;  4GGN A;  1B47 A;  1BOD A;  2WCJ A;  1D1O A;  2L2C A;  2EHB A;  4E68 A;  2M0R A;  2MRD A;  4WQ2 A;  4PE7 A;  5G08 A;  1QTX A;  1MXE A;  3M0W A;  4I5N B;  1G4Y R;  5HKZ A;  1K93 D;  2PYQ A;  3Q8I A;  1R2U A;  4U8D A;  1LIN A;  2JRF A;  2M7N A;  4IL1 A;  3AKA A;  3SG6 A;  1QIV A;  2KBI A;  1CFF A;  2M97 A;  1F55 A;  1QVI Y;  1LA3 A;  3B6X A;  4DIR A;  5I2Q A;  4TNC A;  3VGO A;  3D74 A;  1KWO B;  3D10 A;  4PE4 A;  3SIA A;  4DS7 A;  1CNP A;  2KYF A;  1H4B A;  3BUN B;  2AAO A;  2CCM A;  2LE9 B;  3D75 A;  1PSR A;  2JPO A;  2BE4 A;  2K8M B;  3NSL A;  1ODB A;  4PHK A;  5FYX A;  1IGV A;  3L47 A;  5D7F A;  4OZD A;  4WRI A;  1KFU L;  1WLM A;  2K0J A;  5FI2 A;  2BBN A;  2QEV A;  1CDP A;  2BL0 B;  2NCP A;  2M8U A;  1BOC A;  1W7J B;  2H61 C;  4M2P A;  1B7T Z;  3B88 A;  3EVR A;  4P2Y B;  2E30 A;  2KPH A;  1JSA A;  1DGU A;  2WCK A;  3DZT A;  3ZWH A;  1QXP A;  2K7D A;  2KI6 D;  2LMV A;  4YRU A;  1JWD A;  2LLT A;  2JXL A;  1KFX L;  2RGI A;  3L4L A;  1CLL A;  1ALV A;  2LUX A;  3LL8 B;  2MHH A;  1CM1 A;  3PFV A;  1XFU O;  4YBH B;  4A4B A;  2LVJ A;  2KOT A;  2M3W A;  1K9U A;  3PM8 A;  1S3P A;  1OOI X;  1MUX A;  2TN4 A;  1TCO B;  4CPV A;  2OTG C;  1S5G Z;  1UHN A;  2K61 A;  1BG1 A;  1R6P A;  2KI4 B;  3S0A A;  1G33 A;  4GGF C;  2M1K B;  5CSN A;  3LK1 A;  1UUR A;  2LMU A;  1OOH A;  1JUO A;  1KQM C;  2LCP A;  3FS7 A;  1XFX O;  3FE6 A;  1JF0 A;  3NSO A;  5I94 A;  1M31 A;  1UHI A;  2K2A A;  1SCV A;  2PAS A;  3D73 A;  2GV5 A;  3BFH A;  5B8I B;  1OMR A;  3WNX B;  1NWD A;  1SR6 B;  3DVM A;  1BR4 B;  1QWV A;  4MZL A;  1B4C A;  1KSM A;  1N65 A;  2AUC A;  2CTN A;  1IG5 A;  4R1E A;  1MXL C;  1YX8 A;  1CDM A;  1UWO A;  1YTZ C;  2KAY A;  1EG4 A;  5AER A;  3GK4 X;  2MA2 A;  4YGD B;  3KF9 A;  1MQ1 A;  2BAP A;  2FCD A;  2WCM A;  1JC2 A;  4MLW A;  3CYZ A;  1H8B A;  3BFA A;  2Q4U A;  5D69 A;  3TS5 C;  1WDC C;  1S5G Y;  1NCX A;  3B86 A;  2LHL A;  1CMG A;  1ZAC A;  2COL B;  3F45 A;  5DKR A;  4CFR A;  1CFD A;  3AKB A;  2EC6 C;  2QEH A;  4DCK A;  2FOT A;  5CPV A;  3KEV A;  1IQ3 A;  1DVI A;  3I5H B;  3D78 A;  3OGN A;  4BY5 A;  1DT7 B;  4IJ7 A;  2WCL A;  3CS1 A;  1CB1 A;  1KQV A;  3D76 A;  1OSA A;  3C1V A;  3S0G A;  1TNX A;  3EK4 A;  5DKQ A;  1M39 A;  1RTP 1;  5HYD A;  1PUL A;  1K96 A;  4CID A;  3I5G B;  1C7W A;  1TNW A;  3R1P A;  1SKT A;  2H2K A;  2OS8 B;  4QJ4 B;  3CGA A;  1BU3 A;  1B8L A;  1DJI A;  1BT6 A;  4AQJ A;  2PMY A;  3EVV A;  3N7H A;  4I5L B;  1PRW A;  1Z4H A;  2WC8 A;  2AMI A;  1CMF A;  5ER4 X;  2BCA A;  1JF2 A;  3BQ3 A;  3EKJ A;  1IRJ A;  2JZI A;  3CAB A;  2F3Z A;  2ZRS A;  5CSI A;  4NDC A;  2JXC A;  3RLZ A;  1T14 A;  2Y1M A;  1OZO A;  1YUU A;  3O6B A;  3WXA A;  2PAL A;  1UP5 A;  1NX2 A;  4PDZ A;  1QS7 A;  3FE9 A;  1A03 A;  3S0E A;  3CLN A;  2HQW A;  2OPO A;  3MSE B;  3CWG A;  1FI5 A;  1FI6 A;  2KAX A;  3KPX A;  1RRO A;  2M7L A;  2LP3 A;  3K1E A;  1S36 A;  1QAT A;  2KAV A;  1PAL A;  3DF0 B;  4GUK A;  5DIC A;  2F3Y A;  2Y5I A;  1XFR A;  3OBV A;  1YRT B;  3BYA A;  3O78 A;  1ZUZ A;  1S6I A;  1SPY A;  2JT8 A;  4M2O A;  1SK6 D;  1S26 D;  3NSI A;  1C07 A;  1XFW O;  1EJ3 A;  1QAS A;  1XFZ O;  3OX5 A;  1KK8 B;  3IQQ A;  3HX4 A;  1CM4 A;  3JTD B;  1BJF A;  2BNX A;  3CZ1 A;  3DVK A;  2LAP A;  1L2O B;  1MWN A;  3JVT B;  1RJV A;  1WLZ A;  5K89 A;  3DF0 A;  2I2R E;  2JTZ A;  3KHE A;  4GAO A;  3I5F C;  2LUC A;  4YGE B;  4AQI A;  1K94 A;  1C3Z A;  2HPS A;  5HKY A;  2K2F A;  2KQ6 A;  1IJ6 A;  3QRX A;  1QV1 A;  1NCZ A;  1FF1 A;  2FCE A;  3EG5 B;  2CNP A;  4N5X A;  1DEK A;  1OZS A;  4XYN A;  5AFP A;  1WRZ A;  2E6W A;  3SG3 A;  1TNQ A;  3TDU A;  1XK4 A;  2JWW A;  4PE1 A;  1F70 A;  5KTY A;  1B9A A;  1DJG A;  5AEQ A;  2LV7 A;  1OMV A;  4JWQ A;  4ZCU A;  1MF8 B;  1NYA A;  5EL2 A;  2LNK A;  3EK7 A;  1KFU S;  1M63 B;  2OS8 C;  3CZT X;  3S0B A;  1MR8 A;  2ZND A;  3VB1 A;  3L4A A;  2IS9 A;  2ZN8 A;  3CZ0 A;  3S0F A;  4OV2 A;  2ZFD A;  1IIO A;  1TTX A;  3HCM A;  1J7O A;  3SJS A;  1NX0 A;  1TNP A;  3R1O A;  5J3X A;  4OR9 B;  2B1U A;  2F2P A;  5TNC A;  2BKI B;  1P28 A;  3LLE A;  2KHN A;  1IQ5 A;  1QX7 A;  3SG7 A;  2KLE A;  2KDH A;  3OHM B;  2KNE A;  1WY9 A;  2JPT A;  1J7Q A;  1NP8 A;  1OMD A;  1XO5 A;  1KFX S;  1EXR A;  1S1E A;  1TN4 A;  1W7I B;  4HSZ A;  4MRX A;  1IWQ A;  1NPQ A;  2CT9 A;  5GQQ C;  3SS3 A;  1AP4 A;  3NSK A;  1BR1 B;  3IVT A;  1YUT A;  1CDL A;  1F71 A;  3TUY B;  3I5I B;  1KK7 Y;  2LAN A;  2M9G A;  3OX6 A;  1A29 A;  1DMO A;  4HRE E;  3ICB A;  3PLF B;  2G2B A;  1K9P A;  3VRP A;  3EKH A;  1K2H A;  1JBA A;  1K90 D;  1ZMZ A;  4BY4 A;  3SG5 A;  1SCM B;  2LMT A;  2I7A A;  2LVI A;  5F6T A;  5AAN A;  1KWO C;  1XA5 A;  3D77 A;  4ORB B;  3PN7 B;  2F33 A;  1DC1 A;  2I18 A;  2O60 A;  5BPJ A;  5CSF A;  1K8U A;  2M1U A;  3OB2 B;  2Y1N A;  5I2O A;  1CKK A;  2JNF A;  2LP2 A;  3CTN A;  4MEW A;  2BL0 C;  1YRU B;  5I8N A;  4HRH A;  2GTE A;  2KGR A;  1OW4 A;  2PSR A;  3D0Y B;  1Y1U A;  3BJH A;  3H4S E;  2K7O A;  2BE6 A;  5ER5 A;  3V2L A;  1B8R A;  1DTL A;  1SBJ A;  4N1G A;  3WHU B;  1S6J A;  1AJ5 A;  1V1G A;  2KFF A;  1U5I B;  1CLM A;  1LXF C;  1XVJ A;  1E8A A;  2FJU B;  1XFV O;  1YUS A;  4DRW A;  3D0Y A;  1PSB A;  4INW A;  1M46 A;  2MLF C;  1LKJ A;  1AHR A;  3UO9 A;  2I94 A;  2ZNE A;  2PVB A;  3E3R A;  5JOL A;  2MBX A;  1J7R A;  3UNW A;  1V1F A;  2P71 A;  4OCI A;  3DVE A;  2KGB C;  1B8C A;  4A4C A;  1TUZ A;  2KI4 C;  1OOG A;  4ICB A;  4HRG A;  4JPZ B;  5HLV A;  4USL A;  1QLS A;  4PHM A;  3TDZ A;  1CFP A;  2NLN A;  3GK1 A;  2WOR A;  4MBE A;  2JNX A;  2DOQ A;  3BUW B;  3PAT A;  4OVN F;  3EVU A;  2PQL A;  2L5X B;  2LM5 A;  2L50 A;  3R72 A;  4C0L A;  1SR6 C;  1Y1A A;  2A4J A;  3CDN A;  4YI8 A;  1QX2 A;  3A8R A;  3A4U B;  3OB1 B;  5D3O A;  3KO0 A;  1JFK A;  2LVV A;  2PRU A;  1L7Z A;  4MSP A;  4F7F A;  1Y6W A;  1DJY A;  2ERB A;  5AXI A;  2H61 A;  3BUX B;  1QJT A;  3RZS A;  3DVJ A;  3PM2 A;  1CDN A;  4N1F A;  1UHJ A;  3QME A;  2L98 A;  2WC6 A;  2QEB A;  4WQ3 A;  3SG4 A;  4P5O E;  3O2P A;  1DF0 B;  3IF7 A;  1ZFS A;  4NQG A;  5KU1 A;  3CR5 X;  1QV0 A;  1F4Q A;  1SYM A;  1DJW A;  3NGV A;  1DQE A;  1OOF A;  2OTG B;  1SL8 A;  1J55 A;  1NX1 A;  1GM0 A;  2F2O A;  1GGZ A;  3FIA A;  3IQO A;  1XYD A;  1FPW A;  2QDI A;  3GK2 A;  1S6C A;  2WCE A;  1QIW A;  3SG2 A;  1SNL A;  2M29 A;  1CLB A;  4INX A;  2SAS A;  1KQM B;  1DF0 A;  1G8I A;  2Q91 A;  1WRK A;  3I5H C;  2HF5 A;  1TRF A;  4MZK A;  2L51 A;  4ETO A;  1BLQ A;  4JKT A;  2QPT A;  4L9M A;  1UHH A;  4ORC B;  3WHT B;  2O5G A;  3VRO A;  2MAZ A;  3FE8 A;  1KK7 Z;  1LS8 A;  2LLU A;  4GGF A;  2GGM A;  1F54 A;  1YX7 A;  1W9Z A;  1XFY O;  1NSH A;  2JUL A;  2JT3 A;  3NXA A;  3I5G C;  1BF5 A;  1N2D A;  2KFG A;  1DEL A;  1HQV A;  3PJI A;  1Z2C B;  3CZ2 A;  1J1D A;  1UHK A;  4MN0 A;  4YGA A;  2L4H A;  4MZJ A;  2LHI A;  1TOP A;  4XJK B;  3EK8 A;  2LLS A;  2G9B A;  3TDI A;  3VRN A;  1RFJ A;  3TS5 B;  3VRQ A;  1Q80 A;  1A4P A;  1WDC B;  3B7A A;  1GQM A;  3PAL A;  4QJ5 B;  1K95 A;  1Y0V H;  5KSZ A;  3GOF A;  2EC6 B;  4CFQ A;  1IKU A;  3O4Y A;  1YVL A;  2KI6 C;  2P70 A;  3TZ1 A;  1Y1X A;  4C0J A;  1ALW A;  4PE0 A;  1RK9 A;  1ZOT B;  1LA0 A;  1OOJ A;  1VRK A;  1EL4 A;  2BCB A;  2LC5 A;  4PT1 A;  4XJK A;  1K9K A;  3BOW B;  5FI6 A;  4CLN A;  4DUQ A;  5IBW A;  5JJG A;  1GJY A;  1MHO A;  2L4I A;  2WC5 A; 
#chains in the Genus database with same CATH homology
 1YUR A;  2K7B A;  1IH0 A;  1F4O A;  2ZN9 A;  2BBM A;  2JU0 A;  2V53 A;  1AUI B;  5HKW A;  2P6B B;  4MVF A;  3PSR A;  1A2X A;  3FWC A;  1AJ4 A;  3BOW A;  1KK8 C;  2HQ8 A;  1SMG A;  3JTD C;  4FTG A;  1A75 B;  1QLK A;  2Y4Q A;  1L2O C;  3JVT C;  1XK4 C;  2SCP A;  5PAL A;  3VRR A;  1B1G A;  3AAK A;  1KSO A;  2KFH A;  1NUB A;  1FBV A;  1QX5 B;  4YGC B;  1B7T Y;  2VRG A;  4QJ3 B;  2LVK A;  1AVS A;  3BUM B;  3LK0 A;  1OQP A;  1WRL A;  2R2I A;  1FW4 A;  3FWB A;  1UUS A;  4PHJ A;  4MRY A;  1A75 A;  1BMO A;  1HT9 A;  1SRA A;  1SY9 A;  2CBL A;  2NXQ A;  2WCF A;  4D1E A;  1NCY A;  1X02 A;  1J1E A;  2WOS A;  3DD4 A;  4PHN A;  1PVB A;  3SIB A;  4ZCV A;  2MJW B;  1C7V A;  1GGW A;  2BEC A;  2JOJ A;  4NDD A;  1PVA A;  4YI9 A;  1JFJ A;  4M2Q A;  1CFC A;  3LCP C;  1CTR A;  2KYC A;  2L2E A;  4GNK B;  4GFT A;  1NX3 A;  4NDB A;  5CSJ A;  3RM1 A;  2GGZ A;  1SL7 A;  1SW8 A;  4C0K A;  4UPG A;  2L0P A;  1J7P A;  3ZNI A;  4AOM A;  3K21 A;  1U5I A;  2HET A;  3I5F B;  2BKH B;  4JQ0 D;  4I5J A;  1N0Y A;  1YR5 A;  2CXJ A;  2NZ0 A;  2WCB A;  3CR2 A;  2KSP A;  1KCY A;  4F0Z B;  1TIZ A;  2EGD A;  1NIW A;  1LVC D;  4GBA A;  3BUO B;  1AK8 A;  2K7C A;  3TUY C;  2MLE C;  3CR4 X;  3I5I C;  2JT0 A;  2JC2 A;  1F8H A;  1DGV A;  2KQY A;  2ISD A;  4OKH A;  1EG3 A;  4PAL A;  4Q04 A;  2WND A;  2ZKM X;  2JQ6 A;  2JTT A;  2ZRT A;  1QVI Z;  4GPL B;  4ORA B;  2BCX A;  4PCW A;  1DJZ A;  1SCM C;  1REC A;  1M45 A;  5DKN A;  4YGB B;  2M49 B;  3PN7 C;  2QAC A;  1IJ5 A;  2F8P A;  1EH2 A;  4I5K A;  2NCO A;  3OP0 A;  3AAJ A;  1SL9 A;  3BXK A;  1PK0 D;  4FQO A;  5HLO A;  1DJH A;  5I2L A;  1RWY A;  1OE9 B;  2D8N A;  2KBM A;  1YVH A;  1TCF A;  1DJX A;  4GGN A;  1B47 A;  1BOD A;  1D1O A;  2EHB A;  4E68 A;  2M0R A;  2MRD A;  4WQ2 A;  4PE7 A;  5G08 A;  1QTX A;  1MXE A;  3M0W A;  4I5N B;  1G4Y R;  5HKZ A;  1K93 D;  4U8D A;  1R2U A;  1LIN A;  2JRF A;  2M7N A;  4IL1 A;  3AKA A;  3SG6 A;  1QIV A;  2KBI A;  1CFF A;  2M97 A;  1F55 A;  1QVI Y;  1LA3 A;  4DIR A;  5I2Q A;  4TNC A;  3VGO A;  1KWO B;  3D10 A;  4PE4 A;  3SIA A;  4DS7 A;  1CNP A;  2KYF A;  1H4B A;  3BUN B;  2AAO A;  2CCM A;  2LE9 B;  1PSR A;  3NSL A;  2BE4 A;  2K8M B;  4PHK A;  1ODB A;  5FYX A;  1IGV A;  5D7F A;  4WRI A;  1KFU L;  1WLM A;  2K0J A;  2BBN A;  1CDP A;  2BL0 B;  2NCP A;  2M8U A;  1BOC A;  1W7J B;  2H61 C;  4M2P A;  1B7T Z;  3EVR A;  4P2Y B;  2E30 A;  1JSA A;  1DGU A;  3ZWH A;  1QXP A;  2K7D A;  2KI6 D;  2LMV A;  4YRU A;  1JWD A;  2LLT A;  2JXL A;  1KFX L;  2RGI A;  3LL8 B;  1CLL A;  1ALV A;  2LUX A;  2MHH A;  1CM1 A;  3PFV A;  1XFU O;  4YBH B;  4A4B A;  2LVJ A;  2KOT A;  2M3W A;  1K9U A;  3PM8 A;  1S3P A;  1MUX A;  2TN4 A;  1TCO B;  4CPV A;  2OTG C;  1S5G Z;  1UHN A;  2K61 A;  1BG1 A;  1R6P A;  2KI4 B;  1G33 A;  4GGF C;  2M1K B;  5CSN A;  3LK1 A;  1UUR A;  2LMU A;  1JUO A;  1KQM C;  2LCP A;  3FS7 A;  1XFX O;  1JF0 A;  3NSO A;  1M31 A;  1UHI A;  2K2A A;  1SCV A;  2PAS A;  2GV5 A;  5B8I B;  1OMR A;  3WNX B;  1NWD A;  1SR6 B;  3DVM A;  1BR4 B;  4MZL A;  1B4C A;  1KSM A;  1N65 A;  2AUC A;  2CTN A;  1IG5 A;  4R1E A;  1MXL C;  1YX8 A;  1CDM A;  1UWO A;  1YTZ C;  2KAY A;  1EG4 A;  5AER A;  3GK4 X;  2MA2 A;  4YGD B;  3KF9 A;  1MQ1 A;  2FCD A;  1JC2 A;  4MLW A;  1H8B A;  2Q4U A;  5D69 A;  3TS5 C;  1WDC C;  1S5G Y;  1NCX A;  2LHL A;  1CMG A;  1ZAC A;  2COL B;  3F45 A;  5DKR A;  4CFR A;  1CFD A;  3AKB A;  2EC6 C;  4DCK A;  2FOT A;  5CPV A;  3KEV A;  1IQ3 A;  1DVI A;  3I5H B;  4BY5 A;  1DT7 B;  1CB1 A;  3CS1 A;  1KQV A;  1OSA A;  3C1V A;  1TNX A;  3EK4 A;  5DKQ A;  1M39 A;  1RTP 1;  5HYD A;  1PUL A;  1K96 A;  4CID A;  3I5G B;  1C7W A;  1TNW A;  1SKT A;  2H2K A;  2OS8 B;  4QJ4 B;  3CGA A;  1BU3 A;  1B8L A;  1DJI A;  1BT6 A;  4AQJ A;  2PMY A;  3EVV A;  4I5L B;  1PRW A;  2WC8 A;  2AMI A;  1CMF A;  5ER4 X;  2BCA A;  1JF2 A;  3BQ3 A;  3EKJ A;  1IRJ A;  2JZI A;  5CSI A;  2F3Z A;  2ZRS A;  4NDC A;  2JXC A;  3RLZ A;  2Y1M A;  1OZO A;  1YUU A;  3O6B A;  3WXA A;  2PAL A;  1UP5 A;  1NX2 A;  4PDZ A;  1QS7 A;  1A03 A;  3CLN A;  2HQW A;  2OPO A;  3MSE B;  3CWG A;  1FI5 A;  1FI6 A;  2KAX A;  3KPX A;  1RRO A;  2M7L A;  2LP3 A;  1S36 A;  1QAT A;  2KAV A;  1PAL A;  3DF0 B;  4GUK A;  2F3Y A;  2Y5I A;  1YRT B;  3BYA A;  3O78 A;  1ZUZ A;  1S6I A;  1SPY A;  2JT8 A;  4M2O A;  1SK6 D;  1S26 D;  3NSI A;  1C07 A;  1XFW O;  1EJ3 A;  1QAS A;  1XFZ O;  3OX5 A;  1KK8 B;  3IQQ A;  3HX4 A;  1CM4 A;  3JTD B;  1BJF A;  3DVK A;  2LAP A;  1L2O B;  1MWN A;  3JVT B;  1RJV A;  1WLZ A;  5K89 A;  3DF0 A;  2I2R E;  2JTZ A;  3KHE A;  4GAO A;  3I5F C;  2LUC A;  4YGE B;  4AQI A;  1K94 A;  2HPS A;  5HKY A;  2K2F A;  2KQ6 A;  1IJ6 A;  3QRX A;  1QV1 A;  1NCZ A;  1FF1 A;  2FCE A;  2CNP A;  4N5X A;  1OZS A;  4XYN A;  5AFP A;  1WRZ A;  2E6W A;  3SG3 A;  1TNQ A;  3TDU A;  1XK4 A;  2JWW A;  4PE1 A;  1F70 A;  5KTY A;  1B9A A;  1DJG A;  5AEQ A;  2LV7 A;  1OMV A;  4JWQ A;  4ZCU A;  1MF8 B;  1NYA A;  2LNK A;  3EK7 A;  1KFU S;  1M63 B;  2OS8 C;  3CZT X;  1MR8 A;  2ZND A;  2IS9 A;  2ZN8 A;  4OV2 A;  2ZFD A;  1TTX A;  3HCM A;  1J7O A;  3SJS A;  1NX0 A;  1TNP A;  5J3X A;  4OR9 B;  2B1U A;  2F2P A;  5TNC A;  2BKI B;  3LLE A;  2KHN A;  1IQ5 A;  1QX7 A;  3SG7 A;  2KDH A;  3OHM B;  2KNE A;  1WY9 A;  2JPT A;  1J7Q A;  1NP8 A;  1OMD A;  1XO5 A;  1KFX S;  1EXR A;  1S1E A;  1TN4 A;  1W7I B;  4HSZ A;  4MRX A;  1IWQ A;  1NPQ A;  2CT9 A;  5GQQ C;  1AP4 A;  3NSK A;  1BR1 B;  1YUT A;  1CDL A;  1F71 A;  3TUY B;  3I5I B;  1KK7 Y;  2LAN A;  2M9G A;  3OX6 A;  1A29 A;  1DMO A;  4HRE E;  3ICB A;  3PLF B;  2G2B A;  1K9P A;  3VRP A;  3EKH A;  1K2H A;  1JBA A;  1K90 D;  1ZMZ A;  4BY4 A;  3SG5 A;  1SCM B;  2LMT A;  2I7A A;  2LVI A;  5F6T A;  5AAN A;  1KWO C;  1XA5 A;  4ORB B;  3PN7 B;  2F33 A;  2I18 A;  2O60 A;  5BPJ A;  5CSF A;  1K8U A;  2M1U A;  3OB2 B;  2Y1N A;  5I2O A;  1CKK A;  2JNF A;  2LP2 A;  3CTN A;  4MEW A;  2BL0 C;  1YRU B;  5I8N A;  4HRH A;  2KGR A;  2PSR A;  3D0Y B;  1Y1U A;  3H4S E;  2K7O A;  2BE6 A;  5ER5 A;  1B8R A;  1DTL A;  1SBJ A;  4N1G A;  3WHU B;  1S6J A;  1AJ5 A;  1V1G A;  2KFF A;  1U5I B;  1CLM A;  1LXF C;  1XVJ A;  1E8A A;  2FJU B;  1XFV O;  1YUS A;  4DRW A;  3D0Y A;  1PSB A;  1M46 A;  2MLF C;  1LKJ A;  1AHR A;  2I94 A;  2ZNE A;  2PVB A;  3E3R A;  5JOL A;  2MBX A;  1J7R A;  1V1F A;  4OCI A;  3DVE A;  2KGB C;  1B8C A;  4A4C A;  2KI4 C;  4ICB A;  4HRG A;  4JPZ B;  5HLV A;  4USL A;  1QLS A;  4PHM A;  3TDZ A;  1CFP A;  2NLN A;  3GK1 A;  2WOR A;  4MBE A;  2JNX A;  2DOQ A;  3BUW B;  3PAT A;  4OVN F;  3EVU A;  2L5X B;  2LM5 A;  2L50 A;  4C0L A;  1SR6 C;  1Y1A A;  2A4J A;  4YI8 A;  1QX2 A;  3A8R A;  3A4U B;  3OB1 B;  3KO0 A;  1JFK A;  2LVV A;  2PRU A;  1L7Z A;  4MSP A;  1Y6W A;  1DJY A;  5AXI A;  2H61 A;  3BUX B;  1QJT A;  3DVJ A;  1CDN A;  4N1F A;  1UHJ A;  2L98 A;  4WQ3 A;  3SG4 A;  4P5O E;  3O2P A;  1DF0 B;  3IF7 A;  1ZFS A;  4NQG A;  5KU1 A;  3CR5 X;  1QV0 A;  1F4Q A;  1SYM A;  1DJW A;  2OTG B;  1SL8 A;  1J55 A;  1NX1 A;  2F2O A;  1GGZ A;  3FIA A;  3IQO A;  1XYD A;  1FPW A;  3GK2 A;  1S6C A;  2WCE A;  1QIW A;  3SG2 A;  1SNL A;  2M29 A;  1CLB A;  2SAS A;  1KQM B;  1DF0 A;  1G8I A;  2Q91 A;  1WRK A;  3I5H C;  2HF5 A;  1TRF A;  4MZK A;  2L51 A;  4ETO A;  1BLQ A;  2QPT A;  4L9M A;  1UHH A;  4ORC B;  3WHT B;  2O5G A;  3VRO A;  2MAZ A;  1KK7 Z;  2LLU A;  4GGF A;  2GGM A;  1F54 A;  1YX7 A;  1XFY O;  1NSH A;  2JUL A;  2JT3 A;  3NXA A;  3I5G C;  1BF5 A;  1N2D A;  2KFG A;  1HQV A;  1J1D A;  1UHK A;  4MN0 A;  4YGA A;  2L4H A;  4MZJ A;  2LHI A;  1TOP A;  4XJK B;  3EK8 A;  2LLS A;  2G9B A;  3TDI A;  3VRN A;  1RFJ A;  3TS5 B;  3VRQ A;  1Q80 A;  1A4P A;  1WDC B;  1GQM A;  3PAL A;  4QJ5 B;  1K95 A;  1Y0V H;  5KSZ A;  3GOF A;  2EC6 B;  4CFQ A;  1IKU A;  3O4Y A;  1YVL A;  2KI6 C;  4C0J A;  3TZ1 A;  1Y1X A;  1ALW A;  4PE0 A;  1RK9 A;  1ZOT B;  2BCB A;  1LA0 A;  1OOJ A;  1EL4 A;  1VRK A;  2LC5 A;  4XJK A;  4CLN A;  1K9K A;  3BOW B;  4DUQ A;  5IBW A;  5JJG A;  1GJY A;  1MHO A;  2L4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...