3D74A

Crystal structure of a pheromone binding protein mutant d35a, from apis mellifera, soaked at ph 5.5
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
119
structure length
119
Chain Sequence
APDWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVAKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone-binding protein ASP1
publication title Queen bee pheromone binding protein pH-induced domain swapping favors pheromone release
pubmed doi rcsb
source organism Apis mellifera
molecule tags Pheromone binding protein
total genus 37
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3d74A00
1XFRA 3B87A 1DQEA 3RZSA 3S0AA 2GTEA 3CZ1A 3R1VA 1T14A 2JPOA 1P28A 3BJHA 1TWOA 3S0GA 2ERBA 1TUJA 3D73A 2H8VA 3QMEA 4OZDA 1OOFA 2P71A 2WC5A 3FE8A 2WCKA 3R72A 3NHIA 3L4AA 3N7HA 3DZTA 3B86A 3FE6A 3FE9A 4INWA 3PJIA 1LS8A 3S0BA 3D74A 3CZ2A 3B7AA 2QDIA 2WCHA 1OOGA 3OGNA 3BFAA 3B6XA 3B88A 3CYZA 3L4LA 3D75A 1OOIX 3L47A 2QEVA 3CDNA 3S0DA 4JD9A 2QEOA 3NHTA 5EL2A 3R1PA 3D77A 3NGVA 4PT1A 2KPHA 1OOHA 1OW4A 3CABA 2WCMA 3DYEA 4INXA 4F7FA 3K1EA 3Q8IA 1C3YA 3DY9A 2WC6A 3V2LA 3S0EA 2P70A 3R1OA 2QEHA 3D78A 1ORGA 1QWVA 2QEBA 3CZ0A 1GM0A 2L2CA 1C3ZA 3D76A 2FJYA 3S0FA 3DXLA 2PQLA 5DICA 4FQTA 2WCLA 3VB1A 2WCJA 3BFBA 3BFHA
chains in the Genus database with same CATH superfamily
1TNQA 1DQEA 5JJGA 3PSRA 1TUZA 3S0AA 1KK8C 2K7DA 2LVKA 3SS4A 2JPOA 4P2YB 1IJ5A 4AQIA 1LVCD 2LVIA 3I5HB 3OHMB 2NCOA 5K89A 1TNXA 5DKNA 3TDIA 1K95A 1DT7B 3DVMA 1TNWA 4ICBA 1M45A 2HF5A 3GK2A 4FQOA 4PE1A 5D69A 4Q04A 3BOWA 3D73A 2MA2A 1XFZO 4NDBA 2F2OA 1RWYA 2D8NA 1MUXA 2P71A 2M8UA 4GNKB 2M29A 4XJKA 2LMUA 2ZKMX 2WCKA 3EK7A 1J7RA 1RTP1 3R72A 1F8HA 4IL1A 2O5GA 3N7HA 3O2PA 2JRFA 2ZNDA 3FE9A 3SS5A 1U5IB 1IG5A 1BMOA 1K9UA 1WLZA 1SR6B 2KYFA 2VRGA 2BKIB 1A29A 3D74A 3HCMA 4C0KA 2LLSA 2MBXA 3SS3A 2QDIA 3SG5A 4PE4A 1J7OA 3O78A 3OGNA 3OX5A 5HLOA 1QX5B 3SIBA 2OTGC 3TDZA 1PVBA 4PHMA 3B6XA 2BECA 2KAVA 4MSPA 1CFPA 1S5GZ 1WRLA 1Z4HA 2K0JA 1KK7Y 1G33A 2BBNA 2KAYA 3NSKA 2QEVA 4I5NB 1K2HA 1NSHA 1CB1A 1K93D 2CTNA 2KYCA 1YUTA 3ZWHA 2LMVA 5I8NA 1CDNA 1XFVO 2K61A 4YBHB 5CSFA 2HQWA 1BJFA 5CSIA 1R2UA 1L2OB 1DELA 1W7IB 2DOQA 5FYXA 1OW4A 1EXRA 1SNLA 1NX1A 4TNCA 1F55A 4YRUA 5FI2A 3AAKA 2CXJA 2GV5A 1RROA 1CNPA 3DYEA 1KQMB 2LHIA 1BF5A 4CIDA 1NYAA 3OP0A 4PHJA 2M9GA 1CFFA 3Q8IA 2KFGA 2BL0B 5AFPA 1JBAA 2LVVA 1X02A 1SYMA 3KEVA 1KQVA 3FWBA 1A75A 4JQ0D 5F6TA 3SIAA 1IQ5A 1C7WA 1M39A 2F3YA 2GGZA 2QPTA 3VROA 1NP8A 1UHHA 1TOPA 2PALA 3CR4X 5HYDA 2OPOA 1ZOTB 5HKZA 3JVTB 1SCMB 5HKWA 2OS8C 2M49B 1YVHA 1WRKA 1HQVA 1CLLA 1ALWA 2ZRSA 3CGAA 3SJSA 1YR5A 1GJYA 1R6PA 1SL9A 1XVJA 2NZ0A 1BODA 1NCZA 3O4YA 4USLA 5AXIA 1XFXO 2JXLA 4A4BA 1M63B 1N65A 4E68A 4PHNA 1DGVA 1EL4A 4WRIA 3CZTX 4WQ3A 1Y1XA 3AAJA 3EK8A 3LK0A 5HL1A 2KFHA 1YRUB 1CLMA 3I5IB 2WCJA 3BFBA 2PVBA 1CDPA 1JWDA 1G8IA 1QVIY 2WCBA 2LUXA 2V53A 4GFTA 1KWOB 3RZSA 1AVSA 3CS1A 1TNPA 1XK4C 2FOTA 1OZSA 2KGRA 3PM2A 1T14A 2K7OA 1KFXS 3JTDB 3NSOA 1NWDA 2BNXA 3LLEA 1P28A 2M0RA 3BUNB 1TWOA 2HPSA 2M7NA 2M1KB 2LHLA 2PSRA 1EH2A 1B9AA 2KFFA 1SK6D 2COLB 3S0GA 1W7JB 1ODBA 1QJTA 1XO5A 1F4QA 3I5HC 3PN7B 4A4CA 2G2BA 1TUJA 2LMTA 3TS5B 3NXAA 2H8VA 1OMDA 1UHIA 1BR1B 2RGIA 4WQ2A 4BY5A 1OOFA 5CSJA 1YUSA 2JC2A 3C1VA 2KQ6A 1GGWA 1A4PA 1IGVA 2I94A 3DVKA 4JWQA 4MN0A 2L4IA 4OR9B 3K21A 1IKUA 3LL8B 3PATA 3CR5X 1MF8B 2ISDA 1BU3A 1H8BA 3D0YA 2BKHB 4INWA 3KPXA 1LS8A 1PULA 1B8LA 1S1EA 1WDCB 2I7AA 1OE9B 1M46A 1N0YA 3CZ2A 4I5LB 4R1EA 3B7AA 1DJGA 1SR6C 1CTRA 2L98A 2WCHA 3PALA 1CFCA 1FPWA 2ZFDA 4QJ3B 1F4OA 3BFAA 1A2XA 2BCBA 3BUWB 4U8DA 3BOWB 3B88A 1MXEA 2I18A 4YGBB 3EKHA 3D75A 1S5GY 1SL8A 2H2KA 4XJKB 5ER4X 5IBWA 3L47A 4OKHA 3CDNA 1WY9A 4JD9A 3S0DA 1UHKA 4DUQA 1TTXA 1OMRA 2QEOA 1J7QA 1EJ3A 3OBVA 2ZN8A 2JT0A 2KGBC 1SY9A 3CLNA 3M0WA 1Y6WA 3NSIA 3RLZA 3WNXB 2NXQA 5BPJA 3DD4A 3VRNA 3HX4A 3ICBA 2SCPA 1YURA 4HREE 1YUUA 1L2OC 2WCMA 4F0ZB 4INXA 1V1GA 1SRAA 1TRFA 5I94A 1MR8A 4M2PA 1ZUZA 4F7FA 4MZJA 2B1UA 1AJ5A 1YRTB 3K1EA 4YI8A 2LP3A 1KSOA 1CDMA 1BLQA 4DCKA 1CMFA 3D10A 3DY9A 2BCXA 2WC6A 3V2LA 3F45A 5G08A 1KK8B 1SCVA 1CMGA 1RJVA 4PHKA 3VRRA 3EVUA 2M7LA 2PMYA 5D7FA 3S0EA 2P70A 5I2QA 2QACA 4JPZB 1QWVA 1NPQA 3KHEA 4C0LA 2PRUA 1BT6A 2KI6D 3JVTC 4QJ4B 1B47A 5KTYA 1JF0A 1K90D 2L2EA 3EKJA 4AQJA 4FTGA 1PRWA 2CBLA 2ZN9A 1UURA 3S0FA 3DXLA 3CWGA 3TUYB 1JC2A 2JWWA 1QS7A 1Y0VH 2JTZA 2KHNA 1IJ6A 3I5GC 1K9PA 1A75B 4M2QA 3GK1A 4NDDA 1YTZC 2BBMA 4QJ5B 5ER5A 1J1EA 2KAXA 1SL7A 2KOTA 3BFHA 2O60A 3I5IC 4HRHA 3DVEA 1K96A 1OQPA 1UWOA 4PE0A 2EHBA 1XFRA 1B7TZ 1QIWA 1DTLA 1RK9A 2K8MB 1YVLA 2L0PA 1DEKA 2Q4UA 3GK4X 1DJYA 4ZCVA 4MLWA 4CFQA 2NCPA 3VGOA 2MLEC 2A4JA 1AJ4A 3BJHA 1DJHA 1XFYO 1LA3A 5JOLA 1NUBA 1ZFSA 4JKTA 1L7ZA 1ZMZA 2HQ8A 4PALA 1C07A 2MAZA 2JZIA 4MZKA 5J3XA 1IWQA 3OB2B 1QASA 3PN7C 1K94A 2IS9A 5HKYA 4OZDA 1F54A 1SSEB 3OX6A 1LINA 2FJUB 2LLTA 2LAPA 1K9KA 2JT8A 1EG3A 3O6BA 4NDCA 3RM1A 3SG4A 1JF2A 2BE6A 5TNCA 3NHIA 1DF0B 1S6JA 3B86A 3FE6A 4AOMA 1DF0A 1PSRA 1QV1A 2KSPA 2Q91A 2KI4C 4OV2A 4YI9A 1F70A 1SBJA 1BOCA 1NCXA 4ETOA 2WORA 2G9BA 1QIVA 2M1UA 1B8RA 1OOGA 1SPYA 1Y1UA 2LVJA 3KO0A 1NX3A 4UPGA 2CCMA 4P5OE 4PE7A 5GQQC 3EK4A 1Q80A 3CYZA 2JOJA 1UP5A 2SASA 1OOIX 2L5YA 3CR2A 1SW8A 1KCYA 1VRKA 3PLFB 1AUIB 2K7BA 1NX0A 1JFKA 1XFUO 2EC6B 2KDHA 2WNDA 2LCPA 5EL2A 1PK0D 2FCEA 2P6BB 2WOSA 3TDUA 1JUOA 3LCPC 5FI7A 1DMOA 3MSEB 1GQMA 3D0YB 1H4BA 4CFRA 1C7VA 2KPHA 1ZACA 1B4CA 3IQOA 4XYNA 4D1EA 2LC5A 3VRPA 2I2RE 3BXKA 1AK8A 5KU1A 4DIRA 1TIZA 2FCDA 1FF1A 1LA0A 2PYQA 2AMIA 2BAPA 1PALA 2KLEA 1BR4B 1TCFA 3PFVA 2BE4A 2JNFA 1QXPA 3FS7A 2Y1MA 3FWCA 2MLFC 1QLSA 2L50A 3EVRA 1J1DA 3VRQA 1KFUL 1TCOB 4MZLA 1B1GA 1XK4A 3IF7A 2AUCA 2PASA 2F2PA 4CPVA 4MRYA 2K2FA 1S6CA 3D78A 1ORGA 1QTXA 1MWNA 2JTTA 1N2DA 1PSBA 2QEBA 1BG1A 1DJIA 5DKQA 3I5FB 1GM0A 1UHJA 1Y1AA 2R2IA 3AKBA 4GGFC 2H61C 3D76A 2LANA 1DJZA 4GGNA 3BQ3A 5I2LA 2PQLA 1XA5A 5DICA 4FQTA 1UHNA 3DF0B 1IQ3A 1IIOA 2JT3A 2ZRTA 3CTNA 3DF0A 3FIAA 2JNXA 1NX2A 4KYNA 1KQMC 3VB1A 2JXCA 3TUYC 4YGEB 3BYAA 2JPTA 2NLNA 2BL0C 1NIWA 3NSLA 1CKKA 4PCWA 4MRXA 2M97A 1B7TY 1E8AA 3DVJA 3B87A 2Y5IA 1DGUA 1OMVA 1Z2CB 2GTEA 3CZ1A 1M31A 3R1VA 1S26D 1SKTA 2CNPA 3PM8A 1U5IA 1PVAA 3A8RA 1S36A 2LP2A 1SCMC 4GUKA 4HSZA 5B8IB 1OOJA 4HRGA 1S3PA 1V1FA 4GBAA 5KSZA 2ERBA 2F33A 2KI6C 3GOFA 1XYDA 2K2AA 2MRDA 1FI5A 3LK1A 2WCFA 2K60A 3QMEA 5DKRA 3SG2A 4DRWA 5CPVA 2LM5A 2E6WA 2KBIA 3ZNIA 1J55A 2WC5A 4IJ7A 3FE8A 2LE9B 3WXAA 4MBEA 4MEWA 1LXFC 2KNEA 2GGMA 1KSMA 3L4AA 1D1OA 2EGDA 3DZTA 1WLMA 2KQYA 2F8PA 1XFWO 4NQGA 4GGFA 1ALVA 2H61A 2AAOA 1DJXA 4I5JA 1YX8A 1QX2A 1KWOC 3PJIA 3SG7A 4YGAA 1CFDA 4GAOA 5PALA 3S0BA 1RFJA 4BY4A 3SG6A 1DJWA 1UUSA 2OTGB 1LKJA 3EVVA 3JTDC 3EG5B 3E3RA 4ORCB 1JFJA 1WRZA 2E30A 1DC1A 1QLKA 2WC8A 5HLVA 5AEQA 2Y4QA 2TN4A 4C0JA 3L4LA 2BCAA 2LLUA 4I5KA 3TS5C 5FI6A 2LV7A 3OB1B 1CM1A 1KK7Z 2M3WA 1OZOA 3WHTB 2KBMA 3NHTA 2K7CA 3KF9A 4ZCUA 2LUCA 5AERA 2WCEA 3R1PA 1QV0A 1CLBA 3D77A 3NGVA 2EC6C 4YGCB 4PT1A 3SG3A 1B8CA 3TZ1A 3UO9A 1OOHA 1QATA 3CABA 2MHHA 1CDLA 1MHOA 3AKAA 3BUOB 3WHUB 1W9ZA 3I5GB 4N5XA 1OSAA 2F3ZA 4CLNA 1J7PA 1WDCC 4YGDB 1G4YR 4M2OA 1C3YA 2ZNEA 4N1FA 4OVNF 2CT9A 2JU0A 4ORBB 3QRXA 4GPLB 5I2OA 1GGZA 3IQQA 1F71A 2MJWB 1QX7A 2OS8B 4ORAB 3R1OA 3BUMB 2QEHA 4MVFA 4DS7A 2L5XB 4OCIA 5AANA 1JSAA 3UNWA 1S6IA 1HT9A 1K8UA 4PDZA 1RECA 1MXLC 1IRJA 3CZ0A 1FW4A 1CM4A 2L2CA 2JULA 1C3ZA 1KFUS 1YX7A 2L51A 1MQ1A 1EG4A 1DVIA 2FJYA 2YGUA 3IVTA 4L9MA 2JQ6A 2L4HA 1SMGA 2LNKA 3I5FC 3A4UB 1FI6A 1KFXL 2Y1NA 3O4XA 2WCLA 1NCYA 1AP4A 3BUXB 1AHRA 2HETA 5D3OA 5CSNA 1FBVA 4N1GA 1TN4A 1IH0A 1QVIZ 2KLDA 1A03A 3H4SE 2KI4B
chains in the Genus database with same CATH topology
1XFRA 3B87A 1DQEA 3RZSA 3S0AA 2GTEA 3CZ1A 3R1VA 1T14A 2JPOA 1P28A 3BJHA 1TWOA 3S0GA 2ERBA 1TUJA 3D73A 2H8VA 3QMEA 4OZDA 1OOFA 2P71A 2WC5A 3FE8A 2WCKA 3R72A 3NHIA 3L4AA 3N7HA 3DZTA 3B86A 3FE6A 3FE9A 4INWA 3PJIA 1LS8A 3S0BA 3D74A 3CZ2A 3B7AA 2QDIA 2WCHA 1OOGA 3OGNA 3BFAA 3B6XA 3B88A 3CYZA 3L4LA 3D75A 1OOIX 3L47A 2QEVA 3CDNA 3S0DA 4JD9A 2QEOA 3NHTA 5EL2A 3R1PA 3D77A 3NGVA 4PT1A 2KPHA 1OOHA 1OW4A 3CABA 2WCMA 3DYEA 4INXA 4F7FA 3K1EA 3Q8IA 1C3YA 3DY9A 2WC6A 3V2LA 3S0EA 2P70A 3R1OA 2QEHA 3D78A 1ORGA 1QWVA 2QEBA 3CZ0A 1GM0A 2L2CA 1C3ZA 3D76A 2FJYA 3S0FA 3DXLA 2PQLA 5DICA 4FQTA 2WCLA 3VB1A 2WCJA 3BFBA 3BFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XFR A;  3B87 A;  1DQE A;  3RZS A;  3S0A A;  2GTE A;  3CZ1 A;  3R1V A;  1T14 A;  2JPO A;  1P28 A;  3BJH A;  1TWO A;  3S0G A;  2ERB A;  1TUJ A;  3D73 A;  2H8V A;  3QME A;  4OZD A;  1OOF A;  2P71 A;  2WC5 A;  3FE8 A;  2WCK A;  3R72 A;  3NHI A;  3L4A A;  3N7H A;  3DZT A;  3B86 A;  3FE6 A;  3FE9 A;  4INW A;  3PJI A;  1LS8 A;  3S0B A;  3D74 A;  3CZ2 A;  3B7A A;  2QDI A;  2WCH A;  1OOG A;  3OGN A;  3BFA A;  3B6X A;  3B88 A;  3CYZ A;  3L4L A;  3D75 A;  1OOI X;  3L47 A;  2QEV A;  3CDN A;  3S0D A;  4JD9 A;  2QEO A;  3NHT A;  5EL2 A;  3R1P A;  3D77 A;  3NGV A;  4PT1 A;  2KPH A;  1OOH A;  1OW4 A;  3CAB A;  2WCM A;  3DYE A;  4INX A;  4F7F A;  3K1E A;  3Q8I A;  1C3Y A;  3DY9 A;  2WC6 A;  3V2L A;  3S0E A;  2P70 A;  3R1O A;  2QEH A;  3D78 A;  1ORG A;  1QWV A;  2QEB A;  3CZ0 A;  1GM0 A;  2L2C A;  1C3Z A;  3D76 A;  2FJY A;  3S0F A;  3DXL A;  2PQL A;  5DIC A;  4FQT A;  2WCL A;  3VB1 A;  2WCJ A;  3BFB A;  3BFH A; 
#chains in the Genus database with same CATH topology
 1TNQ A;  1DQE A;  5JJG A;  3PSR A;  1TUZ A;  3S0A A;  1KK8 C;  2K7D A;  2LVK A;  3SS4 A;  2JPO A;  4P2Y B;  1IJ5 A;  4AQI A;  1LVC D;  2LVI A;  3I5H B;  3OHM B;  2NCO A;  5K89 A;  1TNX A;  5DKN A;  3TDI A;  1K95 A;  1DT7 B;  3DVM A;  1TNW A;  4ICB A;  1M45 A;  2HF5 A;  3GK2 A;  4FQO A;  4PE1 A;  5D69 A;  4Q04 A;  3BOW A;  3D73 A;  2MA2 A;  1XFZ O;  4NDB A;  2F2O A;  1RWY A;  2D8N A;  1MUX A;  2P71 A;  2M8U A;  4GNK B;  2M29 A;  4XJK A;  2LMU A;  2ZKM X;  2WCK A;  3EK7 A;  1J7R A;  1RTP 1;  3R72 A;  1F8H A;  4IL1 A;  2O5G A;  3N7H A;  3O2P A;  2JRF A;  2ZND A;  3FE9 A;  3SS5 A;  1U5I B;  1IG5 A;  1BMO A;  1K9U A;  1WLZ A;  1SR6 B;  2KYF A;  2VRG A;  2BKI B;  1A29 A;  3D74 A;  3HCM A;  4C0K A;  2LLS A;  2MBX A;  3SS3 A;  2QDI A;  3SG5 A;  4PE4 A;  1J7O A;  3O78 A;  3OGN A;  3OX5 A;  5HLO A;  1QX5 B;  3SIB A;  2OTG C;  3TDZ A;  1PVB A;  4PHM A;  3B6X A;  2BEC A;  2KAV A;  4MSP A;  1CFP A;  1S5G Z;  1WRL A;  1Z4H A;  2K0J A;  1KK7 Y;  1G33 A;  2BBN A;  2KAY A;  3NSK A;  2QEV A;  4I5N B;  1K2H A;  1NSH A;  1CB1 A;  1K93 D;  2CTN A;  2KYC A;  1YUT A;  3ZWH A;  2LMV A;  5I8N A;  1CDN A;  1XFV O;  2K61 A;  4YBH B;  5CSF A;  2HQW A;  1BJF A;  5CSI A;  1R2U A;  1L2O B;  1DEL A;  1W7I B;  2DOQ A;  5FYX A;  1OW4 A;  1EXR A;  1SNL A;  1NX1 A;  4TNC A;  1F55 A;  4YRU A;  5FI2 A;  3AAK A;  2CXJ A;  2GV5 A;  1RRO A;  1CNP A;  3DYE A;  1KQM B;  2LHI A;  1BF5 A;  4CID A;  1NYA A;  3OP0 A;  4PHJ A;  2M9G A;  1CFF A;  3Q8I A;  2KFG A;  2BL0 B;  5AFP A;  1JBA A;  2LVV A;  1X02 A;  1SYM A;  3KEV A;  1KQV A;  3FWB A;  1A75 A;  4JQ0 D;  5F6T A;  3SIA A;  1IQ5 A;  1C7W A;  1M39 A;  2F3Y A;  2GGZ A;  2QPT A;  3VRO A;  1NP8 A;  1UHH A;  1TOP A;  2PAL A;  3CR4 X;  5HYD A;  2OPO A;  1ZOT B;  5HKZ A;  3JVT B;  1SCM B;  5HKW A;  2OS8 C;  2M49 B;  1YVH A;  1WRK A;  1HQV A;  1CLL A;  1ALW A;  2ZRS A;  3CGA A;  3SJS A;  1YR5 A;  1GJY A;  1R6P A;  1SL9 A;  1XVJ A;  2NZ0 A;  1BOD A;  1NCZ A;  3O4Y A;  4USL A;  5AXI A;  1XFX O;  2JXL A;  4A4B A;  1M63 B;  1N65 A;  4E68 A;  4PHN A;  1DGV A;  1EL4 A;  4WRI A;  3CZT X;  4WQ3 A;  1Y1X A;  3AAJ A;  3EK8 A;  3LK0 A;  5HL1 A;  2KFH A;  1YRU B;  1CLM A;  3I5I B;  2WCJ A;  3BFB A;  2PVB A;  1CDP A;  1JWD A;  1G8I A;  1QVI Y;  2WCB A;  2LUX A;  2V53 A;  4GFT A;  1KWO B;  3RZS A;  1AVS A;  3CS1 A;  1TNP A;  1XK4 C;  2FOT A;  1OZS A;  2KGR A;  3PM2 A;  1T14 A;  2K7O A;  1KFX S;  3JTD B;  3NSO A;  1NWD A;  2BNX A;  3LLE A;  1P28 A;  2M0R A;  3BUN B;  1TWO A;  2HPS A;  2M7N A;  2M1K B;  2LHL A;  2PSR A;  1EH2 A;  1B9A A;  2KFF A;  1SK6 D;  2COL B;  3S0G A;  1W7J B;  1ODB A;  1QJT A;  1XO5 A;  1F4Q A;  3I5H C;  3PN7 B;  4A4C A;  2G2B A;  1TUJ A;  2LMT A;  3TS5 B;  3NXA A;  2H8V A;  1OMD A;  1UHI A;  1BR1 B;  2RGI A;  4WQ2 A;  4BY5 A;  1OOF A;  5CSJ A;  1YUS A;  2JC2 A;  3C1V A;  2KQ6 A;  1GGW A;  1A4P A;  1IGV A;  2I94 A;  3DVK A;  4JWQ A;  4MN0 A;  2L4I A;  4OR9 B;  3K21 A;  1IKU A;  3LL8 B;  3PAT A;  3CR5 X;  1MF8 B;  2ISD A;  1BU3 A;  1H8B A;  3D0Y A;  2BKH B;  4INW A;  3KPX A;  1LS8 A;  1PUL A;  1B8L A;  1S1E A;  1WDC B;  2I7A A;  1OE9 B;  1M46 A;  1N0Y A;  3CZ2 A;  4I5L B;  4R1E A;  3B7A A;  1DJG A;  1SR6 C;  1CTR A;  2L98 A;  2WCH A;  3PAL A;  1CFC A;  1FPW A;  2ZFD A;  4QJ3 B;  1F4O A;  3BFA A;  1A2X A;  2BCB A;  3BUW B;  4U8D A;  3BOW B;  3B88 A;  1MXE A;  2I18 A;  4YGB B;  3EKH A;  3D75 A;  1S5G Y;  1SL8 A;  2H2K A;  4XJK B;  5ER4 X;  5IBW A;  3L47 A;  4OKH A;  3CDN A;  1WY9 A;  4JD9 A;  3S0D A;  1UHK A;  4DUQ A;  1TTX A;  1OMR A;  2QEO A;  1J7Q A;  1EJ3 A;  3OBV A;  2ZN8 A;  2JT0 A;  2KGB C;  1SY9 A;  3CLN A;  3M0W A;  1Y6W A;  3NSI A;  3RLZ A;  3WNX B;  2NXQ A;  5BPJ A;  3DD4 A;  3VRN A;  3HX4 A;  3ICB A;  2SCP A;  1YUR A;  4HRE E;  1YUU A;  1L2O C;  2WCM A;  4F0Z B;  4INX A;  1V1G A;  1SRA A;  1TRF A;  5I94 A;  1MR8 A;  4M2P A;  1ZUZ A;  4F7F A;  4MZJ A;  2B1U A;  1AJ5 A;  1YRT B;  3K1E A;  4YI8 A;  2LP3 A;  1KSO A;  1CDM A;  1BLQ A;  4DCK A;  1CMF A;  3D10 A;  3DY9 A;  2BCX A;  2WC6 A;  3V2L A;  3F45 A;  5G08 A;  1KK8 B;  1SCV A;  1CMG A;  1RJV A;  4PHK A;  3VRR A;  3EVU A;  2M7L A;  2PMY A;  5D7F A;  3S0E A;  2P70 A;  5I2Q A;  2QAC A;  4JPZ B;  1QWV A;  1NPQ A;  3KHE A;  4C0L A;  2PRU A;  1BT6 A;  2KI6 D;  3JVT C;  4QJ4 B;  1B47 A;  5KTY A;  1JF0 A;  1K90 D;  2L2E A;  3EKJ A;  4AQJ A;  4FTG A;  1PRW A;  2CBL A;  2ZN9 A;  1UUR A;  3S0F A;  3DXL A;  3CWG A;  3TUY B;  1JC2 A;  2JWW A;  1QS7 A;  1Y0V H;  2JTZ A;  2KHN A;  1IJ6 A;  3I5G C;  1K9P A;  1A75 B;  4M2Q A;  3GK1 A;  4NDD A;  1YTZ C;  2BBM A;  4QJ5 B;  5ER5 A;  1J1E A;  2KAX A;  1SL7 A;  2KOT A;  3BFH A;  2O60 A;  3I5I C;  4HRH A;  3DVE A;  1K96 A;  1OQP A;  1UWO A;  4PE0 A;  2EHB A;  1XFR A;  1B7T Z;  1QIW A;  1DTL A;  1RK9 A;  2K8M B;  1YVL A;  2L0P A;  1DEK A;  2Q4U A;  3GK4 X;  1DJY A;  4ZCV A;  4MLW A;  4CFQ A;  2NCP A;  3VGO A;  2MLE C;  2A4J A;  1AJ4 A;  3BJH A;  1DJH A;  1XFY O;  1LA3 A;  5JOL A;  1NUB A;  1ZFS A;  4JKT A;  1L7Z A;  1ZMZ A;  2HQ8 A;  4PAL A;  1C07 A;  2MAZ A;  2JZI A;  4MZK A;  5J3X A;  1IWQ A;  3OB2 B;  1QAS A;  3PN7 C;  1K94 A;  2IS9 A;  5HKY A;  4OZD A;  1F54 A;  1SSE B;  3OX6 A;  1LIN A;  2FJU B;  2LLT A;  2LAP A;  1K9K A;  2JT8 A;  1EG3 A;  3O6B A;  4NDC A;  3RM1 A;  3SG4 A;  1JF2 A;  2BE6 A;  5TNC A;  3NHI A;  1DF0 B;  1S6J A;  3B86 A;  3FE6 A;  4AOM A;  1DF0 A;  1PSR A;  1QV1 A;  2KSP A;  2Q91 A;  2KI4 C;  4OV2 A;  4YI9 A;  1F70 A;  1SBJ A;  1BOC A;  1NCX A;  4ETO A;  2WOR A;  2G9B A;  1QIV A;  2M1U A;  1B8R A;  1OOG A;  1SPY A;  1Y1U A;  2LVJ A;  3KO0 A;  1NX3 A;  4UPG A;  2CCM A;  4P5O E;  4PE7 A;  5GQQ C;  3EK4 A;  1Q80 A;  3CYZ A;  2JOJ A;  1UP5 A;  2SAS A;  1OOI X;  2L5Y A;  3CR2 A;  1SW8 A;  1KCY A;  1VRK A;  3PLF B;  1AUI B;  2K7B A;  1NX0 A;  1JFK A;  1XFU O;  2EC6 B;  2KDH A;  2WND A;  2LCP A;  5EL2 A;  1PK0 D;  2FCE A;  2P6B B;  2WOS A;  3TDU A;  1JUO A;  3LCP C;  5FI7 A;  1DMO A;  3MSE B;  1GQM A;  3D0Y B;  1H4B A;  4CFR A;  1C7V A;  2KPH A;  1ZAC A;  1B4C A;  3IQO A;  4XYN A;  4D1E A;  2LC5 A;  3VRP A;  2I2R E;  3BXK A;  1AK8 A;  5KU1 A;  4DIR A;  1TIZ A;  2FCD A;  1FF1 A;  1LA0 A;  2PYQ A;  2AMI A;  2BAP A;  1PAL A;  2KLE A;  1BR4 B;  1TCF A;  3PFV A;  2BE4 A;  2JNF A;  1QXP A;  3FS7 A;  2Y1M A;  3FWC A;  2MLF C;  1QLS A;  2L50 A;  3EVR A;  1J1D A;  3VRQ A;  1KFU L;  1TCO B;  4MZL A;  1B1G A;  1XK4 A;  3IF7 A;  2AUC A;  2PAS A;  2F2P A;  4CPV A;  4MRY A;  2K2F A;  1S6C A;  3D78 A;  1ORG A;  1QTX A;  1MWN A;  2JTT A;  1N2D A;  1PSB A;  2QEB A;  1BG1 A;  1DJI A;  5DKQ A;  3I5F B;  1GM0 A;  1UHJ A;  1Y1A A;  2R2I A;  3AKB A;  4GGF C;  2H61 C;  3D76 A;  2LAN A;  1DJZ A;  4GGN A;  3BQ3 A;  5I2L A;  2PQL A;  1XA5 A;  5DIC A;  4FQT A;  1UHN A;  3DF0 B;  1IQ3 A;  1IIO A;  2JT3 A;  2ZRT A;  3CTN A;  3DF0 A;  3FIA A;  2JNX A;  1NX2 A;  4KYN A;  1KQM C;  3VB1 A;  2JXC A;  3TUY C;  4YGE B;  3BYA A;  2JPT A;  2NLN A;  2BL0 C;  1NIW A;  3NSL A;  1CKK A;  4PCW A;  4MRX A;  2M97 A;  1B7T Y;  1E8A A;  3DVJ A;  3B87 A;  2Y5I A;  1DGU A;  1OMV A;  1Z2C B;  2GTE A;  3CZ1 A;  1M31 A;  3R1V A;  1S26 D;  1SKT A;  2CNP A;  3PM8 A;  1U5I A;  1PVA A;  3A8R A;  1S36 A;  2LP2 A;  1SCM C;  4GUK A;  4HSZ A;  5B8I B;  1OOJ A;  4HRG A;  1S3P A;  1V1F A;  4GBA A;  5KSZ A;  2ERB A;  2F33 A;  2KI6 C;  3GOF A;  1XYD A;  2K2A A;  2MRD A;  1FI5 A;  3LK1 A;  2WCF A;  2K60 A;  3QME A;  5DKR A;  3SG2 A;  4DRW A;  5CPV A;  2LM5 A;  2E6W A;  2KBI A;  3ZNI A;  1J55 A;  2WC5 A;  4IJ7 A;  3FE8 A;  2LE9 B;  3WXA A;  4MBE A;  4MEW A;  1LXF C;  2KNE A;  2GGM A;  1KSM A;  3L4A A;  1D1O A;  2EGD A;  3DZT A;  1WLM A;  2KQY A;  2F8P A;  1XFW O;  4NQG A;  4GGF A;  1ALV A;  2H61 A;  2AAO A;  1DJX A;  4I5J A;  1YX8 A;  1QX2 A;  1KWO C;  3PJI A;  3SG7 A;  4YGA A;  1CFD A;  4GAO A;  5PAL A;  3S0B A;  1RFJ A;  4BY4 A;  3SG6 A;  1DJW A;  1UUS A;  2OTG B;  1LKJ A;  3EVV A;  3JTD C;  3EG5 B;  3E3R A;  4ORC B;  1JFJ A;  1WRZ A;  2E30 A;  1DC1 A;  1QLK A;  2WC8 A;  5HLV A;  5AEQ A;  2Y4Q A;  2TN4 A;  4C0J A;  3L4L A;  2BCA A;  2LLU A;  4I5K A;  3TS5 C;  5FI6 A;  2LV7 A;  3OB1 B;  1CM1 A;  1KK7 Z;  2M3W A;  1OZO A;  3WHT B;  2KBM A;  3NHT A;  2K7C A;  3KF9 A;  4ZCU A;  2LUC A;  5AER A;  2WCE A;  3R1P A;  1QV0 A;  1CLB A;  3D77 A;  3NGV A;  2EC6 C;  4YGC B;  4PT1 A;  3SG3 A;  1B8C A;  3TZ1 A;  3UO9 A;  1OOH A;  1QAT A;  3CAB A;  2MHH A;  1CDL A;  1MHO A;  3AKA A;  3BUO B;  3WHU B;  1W9Z A;  3I5G B;  4N5X A;  1OSA A;  2F3Z A;  4CLN A;  1J7P A;  1WDC C;  4YGD B;  1G4Y R;  4M2O A;  1C3Y A;  2ZNE A;  4N1F A;  4OVN F;  2CT9 A;  2JU0 A;  4ORB B;  3QRX A;  4GPL B;  5I2O A;  1GGZ A;  3IQQ A;  1F71 A;  2MJW B;  1QX7 A;  2OS8 B;  4ORA B;  3R1O A;  3BUM B;  2QEH A;  4MVF A;  4DS7 A;  2L5X B;  4OCI A;  5AAN A;  1JSA A;  3UNW A;  1S6I A;  1HT9 A;  1K8U A;  4PDZ A;  1REC A;  1MXL C;  1IRJ A;  3CZ0 A;  1FW4 A;  1CM4 A;  2L2C A;  2JUL A;  1C3Z A;  1KFU S;  1YX7 A;  2L51 A;  1MQ1 A;  1EG4 A;  1DVI A;  2FJY A;  2YGU A;  3IVT A;  4L9M A;  2JQ6 A;  2L4H A;  1SMG A;  2LNK A;  3I5F C;  3A4U B;  1FI6 A;  1KFX L;  2Y1N A;  3O4X A;  2WCL A;  1NCY A;  1AP4 A;  3BUX B;  1AHR A;  2HET A;  5D3O A;  5CSN A;  1FBV A;  4N1G A;  1TN4 A;  1IH0 A;  1QVI Z;  2KLD A;  1A03 A;  3H4S E;  2KI4 B; 
#chains in the Genus database with same CATH homology
 1XFR A;  3B87 A;  1DQE A;  3RZS A;  3S0A A;  2GTE A;  3CZ1 A;  3R1V A;  1T14 A;  2JPO A;  1P28 A;  3BJH A;  1TWO A;  3S0G A;  2ERB A;  1TUJ A;  3D73 A;  2H8V A;  3QME A;  4OZD A;  1OOF A;  2P71 A;  2WC5 A;  3FE8 A;  2WCK A;  3R72 A;  3NHI A;  3L4A A;  3N7H A;  3DZT A;  3B86 A;  3FE6 A;  3FE9 A;  4INW A;  3PJI A;  1LS8 A;  3S0B A;  3D74 A;  3CZ2 A;  3B7A A;  2QDI A;  2WCH A;  1OOG A;  3OGN A;  3BFA A;  3B6X A;  3B88 A;  3CYZ A;  3L4L A;  3D75 A;  1OOI X;  3L47 A;  2QEV A;  3CDN A;  3S0D A;  4JD9 A;  2QEO A;  3NHT A;  5EL2 A;  3R1P A;  3D77 A;  3NGV A;  4PT1 A;  2KPH A;  1OOH A;  1OW4 A;  3CAB A;  2WCM A;  3DYE A;  4INX A;  4F7F A;  3K1E A;  3Q8I A;  1C3Y A;  3DY9 A;  2WC6 A;  3V2L A;  3S0E A;  2P70 A;  3R1O A;  2QEH A;  3D78 A;  1ORG A;  1QWV A;  2QEB A;  3CZ0 A;  1GM0 A;  2L2C A;  1C3Z A;  3D76 A;  2FJY A;  3S0F A;  3DXL A;  2PQL A;  5DIC A;  4FQT A;  2WCL A;  3VB1 A;  2WCJ A;  3BFB A;  3BFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...