3D74A

Crystal structure of a pheromone binding protein mutant d35a, from apis mellifera, soaked at ph 5.5
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
119
structure length
119
Chain Sequence
APDWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVAKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Pheromone binding protein
molecule keywords Pheromone-binding protein ASP1
publication title Queen bee pheromone binding protein pH-induced domain swapping favors pheromone release
pubmed doi rcsb
source organism Apis mellifera
total genus 37
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3d74A00
1OW4A 3BFHA 1C3YA 2H8VA 2WCMA 3NHTA 3CZ0A 3R72A 4JD9A 4FQTA 3CDNA 3BJHA 1LS8A 3CYZA 1QWVA 1OOFA 3L4AA 1C3ZA 2GTEA 2ERBA 2WC6A 3S0AA 1P28A 2WCJA 3DY9A 3PJIA 4INWA 2PQLA 2WC5A 3L4LA 3NHIA 3R1PA 3D74A 1OOIX 2P71A 3FE9A 1ORGA 1GM0A 3S0BA 3FE6A 3QMEA 3RZSA 3V2LA 3OGNA 3DYEA 2P70A 2QEHA 3VB1A 5EL2A 1TWOA 1TUJA 4OZDA 3NGVA 3S0GA 3BFBA 2WCKA 4F7FA 2KPHA 2QDIA 1T14A 2WCLA 3L47A 3N7HA 3R1VA 3B86A 4INXA 3BFAA 1XFRA 3DXLA 1OOHA 2QEBA 3S0FA 3D76A 2FJYA 3B87A 3CABA 3CZ1A 3D73A 1OOGA 3D78A 3R1OA 2JPOA 5DICA 2QEOA 2WCHA 3B7AA 3B88A 2QEVA 3B6XA 3D77A 3FE8A 2L2CA 1DQEA 3S0DA 3D75A 3DZTA 4PT1A 3Q8IA 3K1EA 3S0EA 3CZ2A
chains in the Genus database with same CATH superfamily
1WY9A 1H8BA 1G8IA 2H8VA 4GGNA 3NHTA 1Y6WA 2G9BA 4DIRA 3RLZA 1TIZA 2F2PA 5J3XA 3F45A 2H2KA 3CDNA 3BJHA 2PALA 1LS8A 4P5OE 3TZ1A 1QWVA 1OOFA 4CFRA 1J7PA 3L4AA 1QVIY 4MZKA 4PE0A 2KFHA 2LVJA 5HLOA 1M39A 2MRDA 2NLNA 3GK4X 2GTEA 3JTDC 1TOPA 3OP0A 1KK7Z 3IVTA 2BL0B 1EJ3A 2WC6A 5HYDA 3IQOA 2K8MB 3O4XA 1P28A 1SL9A 4NQGA 4C0JA 2EHBA 1WDCB 1GQMA 3DY9A 1FF1A 1BJFA 1D1OA 4OR9B 2PMYA 3L4LA 1CNPA 2YGUA 2JC2A 1Y1AA 4TNCA 1DC1A 1S6JA 2KBIA 3KPXA 3EG5B 1ODBA 2BNXA 1TRFA 2O5GA 5DKRA 1LXFC 2LHLA 2K2FA 1WRKA 1B47A 1M45A 3WHUB 2Q91A 4WQ2A 3EK7A 2M29A 3RZSA 3V2LA 2LV7A 4OVNF 4PHMA 3O4YA 1JFJA 3SIBA 1QIWA 1MR8A 2JU0A 1LINA 1F54A 1ZMZA 3VB1A 2QEHA 1PSRA 5B8IB 2MBXA 5DKNA 1CDPA 3EVUA 1WRLA 1KWOC 3DVKA 3VRPA 1NCZA 1TUJA 1CMGA 1ZACA 3S0GA 1M63B 3SG7A 1KCYA 3CR2A 4A4BA 1H4BA 2Y1NA 2HETA 3BFBA 3IF7A 1XFWO 2QACA 1HQVA 2LHIA 2WCKA 5FI7A 4F7FA 4PALA 2QPTA 5JJGA 2WCLA 1KK8C 2WCBA 1DGVA 3I5IC 2K0JA 3CWGA 4ORCB 4D1EA 2KAXA 4FTGA 1QS7A 1ALWA 1XFRA 4PHNA 3D76A 5JOLA 3PFVA 4XYNA 1J1DA 1UUSA 2KSPA 1Z2CB 3D73A 3O6BA 5KSZA 1OOGA 4BY5A 1XFZO 4GPLB 2E6WA 1RECA 2JPOA 1NX1A 5DICA 1KK7Y 3TS5B 2H61A 1BR4B 2QEOA 1K90D 1JUOA 1OE9B 3BYAA 1MXEA 1N0YA 1W7IB 3B88A 5GQQC 1FPWA 1IKUA 3NXAA 3B6XA 3SS4A 5I2OA 3S0DA 2OTGC 1YRTB 2H61C 3D75A 1BLQA 3WNXB 2JRFA 1J7OA 1A2XA 2LVVA 1WRZA 1DTLA 1IG5A 1PULA 3LL8B 4P2YB 3KF9A 2L98A 1K94A 2K7CA 2JTTA 4MSPA 2CNPA 2BBMA 2KNEA 2VRGA 3S0EA 3A8RA 5CSNA 1J7RA 1RFJA 1OMRA 2LP3A 3CZ2A 3TDIA 3I5FB 1LA3A 1XO5A 1NUBA 2K2AA 1F8HA 4DUQA 1IH0A 1C7WA 4CIDA 1J55A 2M8UA 2LVIA 3CZ0A 1JFKA 1Y1UA 1MUXA 1RTP1 1DJHA 2LLUA 3VRNA 1QTXA 1BU3A 1KFUL 2KI6D 2JT3A 1MHOA 2PRUA 3I5GB 3CYZA 2LCPA 2KFGA 1B8RA 1S5GZ 2LLTA 1C3ZA 4MRYA 4N5XA 5TNCA 3EVVA 1Y1XA 2M1KB 2WCEA 4YGDB 2ERBA 1QXPA 1RK9A 4OV2A 3SJSA 2ZFDA 2JWWA 1CB1A 1IRJA 1IGVA 2TN4A 3JVTB 4C0KA 2WCJA 3CLNA 1N2DA 4INWA 3GOFA 2OTGB 4MBEA 3AKAA 4NDBA 3FWCA 4YI9A 3PALA 5CSFA 1RROA 3CTNA 2B1UA 4GFTA 4DRWA 1PVAA 2CTNA 1SRAA 1BMOA 1DMOA 3FS7A 1DT7B 3DVJA 2MJWB 2A4JA 2P71A 3VRRA 1JBAA 1AJ4A 1WLZA 1ORGA 1NPQA 3D10A 1GM0A 1DJWA 3S0BA 2BBNA 4YBHB 1B9AA 2NCPA 1YVLA 3KEVA 1FBVA 1SY9A 3NSOA 4ZCUA 1F55A 1QIVA 1UHHA 2EC6C 5HLVA 1B7TZ 2JPTA 3ZWHA 1K8UA 1NSHA 4HREE 1K9UA 1YURA 3CR4X 2P70A 4YGBB 5AFPA 1F4OA 5KTYA 3FIAA 3AKBA 1WLMA 1E8AA 1OOJA 1YUUA 2L5XB 1KFXS 1SW8A 1IWQA 1RWYA 1F71A 4HRHA 3CS1A 4DCKA 1SSEB 4HSZA 1SNLA 1MXLC 3C1VA 2MLFC 4CFQA 1YX8A 2SASA 2KAVA 2BAPA 1CM1A 3IQQA 2QDIA 4FQOA 5I94A 2L4HA 1ZUZA 2D8NA 1LA0A 3A4UB 3AAJA 4OKHA 3EKJA 3SS3A 2MAZA 1K9PA 3TDZA 2LMVA 2KI4B 3NSIA 3VROA 1XFYO 2LVKA 1NX3A 2QEBA 3DXLA 1QLSA 3HCMA 4MZLA 3TS5C 5G08A 2R2IA 4ETOA 3B87A 3DD4A 2JULA 2Y4QA 3CABA 2BE6A 4QJ4B 3CZ1A 1S5GY 4PHKA 1XFVO 3LLEA 2WOSA 1SR6B 3D78A 2PVBA 1XVJA 2EC6B 1DF0B 1EXRA 2JXCA 1BG1A 2HQWA 2ZNEA 2F33A 1UHNA 2F3ZA 3B7AA 3NSKA 3O2PA 4UPGA 4M2OA 1BODA 4N1FA 2BE4A 2ZRSA 3OB1B 2PASA 3FE8A 1GJYA 2L2CA 4ORBB 2F3YA 4E68A 4NDCA 2RGIA 3I5FC 2FJUB 4M2QA 1TUZA 1TCOB 5HL1A 5PALA 2MA2A 1CKKA 2FOTA 3Q8IA 2LLSA 1IIOA 2AUCA 1CFCA 1IQ5A 2K61A 1QASA 2M1UA 2JTZA 3I5GC 3MSEB 3WXAA 1MF8B 1OW4A 1SYMA 4BY4A 3OX6A 1DELA 2LANA 3LK1A 3SG3A 1K9KA 1CM4A 3R72A 4JD9A 1DJZA 1L2OC 1YVHA 2I2RE 2Y5IA 2K7BA 2WCFA 2GGZA 4PDZA 5BPJA 1CDLA 1J1EA 1UHIA 4PE1A 5AANA 1S6CA 1NX2A 2KGRA 3JVTC 5F6TA 1Z4HA 3BUMB 1FW4A 2LUXA 1QATA 1NP8A 2GV5A 3BUXB 4GNKB 2M7LA 4AQJA 1NX0A 5K89A 2KQYA 2KYFA 2P6BB 3S0AA 1DJXA 4N1GA 2LAPA 1S1EA 5FI6A 1QVIZ 4MN0A 3PJIA 2PQLA 1TN4A 2M9GA 2Q4UA 3D0YA 5KU1A 3EK4A 2WC5A 2O60A 5CSJA 3NHIA 1A75A 1KQMB 1Q80A 1TNQA 1OOIX 4PHJA 4M2PA 1OZOA 3VRQA 1CLLA 1KFUS 5AERA 1AK8A 1EG4A 1IQ3A 1NCYA 3PM2A 1DEKA 3DF0A 1SK6D 2BECA 2JQ6A 3VGOA 1S26D 2M7NA 3K21A 3PLFB 1TNXA 3OGNA 4C0LA 4CLNA 1EH2A 5ER4X 1EG3A 2NXQA 3SG4A 1L2OB 2BCAA 2OS8B 3I5HB 2LM5A 4WRIA 1SPYA 1JF2A 1EL4A 1QX2A 1L7ZA 2COLB 4DS7A 4PE7A 4MRXA 4I5KA 1AP4A 1V1GA 3PATA 1B1GA 1F4QA 3CR5X 2F2OA 2KI4C 3BUNB 2L5YA 5CPVA 4QJ5B 4GBAA 4JPZB 1DF0A 4HRGA 4F0ZB 4QJ3B 1OZSA 1S3PA 1BR1B 2BKHB 2KPHA 1T14A 3PM8A 4ZCVA 3N7HA 1M31A 4INXA 1LKJA 1SR6C 2L2EA 1BT6A 1OOHA 2FCDA 4U8DA 3HX4A 3D0YB 1VRKA 4NDDA 3S0FA 1R6PA 2ZNDA 3BOWA 2KQ6A 2FJYA 3OX5A 3SS5A 2HQ8A 5HKWA 2ZRTA 1A03A 1OMVA 5I2LA 1A75B 2NCOA 2BKIB 1U5IA 1IJ5A 1MQ1A 3R1OA 4YGCB 1V1FA 2CBLA 4YGEB 1C07A 1YUSA 2KLDA 1G4YR 1PALA 1QLKA 3DF0B 2WCHA 3EVRA 1S6IA 1BOCA 1OMDA 2QEVA 3BUOB 1F70A 2CXJA 3BXKA 1QV1A 2JNFA 4YI8A 4CPVA 2L51A 4MLWA 2M97A 2L50A 4AOMA 1KSOA 3DZTA 4PT1A 3GK1A 4KYNA 1G33A 1UP5A 3UNWA 1TTXA 3K1EA 1DJYA 5D7FA 5I2QA 1XK4A 1OSAA 1K96A 1GGZA 1NYAA 2LMUA 1KFXL 3ICBA 2LUCA 3TUYC 2LE9B 4ORAB 2LP2A 3BFHA 1B4CA 3RM1A 1C3YA 2I94A 1B8CA 2WCMA 1YTZC 1XYDA 1R2UA 2WNDA 1XK4C 1CFPA 2KI6C 1CDMA 4FQTA 4JKTA 3CGAA 2HF5A 2KOTA 3SG6A 5FI2A 1PK0D 1KQVA 1NCXA 2KHNA 4USLA 1QX5B 4WQ3A 1JWDA 3PN7C 3DVEA 1JC2A 1FI6A 2LC5A 1HT9A 3BOWB 3O78A 4JQ0D 1UWOA 2MLEC 4IJ7A 5D69A 3PSRA 3EKHA 2ISDA 3SG5A 1A4PA 1KQMC 2KDHA 2WORA 1U5IB 2ZN8A 1K93D 1JF0A 1TNPA 2ZKMX 3CZTX 3LK0A 2JXLA 1SCMC 4YRUA 1QJTA 5D3OA 2OPOA 1XA5A 2ZN9A 1XFXO 1YX7A 3JTDB 3FWBA 2DOQA 3OBVA 4IL1A 1PSBA 1QV0A 1QX7A 4YGAA 1RJVA 2IS9A 2F8PA 1DJGA 1CDNA 4A4CA 3R1PA 3D74A 3WHTB 1B7TY 4XJKA 2OS8C 3I5HC 3FE9A 2AMIA 1ALVA 3TUYB 1CFFA 1M46A 3FE6A 1SKTA 3QMEA 3H4SE 4OCIA 5AXIA 2JT8A 4I5NB 4PCWA 4AQIA 1NWDA 2L0PA 5I8NA 3DYEA 1CFDA 2HPSA 3OB2B 2AAOA 4GGFA 2KBMA 5ER5A 3AAKA 4PE4A 4GUKA 1X02A 1AUIB 1SL8A 2JZIA 5EL2A 4I5LB 5AEQA 2L4IA 1TWOA 2KGBC 2M0RA 2I18A 3PN7B 2KYCA 1XFUO 2JNXA 3QRXA 2LMTA 1CLMA 4GGFC 4MVFA 5CSIA 4OZDA 2KAYA 3NGVA 5FYXA 3OHMB 1AVSA 1CLBA 1ZFSA 1IJ6A 2PSRA 1KWOB 1NIWA 3KHEA 1SCMB 5HKYA 1CMFA 1ZOTB 3L47A 1PVBA 1Y0VH 5HKZA 1C7VA 4Q04A 2JOJA 2V53A 3LCPC 4GAOA 3R1VA 3B86A 3BFAA 1J7QA 3TDUA 2KFFA 1PRWA 2GGMA 3DVMA 1DGUA 1SCVA 3E3RA 4I5JA 4L9MA 3SIAA 1K95A 1UHKA 1BF5A 1KK8B 4MZJA 3I5IB 2KLEA 3BQ3A 3UO9A 1YR5A 2PYQA 1TNWA 1K2HA 4XJKB 3EK8A 2K7DA 1DJIA 1B8LA 1KSMA 1S36A 3BUWB 2MHHA 3KO0A 1SMGA 3ZNIA 2BCBA 2BL0C 1SBJA 1YRUB 1DVIA 1OQPA 2FCEA 4ICBA 3GK2A 2SCPA 2E30A 1CTRA 2G2BA 1SL7A 2JT0A 3D77A 4JWQA 5IBWA 2NZ0A 1TCFA 1WDCC 1DQEA 2LNKA 3SG2A 1N65A 4MEWA 2K60A 1UHJA 2M3WA 2EGDA 2WC8A 1W9ZA 2CCMA 1AHRA 3M0WA 1YUTA 1FI5A 1W7JB 1LVCD 5DKQA 2I7AA 1MWNA 1UURA 4R1EA 2Y1MA 2M49B 2BCXA 2CT9A 2K7OA 3NSLA 1A29A 1GGWA 1JSAA 1AJ5A
chains in the Genus database with same CATH topology
1OW4A 3BFHA 1C3YA 2H8VA 2WCMA 3NHTA 3CZ0A 3R72A 4JD9A 4FQTA 3CDNA 3BJHA 1LS8A 3CYZA 1QWVA 1OOFA 3L4AA 1C3ZA 2GTEA 2ERBA 2WC6A 3S0AA 1P28A 2WCJA 3DY9A 3PJIA 4INWA 2PQLA 2WC5A 3L4LA 3NHIA 3R1PA 3D74A 1OOIX 2P71A 3FE9A 1ORGA 1GM0A 3S0BA 3FE6A 3QMEA 3RZSA 3V2LA 3OGNA 3DYEA 2P70A 2QEHA 3VB1A 5EL2A 1TWOA 1TUJA 4OZDA 3NGVA 3S0GA 3BFBA 2WCKA 4F7FA 2KPHA 2QDIA 1T14A 2WCLA 3L47A 3N7HA 3R1VA 3B86A 4INXA 3BFAA 1XFRA 3DXLA 1OOHA 2QEBA 3S0FA 3D76A 2FJYA 3B87A 3CABA 3CZ1A 3D73A 1OOGA 3D78A 3R1OA 2JPOA 5DICA 2QEOA 2WCHA 3B7AA 3B88A 2QEVA 3B6XA 3D77A 3FE8A 2L2CA 1DQEA 3S0DA 3D75A 3DZTA 4PT1A 3Q8IA 3K1EA 3S0EA 3CZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OW4 A;  3BFH A;  1C3Y A;  2H8V A;  2WCM A;  3NHT A;  3CZ0 A;  3R72 A;  4JD9 A;  4FQT A;  3CDN A;  3BJH A;  1LS8 A;  3CYZ A;  1QWV A;  1OOF A;  3L4A A;  1C3Z A;  2GTE A;  2ERB A;  2WC6 A;  3S0A A;  1P28 A;  2WCJ A;  3DY9 A;  3PJI A;  4INW A;  2PQL A;  2WC5 A;  3L4L A;  3NHI A;  3R1P A;  3D74 A;  1OOI X;  2P71 A;  3FE9 A;  1ORG A;  1GM0 A;  3S0B A;  3FE6 A;  3QME A;  3RZS A;  3V2L A;  3OGN A;  3DYE A;  2P70 A;  2QEH A;  3VB1 A;  5EL2 A;  1TWO A;  1TUJ A;  4OZD A;  3NGV A;  3S0G A;  3BFB A;  2WCK A;  4F7F A;  2KPH A;  2QDI A;  1T14 A;  2WCL A;  3L47 A;  3N7H A;  3R1V A;  3B86 A;  4INX A;  3BFA A;  1XFR A;  3DXL A;  1OOH A;  2QEB A;  3S0F A;  3D76 A;  2FJY A;  3B87 A;  3CAB A;  3CZ1 A;  3D73 A;  1OOG A;  3D78 A;  3R1O A;  2JPO A;  5DIC A;  2QEO A;  2WCH A;  3B7A A;  3B88 A;  2QEV A;  3B6X A;  3D77 A;  3FE8 A;  2L2C A;  1DQE A;  3S0D A;  3D75 A;  3DZT A;  4PT1 A;  3Q8I A;  3K1E A;  3S0E A;  3CZ2 A; 
#chains in the Genus database with same CATH topology
 1WY9 A;  1H8B A;  1G8I A;  2H8V A;  4GGN A;  3NHT A;  1Y6W A;  2G9B A;  4DIR A;  3RLZ A;  1TIZ A;  2F2P A;  5J3X A;  3F45 A;  2H2K A;  3CDN A;  3BJH A;  2PAL A;  1LS8 A;  4P5O E;  3TZ1 A;  1QWV A;  1OOF A;  4CFR A;  1J7P A;  3L4A A;  1QVI Y;  4MZK A;  4PE0 A;  2KFH A;  2LVJ A;  5HLO A;  1M39 A;  2MRD A;  2NLN A;  3GK4 X;  2GTE A;  3JTD C;  1TOP A;  3OP0 A;  1KK7 Z;  3IVT A;  2BL0 B;  1EJ3 A;  2WC6 A;  5HYD A;  3IQO A;  2K8M B;  3O4X A;  1P28 A;  1SL9 A;  4NQG A;  4C0J A;  2EHB A;  1WDC B;  1GQM A;  3DY9 A;  1FF1 A;  1BJF A;  1D1O A;  4OR9 B;  2PMY A;  3L4L A;  1CNP A;  2YGU A;  2JC2 A;  1Y1A A;  4TNC A;  1DC1 A;  1S6J A;  2KBI A;  3KPX A;  3EG5 B;  1ODB A;  2BNX A;  1TRF A;  2O5G A;  5DKR A;  1LXF C;  2LHL A;  2K2F A;  1WRK A;  1B47 A;  1M45 A;  3WHU B;  2Q91 A;  4WQ2 A;  3EK7 A;  2M29 A;  3RZS A;  3V2L A;  2LV7 A;  4OVN F;  4PHM A;  3O4Y A;  1JFJ A;  3SIB A;  1QIW A;  1MR8 A;  2JU0 A;  1LIN A;  1F54 A;  1ZMZ A;  3VB1 A;  2QEH A;  1PSR A;  5B8I B;  2MBX A;  5DKN A;  1CDP A;  3EVU A;  1WRL A;  1KWO C;  3DVK A;  3VRP A;  1NCZ A;  1TUJ A;  1CMG A;  1ZAC A;  3S0G A;  1M63 B;  3SG7 A;  1KCY A;  3CR2 A;  4A4B A;  1H4B A;  2Y1N A;  2HET A;  3BFB A;  3IF7 A;  1XFW O;  2QAC A;  1HQV A;  2LHI A;  2WCK A;  5FI7 A;  4F7F A;  4PAL A;  2QPT A;  5JJG A;  2WCL A;  1KK8 C;  2WCB A;  1DGV A;  3I5I C;  2K0J A;  3CWG A;  4ORC B;  4D1E A;  2KAX A;  4FTG A;  1QS7 A;  1ALW A;  1XFR A;  4PHN A;  3D76 A;  5JOL A;  3PFV A;  4XYN A;  1J1D A;  1UUS A;  2KSP A;  1Z2C B;  3D73 A;  3O6B A;  5KSZ A;  1OOG A;  4BY5 A;  1XFZ O;  4GPL B;  2E6W A;  1REC A;  2JPO A;  1NX1 A;  5DIC A;  1KK7 Y;  3TS5 B;  2H61 A;  1BR4 B;  2QEO A;  1K90 D;  1JUO A;  1OE9 B;  3BYA A;  1MXE A;  1N0Y A;  1W7I B;  3B88 A;  5GQQ C;  1FPW A;  1IKU A;  3NXA A;  3B6X A;  3SS4 A;  5I2O A;  3S0D A;  2OTG C;  1YRT B;  2H61 C;  3D75 A;  1BLQ A;  3WNX B;  2JRF A;  1J7O A;  1A2X A;  2LVV A;  1WRZ A;  1DTL A;  1IG5 A;  1PUL A;  3LL8 B;  4P2Y B;  3KF9 A;  2L98 A;  1K94 A;  2K7C A;  2JTT A;  4MSP A;  2CNP A;  2BBM A;  2KNE A;  2VRG A;  3S0E A;  3A8R A;  5CSN A;  1J7R A;  1RFJ A;  1OMR A;  2LP3 A;  3CZ2 A;  3TDI A;  3I5F B;  1LA3 A;  1XO5 A;  1NUB A;  2K2A A;  1F8H A;  4DUQ A;  1IH0 A;  1C7W A;  4CID A;  1J55 A;  2M8U A;  2LVI A;  3CZ0 A;  1JFK A;  1Y1U A;  1MUX A;  1RTP 1;  1DJH A;  2LLU A;  3VRN A;  1QTX A;  1BU3 A;  1KFU L;  2KI6 D;  2JT3 A;  1MHO A;  2PRU A;  3I5G B;  3CYZ A;  2LCP A;  2KFG A;  1B8R A;  1S5G Z;  2LLT A;  1C3Z A;  4MRY A;  4N5X A;  5TNC A;  3EVV A;  1Y1X A;  2M1K B;  2WCE A;  4YGD B;  2ERB A;  1QXP A;  1RK9 A;  4OV2 A;  3SJS A;  2ZFD A;  2JWW A;  1CB1 A;  1IRJ A;  1IGV A;  2TN4 A;  3JVT B;  4C0K A;  2WCJ A;  3CLN A;  1N2D A;  4INW A;  3GOF A;  2OTG B;  4MBE A;  3AKA A;  4NDB A;  3FWC A;  4YI9 A;  3PAL A;  5CSF A;  1RRO A;  3CTN A;  2B1U A;  4GFT A;  4DRW A;  1PVA A;  2CTN A;  1SRA A;  1BMO A;  1DMO A;  3FS7 A;  1DT7 B;  3DVJ A;  2MJW B;  2A4J A;  2P71 A;  3VRR A;  1JBA A;  1AJ4 A;  1WLZ A;  1ORG A;  1NPQ A;  3D10 A;  1GM0 A;  1DJW A;  3S0B A;  2BBN A;  4YBH B;  1B9A A;  2NCP A;  1YVL A;  3KEV A;  1FBV A;  1SY9 A;  3NSO A;  4ZCU A;  1F55 A;  1QIV A;  1UHH A;  2EC6 C;  5HLV A;  1B7T Z;  2JPT A;  3ZWH A;  1K8U A;  1NSH A;  4HRE E;  1K9U A;  1YUR A;  3CR4 X;  2P70 A;  4YGB B;  5AFP A;  1F4O A;  5KTY A;  3FIA A;  3AKB A;  1WLM A;  1E8A A;  1OOJ A;  1YUU A;  2L5X B;  1KFX S;  1SW8 A;  1IWQ A;  1RWY A;  1F71 A;  4HRH A;  3CS1 A;  4DCK A;  1SSE B;  4HSZ A;  1SNL A;  1MXL C;  3C1V A;  2MLF C;  4CFQ A;  1YX8 A;  2SAS A;  2KAV A;  2BAP A;  1CM1 A;  3IQQ A;  2QDI A;  4FQO A;  5I94 A;  2L4H A;  1ZUZ A;  2D8N A;  1LA0 A;  3A4U B;  3AAJ A;  4OKH A;  3EKJ A;  3SS3 A;  2MAZ A;  1K9P A;  3TDZ A;  2LMV A;  2KI4 B;  3NSI A;  3VRO A;  1XFY O;  2LVK A;  1NX3 A;  2QEB A;  3DXL A;  1QLS A;  3HCM A;  4MZL A;  3TS5 C;  5G08 A;  2R2I A;  4ETO A;  3B87 A;  3DD4 A;  2JUL A;  2Y4Q A;  3CAB A;  2BE6 A;  4QJ4 B;  3CZ1 A;  1S5G Y;  4PHK A;  1XFV O;  3LLE A;  2WOS A;  1SR6 B;  3D78 A;  2PVB A;  1XVJ A;  2EC6 B;  1DF0 B;  1EXR A;  2JXC A;  1BG1 A;  2HQW A;  2ZNE A;  2F33 A;  1UHN A;  2F3Z A;  3B7A A;  3NSK A;  3O2P A;  4UPG A;  4M2O A;  1BOD A;  4N1F A;  2BE4 A;  2ZRS A;  3OB1 B;  2PAS A;  3FE8 A;  1GJY A;  2L2C A;  4ORB B;  2F3Y A;  4E68 A;  4NDC A;  2RGI A;  3I5F C;  2FJU B;  4M2Q A;  1TUZ A;  1TCO B;  5HL1 A;  5PAL A;  2MA2 A;  1CKK A;  2FOT A;  3Q8I A;  2LLS A;  1IIO A;  2AUC A;  1CFC A;  1IQ5 A;  2K61 A;  1QAS A;  2M1U A;  2JTZ A;  3I5G C;  3MSE B;  3WXA A;  1MF8 B;  1OW4 A;  1SYM A;  4BY4 A;  3OX6 A;  1DEL A;  2LAN A;  3LK1 A;  3SG3 A;  1K9K A;  1CM4 A;  3R72 A;  4JD9 A;  1DJZ A;  1L2O C;  1YVH A;  2I2R E;  2Y5I A;  2K7B A;  2WCF A;  2GGZ A;  4PDZ A;  5BPJ A;  1CDL A;  1J1E A;  1UHI A;  4PE1 A;  5AAN A;  1S6C A;  1NX2 A;  2KGR A;  3JVT C;  5F6T A;  1Z4H A;  3BUM B;  1FW4 A;  2LUX A;  1QAT A;  1NP8 A;  2GV5 A;  3BUX B;  4GNK B;  2M7L A;  4AQJ A;  1NX0 A;  5K89 A;  2KQY A;  2KYF A;  2P6B B;  3S0A A;  1DJX A;  4N1G A;  2LAP A;  1S1E A;  5FI6 A;  1QVI Z;  4MN0 A;  3PJI A;  2PQL A;  1TN4 A;  2M9G A;  2Q4U A;  3D0Y A;  5KU1 A;  3EK4 A;  2WC5 A;  2O60 A;  5CSJ A;  3NHI A;  1A75 A;  1KQM B;  1Q80 A;  1TNQ A;  1OOI X;  4PHJ A;  4M2P A;  1OZO A;  3VRQ A;  1CLL A;  1KFU S;  5AER A;  1AK8 A;  1EG4 A;  1IQ3 A;  1NCY A;  3PM2 A;  1DEK A;  3DF0 A;  1SK6 D;  2BEC A;  2JQ6 A;  3VGO A;  1S26 D;  2M7N A;  3K21 A;  3PLF B;  1TNX A;  3OGN A;  4C0L A;  4CLN A;  1EH2 A;  5ER4 X;  1EG3 A;  2NXQ A;  3SG4 A;  1L2O B;  2BCA A;  2OS8 B;  3I5H B;  2LM5 A;  4WRI A;  1SPY A;  1JF2 A;  1EL4 A;  1QX2 A;  1L7Z A;  2COL B;  4DS7 A;  4PE7 A;  4MRX A;  4I5K A;  1AP4 A;  1V1G A;  3PAT A;  1B1G A;  1F4Q A;  3CR5 X;  2F2O A;  2KI4 C;  3BUN B;  2L5Y A;  5CPV A;  4QJ5 B;  4GBA A;  4JPZ B;  1DF0 A;  4HRG A;  4F0Z B;  4QJ3 B;  1OZS A;  1S3P A;  1BR1 B;  2BKH B;  2KPH A;  1T14 A;  3PM8 A;  4ZCV A;  3N7H A;  1M31 A;  4INX A;  1LKJ A;  1SR6 C;  2L2E A;  1BT6 A;  1OOH A;  2FCD A;  4U8D A;  3HX4 A;  3D0Y B;  1VRK A;  4NDD A;  3S0F A;  1R6P A;  2ZND A;  3BOW A;  2KQ6 A;  2FJY A;  3OX5 A;  3SS5 A;  2HQ8 A;  5HKW A;  2ZRT A;  1A03 A;  1OMV A;  5I2L A;  1A75 B;  2NCO A;  2BKI B;  1U5I A;  1IJ5 A;  1MQ1 A;  3R1O A;  4YGC B;  1V1F A;  2CBL A;  4YGE B;  1C07 A;  1YUS A;  2KLD A;  1G4Y R;  1PAL A;  1QLK A;  3DF0 B;  2WCH A;  3EVR A;  1S6I A;  1BOC A;  1OMD A;  2QEV A;  3BUO B;  1F70 A;  2CXJ A;  3BXK A;  1QV1 A;  2JNF A;  4YI8 A;  4CPV A;  2L51 A;  4MLW A;  2M97 A;  2L50 A;  4AOM A;  1KSO A;  3DZT A;  4PT1 A;  3GK1 A;  4KYN A;  1G33 A;  1UP5 A;  3UNW A;  1TTX A;  3K1E A;  1DJY A;  5D7F A;  5I2Q A;  1XK4 A;  1OSA A;  1K96 A;  1GGZ A;  1NYA A;  2LMU A;  1KFX L;  3ICB A;  2LUC A;  3TUY C;  2LE9 B;  4ORA B;  2LP2 A;  3BFH A;  1B4C A;  3RM1 A;  1C3Y A;  2I94 A;  1B8C A;  2WCM A;  1YTZ C;  1XYD A;  1R2U A;  2WND A;  1XK4 C;  1CFP A;  2KI6 C;  1CDM A;  4FQT A;  4JKT A;  3CGA A;  2HF5 A;  2KOT A;  3SG6 A;  5FI2 A;  1PK0 D;  1KQV A;  1NCX A;  2KHN A;  4USL A;  1QX5 B;  4WQ3 A;  1JWD A;  3PN7 C;  3DVE A;  1JC2 A;  1FI6 A;  2LC5 A;  1HT9 A;  3BOW B;  3O78 A;  4JQ0 D;  1UWO A;  2MLE C;  4IJ7 A;  5D69 A;  3PSR A;  3EKH A;  2ISD A;  3SG5 A;  1A4P A;  1KQM C;  2KDH A;  2WOR A;  1U5I B;  2ZN8 A;  1K93 D;  1JF0 A;  1TNP A;  2ZKM X;  3CZT X;  3LK0 A;  2JXL A;  1SCM C;  4YRU A;  1QJT A;  5D3O A;  2OPO A;  1XA5 A;  2ZN9 A;  1XFX O;  1YX7 A;  3JTD B;  3FWB A;  2DOQ A;  3OBV A;  4IL1 A;  1PSB A;  1QV0 A;  1QX7 A;  4YGA A;  1RJV A;  2IS9 A;  2F8P A;  1DJG A;  1CDN A;  4A4C A;  3R1P A;  3D74 A;  3WHT B;  1B7T Y;  4XJK A;  2OS8 C;  3I5H C;  3FE9 A;  2AMI A;  1ALV A;  3TUY B;  1CFF A;  1M46 A;  3FE6 A;  1SKT A;  3QME A;  3H4S E;  4OCI A;  5AXI A;  2JT8 A;  4I5N B;  4PCW A;  4AQI A;  1NWD A;  2L0P A;  5I8N A;  3DYE A;  1CFD A;  2HPS A;  3OB2 B;  2AAO A;  4GGF A;  2KBM A;  5ER5 A;  3AAK A;  4PE4 A;  4GUK A;  1X02 A;  1AUI B;  1SL8 A;  2JZI A;  5EL2 A;  4I5L B;  5AEQ A;  2L4I A;  1TWO A;  2KGB C;  2M0R A;  2I18 A;  3PN7 B;  2KYC A;  1XFU O;  2JNX A;  3QRX A;  2LMT A;  1CLM A;  4GGF C;  4MVF A;  5CSI A;  4OZD A;  2KAY A;  3NGV A;  5FYX A;  3OHM B;  1AVS A;  1CLB A;  1ZFS A;  1IJ6 A;  2PSR A;  1KWO B;  1NIW A;  3KHE A;  1SCM B;  5HKY A;  1CMF A;  1ZOT B;  3L47 A;  1PVB A;  1Y0V H;  5HKZ A;  1C7V A;  4Q04 A;  2JOJ A;  2V53 A;  3LCP C;  4GAO A;  3R1V A;  3B86 A;  3BFA A;  1J7Q A;  3TDU A;  2KFF A;  1PRW A;  2GGM A;  3DVM A;  1DGU A;  1SCV A;  3E3R A;  4I5J A;  4L9M A;  3SIA A;  1K95 A;  1UHK A;  1BF5 A;  1KK8 B;  4MZJ A;  3I5I B;  2KLE A;  3BQ3 A;  3UO9 A;  1YR5 A;  2PYQ A;  1TNW A;  1K2H A;  4XJK B;  3EK8 A;  2K7D A;  1DJI A;  1B8L A;  1KSM A;  1S36 A;  3BUW B;  2MHH A;  3KO0 A;  1SMG A;  3ZNI A;  2BCB A;  2BL0 C;  1SBJ A;  1YRU B;  1DVI A;  1OQP A;  2FCE A;  4ICB A;  3GK2 A;  2SCP A;  2E30 A;  1CTR A;  2G2B A;  1SL7 A;  2JT0 A;  3D77 A;  4JWQ A;  5IBW A;  2NZ0 A;  1TCF A;  1WDC C;  1DQE A;  2LNK A;  3SG2 A;  1N65 A;  4MEW A;  2K60 A;  1UHJ A;  2M3W A;  2EGD A;  2WC8 A;  1W9Z A;  2CCM A;  1AHR A;  3M0W A;  1YUT A;  1FI5 A;  1W7J B;  1LVC D;  5DKQ A;  2I7A A;  1MWN A;  1UUR A;  4R1E A;  2Y1M A;  2M49 B;  2BCX A;  2CT9 A;  2K7O A;  3NSL A;  1A29 A;  1GGW A;  1JSA A;  1AJ5 A; 
#chains in the Genus database with same CATH homology
 1OW4 A;  3BFH A;  1C3Y A;  2H8V A;  2WCM A;  3NHT A;  3CZ0 A;  3R72 A;  4JD9 A;  4FQT A;  3CDN A;  3BJH A;  1LS8 A;  3CYZ A;  1QWV A;  1OOF A;  3L4A A;  1C3Z A;  2GTE A;  2ERB A;  2WC6 A;  3S0A A;  1P28 A;  2WCJ A;  3DY9 A;  3PJI A;  4INW A;  2PQL A;  2WC5 A;  3L4L A;  3NHI A;  3R1P A;  3D74 A;  1OOI X;  2P71 A;  3FE9 A;  1ORG A;  1GM0 A;  3S0B A;  3FE6 A;  3QME A;  3RZS A;  3V2L A;  3OGN A;  3DYE A;  2P70 A;  2QEH A;  3VB1 A;  5EL2 A;  1TWO A;  1TUJ A;  4OZD A;  3NGV A;  3S0G A;  3BFB A;  2WCK A;  4F7F A;  2KPH A;  2QDI A;  1T14 A;  2WCL A;  3L47 A;  3N7H A;  3R1V A;  3B86 A;  4INX A;  3BFA A;  1XFR A;  3DXL A;  1OOH A;  2QEB A;  3S0F A;  3D76 A;  2FJY A;  3B87 A;  3CAB A;  3CZ1 A;  3D73 A;  1OOG A;  3D78 A;  3R1O A;  2JPO A;  5DIC A;  2QEO A;  2WCH A;  3B7A A;  3B88 A;  2QEV A;  3B6X A;  3D77 A;  3FE8 A;  2L2C A;  1DQE A;  3S0D A;  3D75 A;  3DZT A;  4PT1 A;  3Q8I A;  3K1E A;  3S0E A;  3CZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...