3D74A

Crystal structure of a pheromone binding protein mutant d35a, from apis mellifera, soaked at ph 5.5
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
119
structure length
119
Chain Sequence
APDWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVAKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone-binding protein ASP1
publication title Queen bee pheromone binding protein pH-induced domain swapping favors pheromone release
pubmed doi rcsb
source organism Apis mellifera
molecule tags Pheromone binding protein
total genus 37
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3d74A00
3CZ2A 3VB1A 1OW4A 2JPOA 4FQTA 3DZTA 3BJHA 3DXLA 1LS8A 1DQEA 3B86A 3D78A 2WCHA 3BFBA 3FE9A 3R72A 3L4LA 3D74A 4OZDA 2QEBA 3CDNA 1OOGA 3DY9A 3QMEA 2WCKA 3FE6A 1ORGA 4INWA 2WCMA 3S0EA 3BFHA 1C3YA 3D73A 2QEOA 3L4AA 3R1OA 3B87A 3NGVA 1T14A 2QEVA 2ERBA 2WC5A 3S0AA 3S0BA 1OOHA 3B6XA 4JD9A 2QDIA 3S0DA 2WCJA 3CABA 2GTEA 3CYZA 2H8VA 3D77A 4F7FA 1GM0A 3S0GA 3D76A 2WC6A 2WCLA 3K1EA 3RZSA 3CZ0A 1TWOA 1C3ZA 5EL2A 2P70A 3NHTA 4PT1A 3R1VA 1QWVA 2FJYA 3B88A 1OOIX 2KPHA 2QEHA 3FE8A 3PJIA 3CZ1A 3DYEA 1OOFA 3R1PA 1TUJA 3NHIA 5DICA 1P28A 3OGNA 3Q8IA 3V2LA 3D75A 1XFRA 2L2CA 3BFAA 4INXA 3L47A 2P71A 3S0FA 2PQLA 3N7HA 3B7AA
chains in the Genus database with same CATH superfamily
1S5GZ 1RFJA 4FQTA 1PVAA 3QRXA 3SG5A 2H2KA 1M31A 3DZTA 1FI6A 1K9UA 4PHKA 3EKJA 1LKJA 2F33A 1A4PA 3DXLA 1BF5A 1X02A 1KSMA 5CPVA 2WORA 1Q80A 4P2YB 1QV1A 1SYMA 3B86A 5BPJA 4PE7A 2JQ6A 1W7JB 1XA5A 2KAVA 3NSLA 5D3OA 2LLTA 1SCMB 4YI8A 1A75B 2KFGA 1QLSA 5I2OA 3DVJA 2K7OA 1NCZA 2BCAA 3L4LA 2CBLA 3IVTA 5FI2A 2MJWB 1TUZA 4BY5A 1BODA 1CFFA 1WLZA 1NYAA 3GK4X 1OOGA 4M2OA 1KFXL 1SRAA 2EC6C 3QMEA 4OKHA 2BKHB 1U5IB 2LCPA 4CFQA 3WNXB 1SR6C 1JF0A 2BL0B 3CGAA 1TCFA 1BU3A 4USLA 2Y1NA 4INWA 4IJ7A 3OHMB 4F0ZB 1QIWA 1SPYA 3CS1A 1DGUA 2E6WA 3KF9A 1F8HA 1QLKA 1C3YA 2NXQA 2KGRA 3JTDB 4QJ4B 1UUSA 2M29A 3L4AA 2NLNA 3B87A 1N0YA 3BUWB 4GPLB 3D0YB 3PATA 4OCIA 1TN4A 5DKNA 1C7VA 1A2XA 1BOCA 1PRWA 1V1FA 3SIBA 1OE9B 2JRFA 3CTNA 3UO9A 2GGMA 3S0DA 1YVHA 4A4BA 2AAOA 3CABA 1NCXA 2HF5A 2SASA 3CYZA 1L2OB 1YRUB 2LVKA 1LINA 2KAYA 2L4IA 2PALA 5ER5A 1FI5A 5HYDA 3PM2A 2WOSA 4P5OE 2JT0A 1OMRA 2KDHA 3BUMB 4ZCVA 4YGEB 4WRIA 4CLNA 2K7BA 4PE1A 3DVMA 1NX1A 1IRJA 3K1EA 1BR1B 4ORAB 4C0JA 5AERA 4WQ3A 1DJZA 5EL2A 1WRKA 1JBAA 1YR5A 4GUKA 1NX3A 1CFCA 2M97A 3FS7A 4PT1A 1YVLA 3PALA 1TNWA 2K60A 2G2BA 5I2LA 1J1DA 1B4CA 1K96A 4CFRA 3PJIA 1IJ5A 1RK9A 3CZ1A 1AJ4A 1KWOB 1J7RA 2BCXA 2MRDA 2O60A 3KHEA 1KQVA 2MBXA 3R1PA 2AUCA 5AXIA 4ICBA 2JU0A 1DF0A 2WCFA 2Y4QA 3OGNA 1QX2A 1DMOA 2OTGB 1UHKA 2ZN8A 1BJFA 4MZLA 1XFRA 2I18A 1CDPA 3IQOA 3LLEA 3OB2B 4INXA 4Q04A 1MHOA 1QIVA 2KQ6A 3IF7A 1K93D 2P71A 1QS7A 2NCPA 3I5GB 3S0FA 3CR5X 3EK8A 2PQLA 3NSKA 5HKZA 3CR4X 3EK4A 5CSNA 2KHNA 4DCKA 1J55A 4D1EA 1J7QA 4PCWA 1TIZA 3AKAA 2FCEA 5FI6A 4I5JA 1S3PA 2F2PA 2GV5A 2Q91A 1QVIY 1ALWA 1TNQA 1M39A 1CKKA 3M0WA 2D8NA 1KQMC 3TS5C 3D78A 1A03A 1F55A 2LP2A 3EVRA 1OOJA 4YGBB 3SG4A 2LHIA 1AK8A 4GBAA 1Y0VH 1LA0A 4OZDA 2LC5A 4M2QA 2JWWA 1F4QA 1SL7A 2QEBA 1TNPA 2KLEA 1KK8B 3DY9A 4MRXA 2WCKA 4GAOA 3EVUA 2JPTA 1QVIZ 2JZIA 2KI4B 4JQ0D 2FJUB 2CXJA 2LVIA 1KFUS 2WCMA 1PULA 3S0EA 1DJYA 1XYDA 1E8AA 4YGCB 1CLMA 2L5YA 4JPZB 1DTLA 2BCBA 2QPTA 4YBHB 1S6JA 2R2IA 1AJ5A 3CWGA 2K7CA 2KLDA 3F45A 3JVTC 2EHBA 3I5FB 1Y1UA 1T14A 3ZWHA 2ERBA 2Q4UA 5DKRA 1EXRA 1R6PA 2L4HA 3DVKA 4GGNA 4MLWA 3UNWA 4AQJA 3S0BA 1OOHA 2VRGA 2F3YA 1YTZC 2MLEC 2BKIB 2HQ8A 1RECA 2M1KB 1DJIA 2QDIA 4JD9A 1JC2A 1DELA 4AQIA 2K7DA 2WCJA 4DIRA 3SG2A 2ZNDA 1SMGA 2H8VA 1PSRA 3C1VA 3O6BA 1MXEA 2JULA 2BECA 3D77A 1RROA 4F7FA 1DJGA 4UPGA 1UP5A 1YX8A 4ZCUA 3S0GA 2OS8C 1MF8B 4XJKA 1B47A 3D76A 2CNPA 1DGVA 1KSOA 1IKUA 2WC6A 1YURA 2LV7A 2WNDA 3RZSA 4A4CA 2YGUA 4TNCA 2FCDA 1SL8A 1C3ZA 2H61C 2KSPA 4ORCB 4GNKB 5HLVA 1J7OA 3NHTA 1QASA 3R1VA 4WQ2A 1QX7A 1QWVA 3I5IC 3I5HC 3LK0A 1VRKA 3PN7C 3CR2A 1OOIX 2KPHA 5KTYA 3GK2A 3BOWA 3TDUA 1J7PA 2KGBC 1NIWA 1UHIA 2B1UA 4QJ5B 1WRZA 1NWDA 1Y6WA 4CPVA 3DVEA 1K8UA 4QJ3B 1IQ5A 1OOFA 1J1EA 1H4BA 1DVIA 4OR9B 1CM4A 1XFVO 3O78A 1S1EA 2KI6D 4MZJA 1P28A 3FIAA 3KEVA 3DF0A 4PE4A 3VRPA 2K61A 2K8MB 1YUUA 1ZFSA 2E30A 3TZ1A 2H61A 1D1OA 2L2CA 2COLB 2KFFA 5D7FA 4DS7A 1AHRA 3BXKA 2QACA 2LLSA 1CFPA 2LANA 3RM1A 1QX5B 1XVJA 3O4YA 4C0KA 1KK7Y 1SBJA 2LMVA 3TDIA 4PE0A 3K21A 2G9BA 1G33A 1QATA 1GJYA 2RGIA 3SS4A 2ZRTA 1M46A 1IH0A 3BUOB 1OW4A 2PYQA 4PHNA 1S6IA 1SCMC 1WDCB 4N5XA 1W7IB 1EH2A 4ETOA 4KYNA 5AFPA 1C7WA 1FPWA 3E3RA 3HX4A 4HREE 4N1FA 4NDCA 4R1EA 1C07A 1CMGA 2WCHA 5CSIA 3BFBA 2PVBA 2L50A 3AKBA 1N2DA 3VROA 2L2EA 3IQQA 2BL0C 1KK7Z 1KFUL 1CNPA 4HRGA 2JXCA 4M2PA 3D74A 2I7AA 1ODBA 1XFUO 1DEKA 1IWQA 1S6CA 3CDNA 4PDZA 2JT8A 5TNCA 4MVFA 5I2QA 3OBVA 3FE6A 3JTDC 1UWOA 5FI7A 1TOPA 1JUOA 1TNXA 1XFYO 1XFXO 4FTGA 3SJSA 4GGFC 3VRQA 1B1GA 2A4JA 2KBMA 1PSBA 1TRFA 1A75A 2Y1MA 4OVNF 2MAZA 4I5LB 4YGDB 4PALA 3BFHA 2KAXA 4MSPA 2EC6B 1MXLC 1XK4C 1MR8A 2BBMA 2QEOA 3D73A 4FQOA 2LE9B 4HRHA 2KI6C 4OV2A 1SR6B 3R1OA 4MRYA 1U5IA 4PHJA 4YRUA 3NGVA 2GGZA 1L2OC 1A29A 2JNFA 3TUYC 4I5NB 1BR4B 1IIOA 2Y5IA 1YX7A 2L0PA 1CLLA 1SKTA 4IL1A 1UHJA 2LUCA 4MEWA 1FW4A 2LP3A 1WRLA 4ORBB 3VGOA 5G08A 3CLNA 3D10A 1SCVA 4GGFA 1Y1XA 2LVJA 3D0YA 3GOFA 4C0LA 2KNEA 1YUTA 1OZSA 1B8RA 1L7ZA 4CIDA 1SSEB 1SW8A 3AAJA 2BE4A 2KBIA 1F4OA 1XK4A 2WCLA 2LMTA 2F3ZA 2MA2A 3TDZA 3CZ0A 1TWOA 2P70A 2JT3A 4U8DA 3A8RA 1OMVA 2PASA 1KWOC 1S36A 2NZ0A 4JKTA 5IBWA 1PALA 1DF0B 1RWYA 2ZFDA 2O5GA 3B88A 1QV0A 1Y1AA 1F71A 5AANA 2M1UA 5B8IB 3SG6A 5HKYA 2PSRA 4PHMA 2OTGC 1XFZO 2MHHA 5HLOA 3SG3A 3DYEA 2JXLA 2JTZA 1XFWO 1NX0A 2MLFC 4L9MA 1NPQA 1DT7B 2OPOA 1TUJA 1UHNA 5PALA 4N1GA 2LUXA 3I5GC 3PSRA 1M45A 1XO5A 1K94A 2HQWA 3V2LA 3WHTB 3OX6A 3A4UB 3D75A 1ZOTB 1V1GA 5F6TA 2V53A 3KPXA 3OP0A 1ALVA 4DRWA 2JOJA 3L47A 1R2UA 2CT9A 3MSEB 1BG1A 2KQYA 1K90D 1JWDA 1OSAA 1K95A 4NDDA 2PRUA 1BMOA 1IQ3A 2JNXA 1K9PA 1CFDA 2ISDA 1DJHA 1G4YR 1IGVA 5KU1A 1B8LA 3N7HA 4MZKA 1NP8A 4XYNA 3CZ2A 5D69A 3VB1A 1CDNA 2I2RE 1H8BA 3EK7A 2JPOA 4HSZA 5KSZA 3FWBA 3BJHA 5I8NA 1CMFA 3SIAA 1CLBA 1KCYA 1LS8A 3PFVA 2CTNA 1MUXA 1SL9A 2JTTA 1DQEA 1EG4A 1B8CA 2BE6A 4JWQA 1KK8C 3BQ3A 3NSOA 1B7TY 2KFHA 3FE9A 1UHHA 5CSFA 3R72A 2KI4C 1QTXA 5JJGA 2SCPA 1OZOA 1JF2A 5AEQA 1HT9A 5ER4X 1QJTA 1IG5A 3O2PA 3TS5B 1KQMB 1DJWA 3H4SE 1WY9A 1NUBA 2F2OA 5GQQC 4GFTA 5HKWA 1N65A 1QXPA 3BUXB 3CZTX 1ORGA 4MN0A 3BUNB 3I5FC 1CDMA 1CDLA 3PLFB 5CSJA 3GK1A 1CTRA 1B7TZ 1SNLA 2WCEA 3ICBA 2PMYA 3WHUB 1MWNA 3OX5A 2EGDA 1OMDA 2ZN9A 3BYAA 3SG7A 4BY4A 1BT6A 1AVSA 1KFXS 2M0RA 1LVCD 2LM5A 3NSIA 2QEVA 2TN4A 4AOMA 2WC5A 1PK0D 2LVVA 4E68A 4XJKB 3S0AA 1Z4HA 1PVBA 5J3XA 2IS9A 2M49B 2KOTA 1W9ZA 3B6XA 3EKHA 3NXAA 5FYXA 1EJ3A 2L5XB 1AP4A 1WLMA 3LL8B 3LCPC 2FOTA 3TUYB 3JVTB 1GQMA 2GTEA 3SS5A 3WXAA 1CB1A 1YUSA 2KYCA 1HQVA 5I94A 1AUIB 2BNXA 2NCOA 2M9GA 1GM0A 1FBVA 1OQPA 5K89A 1B9AA 1GGZA 5DKQA 4I5KA 5JOLA 3AAKA 2K2FA 4NDBA 3BOWB 3EG5B 1M63B 2ZRSA 1ZMZA 2JC2A 2M8UA 1JFJA 1RTP1 1TTXA 3O4XA 3OB1B 2ZKMX 2ZNEA 2K0JA 2LLUA 3DD4A 4YGAA 2P6BB 2OS8B 2WC8A 1CM1A 1DJXA 4NQGA 1F54A 2FJYA 2LMUA 1ZACA 3RLZA 3DF0B 2I94A 2QEHA 3KO0A 1GGWA 3FE8A 1LA3A 2M3WA 2WCBA 1IJ6A 1S26D 1FF1A 2LAPA 1ZUZA 2LHLA 1SK6D 1DC1A 1LXFC 1UURA 2L51A 4YI9A 3I5HB 1F70A 3I5IB 3NHIA 1NSHA 5DICA 2CCMA 1K9KA 3PN7B 1NCYA 1SY9A 1S5GY 1BLQA 1TCOB 3Q8IA 1MQ1A 1K2HA 3ZNIA 2BBNA 2AMIA 3LK1A 3SS3A 2LNKA 1JSAA 2M7LA 2HETA 3HCMA 3BFAA 2M7NA 4MBEA 1G8IA 3EVVA 1WDCC 2KYFA 1JFKA 3PM8A 2BAPA 3VRNA 1EG3A 3FWCA 2DOQA 5HL1A 1YRTB 1Z2CB 4DUQA 1EL4A 3VRRA 1NX2A 2K2AA 2L98A 1RJVA 2F8PA 3B7AA 2HPSA
chains in the Genus database with same CATH topology
3CZ2A 3VB1A 1OW4A 2JPOA 4FQTA 3DZTA 3BJHA 3DXLA 1LS8A 1DQEA 3B86A 3D78A 2WCHA 3BFBA 3FE9A 3R72A 3L4LA 3D74A 4OZDA 2QEBA 3CDNA 1OOGA 3DY9A 3QMEA 2WCKA 3FE6A 1ORGA 4INWA 2WCMA 3S0EA 3BFHA 1C3YA 3D73A 2QEOA 3L4AA 3R1OA 3B87A 3NGVA 1T14A 2QEVA 2ERBA 2WC5A 3S0AA 3S0BA 1OOHA 3B6XA 4JD9A 2QDIA 3S0DA 2WCJA 3CABA 2GTEA 3CYZA 2H8VA 3D77A 4F7FA 1GM0A 3S0GA 3D76A 2WC6A 2WCLA 3K1EA 3RZSA 3CZ0A 1TWOA 1C3ZA 5EL2A 2P70A 3NHTA 4PT1A 3R1VA 1QWVA 2FJYA 3B88A 1OOIX 2KPHA 2QEHA 3FE8A 3PJIA 3CZ1A 3DYEA 1OOFA 3R1PA 1TUJA 3NHIA 5DICA 1P28A 3OGNA 3Q8IA 3V2LA 3D75A 1XFRA 2L2CA 3BFAA 4INXA 3L47A 2P71A 3S0FA 2PQLA 3N7HA 3B7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CZ2 A;  3VB1 A;  1OW4 A;  2JPO A;  4FQT A;  3DZT A;  3BJH A;  3DXL A;  1LS8 A;  1DQE A;  3B86 A;  3D78 A;  2WCH A;  3BFB A;  3FE9 A;  3R72 A;  3L4L A;  3D74 A;  4OZD A;  2QEB A;  3CDN A;  1OOG A;  3DY9 A;  3QME A;  2WCK A;  3FE6 A;  1ORG A;  4INW A;  2WCM A;  3S0E A;  3BFH A;  1C3Y A;  3D73 A;  2QEO A;  3L4A A;  3R1O A;  3B87 A;  3NGV A;  1T14 A;  2QEV A;  2ERB A;  2WC5 A;  3S0A A;  3S0B A;  1OOH A;  3B6X A;  4JD9 A;  2QDI A;  3S0D A;  2WCJ A;  3CAB A;  2GTE A;  3CYZ A;  2H8V A;  3D77 A;  4F7F A;  1GM0 A;  3S0G A;  3D76 A;  2WC6 A;  2WCL A;  3K1E A;  3RZS A;  3CZ0 A;  1TWO A;  1C3Z A;  5EL2 A;  2P70 A;  3NHT A;  4PT1 A;  3R1V A;  1QWV A;  2FJY A;  3B88 A;  1OOI X;  2KPH A;  2QEH A;  3FE8 A;  3PJI A;  3CZ1 A;  3DYE A;  1OOF A;  3R1P A;  1TUJ A;  3NHI A;  5DIC A;  1P28 A;  3OGN A;  3Q8I A;  3V2L A;  3D75 A;  1XFR A;  2L2C A;  3BFA A;  4INX A;  3L47 A;  2P71 A;  3S0F A;  2PQL A;  3N7H A;  3B7A A; 
#chains in the Genus database with same CATH topology
 1S5G Z;  1RFJ A;  4FQT A;  1PVA A;  3QRX A;  3SG5 A;  2H2K A;  1M31 A;  3DZT A;  1FI6 A;  1K9U A;  4PHK A;  3EKJ A;  1LKJ A;  2F33 A;  1A4P A;  3DXL A;  1BF5 A;  1X02 A;  1KSM A;  5CPV A;  2WOR A;  1Q80 A;  4P2Y B;  1QV1 A;  1SYM A;  3B86 A;  5BPJ A;  4PE7 A;  2JQ6 A;  1W7J B;  1XA5 A;  2KAV A;  3NSL A;  5D3O A;  2LLT A;  1SCM B;  4YI8 A;  1A75 B;  2KFG A;  1QLS A;  5I2O A;  3DVJ A;  2K7O A;  1NCZ A;  2BCA A;  3L4L A;  2CBL A;  3IVT A;  5FI2 A;  2MJW B;  1TUZ A;  4BY5 A;  1BOD A;  1CFF A;  1WLZ A;  1NYA A;  3GK4 X;  1OOG A;  4M2O A;  1KFX L;  1SRA A;  2EC6 C;  3QME A;  4OKH A;  2BKH B;  1U5I B;  2LCP A;  4CFQ A;  3WNX B;  1SR6 C;  1JF0 A;  2BL0 B;  3CGA A;  1TCF A;  1BU3 A;  4USL A;  2Y1N A;  4INW A;  4IJ7 A;  3OHM B;  4F0Z B;  1QIW A;  1SPY A;  3CS1 A;  1DGU A;  2E6W A;  3KF9 A;  1F8H A;  1QLK A;  1C3Y A;  2NXQ A;  2KGR A;  3JTD B;  4QJ4 B;  1UUS A;  2M29 A;  3L4A A;  2NLN A;  3B87 A;  1N0Y A;  3BUW B;  4GPL B;  3D0Y B;  3PAT A;  4OCI A;  1TN4 A;  5DKN A;  1C7V A;  1A2X A;  1BOC A;  1PRW A;  1V1F A;  3SIB A;  1OE9 B;  2JRF A;  3CTN A;  3UO9 A;  2GGM A;  3S0D A;  1YVH A;  4A4B A;  2AAO A;  3CAB A;  1NCX A;  2HF5 A;  2SAS A;  3CYZ A;  1L2O B;  1YRU B;  2LVK A;  1LIN A;  2KAY A;  2L4I A;  2PAL A;  5ER5 A;  1FI5 A;  5HYD A;  3PM2 A;  2WOS A;  4P5O E;  2JT0 A;  1OMR A;  2KDH A;  3BUM B;  4ZCV A;  4YGE B;  4WRI A;  4CLN A;  2K7B A;  4PE1 A;  3DVM A;  1NX1 A;  1IRJ A;  3K1E A;  1BR1 B;  4ORA B;  4C0J A;  5AER A;  4WQ3 A;  1DJZ A;  5EL2 A;  1WRK A;  1JBA A;  1YR5 A;  4GUK A;  1NX3 A;  1CFC A;  2M97 A;  3FS7 A;  4PT1 A;  1YVL A;  3PAL A;  1TNW A;  2K60 A;  2G2B A;  5I2L A;  1J1D A;  1B4C A;  1K96 A;  4CFR A;  3PJI A;  1IJ5 A;  1RK9 A;  3CZ1 A;  1AJ4 A;  1KWO B;  1J7R A;  2BCX A;  2MRD A;  2O60 A;  3KHE A;  1KQV A;  2MBX A;  3R1P A;  2AUC A;  5AXI A;  4ICB A;  2JU0 A;  1DF0 A;  2WCF A;  2Y4Q A;  3OGN A;  1QX2 A;  1DMO A;  2OTG B;  1UHK A;  2ZN8 A;  1BJF A;  4MZL A;  1XFR A;  2I18 A;  1CDP A;  3IQO A;  3LLE A;  3OB2 B;  4INX A;  4Q04 A;  1MHO A;  1QIV A;  2KQ6 A;  3IF7 A;  1K93 D;  2P71 A;  1QS7 A;  2NCP A;  3I5G B;  3S0F A;  3CR5 X;  3EK8 A;  2PQL A;  3NSK A;  5HKZ A;  3CR4 X;  3EK4 A;  5CSN A;  2KHN A;  4DCK A;  1J55 A;  4D1E A;  1J7Q A;  4PCW A;  1TIZ A;  3AKA A;  2FCE A;  5FI6 A;  4I5J A;  1S3P A;  2F2P A;  2GV5 A;  2Q91 A;  1QVI Y;  1ALW A;  1TNQ A;  1M39 A;  1CKK A;  3M0W A;  2D8N A;  1KQM C;  3TS5 C;  3D78 A;  1A03 A;  1F55 A;  2LP2 A;  3EVR A;  1OOJ A;  4YGB B;  3SG4 A;  2LHI A;  1AK8 A;  4GBA A;  1Y0V H;  1LA0 A;  4OZD A;  2LC5 A;  4M2Q A;  2JWW A;  1F4Q A;  1SL7 A;  2QEB A;  1TNP A;  2KLE A;  1KK8 B;  3DY9 A;  4MRX A;  2WCK A;  4GAO A;  3EVU A;  2JPT A;  1QVI Z;  2JZI A;  2KI4 B;  4JQ0 D;  2FJU B;  2CXJ A;  2LVI A;  1KFU S;  2WCM A;  1PUL A;  3S0E A;  1DJY A;  1XYD A;  1E8A A;  4YGC B;  1CLM A;  2L5Y A;  4JPZ B;  1DTL A;  2BCB A;  2QPT A;  4YBH B;  1S6J A;  2R2I A;  1AJ5 A;  3CWG A;  2K7C A;  2KLD A;  3F45 A;  3JVT C;  2EHB A;  3I5F B;  1Y1U A;  1T14 A;  3ZWH A;  2ERB A;  2Q4U A;  5DKR A;  1EXR A;  1R6P A;  2L4H A;  3DVK A;  4GGN A;  4MLW A;  3UNW A;  4AQJ A;  3S0B A;  1OOH A;  2VRG A;  2F3Y A;  1YTZ C;  2MLE C;  2BKI B;  2HQ8 A;  1REC A;  2M1K B;  1DJI A;  2QDI A;  4JD9 A;  1JC2 A;  1DEL A;  4AQI A;  2K7D A;  2WCJ A;  4DIR A;  3SG2 A;  2ZND A;  1SMG A;  2H8V A;  1PSR A;  3C1V A;  3O6B A;  1MXE A;  2JUL A;  2BEC A;  3D77 A;  1RRO A;  4F7F A;  1DJG A;  4UPG A;  1UP5 A;  1YX8 A;  4ZCU A;  3S0G A;  2OS8 C;  1MF8 B;  4XJK A;  1B47 A;  3D76 A;  2CNP A;  1DGV A;  1KSO A;  1IKU A;  2WC6 A;  1YUR A;  2LV7 A;  2WND A;  3RZS A;  4A4C A;  2YGU A;  4TNC A;  2FCD A;  1SL8 A;  1C3Z A;  2H61 C;  2KSP A;  4ORC B;  4GNK B;  5HLV A;  1J7O A;  3NHT A;  1QAS A;  3R1V A;  4WQ2 A;  1QX7 A;  1QWV A;  3I5I C;  3I5H C;  3LK0 A;  1VRK A;  3PN7 C;  3CR2 A;  1OOI X;  2KPH A;  5KTY A;  3GK2 A;  3BOW A;  3TDU A;  1J7P A;  2KGB C;  1NIW A;  1UHI A;  2B1U A;  4QJ5 B;  1WRZ A;  1NWD A;  1Y6W A;  4CPV A;  3DVE A;  1K8U A;  4QJ3 B;  1IQ5 A;  1OOF A;  1J1E A;  1H4B A;  1DVI A;  4OR9 B;  1CM4 A;  1XFV O;  3O78 A;  1S1E A;  2KI6 D;  4MZJ A;  1P28 A;  3FIA A;  3KEV A;  3DF0 A;  4PE4 A;  3VRP A;  2K61 A;  2K8M B;  1YUU A;  1ZFS A;  2E30 A;  3TZ1 A;  2H61 A;  1D1O A;  2L2C A;  2COL B;  2KFF A;  5D7F A;  4DS7 A;  1AHR A;  3BXK A;  2QAC A;  2LLS A;  1CFP A;  2LAN A;  3RM1 A;  1QX5 B;  1XVJ A;  3O4Y A;  4C0K A;  1KK7 Y;  1SBJ A;  2LMV A;  3TDI A;  4PE0 A;  3K21 A;  2G9B A;  1G33 A;  1QAT A;  1GJY A;  2RGI A;  3SS4 A;  2ZRT A;  1M46 A;  1IH0 A;  3BUO B;  1OW4 A;  2PYQ A;  4PHN A;  1S6I A;  1SCM C;  1WDC B;  4N5X A;  1W7I B;  1EH2 A;  4ETO A;  4KYN A;  5AFP A;  1C7W A;  1FPW A;  3E3R A;  3HX4 A;  4HRE E;  4N1F A;  4NDC A;  4R1E A;  1C07 A;  1CMG A;  2WCH A;  5CSI A;  3BFB A;  2PVB A;  2L50 A;  3AKB A;  1N2D A;  3VRO A;  2L2E A;  3IQQ A;  2BL0 C;  1KK7 Z;  1KFU L;  1CNP A;  4HRG A;  2JXC A;  4M2P A;  3D74 A;  2I7A A;  1ODB A;  1XFU O;  1DEK A;  1IWQ A;  1S6C A;  3CDN A;  4PDZ A;  2JT8 A;  5TNC A;  4MVF A;  5I2Q A;  3OBV A;  3FE6 A;  3JTD C;  1UWO A;  5FI7 A;  1TOP A;  1JUO A;  1TNX A;  1XFY O;  1XFX O;  4FTG A;  3SJS A;  4GGF C;  3VRQ A;  1B1G A;  2A4J A;  2KBM A;  1PSB A;  1TRF A;  1A75 A;  2Y1M A;  4OVN F;  2MAZ A;  4I5L B;  4YGD B;  4PAL A;  3BFH A;  2KAX A;  4MSP A;  2EC6 B;  1MXL C;  1XK4 C;  1MR8 A;  2BBM A;  2QEO A;  3D73 A;  4FQO A;  2LE9 B;  4HRH A;  2KI6 C;  4OV2 A;  1SR6 B;  3R1O A;  4MRY A;  1U5I A;  4PHJ A;  4YRU A;  3NGV A;  2GGZ A;  1L2O C;  1A29 A;  2JNF A;  3TUY C;  4I5N B;  1BR4 B;  1IIO A;  2Y5I A;  1YX7 A;  2L0P A;  1CLL A;  1SKT A;  4IL1 A;  1UHJ A;  2LUC A;  4MEW A;  1FW4 A;  2LP3 A;  1WRL A;  4ORB B;  3VGO A;  5G08 A;  3CLN A;  3D10 A;  1SCV A;  4GGF A;  1Y1X A;  2LVJ A;  3D0Y A;  3GOF A;  4C0L A;  2KNE A;  1YUT A;  1OZS A;  1B8R A;  1L7Z A;  4CID A;  1SSE B;  1SW8 A;  3AAJ A;  2BE4 A;  2KBI A;  1F4O A;  1XK4 A;  2WCL A;  2LMT A;  2F3Z A;  2MA2 A;  3TDZ A;  3CZ0 A;  1TWO A;  2P70 A;  2JT3 A;  4U8D A;  3A8R A;  1OMV A;  2PAS A;  1KWO C;  1S36 A;  2NZ0 A;  4JKT A;  5IBW A;  1PAL A;  1DF0 B;  1RWY A;  2ZFD A;  2O5G A;  3B88 A;  1QV0 A;  1Y1A A;  1F71 A;  5AAN A;  2M1U A;  5B8I B;  3SG6 A;  5HKY A;  2PSR A;  4PHM A;  2OTG C;  1XFZ O;  2MHH A;  5HLO A;  3SG3 A;  3DYE A;  2JXL A;  2JTZ A;  1XFW O;  1NX0 A;  2MLF C;  4L9M A;  1NPQ A;  1DT7 B;  2OPO A;  1TUJ A;  1UHN A;  5PAL A;  4N1G A;  2LUX A;  3I5G C;  3PSR A;  1M45 A;  1XO5 A;  1K94 A;  2HQW A;  3V2L A;  3WHT B;  3OX6 A;  3A4U B;  3D75 A;  1ZOT B;  1V1G A;  5F6T A;  2V53 A;  3KPX A;  3OP0 A;  1ALV A;  4DRW A;  2JOJ A;  3L47 A;  1R2U A;  2CT9 A;  3MSE B;  1BG1 A;  2KQY A;  1K90 D;  1JWD A;  1OSA A;  1K95 A;  4NDD A;  2PRU A;  1BMO A;  1IQ3 A;  2JNX A;  1K9P A;  1CFD A;  2ISD A;  1DJH A;  1G4Y R;  1IGV A;  5KU1 A;  1B8L A;  3N7H A;  4MZK A;  1NP8 A;  4XYN A;  3CZ2 A;  5D69 A;  3VB1 A;  1CDN A;  2I2R E;  1H8B A;  3EK7 A;  2JPO A;  4HSZ A;  5KSZ A;  3FWB A;  3BJH A;  5I8N A;  1CMF A;  3SIA A;  1CLB A;  1KCY A;  1LS8 A;  3PFV A;  2CTN A;  1MUX A;  1SL9 A;  2JTT A;  1DQE A;  1EG4 A;  1B8C A;  2BE6 A;  4JWQ A;  1KK8 C;  3BQ3 A;  3NSO A;  1B7T Y;  2KFH A;  3FE9 A;  1UHH A;  5CSF A;  3R72 A;  2KI4 C;  1QTX A;  5JJG A;  2SCP A;  1OZO A;  1JF2 A;  5AEQ A;  1HT9 A;  5ER4 X;  1QJT A;  1IG5 A;  3O2P A;  3TS5 B;  1KQM B;  1DJW A;  3H4S E;  1WY9 A;  1NUB A;  2F2O A;  5GQQ C;  4GFT A;  5HKW A;  1N65 A;  1QXP A;  3BUX B;  3CZT X;  1ORG A;  4MN0 A;  3BUN B;  3I5F C;  1CDM A;  1CDL A;  3PLF B;  5CSJ A;  3GK1 A;  1CTR A;  1B7T Z;  1SNL A;  2WCE A;  3ICB A;  2PMY A;  3WHU B;  1MWN A;  3OX5 A;  2EGD A;  1OMD A;  2ZN9 A;  3BYA A;  3SG7 A;  4BY4 A;  1BT6 A;  1AVS A;  1KFX S;  2M0R A;  1LVC D;  2LM5 A;  3NSI A;  2QEV A;  2TN4 A;  4AOM A;  2WC5 A;  1PK0 D;  2LVV A;  4E68 A;  4XJK B;  3S0A A;  1Z4H A;  1PVB A;  5J3X A;  2IS9 A;  2M49 B;  2KOT A;  1W9Z A;  3B6X A;  3EKH A;  3NXA A;  5FYX A;  1EJ3 A;  2L5X B;  1AP4 A;  1WLM A;  3LL8 B;  3LCP C;  2FOT A;  3TUY B;  3JVT B;  1GQM A;  2GTE A;  3SS5 A;  3WXA A;  1CB1 A;  1YUS A;  2KYC A;  1HQV A;  5I94 A;  1AUI B;  2BNX A;  2NCO A;  2M9G A;  1GM0 A;  1FBV A;  1OQP A;  5K89 A;  1B9A A;  1GGZ A;  5DKQ A;  4I5K A;  5JOL A;  3AAK A;  2K2F A;  4NDB A;  3BOW B;  3EG5 B;  1M63 B;  2ZRS A;  1ZMZ A;  2JC2 A;  2M8U A;  1JFJ A;  1RTP 1;  1TTX A;  3O4X A;  3OB1 B;  2ZKM X;  2ZNE A;  2K0J A;  2LLU A;  3DD4 A;  4YGA A;  2P6B B;  2OS8 B;  2WC8 A;  1CM1 A;  1DJX A;  4NQG A;  1F54 A;  2FJY A;  2LMU A;  1ZAC A;  3RLZ A;  3DF0 B;  2I94 A;  2QEH A;  3KO0 A;  1GGW A;  3FE8 A;  1LA3 A;  2M3W A;  2WCB A;  1IJ6 A;  1S26 D;  1FF1 A;  2LAP A;  1ZUZ A;  2LHL A;  1SK6 D;  1DC1 A;  1LXF C;  1UUR A;  2L51 A;  4YI9 A;  3I5H B;  1F70 A;  3I5I B;  3NHI A;  1NSH A;  5DIC A;  2CCM A;  1K9K A;  3PN7 B;  1NCY A;  1SY9 A;  1S5G Y;  1BLQ A;  1TCO B;  3Q8I A;  1MQ1 A;  1K2H A;  3ZNI A;  2BBN A;  2AMI A;  3LK1 A;  3SS3 A;  2LNK A;  1JSA A;  2M7L A;  2HET A;  3HCM A;  3BFA A;  2M7N A;  4MBE A;  1G8I A;  3EVV A;  1WDC C;  2KYF A;  1JFK A;  3PM8 A;  2BAP A;  3VRN A;  1EG3 A;  3FWC A;  2DOQ A;  5HL1 A;  1YRT B;  1Z2C B;  4DUQ A;  1EL4 A;  3VRR A;  1NX2 A;  2K2A A;  2L98 A;  1RJV A;  2F8P A;  3B7A A;  2HPS A; 
#chains in the Genus database with same CATH homology
 3CZ2 A;  3VB1 A;  1OW4 A;  2JPO A;  4FQT A;  3DZT A;  3BJH A;  3DXL A;  1LS8 A;  1DQE A;  3B86 A;  3D78 A;  2WCH A;  3BFB A;  3FE9 A;  3R72 A;  3L4L A;  3D74 A;  4OZD A;  2QEB A;  3CDN A;  1OOG A;  3DY9 A;  3QME A;  2WCK A;  3FE6 A;  1ORG A;  4INW A;  2WCM A;  3S0E A;  3BFH A;  1C3Y A;  3D73 A;  2QEO A;  3L4A A;  3R1O A;  3B87 A;  3NGV A;  1T14 A;  2QEV A;  2ERB A;  2WC5 A;  3S0A A;  3S0B A;  1OOH A;  3B6X A;  4JD9 A;  2QDI A;  3S0D A;  2WCJ A;  3CAB A;  2GTE A;  3CYZ A;  2H8V A;  3D77 A;  4F7F A;  1GM0 A;  3S0G A;  3D76 A;  2WC6 A;  2WCL A;  3K1E A;  3RZS A;  3CZ0 A;  1TWO A;  1C3Z A;  5EL2 A;  2P70 A;  3NHT A;  4PT1 A;  3R1V A;  1QWV A;  2FJY A;  3B88 A;  1OOI X;  2KPH A;  2QEH A;  3FE8 A;  3PJI A;  3CZ1 A;  3DYE A;  1OOF A;  3R1P A;  1TUJ A;  3NHI A;  5DIC A;  1P28 A;  3OGN A;  3Q8I A;  3V2L A;  3D75 A;  1XFR A;  2L2C A;  3BFA A;  4INX A;  3L47 A;  2P71 A;  3S0F A;  2PQL A;  3N7H A;  3B7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...