5I2LA

Structure of ef-hand containing protein
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
105
structure length
105
Chain Sequence
FNPYTEFKEFSRKQIKDMEKMFKQYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDFDSKLSFREFLLIFRKAAAGELQEDSGLCVLARLSEIDVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EF-hand domain-containing protein D2
publication title Structural implications of Ca(2+)-dependent actin-bundling function of human EFhd2/Swiprosin-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 33
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2016-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5i2lA00
4ORAB 2KQYA 3I5IB 3CR5X 4ORCB 1IWQA 1WDCB 3EVRA 2KAVA 2JQ6A 2BKIB 2M29A 4OR9B 2TN4A 1CKKA 4I5NB 1CDPA 1F55A 1JWDA 2JT8A 4GUKA 4MBEA 1ALVA 1OQPA 1TN4A 1DGUA 2BKHB 4NDDA 2O60A 1MF8B 1EJ3A 1QV1A 5AERA 1YUSA 1AP4A 1F54A 4OCIA 2E6WA 3GK1A 2KAYA 1WY9A 2Q4UA 4A4BA 5I2QA 1Q80A 2JWWA 1C07A 1MXLC 1EG4A 2Y4QA 1IH0A 2KBIA 1N65A 2KFFA 1N0YA 1ZUZA 1PVAA 2L50A 2F2OA 2HQ8A 1A75A 1F4QA 1KK7Z 2PVBA 1XYDA 1M39A 5B8IB 2GGZA 1TCOB 3JTDC 1A2XA 2K2FA 2MAZA 3K21A 2ZFDA 1OSAA 1BLQA 3OP0A 1KK8B 2EC6B 1GGWA 1BU3A 3GOFA 1NX2A 4MZLA 1KWOC 4PHKA 1H4BA 1JF0A 1JC2A 3TDZA 2LVJA 5CSJA 1W7JB 4JQ0D 1NIWA 1KCYA 1BF5A 1M63B 1H8BA 3DVKA 4CPVA 4GBAA 3EVVA 2OTGC 1B4CA 5J3XA 1LINA 5HYDA 2KI4C 1NUBA 2KDHA 5DKRA 2ZNDA 3H4SE 4PE4A 1KK7Y 4OVNF 3PFVA 1XFZO 4PE1A 2LAPA 1NSHA 1YRTB 3EK4A 4PE7A 2MBXA 2WCEA 5KSZA 1FBVA 1QTXA 4DRWA 2D8NA 2MLEC 2M3WA 1A4PA 2ZN9A 2ZRTA 3M0WA 3C1VA 1YTZC 2WCBA 1IKUA 2K7DA 1PVBA 2ZRSA 1TRFA 2ZNEA 1TNQA 1UHJA 1UHHA 3SIBA 4HREE 4XJKA 4I5KA 4FTGA 3OB2B 2BBNA 1CNPA 2NZ0A 4OKHA 4L9MA 2JULA 4MN0A 3QRXA 2Q91A 3AAJA 2JU0A 1QASA 2JNXA 3BOWA 3KHEA 3NSIA 4AQJA 1K2HA 3JTDB 2M1UA 1EXRA 3BUXB 2LC5A 3BYAA 2KFHA 1LKJA 1AJ4A 1MR8A 4JPZB 5PALA 2FOTA 2M7NA 3SG7A 1QX7A 2WCFA 1KWOB 4MZJA 1XFYO 2KI6D 1JFJA 1HT9A 1SK6D 1UHKA 2BE6A 2SCPA 1A75B 1QXPA 1M31A 4YBHB 4M2QA 2KNEA 2V53A 2NXQA 2KI4B 1G33A 1IQ5A 1F71A 1BOCA 3IQQA 5I8NA 3AKBA 1WRZA 1C7WA 1DMOA 1SPYA 2LP3A 4TNCA 3CS1A 1IJ5A 4MVFA 2QPTA 1QV0A 3SIAA 1TTXA 2L4IA 1KFUL 1XK4A 1S36A 4IL1A 2P6BB 1TIZA 2K7OA 3BUOB 2HQWA 2F33A 4DUQA 2M1KB 1CTRA 2JXCA 4YGDB 1LA0A 3O6BA 3CR2A 5KTYA 1YRUB 1U5IA 1X02A 4GGFA 5IBWA 4N1GA 4R1EA 1B8LA 2B1UA 4GGNA 1JFKA 2LE9B 3LK1A 1XK4C 4DS7A 3F45A 1F70A 2WNDA 2CT9A 3D10A 1K9UA 2BBMA 2BCBA 3TUYB 2F3YA 1UHIA 1RFJA 1GJYA 1QLKA 4BY4A 1M45A 3FWCA 4MRXA 4P5OE 1FW4A 1A29A 3SG6A 1L7ZA 1DJIA 5G08A 2LMUA 1B8CA 2SASA 1FI6A 3ZNIA 1NP8A 4QJ4B 2K7CA 1A03A 4GGFC 1EL4A 4XJKB 1CMFA 1ODBA 3TDIA 4NDCA 2LV7A 1DVIA 3OHMB 4YGBB 3NXAA 1WLMA 2DOQA 1K93D 1IRJA 2I94A 3I5HB 1AHRA 3BOWB 3BUWB 3O78A 1NPQA 2E30A 1NCXA 1CM1A 5HKYA 1EH2A 2NLNA 1F8HA 1K9KA 2PRUA 1S6CA 3SJSA 4YI8A 4XYNA 3I5FC 2JTTA 4Q04A 3EK8A 1SR6B 1CFPA 2CBLA 2BL0C 2K7BA 1QIVA 2Y1NA 1CFCA 3WHTB 2LHIA 3BQ3A 3VRRA 2KYFA 4QJ5B 1ZFSA 1DJXA 3DVEA 1IGVA 2JOJA 2JZIA 4YGAA 1FPWA 2CTNA 5D69A 1K95A 2F3ZA 2I7AA 1JUOA 2LP2A 2QACA 1RTP1 1V1GA 4DIRA 2F8PA 2HETA 3SG4A 3PLFB 4CFQA 1J7PA 2M8UA 2JXLA 1G4YR 1PALA 4PE0A 1DJWA 2PMYA 5JJGA 1NWDA 1IG5A 1S1EA 3D0YA 1B1GA 4GPLB 5CPVA 1XFUO 1QLSA 2IS9A 2HF5A 2KGRA 1Y1XA 1MWNA 2CXJA 3IF7A 2MA2A 2ZKMX 5AFPA 2MJWB 3IQOA 3I5GC 2LCPA 1KQMC 2JC2A 1BODA 1QS7A 1L2OC 1U5IB 1UUSA 1YVLA 4HSZA 4MSPA 1G8IA 1YX8A 2AUCA 2L4HA 1OZOA 2L0PA 3HX4A 1SW8A 4JWQA 3FWBA 3O4YA 5TNCA 1LVCD 4MRYA 3PM8A 3CR4X 4PALA 2G2BA 1PULA 2F2PA 4WQ3A 2JTZA 2LLSA 4N5XA 1OMDA 5HKWA 1NCYA 1S26D 1V1FA 2A4JA 2KSPA 3CGAA 1SCMC 1WRLA 4F0ZB 1YR5A 2G9BA 3PN7C 1IQ3A 1WLZA 1BG1A 2FCDA 5JOLA 3CWGA 3SG3A 3AKAA 4NQGA 5HLOA 4UPGA 1CDMA 4I5LB 5FYXA 3I5FB 1YX7A 4ZCVA 3KPXA 2LLTA 4WRIA 1PSBA 1DT7B 2OTGB 2PSRA 3ICBA 3KF9A 1AK8A 1S3PA 1RROA 5DKQA 5K89A 2KQ6A 3EKJA 1AUIB 1MHOA 4AOMA 1J1EA 3LL8B 2O5GA 3E3RA 4ORBB 1XA5A 1NCZA 3OB1B 1OMRA 3PATA 1AJ5A 1DJGA 1RJVA 2M9GA 4A4CA 2OPOA 1ZOTB 4BY5A 2KHNA 3AAKA 1BR1B 3A8RA 1PK0D 2LANA 1S5GY 1NX0A 3JVTC 2LVIA 5BPJA 4PCWA 2R2IA 3OX5A 2EC6C 5I2LA 1BMOA 2KAXA 2H61C 1B7TZ 3ZWHA 4I5JA 1QIWA 1Y6WA 4E68A 4MEWA 1KFUS 3EVUA 2L98A 3PSRA 2KGBC 3I5GB 1KQMB 3SG5A 1BJFA 1L2OB 1UP5A 2CNPA 3KO0A 3FIAA 1SMGA 2JT0A 2AMIA 1NX3A 2K61A 4M2PA 1SBJA 3FS7A 3NSKA 1J55A 4YGCB 4GFTA 1CMGA 4PHJA 3HCMA 2M49B 3NSLA 5ER5A 1N2DA 1Y1AA 1QJTA 5AEQA 1R2UA 3D0YB 1SCMB 2I18A 3CTNA 3PN7B 2LLUA 4PHNA 2CCMA 2HPSA 1CFDA 3EK7A 3LLEA 3TDUA 1GQMA 1XVJA 1DF0A 2NCOA 4ZCUA 5CSNA 1EG3A 4ETOA 1GGZA 2K8MB 1B7TY 1BR4B 1K8UA 4M2OA 1K94A 1S6IA 2I2RE 1K96A 3KEVA 5DKNA 2LUCA 1ALWA 4MZKA 2LMTA 1M46A 1UWOA 1IJ6A 1B8RA 5AXIA 5HLVA 2JPTA 1J7RA 2NCPA 1B9AA 2KOTA 1JBAA 1NYAA 2BECA 2LVVA 2L5XB 5ER4X 1LXFC 1TNPA 2LM5A 4PDZA 2M0RA 2L51A 3DF0A 2MLFC 3CZTX 3PALA 4C0JA 1F4OA 2KBMA 1MQ1A 1J1DA 2FJUB 3JVTB 1SYMA 1J7OA 1E8AA 4CLNA 3VRQA 4P2YB 3WXAA 2JNFA 1YVHA 1LA3A 2K0JA 1SRAA 1OE9B 3DD4A 4PHMA 2OS8C 1XFVO 1CLMA 3EKHA 4YI9A 4C0LA 1KSMA 1FF1A 1R6PA 1J7QA 1RECA 3LCPC 1C7VA 4ICBA 3NSOA 2EGDA 4NDBA 2LNKA 1SL7A 4C0KA 1JSAA 1CDLA 1KFXL 2AAOA 1BT6A 1TNWA 2BCXA 3BUNB 1CFFA 2ZN8A 1QVIZ 5HKZA 2M7LA 2GGMA 2PALA 1CDNA 3SG2A 2H2KA 3GK4X 1D1OA 1YUTA 2KFGA 2MRDA 4USLA 1WRKA 3TS5C 2WORA 1MXEA 2LHLA 1AVSA 5D7FA 2ISDA 1CM4A 2BCAA 2LVKA 4HRHA 3WNXB 5GQQC 1VRKA 1KFXS 4FQOA 1CLLA 3OX6A 3A4UB 1W7IB 2EHBA 3I5IC 1JF2A 1RK9A 4WQ2A 4MLWA 1NX1A 2MHHA 1QX5B 1DGVA 4QJ3B 3CLNA 1K9PA 1WDCC 1S5GZ 1TCFA 3DVMA 2VRGA 1SL8A 2BE4A 1ZMZA 4YGEB 1MUXA 3VRNA 1SNLA 3DVJA 1UHNA 1XFWO 2JT3A 4HRGA 2BL0B 1DF0B 1QVIY 4CFRA 1OMVA 3BUMB 1FI5A 1DJZA 4D1EA 3MSEB 2LUXA 4GAOA 1SY9A 2L2EA 4YRUA 3TUYC 2H61A 2LMVA 1XFXO 2COLB 3TZ1A 1KSOA 1DJYA 1SKTA 1XO5A 5KU1A 4AQIA 1DJHA 1Y1UA 2KYCA 3VROA 5I2OA 2WC8A 1CLBA 1RWYA 1Y0VH 1TNXA 1YUUA 1YURA 4CIDA 1CB1A 2OS8B 3GK2A 3VRPA 4DCKA 3BXKA 3LK0A 3RM1A 2WOSA 1OZSA 1S6JA 2PASA 1PSRA 3DF0B 3I5HC 4GNKB 4N1FA 5F6TA 1KK8C 1DTLA 3O2PA 1SCVA 4OV2A 1K90D 1PRWA 1SL9A 2RGIA 1TOPA 1QATA 2GV5A 2K2AA 2Y5IA 3RLZA 3VGOA 1OOJA 1HQVA 5CSFA 1B47A 3TS5B 1SR6C 2JRFA 2KI6C 4U8DA 5CSIA 2Y1MA 1KQVA 2M97A 5AANA 1QX2A 1UURA 2FCEA 3WHUB 1ZACA
chains in the Genus database with same CATH superfamily
4ORAB 2KQYA 3I5IB 3CR5X 1XFRA 2JPOA 4ORCB 1IWQA 1WDCB 3EVRA 2KAVA 2JQ6A 2BKIB 2M29A 4OR9B 2TN4A 1CKKA 4I5NB 1CDPA 1OOGA 1F55A 1JWDA 2JT8A 4GUKA 4MBEA 1ALVA 1OQPA 1TN4A 1DGUA 2BKHB 2WC6A 2O60A 4NDDA 1MF8B 1EJ3A 1QV1A 5AERA 1YUSA 1AP4A 1F54A 4OCIA 2E6WA 3GK1A 3OGNA 1GM0A 2KAYA 1WY9A 2Q4UA 4A4BA 5I2QA 1Q80A 2JWWA 1C07A 1MXLC 1EG4A 2Y4QA 2QDIA 1IH0A 2KBIA 1N65A 2KFFA 1N0YA 1ZUZA 1PVAA 2L50A 2F2OA 2HQ8A 1A75A 1F4QA 1KK7Z 2PVBA 1XYDA 1M39A 5B8IB 2GGZA 1TCOB 3JTDC 1A2XA 2K2FA 2MAZA 3K21A 2ZFDA 1OSAA 1BLQA 3OP0A 1KK8B 2EC6B 1GGWA 1BU3A 3GOFA 1NX2A 4MZLA 1KWOC 4PHKA 1H4BA 3CZ1A 1JF0A 3S0FA 1JC2A 4INWA 2LVJA 3TDZA 5CSJA 1W7JB 1T14A 4JQ0D 1NIWA 1KCYA 1BF5A 1M63B 1H8BA 3DVKA 4CPVA 4GBAA 3EVVA 1DQEA 2OTGC 5J3XA 1B4CA 1LINA 5HYDA 2KI4C 1NUBA 2KDHA 5DKRA 2ZNDA 3H4SE 4PE4A 1KK7Y 4OVNF 3PFVA 1XFZO 4PE1A 2LAPA 2PQLA 3CDNA 1NSHA 1YRTB 3EK4A 4PE7A 2MBXA 2WCEA 5KSZA 3DXLA 1FBVA 1QTXA 3D76A 3NHTA 4DRWA 2D8NA 2MLEC 1DC1A 2M3WA 1A4PA 2ZN9A 2ZRTA 3M0WA 3C1VA 1YTZC 2WCBA 1IKUA 2K7DA 1PVBA 2ZRSA 1TRFA 2ZNEA 1TNQA 1UHJA 1UHHA 2QEVA 3SIBA 4HREE 4XJKA 4I5KA 4FTGA 3OB2B 2BBNA 3D73A 1CNPA 2NZ0A 4OKHA 4L9MA 5EL2A 2JULA 4MN0A 3QRXA 3UO9A 2Q91A 3AAJA 2JU0A 1QASA 2JNXA 3BOWA 3KHEA 3NSIA 4AQJA 1K2HA 3QMEA 3JTDB 2M1UA 1EXRA 3BUXB 2LC5A 3BYAA 2KFHA 1LKJA 1AJ4A 1MR8A 3DZTA 4JPZB 5PALA 2FOTA 2M7NA 3SG7A 1QX7A 2WCFA 1KWOB 4MZJA 2WCKA 5DICA 1XFYO 2KI6D 3BJHA 1JFJA 1HT9A 1SK6D 1UHKA 2YGUA 3NHIA 2BAPA 2BE6A 2SCPA 1A75B 1QXPA 1M31A 4YBHB 4M2QA 2KNEA 2V53A 2NXQA 2KI4B 1G33A 1IQ5A 1F71A 1BOCA 3IQQA 5I8NA 3BFHA 3AKBA 1IIOA 1WRZA 1C7WA 1DMOA 3R1OA 3IVTA 1SPYA 2LP3A 4TNCA 3CS1A 1IJ5A 4JD9A 4MVFA 2QPTA 1QV0A 3SIAA 1TTXA 2L4IA 1KFUL 1XK4A 1S36A 3B6XA 4IL1A 2P6BB 1TIZA 2K7OA 2BNXA 3BUOB 2HQWA 2F33A 4DUQA 2M1KB 1CTRA 1Z2CB 2JXCA 4YGDB 1LA0A 3O6BA 3CR2A 5KTYA 2GTEA 1YRUB 3L4AA 1U5IA 1X02A 4GGFA 5IBWA 4N1GA 4R1EA 1B8LA 2B1UA 4GGNA 1JFKA 2LE9B 3LK1A 1XK4C 4DS7A 3F45A 1F70A 2WNDA 2CT9A 3D10A 1K9UA 2BBMA 3NGVA 2BCBA 3S0DA 3TUYB 2F3YA 1UHIA 1RFJA 1GJYA 1QLKA 4BY4A 1M45A 3FWCA 4MRXA 4P5OE 1FW4A 1A29A 3SG6A 1L7ZA 1DJIA 5G08A 2LMUA 1B8CA 2SASA 3S0AA 1FI6A 3ZNIA 1NP8A 4QJ4B 2K7CA 1A03A 1TUZA 4GGFC 1EL4A 4XJKB 1CMFA 1ODBA 3TDIA 4NDCA 2LV7A 1DVIA 3OHMB 4INXA 4YGBB 3NXAA 1WLMA 2DOQA 1K93D 2KLEA 1IRJA 2I94A 2ERBA 3I5HB 1AHRA 3BOWB 3BUWB 3O78A 1NPQA 2E30A 1NCXA 1CM1A 3CZ2A 5HKYA 1EH2A 2NLNA 1F8HA 1K9KA 3FE9A 2PRUA 1S6CA 3SJSA 4YI8A 4XYNA 1W9ZA 3I5FC 2WCHA 2JTTA 4Q04A 3EK8A 1SR6B 1CFPA 1SSEB 2CBLA 2BL0C 2K7BA 1QIVA 2Y1NA 3B86A 1CFCA 3WHTB 2LHIA 3BQ3A 3VRRA 2KYFA 4QJ5B 1ZFSA 1DJXA 3B87A 3DVEA 1IGVA 2JOJA 2JZIA 4YGAA 1FPWA 2CTNA 5D69A 1K95A 4KYNA 2F3ZA 2I7AA 1JUOA 2LP2A 2QACA 1RTP1 1V1GA 4DIRA 3SS3A 3CYZA 2F8PA 2HETA 3SG4A 3PLFB 4CFQA 1J7PA 2M8UA 2JXLA 1G4YR 1PALA 4PE0A 1DJWA 2PMYA 5JJGA 1NWDA 1IG5A 2WCLA 1S1EA 3O4XA 3D0YA 1B1GA 4GPLB 5CPVA 1XFUO 1QLSA 2IS9A 2HF5A 2KGRA 1Y1XA 1MWNA 2CXJA 3IF7A 2MA2A 2ZKMX 4FQTA 2MJWB 1TUJA 3IQOA 5AFPA 3I5GC 1LS8A 2LCPA 1KQMC 2JC2A 1BODA 1QS7A 1L2OC 1U5IB 1UUSA 1YVLA 3DYEA 4HSZA 4MSPA 1G8IA 1YX8A 2AUCA 2L4HA 1OZOA 2L0PA 3B88A 2H8VA 1SW8A 3HX4A 3FWBA 3O4YA 4JWQA 5TNCA 1LVCD 4MRYA 2WCJA 3PM8A 3CR4X 4PALA 2G2BA 1PULA 2F2PA 4WQ3A 2JTZA 2LLSA 4N5XA 1OMDA 5HKWA 1NCYA 1S26D 1V1FA 2A4JA 2KSPA 3CGAA 1SCMC 1WRLA 3PM2A 4F0ZB 1YR5A 2G9BA 3PN7C 1IQ3A 1WLZA 1BG1A 2FCDA 5JOLA 3CWGA 3SG3A 3AKAA 4NQGA 5HLOA 2QEOA 4UPGA 1CDMA 4I5LB 5FYXA 3I5FB 1YX7A 4ZCVA 3KPXA 2LLTA 3FE6A 4WRIA 1PSBA 1DT7B 2OTGB 2PSRA 3SS4A 3D77A 3ICBA 3KF9A 1AK8A 1S3PA 1RROA 5DKQA 5K89A 1C3YA 2KQ6A 3V2LA 3EKJA 1OOIX 1AUIB 3UNWA 1MHOA 4AOMA 1J1EA 3LL8B 2O5GA 3E3RA 4ORBB 1XA5A 1NCZA 3OB1B 1OMRA 5FI7A 3PATA 1AJ5A 1DJGA 1OOFA 1RJVA 2M9GA 4A4CA 3S0GA 2OPOA 1ZOTB 1C3ZA 4BY5A 2KHNA 3AAKA 1BR1B 3A8RA 1PK0D 2LANA 4F7FA 1S5GY 3CABA 1NX0A 2WCMA 3JVTC 2LVIA 5BPJA 4PCWA 2R2IA 3OX5A 3R1PA 2EC6C 5I2LA 1BMOA 2KAXA 2H61C 1B7TZ 3ZWHA 4I5JA 1QIWA 1Y6WA 3EG5B 4MEWA 4E68A 3Q8IA 1KFUS 3EVUA 2QEBA 2L98A 3PSRA 2KGBC 3I5GB 1KQMB 3SG5A 1BJFA 1L2OB 1UP5A 2CNPA 3KO0A 3FIAA 1SMGA 2JT0A 2AMIA 1NX3A 2K61A 4M2PA 1SBJA 3FS7A 3NSKA 1J55A 2P71A 4YGCB 4GFTA 1CMGA 4PHJA 3HCMA 2M49B 3NSLA 5ER5A 1N2DA 1Y1AA 1QJTA 5AEQA 1R2UA 1P28A 3D0YB 1SCMB 2I18A 3CTNA 3PN7B 2LLUA 4PHNA 2CCMA 2HPSA 1CFDA 3EK7A 3LLEA 3TDUA 1GQMA 1XVJA 1DF0A 2NCOA 3D74A 5CSNA 1EG3A 4ZCUA 4ETOA 1GGZA 2KLDA 2K8MB 1B7TY 1BR4B 1K8UA 4JKTA 4M2OA 5FI2A 3CZ0A 1K94A 1S6IA 2I2RE 3PJIA 1K96A 3KEVA 3R72A 5DKNA 2LUCA 1ALWA 4MZKA 2LMTA 1M46A 1UWOA 1IJ6A 3BFAA 1B8RA 5AXIA 3OBVA 2L2CA 5HLVA 4IJ7A 2JPTA 1J7RA 2NCPA 1B9AA 2KOTA 3FE8A 3L4LA 1JBAA 1NYAA 2BECA 2LVVA 2L5XB 5ER4X 1LXFC 1OW4A 1TNPA 2LM5A 4PDZA 5FI6A 3S0EA 2M0RA 2L51A 3DF0A 2MLFC 3CZTX 3PALA 4C0JA 1F4OA 2KBMA 1MQ1A 1J1DA 2FJUB 3D75A 3N7HA 3JVTB 1SYMA 1J7OA 1E8AA 4CLNA 3VRQA 4P2YB 3WXAA 3BFBA 2JNFA 1YVHA 1LA3A 2K0JA 1SRAA 1OE9B 2L5YA 3DD4A 4PHMA 2OS8C 1XFVO 1CLMA 3EKHA 4YI9A 4C0LA 2P70A 3K1EA 1KSMA 1FF1A 1R6PA 1J7QA 1RECA 3LCPC 1C7VA 4ICBA 3NSOA 2EGDA 5I94A 4NDBA 2LNKA 3L47A 1SL7A 3VB1A 4C0KA 1JSAA 1CDLA 1KFXL 2AAOA 1BT6A 1TNWA 2BCXA 2FJYA 3BUNB 1CFFA 2ZN8A 1QVIZ 5HKZA 2M7LA 2GGMA 2PALA 1CDNA 3SG2A 2H2KA 3GK4X 1D1OA 1YUTA 2KFGA 2MRDA 4USLA 1WRKA 3TS5C 2WORA 1MXEA 2LHLA 2KPHA 1AVSA 5D7FA 2ISDA 1CM4A 2BCAA 2LVKA 3DY9A 4HRHA 3WNXB 5GQQC 1VRKA 1KFXS 4FQOA 1CLLA 3OX6A 3A4UB 1W7IB 3D78A 2EHBA 3I5IC 1JF2A 1RK9A 1TWOA 4WQ2A 4MLWA 1NX1A 2MHHA 1QX5B 5D3OA 1DGVA 4QJ3B 3CLNA 1K9PA 1WDCC 1S5GZ 1TCFA 3DVMA 2VRGA 1SL8A 2BE4A 1ZMZA 4YGEB 1DEKA 1MUXA 3VRNA 1SNLA 3DVJA 3R1VA 1UHNA 1XFWO 2JT3A 4HRGA 1DELA 2BL0B 1DF0B 1QVIY 4CFRA 1OMVA 3BUMB 1FI5A 1DJZA 4D1EA 2QEHA 2LUXA 3MSEB 1SY9A 2L2EA 4GAOA 4YRUA 3TUYC 2H61A 2LMVA 1XFXO 2COLB 3TZ1A 1KSOA 1ORGA 1DJYA 1SKTA 1XO5A 5KU1A 4PT1A 4AQIA 1DJHA 1Y1UA 2KYCA 3S0BA 3VROA 5I2OA 2WC8A 5HL1A 1CLBA 1OOHA 1RWYA 3SS5A 1Y0VH 1TNXA 1YUUA 1YURA 4CIDA 1CB1A 2OS8B 3GK2A 3VRPA 4DCKA 3BXKA 4OZDA 3LK0A 3RM1A 2WOSA 2WC5A 1OZSA 1S6JA 2PASA 1PSRA 1QWVA 3DF0B 3I5HC 4GNKB 4N1FA 1KK8C 5F6TA 1DTLA 3O2PA 1SCVA 4OV2A 1K90D 1PRWA 1SL9A 2RGIA 1TOPA 1QATA 2GV5A 2K2AA 2Y5IA 3RLZA 3VGOA 1OOJA 3RZSA 2PYQA 1HQVA 5CSFA 1B47A 3B7AA 1SR6C 2JRFA 3TS5B 2KI6C 4U8DA 5CSIA 2Y1MA 1KQVA 1Z4HA 2M97A 2K60A 5AANA 1QX2A 1UURA 2FCEA 3WHUB 1ZACA
chains in the Genus database with same CATH topology
4ORAB 2KQYA 3I5IB 3CR5X 4ORCB 1IWQA 1WDCB 3EVRA 2KAVA 2JQ6A 2BKIB 2M29A 4OR9B 2TN4A 1CKKA 4I5NB 1CDPA 1F55A 1JWDA 2JT8A 4GUKA 4MBEA 1ALVA 1OQPA 1TN4A 1DGUA 2BKHB 4NDDA 2O60A 1MF8B 1EJ3A 1QV1A 5AERA 1YUSA 1AP4A 1F54A 4OCIA 2E6WA 3GK1A 2KAYA 1WY9A 2Q4UA 4A4BA 5I2QA 1Q80A 2JWWA 1C07A 1MXLC 1EG4A 2Y4QA 1IH0A 2KBIA 1N65A 2KFFA 1N0YA 1ZUZA 1PVAA 2L50A 2F2OA 2HQ8A 1A75A 1F4QA 1KK7Z 2PVBA 1XYDA 1M39A 5B8IB 2GGZA 1TCOB 3JTDC 1A2XA 2K2FA 2MAZA 3K21A 2ZFDA 1OSAA 1BLQA 3OP0A 1KK8B 2EC6B 1GGWA 1BU3A 3GOFA 1NX2A 4MZLA 1KWOC 4PHKA 1H4BA 1JF0A 1JC2A 3TDZA 2LVJA 5CSJA 1W7JB 4JQ0D 1NIWA 1KCYA 1BF5A 1M63B 1H8BA 3DVKA 4CPVA 4GBAA 3EVVA 2OTGC 1B4CA 5J3XA 1LINA 5HYDA 2KI4C 1NUBA 2KDHA 5DKRA 2ZNDA 3H4SE 4PE4A 1KK7Y 4OVNF 3PFVA 1XFZO 4PE1A 2LAPA 1NSHA 1YRTB 3EK4A 4PE7A 2MBXA 2WCEA 5KSZA 1FBVA 1QTXA 4DRWA 2D8NA 2MLEC 2M3WA 1A4PA 2ZN9A 2ZRTA 3M0WA 3C1VA 1YTZC 2WCBA 1IKUA 2K7DA 1PVBA 2ZRSA 1TRFA 2ZNEA 1TNQA 1UHJA 1UHHA 3SIBA 4HREE 4XJKA 4I5KA 4FTGA 3OB2B 2BBNA 1CNPA 2NZ0A 4OKHA 4L9MA 2JULA 4MN0A 3QRXA 2Q91A 3AAJA 2JU0A 1QASA 2JNXA 3BOWA 3KHEA 3NSIA 4AQJA 1K2HA 3JTDB 2M1UA 1EXRA 3BUXB 2LC5A 3BYAA 2KFHA 1LKJA 1AJ4A 1MR8A 4JPZB 5PALA 2FOTA 2M7NA 3SG7A 1QX7A 2WCFA 1KWOB 4MZJA 1XFYO 2KI6D 1JFJA 1HT9A 1SK6D 1UHKA 2BE6A 2SCPA 1A75B 1QXPA 1M31A 4YBHB 4M2QA 2KNEA 2V53A 2NXQA 2KI4B 1G33A 1IQ5A 1F71A 1BOCA 3IQQA 5I8NA 3AKBA 1WRZA 1C7WA 1DMOA 1SPYA 2LP3A 4TNCA 3CS1A 1IJ5A 4MVFA 2QPTA 1QV0A 3SIAA 1TTXA 2L4IA 1KFUL 1XK4A 1S36A 4IL1A 2P6BB 1TIZA 2K7OA 3BUOB 2HQWA 2F33A 4DUQA 2M1KB 1CTRA 2JXCA 4YGDB 1LA0A 3O6BA 3CR2A 5KTYA 1YRUB 1U5IA 1X02A 4GGFA 5IBWA 4N1GA 4R1EA 1B8LA 2B1UA 4GGNA 1JFKA 2LE9B 3LK1A 1XK4C 4DS7A 3F45A 1F70A 2WNDA 2CT9A 3D10A 1K9UA 2BBMA 2BCBA 3TUYB 2F3YA 1UHIA 1RFJA 1GJYA 1QLKA 4BY4A 1M45A 3FWCA 4MRXA 4P5OE 1FW4A 1A29A 3SG6A 1L7ZA 1DJIA 5G08A 2LMUA 1B8CA 2SASA 1FI6A 3ZNIA 1NP8A 4QJ4B 2K7CA 1A03A 4GGFC 1EL4A 4XJKB 1CMFA 1ODBA 3TDIA 4NDCA 2LV7A 1DVIA 3OHMB 4YGBB 3NXAA 1WLMA 2DOQA 1K93D 1IRJA 2I94A 3I5HB 1AHRA 3BOWB 3BUWB 3O78A 1NPQA 2E30A 1NCXA 1CM1A 5HKYA 1EH2A 2NLNA 1F8HA 1K9KA 2PRUA 1S6CA 3SJSA 4YI8A 4XYNA 3I5FC 2JTTA 4Q04A 3EK8A 1SR6B 1CFPA 2CBLA 2BL0C 2K7BA 1QIVA 2Y1NA 1CFCA 3WHTB 2LHIA 3BQ3A 3VRRA 2KYFA 4QJ5B 1ZFSA 1DJXA 3DVEA 1IGVA 2JOJA 2JZIA 4YGAA 1FPWA 2CTNA 5D69A 1K95A 2F3ZA 2I7AA 1JUOA 2LP2A 2QACA 1RTP1 1V1GA 4DIRA 2F8PA 2HETA 3SG4A 3PLFB 4CFQA 1J7PA 2M8UA 2JXLA 1G4YR 1PALA 4PE0A 1DJWA 2PMYA 5JJGA 1NWDA 1IG5A 1S1EA 3D0YA 1B1GA 4GPLB 5CPVA 1XFUO 1QLSA 2IS9A 2HF5A 2KGRA 1Y1XA 1MWNA 2CXJA 3IF7A 2MA2A 2ZKMX 5AFPA 2MJWB 3IQOA 3I5GC 2LCPA 1KQMC 2JC2A 1BODA 1QS7A 1L2OC 1U5IB 1UUSA 1YVLA 4HSZA 4MSPA 1G8IA 1YX8A 2AUCA 2L4HA 1OZOA 2L0PA 3HX4A 1SW8A 4JWQA 3FWBA 3O4YA 5TNCA 1LVCD 4MRYA 3PM8A 3CR4X 4PALA 2G2BA 1PULA 2F2PA 4WQ3A 2JTZA 2LLSA 4N5XA 1OMDA 5HKWA 1NCYA 1S26D 1V1FA 2A4JA 2KSPA 3CGAA 1SCMC 1WRLA 4F0ZB 1YR5A 2G9BA 3PN7C 1IQ3A 1WLZA 1BG1A 2FCDA 5JOLA 3CWGA 3SG3A 3AKAA 4NQGA 5HLOA 4UPGA 1CDMA 4I5LB 5FYXA 3I5FB 1YX7A 4ZCVA 3KPXA 2LLTA 4WRIA 1PSBA 1DT7B 2OTGB 2PSRA 3ICBA 3KF9A 1AK8A 1S3PA 1RROA 5DKQA 5K89A 2KQ6A 3EKJA 1AUIB 1MHOA 4AOMA 1J1EA 3LL8B 2O5GA 3E3RA 4ORBB 1XA5A 1NCZA 3OB1B 1OMRA 3PATA 1AJ5A 1DJGA 1RJVA 2M9GA 4A4CA 2OPOA 1ZOTB 4BY5A 2KHNA 3AAKA 1BR1B 3A8RA 1PK0D 2LANA 1S5GY 1NX0A 3JVTC 2LVIA 5BPJA 4PCWA 2R2IA 3OX5A 2EC6C 5I2LA 1BMOA 2KAXA 2H61C 1B7TZ 3ZWHA 4I5JA 1QIWA 1Y6WA 4E68A 4MEWA 1KFUS 3EVUA 2L98A 3PSRA 2KGBC 3I5GB 1KQMB 3SG5A 1BJFA 1L2OB 1UP5A 2CNPA 3KO0A 3FIAA 1SMGA 2JT0A 2AMIA 1NX3A 2K61A 4M2PA 1SBJA 3FS7A 3NSKA 1J55A 4YGCB 4GFTA 1CMGA 4PHJA 3HCMA 2M49B 3NSLA 5ER5A 1N2DA 1Y1AA 1QJTA 5AEQA 1R2UA 3D0YB 1SCMB 2I18A 3CTNA 3PN7B 2LLUA 4PHNA 2CCMA 2HPSA 1CFDA 3EK7A 3LLEA 3TDUA 1GQMA 1XVJA 1DF0A 2NCOA 4ZCUA 5CSNA 1EG3A 4ETOA 1GGZA 2K8MB 1B7TY 1BR4B 1K8UA 4M2OA 1K94A 1S6IA 2I2RE 1K96A 3KEVA 5DKNA 2LUCA 1ALWA 4MZKA 2LMTA 1M46A 1UWOA 1IJ6A 1B8RA 5AXIA 5HLVA 2JPTA 1J7RA 2NCPA 1B9AA 2KOTA 1JBAA 1NYAA 2BECA 2LVVA 2L5XB 5ER4X 1LXFC 1TNPA 2LM5A 4PDZA 2M0RA 2L51A 3DF0A 2MLFC 3CZTX 3PALA 4C0JA 1F4OA 2KBMA 1MQ1A 1J1DA 2FJUB 3JVTB 1SYMA 1J7OA 1E8AA 4CLNA 3VRQA 4P2YB 3WXAA 2JNFA 1YVHA 1LA3A 2K0JA 1SRAA 1OE9B 3DD4A 4PHMA 2OS8C 1XFVO 1CLMA 3EKHA 4YI9A 4C0LA 1KSMA 1FF1A 1R6PA 1J7QA 1RECA 3LCPC 1C7VA 4ICBA 3NSOA 2EGDA 4NDBA 2LNKA 1SL7A 4C0KA 1JSAA 1CDLA 1KFXL 2AAOA 1BT6A 1TNWA 2BCXA 3BUNB 1CFFA 2ZN8A 1QVIZ 5HKZA 2M7LA 2GGMA 2PALA 1CDNA 3SG2A 2H2KA 3GK4X 1D1OA 1YUTA 2KFGA 2MRDA 4USLA 1WRKA 3TS5C 2WORA 1MXEA 2LHLA 1AVSA 5D7FA 2ISDA 1CM4A 2BCAA 2LVKA 4HRHA 3WNXB 5GQQC 1VRKA 1KFXS 4FQOA 1CLLA 3OX6A 3A4UB 1W7IB 2EHBA 3I5IC 1JF2A 1RK9A 4WQ2A 4MLWA 1NX1A 2MHHA 1QX5B 1DGVA 4QJ3B 3CLNA 1K9PA 1WDCC 1S5GZ 1TCFA 3DVMA 2VRGA 1SL8A 2BE4A 1ZMZA 4YGEB 1MUXA 3VRNA 1SNLA 3DVJA 1UHNA 1XFWO 2JT3A 4HRGA 2BL0B 1DF0B 1QVIY 4CFRA 1OMVA 3BUMB 1FI5A 1DJZA 4D1EA 3MSEB 2LUXA 4GAOA 1SY9A 2L2EA 4YRUA 3TUYC 2H61A 2LMVA 1XFXO 2COLB 3TZ1A 1KSOA 1DJYA 1SKTA 1XO5A 5KU1A 4AQIA 1DJHA 1Y1UA 2KYCA 3VROA 5I2OA 2WC8A 1CLBA 1RWYA 1Y0VH 1TNXA 1YUUA 1YURA 4CIDA 1CB1A 2OS8B 3GK2A 3VRPA 4DCKA 3BXKA 3LK0A 3RM1A 2WOSA 1OZSA 1S6JA 2PASA 1PSRA 3DF0B 3I5HC 4GNKB 4N1FA 5F6TA 1KK8C 1DTLA 3O2PA 1SCVA 4OV2A 1K90D 1PRWA 1SL9A 2RGIA 1TOPA 1QATA 2GV5A 2K2AA 2Y5IA 3RLZA 3VGOA 1OOJA 1HQVA 5CSFA 1B47A 3TS5B 1SR6C 2JRFA 2KI6C 4U8DA 5CSIA 2Y1MA 1KQVA 2M97A 5AANA 1QX2A 1UURA 2FCEA 3WHUB 1ZACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ORA B;  2KQY A;  3I5I B;  3CR5 X;  4ORC B;  1IWQ A;  1WDC B;  3EVR A;  2KAV A;  2JQ6 A;  2BKI B;  2M29 A;  4OR9 B;  2TN4 A;  1CKK A;  4I5N B;  1CDP A;  1F55 A;  1JWD A;  2JT8 A;  4GUK A;  4MBE A;  1ALV A;  1OQP A;  1TN4 A;  1DGU A;  2BKH B;  4NDD A;  2O60 A;  1MF8 B;  1EJ3 A;  1QV1 A;  5AER A;  1YUS A;  1AP4 A;  1F54 A;  4OCI A;  2E6W A;  3GK1 A;  2KAY A;  1WY9 A;  2Q4U A;  4A4B A;  5I2Q A;  1Q80 A;  2JWW A;  1C07 A;  1MXL C;  1EG4 A;  2Y4Q A;  1IH0 A;  2KBI A;  1N65 A;  2KFF A;  1N0Y A;  1ZUZ A;  1PVA A;  2L50 A;  2F2O A;  2HQ8 A;  1A75 A;  1F4Q A;  1KK7 Z;  2PVB A;  1XYD A;  1M39 A;  5B8I B;  2GGZ A;  1TCO B;  3JTD C;  1A2X A;  2K2F A;  2MAZ A;  3K21 A;  2ZFD A;  1OSA A;  1BLQ A;  3OP0 A;  1KK8 B;  2EC6 B;  1GGW A;  1BU3 A;  3GOF A;  1NX2 A;  4MZL A;  1KWO C;  4PHK A;  1H4B A;  1JF0 A;  1JC2 A;  3TDZ A;  2LVJ A;  5CSJ A;  1W7J B;  4JQ0 D;  1NIW A;  1KCY A;  1BF5 A;  1M63 B;  1H8B A;  3DVK A;  4CPV A;  4GBA A;  3EVV A;  2OTG C;  1B4C A;  5J3X A;  1LIN A;  5HYD A;  2KI4 C;  1NUB A;  2KDH A;  5DKR A;  2ZND A;  3H4S E;  4PE4 A;  1KK7 Y;  4OVN F;  3PFV A;  1XFZ O;  4PE1 A;  2LAP A;  1NSH A;  1YRT B;  3EK4 A;  4PE7 A;  2MBX A;  2WCE A;  5KSZ A;  1FBV A;  1QTX A;  4DRW A;  2D8N A;  2MLE C;  2M3W A;  1A4P A;  2ZN9 A;  2ZRT A;  3M0W A;  3C1V A;  1YTZ C;  2WCB A;  1IKU A;  2K7D A;  1PVB A;  2ZRS A;  1TRF A;  2ZNE A;  1TNQ A;  1UHJ A;  1UHH A;  3SIB A;  4HRE E;  4XJK A;  4I5K A;  4FTG A;  3OB2 B;  2BBN A;  1CNP A;  2NZ0 A;  4OKH A;  4L9M A;  2JUL A;  4MN0 A;  3QRX A;  2Q91 A;  3AAJ A;  2JU0 A;  1QAS A;  2JNX A;  3BOW A;  3KHE A;  3NSI A;  4AQJ A;  1K2H A;  3JTD B;  2M1U A;  1EXR A;  3BUX B;  2LC5 A;  3BYA A;  2KFH A;  1LKJ A;  1AJ4 A;  1MR8 A;  4JPZ B;  5PAL A;  2FOT A;  2M7N A;  3SG7 A;  1QX7 A;  2WCF A;  1KWO B;  4MZJ A;  1XFY O;  2KI6 D;  1JFJ A;  1HT9 A;  1SK6 D;  1UHK A;  2BE6 A;  2SCP A;  1A75 B;  1QXP A;  1M31 A;  4YBH B;  4M2Q A;  2KNE A;  2V53 A;  2NXQ A;  2KI4 B;  1G33 A;  1IQ5 A;  1F71 A;  1BOC A;  3IQQ A;  5I8N A;  3AKB A;  1WRZ A;  1C7W A;  1DMO A;  1SPY A;  2LP3 A;  4TNC A;  3CS1 A;  1IJ5 A;  4MVF A;  2QPT A;  1QV0 A;  3SIA A;  1TTX A;  2L4I A;  1KFU L;  1XK4 A;  1S36 A;  4IL1 A;  2P6B B;  1TIZ A;  2K7O A;  3BUO B;  2HQW A;  2F33 A;  4DUQ A;  2M1K B;  1CTR A;  2JXC A;  4YGD B;  1LA0 A;  3O6B A;  3CR2 A;  5KTY A;  1YRU B;  1U5I A;  1X02 A;  4GGF A;  5IBW A;  4N1G A;  4R1E A;  1B8L A;  2B1U A;  4GGN A;  1JFK A;  2LE9 B;  3LK1 A;  1XK4 C;  4DS7 A;  3F45 A;  1F70 A;  2WND A;  2CT9 A;  3D10 A;  1K9U A;  2BBM A;  2BCB A;  3TUY B;  2F3Y A;  1UHI A;  1RFJ A;  1GJY A;  1QLK A;  4BY4 A;  1M45 A;  3FWC A;  4MRX A;  4P5O E;  1FW4 A;  1A29 A;  3SG6 A;  1L7Z A;  1DJI A;  5G08 A;  2LMU A;  1B8C A;  2SAS A;  1FI6 A;  3ZNI A;  1NP8 A;  4QJ4 B;  2K7C A;  1A03 A;  4GGF C;  1EL4 A;  4XJK B;  1CMF A;  1ODB A;  3TDI A;  4NDC A;  2LV7 A;  1DVI A;  3OHM B;  4YGB B;  3NXA A;  1WLM A;  2DOQ A;  1K93 D;  1IRJ A;  2I94 A;  3I5H B;  1AHR A;  3BOW B;  3BUW B;  3O78 A;  1NPQ A;  2E30 A;  1NCX A;  1CM1 A;  5HKY A;  1EH2 A;  2NLN A;  1F8H A;  1K9K A;  2PRU A;  1S6C A;  3SJS A;  4YI8 A;  4XYN A;  3I5F C;  2JTT A;  4Q04 A;  3EK8 A;  1SR6 B;  1CFP A;  2CBL A;  2BL0 C;  2K7B A;  1QIV A;  2Y1N A;  1CFC A;  3WHT B;  2LHI A;  3BQ3 A;  3VRR A;  2KYF A;  4QJ5 B;  1ZFS A;  1DJX A;  3DVE A;  1IGV A;  2JOJ A;  2JZI A;  4YGA A;  1FPW A;  2CTN A;  5D69 A;  1K95 A;  2F3Z A;  2I7A A;  1JUO A;  2LP2 A;  2QAC A;  1RTP 1;  1V1G A;  4DIR A;  2F8P A;  2HET A;  3SG4 A;  3PLF B;  4CFQ A;  1J7P A;  2M8U A;  2JXL A;  1G4Y R;  1PAL A;  4PE0 A;  1DJW A;  2PMY A;  5JJG A;  1NWD A;  1IG5 A;  1S1E A;  3D0Y A;  1B1G A;  4GPL B;  5CPV A;  1XFU O;  1QLS A;  2IS9 A;  2HF5 A;  2KGR A;  1Y1X A;  1MWN A;  2CXJ A;  3IF7 A;  2MA2 A;  2ZKM X;  5AFP A;  2MJW B;  3IQO A;  3I5G C;  2LCP A;  1KQM C;  2JC2 A;  1BOD A;  1QS7 A;  1L2O C;  1U5I B;  1UUS A;  1YVL A;  4HSZ A;  4MSP A;  1G8I A;  1YX8 A;  2AUC A;  2L4H A;  1OZO A;  2L0P A;  3HX4 A;  1SW8 A;  4JWQ A;  3FWB A;  3O4Y A;  5TNC A;  1LVC D;  4MRY A;  3PM8 A;  3CR4 X;  4PAL A;  2G2B A;  1PUL A;  2F2P A;  4WQ3 A;  2JTZ A;  2LLS A;  4N5X A;  1OMD A;  5HKW A;  1NCY A;  1S26 D;  1V1F A;  2A4J A;  2KSP A;  3CGA A;  1SCM C;  1WRL A;  4F0Z B;  1YR5 A;  2G9B A;  3PN7 C;  1IQ3 A;  1WLZ A;  1BG1 A;  2FCD A;  5JOL A;  3CWG A;  3SG3 A;  3AKA A;  4NQG A;  5HLO A;  4UPG A;  1CDM A;  4I5L B;  5FYX A;  3I5F B;  1YX7 A;  4ZCV A;  3KPX A;  2LLT A;  4WRI A;  1PSB A;  1DT7 B;  2OTG B;  2PSR A;  3ICB A;  3KF9 A;  1AK8 A;  1S3P A;  1RRO A;  5DKQ A;  5K89 A;  2KQ6 A;  3EKJ A;  1AUI B;  1MHO A;  4AOM A;  1J1E A;  3LL8 B;  2O5G A;  3E3R A;  4ORB B;  1XA5 A;  1NCZ A;  3OB1 B;  1OMR A;  3PAT A;  1AJ5 A;  1DJG A;  1RJV A;  2M9G A;  4A4C A;  2OPO A;  1ZOT B;  4BY5 A;  2KHN A;  3AAK A;  1BR1 B;  3A8R A;  1PK0 D;  2LAN A;  1S5G Y;  1NX0 A;  3JVT C;  2LVI A;  5BPJ A;  4PCW A;  2R2I A;  3OX5 A;  2EC6 C;  5I2L A;  1BMO A;  2KAX A;  2H61 C;  1B7T Z;  3ZWH A;  4I5J A;  1QIW A;  1Y6W A;  4E68 A;  4MEW A;  1KFU S;  3EVU A;  2L98 A;  3PSR A;  2KGB C;  3I5G B;  1KQM B;  3SG5 A;  1BJF A;  1L2O B;  1UP5 A;  2CNP A;  3KO0 A;  3FIA A;  1SMG A;  2JT0 A;  2AMI A;  1NX3 A;  2K61 A;  4M2P A;  1SBJ A;  3FS7 A;  3NSK A;  1J55 A;  4YGC B;  4GFT A;  1CMG A;  4PHJ A;  3HCM A;  2M49 B;  3NSL A;  5ER5 A;  1N2D A;  1Y1A A;  1QJT A;  5AEQ A;  1R2U A;  3D0Y B;  1SCM B;  2I18 A;  3CTN A;  3PN7 B;  2LLU A;  4PHN A;  2CCM A;  2HPS A;  1CFD A;  3EK7 A;  3LLE A;  3TDU A;  1GQM A;  1XVJ A;  1DF0 A;  2NCO A;  4ZCU A;  5CSN A;  1EG3 A;  4ETO A;  1GGZ A;  2K8M B;  1B7T Y;  1BR4 B;  1K8U A;  4M2O A;  1K94 A;  1S6I A;  2I2R E;  1K96 A;  3KEV A;  5DKN A;  2LUC A;  1ALW A;  4MZK A;  2LMT A;  1M46 A;  1UWO A;  1IJ6 A;  1B8R A;  5AXI A;  5HLV A;  2JPT A;  1J7R A;  2NCP A;  1B9A A;  2KOT A;  1JBA A;  1NYA A;  2BEC A;  2LVV A;  2L5X B;  5ER4 X;  1LXF C;  1TNP A;  2LM5 A;  4PDZ A;  2M0R A;  2L51 A;  3DF0 A;  2MLF C;  3CZT X;  3PAL A;  4C0J A;  1F4O A;  2KBM A;  1MQ1 A;  1J1D A;  2FJU B;  3JVT B;  1SYM A;  1J7O A;  1E8A A;  4CLN A;  3VRQ A;  4P2Y B;  3WXA A;  2JNF A;  1YVH A;  1LA3 A;  2K0J A;  1SRA A;  1OE9 B;  3DD4 A;  4PHM A;  2OS8 C;  1XFV O;  1CLM A;  3EKH A;  4YI9 A;  4C0L A;  1KSM A;  1FF1 A;  1R6P A;  1J7Q A;  1REC A;  3LCP C;  1C7V A;  4ICB A;  3NSO A;  2EGD A;  4NDB A;  2LNK A;  1SL7 A;  4C0K A;  1JSA A;  1CDL A;  1KFX L;  2AAO A;  1BT6 A;  1TNW A;  2BCX A;  3BUN B;  1CFF A;  2ZN8 A;  1QVI Z;  5HKZ A;  2M7L A;  2GGM A;  2PAL A;  1CDN A;  3SG2 A;  2H2K A;  3GK4 X;  1D1O A;  1YUT A;  2KFG A;  2MRD A;  4USL A;  1WRK A;  3TS5 C;  2WOR A;  1MXE A;  2LHL A;  1AVS A;  5D7F A;  2ISD A;  1CM4 A;  2BCA A;  2LVK A;  4HRH A;  3WNX B;  5GQQ C;  1VRK A;  1KFX S;  4FQO A;  1CLL A;  3OX6 A;  3A4U B;  1W7I B;  2EHB A;  3I5I C;  1JF2 A;  1RK9 A;  4WQ2 A;  4MLW A;  1NX1 A;  2MHH A;  1QX5 B;  1DGV A;  4QJ3 B;  3CLN A;  1K9P A;  1WDC C;  1S5G Z;  1TCF A;  3DVM A;  2VRG A;  1SL8 A;  2BE4 A;  1ZMZ A;  4YGE B;  1MUX A;  3VRN A;  1SNL A;  3DVJ A;  1UHN A;  1XFW O;  2JT3 A;  4HRG A;  2BL0 B;  1DF0 B;  1QVI Y;  4CFR A;  1OMV A;  3BUM B;  1FI5 A;  1DJZ A;  4D1E A;  3MSE B;  2LUX A;  4GAO A;  1SY9 A;  2L2E A;  4YRU A;  3TUY C;  2H61 A;  2LMV A;  1XFX O;  2COL B;  3TZ1 A;  1KSO A;  1DJY A;  1SKT A;  1XO5 A;  5KU1 A;  4AQI A;  1DJH A;  1Y1U A;  2KYC A;  3VRO A;  5I2O A;  2WC8 A;  1CLB A;  1RWY A;  1Y0V H;  1TNX A;  1YUU A;  1YUR A;  4CID A;  1CB1 A;  2OS8 B;  3GK2 A;  3VRP A;  4DCK A;  3BXK A;  3LK0 A;  3RM1 A;  2WOS A;  1OZS A;  1S6J A;  2PAS A;  1PSR A;  3DF0 B;  3I5H C;  4GNK B;  4N1F A;  5F6T A;  1KK8 C;  1DTL A;  3O2P A;  1SCV A;  4OV2 A;  1K90 D;  1PRW A;  1SL9 A;  2RGI A;  1TOP A;  1QAT A;  2GV5 A;  2K2A A;  2Y5I A;  3RLZ A;  3VGO A;  1OOJ A;  1HQV A;  5CSF A;  1B47 A;  3TS5 B;  1SR6 C;  2JRF A;  2KI6 C;  4U8D A;  5CSI A;  2Y1M A;  1KQV A;  2M97 A;  5AAN A;  1QX2 A;  1UUR A;  2FCE A;  3WHU B;  1ZAC A; 
#chains in the Genus database with same CATH topology
 4ORA B;  2KQY A;  3I5I B;  3CR5 X;  1XFR A;  2JPO A;  4ORC B;  1IWQ A;  1WDC B;  3EVR A;  2KAV A;  2JQ6 A;  2BKI B;  2M29 A;  4OR9 B;  2TN4 A;  1CKK A;  4I5N B;  1CDP A;  1OOG A;  1F55 A;  1JWD A;  2JT8 A;  4GUK A;  4MBE A;  1ALV A;  1OQP A;  1TN4 A;  1DGU A;  2BKH B;  2WC6 A;  2O60 A;  4NDD A;  1MF8 B;  1EJ3 A;  1QV1 A;  5AER A;  1YUS A;  1AP4 A;  1F54 A;  4OCI A;  2E6W A;  3GK1 A;  3OGN A;  1GM0 A;  2KAY A;  1WY9 A;  2Q4U A;  4A4B A;  5I2Q A;  1Q80 A;  2JWW A;  1C07 A;  1MXL C;  1EG4 A;  2Y4Q A;  2QDI A;  1IH0 A;  2KBI A;  1N65 A;  2KFF A;  1N0Y A;  1ZUZ A;  1PVA A;  2L50 A;  2F2O A;  2HQ8 A;  1A75 A;  1F4Q A;  1KK7 Z;  2PVB A;  1XYD A;  1M39 A;  5B8I B;  2GGZ A;  1TCO B;  3JTD C;  1A2X A;  2K2F A;  2MAZ A;  3K21 A;  2ZFD A;  1OSA A;  1BLQ A;  3OP0 A;  1KK8 B;  2EC6 B;  1GGW A;  1BU3 A;  3GOF A;  1NX2 A;  4MZL A;  1KWO C;  4PHK A;  1H4B A;  3CZ1 A;  1JF0 A;  3S0F A;  1JC2 A;  4INW A;  2LVJ A;  3TDZ A;  5CSJ A;  1W7J B;  1T14 A;  4JQ0 D;  1NIW A;  1KCY A;  1BF5 A;  1M63 B;  1H8B A;  3DVK A;  4CPV A;  4GBA A;  3EVV A;  1DQE A;  2OTG C;  5J3X A;  1B4C A;  1LIN A;  5HYD A;  2KI4 C;  1NUB A;  2KDH A;  5DKR A;  2ZND A;  3H4S E;  4PE4 A;  1KK7 Y;  4OVN F;  3PFV A;  1XFZ O;  4PE1 A;  2LAP A;  2PQL A;  3CDN A;  1NSH A;  1YRT B;  3EK4 A;  4PE7 A;  2MBX A;  2WCE A;  5KSZ A;  3DXL A;  1FBV A;  1QTX A;  3D76 A;  3NHT A;  4DRW A;  2D8N A;  2MLE C;  1DC1 A;  2M3W A;  1A4P A;  2ZN9 A;  2ZRT A;  3M0W A;  3C1V A;  1YTZ C;  2WCB A;  1IKU A;  2K7D A;  1PVB A;  2ZRS A;  1TRF A;  2ZNE A;  1TNQ A;  1UHJ A;  1UHH A;  2QEV A;  3SIB A;  4HRE E;  4XJK A;  4I5K A;  4FTG A;  3OB2 B;  2BBN A;  3D73 A;  1CNP A;  2NZ0 A;  4OKH A;  4L9M A;  5EL2 A;  2JUL A;  4MN0 A;  3QRX A;  3UO9 A;  2Q91 A;  3AAJ A;  2JU0 A;  1QAS A;  2JNX A;  3BOW A;  3KHE A;  3NSI A;  4AQJ A;  1K2H A;  3QME A;  3JTD B;  2M1U A;  1EXR A;  3BUX B;  2LC5 A;  3BYA A;  2KFH A;  1LKJ A;  1AJ4 A;  1MR8 A;  3DZT A;  4JPZ B;  5PAL A;  2FOT A;  2M7N A;  3SG7 A;  1QX7 A;  2WCF A;  1KWO B;  4MZJ A;  2WCK A;  5DIC A;  1XFY O;  2KI6 D;  3BJH A;  1JFJ A;  1HT9 A;  1SK6 D;  1UHK A;  2YGU A;  3NHI A;  2BAP A;  2BE6 A;  2SCP A;  1A75 B;  1QXP A;  1M31 A;  4YBH B;  4M2Q A;  2KNE A;  2V53 A;  2NXQ A;  2KI4 B;  1G33 A;  1IQ5 A;  1F71 A;  1BOC A;  3IQQ A;  5I8N A;  3BFH A;  3AKB A;  1IIO A;  1WRZ A;  1C7W A;  1DMO A;  3R1O A;  3IVT A;  1SPY A;  2LP3 A;  4TNC A;  3CS1 A;  1IJ5 A;  4JD9 A;  4MVF A;  2QPT A;  1QV0 A;  3SIA A;  1TTX A;  2L4I A;  1KFU L;  1XK4 A;  1S36 A;  3B6X A;  4IL1 A;  2P6B B;  1TIZ A;  2K7O A;  2BNX A;  3BUO B;  2HQW A;  2F33 A;  4DUQ A;  2M1K B;  1CTR A;  1Z2C B;  2JXC A;  4YGD B;  1LA0 A;  3O6B A;  3CR2 A;  5KTY A;  2GTE A;  1YRU B;  3L4A A;  1U5I A;  1X02 A;  4GGF A;  5IBW A;  4N1G A;  4R1E A;  1B8L A;  2B1U A;  4GGN A;  1JFK A;  2LE9 B;  3LK1 A;  1XK4 C;  4DS7 A;  3F45 A;  1F70 A;  2WND A;  2CT9 A;  3D10 A;  1K9U A;  2BBM A;  3NGV A;  2BCB A;  3S0D A;  3TUY B;  2F3Y A;  1UHI A;  1RFJ A;  1GJY A;  1QLK A;  4BY4 A;  1M45 A;  3FWC A;  4MRX A;  4P5O E;  1FW4 A;  1A29 A;  3SG6 A;  1L7Z A;  1DJI A;  5G08 A;  2LMU A;  1B8C A;  2SAS A;  3S0A A;  1FI6 A;  3ZNI A;  1NP8 A;  4QJ4 B;  2K7C A;  1A03 A;  1TUZ A;  4GGF C;  1EL4 A;  4XJK B;  1CMF A;  1ODB A;  3TDI A;  4NDC A;  2LV7 A;  1DVI A;  3OHM B;  4INX A;  4YGB B;  3NXA A;  1WLM A;  2DOQ A;  1K93 D;  2KLE A;  1IRJ A;  2I94 A;  2ERB A;  3I5H B;  1AHR A;  3BOW B;  3BUW B;  3O78 A;  1NPQ A;  2E30 A;  1NCX A;  1CM1 A;  3CZ2 A;  5HKY A;  1EH2 A;  2NLN A;  1F8H A;  1K9K A;  3FE9 A;  2PRU A;  1S6C A;  3SJS A;  4YI8 A;  4XYN A;  1W9Z A;  3I5F C;  2WCH A;  2JTT A;  4Q04 A;  3EK8 A;  1SR6 B;  1CFP A;  1SSE B;  2CBL A;  2BL0 C;  2K7B A;  1QIV A;  2Y1N A;  3B86 A;  1CFC A;  3WHT B;  2LHI A;  3BQ3 A;  3VRR A;  2KYF A;  4QJ5 B;  1ZFS A;  1DJX A;  3B87 A;  3DVE A;  1IGV A;  2JOJ A;  2JZI A;  4YGA A;  1FPW A;  2CTN A;  5D69 A;  1K95 A;  4KYN A;  2F3Z A;  2I7A A;  1JUO A;  2LP2 A;  2QAC A;  1RTP 1;  1V1G A;  4DIR A;  3SS3 A;  3CYZ A;  2F8P A;  2HET A;  3SG4 A;  3PLF B;  4CFQ A;  1J7P A;  2M8U A;  2JXL A;  1G4Y R;  1PAL A;  4PE0 A;  1DJW A;  2PMY A;  5JJG A;  1NWD A;  1IG5 A;  2WCL A;  1S1E A;  3O4X A;  3D0Y A;  1B1G A;  4GPL B;  5CPV A;  1XFU O;  1QLS A;  2IS9 A;  2HF5 A;  2KGR A;  1Y1X A;  1MWN A;  2CXJ A;  3IF7 A;  2MA2 A;  2ZKM X;  4FQT A;  2MJW B;  1TUJ A;  3IQO A;  5AFP A;  3I5G C;  1LS8 A;  2LCP A;  1KQM C;  2JC2 A;  1BOD A;  1QS7 A;  1L2O C;  1U5I B;  1UUS A;  1YVL A;  3DYE A;  4HSZ A;  4MSP A;  1G8I A;  1YX8 A;  2AUC A;  2L4H A;  1OZO A;  2L0P A;  3B88 A;  2H8V A;  1SW8 A;  3HX4 A;  3FWB A;  3O4Y A;  4JWQ A;  5TNC A;  1LVC D;  4MRY A;  2WCJ A;  3PM8 A;  3CR4 X;  4PAL A;  2G2B A;  1PUL A;  2F2P A;  4WQ3 A;  2JTZ A;  2LLS A;  4N5X A;  1OMD A;  5HKW A;  1NCY A;  1S26 D;  1V1F A;  2A4J A;  2KSP A;  3CGA A;  1SCM C;  1WRL A;  3PM2 A;  4F0Z B;  1YR5 A;  2G9B A;  3PN7 C;  1IQ3 A;  1WLZ A;  1BG1 A;  2FCD A;  5JOL A;  3CWG A;  3SG3 A;  3AKA A;  4NQG A;  5HLO A;  2QEO A;  4UPG A;  1CDM A;  4I5L B;  5FYX A;  3I5F B;  1YX7 A;  4ZCV A;  3KPX A;  2LLT A;  3FE6 A;  4WRI A;  1PSB A;  1DT7 B;  2OTG B;  2PSR A;  3SS4 A;  3D77 A;  3ICB A;  3KF9 A;  1AK8 A;  1S3P A;  1RRO A;  5DKQ A;  5K89 A;  1C3Y A;  2KQ6 A;  3V2L A;  3EKJ A;  1OOI X;  1AUI B;  3UNW A;  1MHO A;  4AOM A;  1J1E A;  3LL8 B;  2O5G A;  3E3R A;  4ORB B;  1XA5 A;  1NCZ A;  3OB1 B;  1OMR A;  5FI7 A;  3PAT A;  1AJ5 A;  1DJG A;  1OOF A;  1RJV A;  2M9G A;  4A4C A;  3S0G A;  2OPO A;  1ZOT B;  1C3Z A;  4BY5 A;  2KHN A;  3AAK A;  1BR1 B;  3A8R A;  1PK0 D;  2LAN A;  4F7F A;  1S5G Y;  3CAB A;  1NX0 A;  2WCM A;  3JVT C;  2LVI A;  5BPJ A;  4PCW A;  2R2I A;  3OX5 A;  3R1P A;  2EC6 C;  5I2L A;  1BMO A;  2KAX A;  2H61 C;  1B7T Z;  3ZWH A;  4I5J A;  1QIW A;  1Y6W A;  3EG5 B;  4MEW A;  4E68 A;  3Q8I A;  1KFU S;  3EVU A;  2QEB A;  2L98 A;  3PSR A;  2KGB C;  3I5G B;  1KQM B;  3SG5 A;  1BJF A;  1L2O B;  1UP5 A;  2CNP A;  3KO0 A;  3FIA A;  1SMG A;  2JT0 A;  2AMI A;  1NX3 A;  2K61 A;  4M2P A;  1SBJ A;  3FS7 A;  3NSK A;  1J55 A;  2P71 A;  4YGC B;  4GFT A;  1CMG A;  4PHJ A;  3HCM A;  2M49 B;  3NSL A;  5ER5 A;  1N2D A;  1Y1A A;  1QJT A;  5AEQ A;  1R2U A;  1P28 A;  3D0Y B;  1SCM B;  2I18 A;  3CTN A;  3PN7 B;  2LLU A;  4PHN A;  2CCM A;  2HPS A;  1CFD A;  3EK7 A;  3LLE A;  3TDU A;  1GQM A;  1XVJ A;  1DF0 A;  2NCO A;  3D74 A;  5CSN A;  1EG3 A;  4ZCU A;  4ETO A;  1GGZ A;  2KLD A;  2K8M B;  1B7T Y;  1BR4 B;  1K8U A;  4JKT A;  4M2O A;  5FI2 A;  3CZ0 A;  1K94 A;  1S6I A;  2I2R E;  3PJI A;  1K96 A;  3KEV A;  3R72 A;  5DKN A;  2LUC A;  1ALW A;  4MZK A;  2LMT A;  1M46 A;  1UWO A;  1IJ6 A;  3BFA A;  1B8R A;  5AXI A;  3OBV A;  2L2C A;  5HLV A;  4IJ7 A;  2JPT A;  1J7R A;  2NCP A;  1B9A A;  2KOT A;  3FE8 A;  3L4L A;  1JBA A;  1NYA A;  2BEC A;  2LVV A;  2L5X B;  5ER4 X;  1LXF C;  1OW4 A;  1TNP A;  2LM5 A;  4PDZ A;  5FI6 A;  3S0E A;  2M0R A;  2L51 A;  3DF0 A;  2MLF C;  3CZT X;  3PAL A;  4C0J A;  1F4O A;  2KBM A;  1MQ1 A;  1J1D A;  2FJU B;  3D75 A;  3N7H A;  3JVT B;  1SYM A;  1J7O A;  1E8A A;  4CLN A;  3VRQ A;  4P2Y B;  3WXA A;  3BFB A;  2JNF A;  1YVH A;  1LA3 A;  2K0J A;  1SRA A;  1OE9 B;  2L5Y A;  3DD4 A;  4PHM A;  2OS8 C;  1XFV O;  1CLM A;  3EKH A;  4YI9 A;  4C0L A;  2P70 A;  3K1E A;  1KSM A;  1FF1 A;  1R6P A;  1J7Q A;  1REC A;  3LCP C;  1C7V A;  4ICB A;  3NSO A;  2EGD A;  5I94 A;  4NDB A;  2LNK A;  3L47 A;  1SL7 A;  3VB1 A;  4C0K A;  1JSA A;  1CDL A;  1KFX L;  2AAO A;  1BT6 A;  1TNW A;  2BCX A;  2FJY A;  3BUN B;  1CFF A;  2ZN8 A;  1QVI Z;  5HKZ A;  2M7L A;  2GGM A;  2PAL A;  1CDN A;  3SG2 A;  2H2K A;  3GK4 X;  1D1O A;  1YUT A;  2KFG A;  2MRD A;  4USL A;  1WRK A;  3TS5 C;  2WOR A;  1MXE A;  2LHL A;  2KPH A;  1AVS A;  5D7F A;  2ISD A;  1CM4 A;  2BCA A;  2LVK A;  3DY9 A;  4HRH A;  3WNX B;  5GQQ C;  1VRK A;  1KFX S;  4FQO A;  1CLL A;  3OX6 A;  3A4U B;  1W7I B;  3D78 A;  2EHB A;  3I5I C;  1JF2 A;  1RK9 A;  1TWO A;  4WQ2 A;  4MLW A;  1NX1 A;  2MHH A;  1QX5 B;  5D3O A;  1DGV A;  4QJ3 B;  3CLN A;  1K9P A;  1WDC C;  1S5G Z;  1TCF A;  3DVM A;  2VRG A;  1SL8 A;  2BE4 A;  1ZMZ A;  4YGE B;  1DEK A;  1MUX A;  3VRN A;  1SNL A;  3DVJ A;  3R1V A;  1UHN A;  1XFW O;  2JT3 A;  4HRG A;  1DEL A;  2BL0 B;  1DF0 B;  1QVI Y;  4CFR A;  1OMV A;  3BUM B;  1FI5 A;  1DJZ A;  4D1E A;  2QEH A;  2LUX A;  3MSE B;  1SY9 A;  2L2E A;  4GAO A;  4YRU A;  3TUY C;  2H61 A;  2LMV A;  1XFX O;  2COL B;  3TZ1 A;  1KSO A;  1ORG A;  1DJY A;  1SKT A;  1XO5 A;  5KU1 A;  4PT1 A;  4AQI A;  1DJH A;  1Y1U A;  2KYC A;  3S0B A;  3VRO A;  5I2O A;  2WC8 A;  5HL1 A;  1CLB A;  1OOH A;  1RWY A;  3SS5 A;  1Y0V H;  1TNX A;  1YUU A;  1YUR A;  4CID A;  1CB1 A;  2OS8 B;  3GK2 A;  3VRP A;  4DCK A;  3BXK A;  4OZD A;  3LK0 A;  3RM1 A;  2WOS A;  2WC5 A;  1OZS A;  1S6J A;  2PAS A;  1PSR A;  1QWV A;  3DF0 B;  3I5H C;  4GNK B;  4N1F A;  1KK8 C;  5F6T A;  1DTL A;  3O2P A;  1SCV A;  4OV2 A;  1K90 D;  1PRW A;  1SL9 A;  2RGI A;  1TOP A;  1QAT A;  2GV5 A;  2K2A A;  2Y5I A;  3RLZ A;  3VGO A;  1OOJ A;  3RZS A;  2PYQ A;  1HQV A;  5CSF A;  1B47 A;  3B7A A;  1SR6 C;  2JRF A;  3TS5 B;  2KI6 C;  4U8D A;  5CSI A;  2Y1M A;  1KQV A;  1Z4H A;  2M97 A;  2K60 A;  5AAN A;  1QX2 A;  1UUR A;  2FCE A;  3WHU B;  1ZAC A; 
#chains in the Genus database with same CATH homology
 4ORA B;  2KQY A;  3I5I B;  3CR5 X;  4ORC B;  1IWQ A;  1WDC B;  3EVR A;  2KAV A;  2JQ6 A;  2BKI B;  2M29 A;  4OR9 B;  2TN4 A;  1CKK A;  4I5N B;  1CDP A;  1F55 A;  1JWD A;  2JT8 A;  4GUK A;  4MBE A;  1ALV A;  1OQP A;  1TN4 A;  1DGU A;  2BKH B;  4NDD A;  2O60 A;  1MF8 B;  1EJ3 A;  1QV1 A;  5AER A;  1YUS A;  1AP4 A;  1F54 A;  4OCI A;  2E6W A;  3GK1 A;  2KAY A;  1WY9 A;  2Q4U A;  4A4B A;  5I2Q A;  1Q80 A;  2JWW A;  1C07 A;  1MXL C;  1EG4 A;  2Y4Q A;  1IH0 A;  2KBI A;  1N65 A;  2KFF A;  1N0Y A;  1ZUZ A;  1PVA A;  2L50 A;  2F2O A;  2HQ8 A;  1A75 A;  1F4Q A;  1KK7 Z;  2PVB A;  1XYD A;  1M39 A;  5B8I B;  2GGZ A;  1TCO B;  3JTD C;  1A2X A;  2K2F A;  2MAZ A;  3K21 A;  2ZFD A;  1OSA A;  1BLQ A;  3OP0 A;  1KK8 B;  2EC6 B;  1GGW A;  1BU3 A;  3GOF A;  1NX2 A;  4MZL A;  1KWO C;  4PHK A;  1H4B A;  1JF0 A;  1JC2 A;  3TDZ A;  2LVJ A;  5CSJ A;  1W7J B;  4JQ0 D;  1NIW A;  1KCY A;  1BF5 A;  1M63 B;  1H8B A;  3DVK A;  4CPV A;  4GBA A;  3EVV A;  2OTG C;  1B4C A;  5J3X A;  1LIN A;  5HYD A;  2KI4 C;  1NUB A;  2KDH A;  5DKR A;  2ZND A;  3H4S E;  4PE4 A;  1KK7 Y;  4OVN F;  3PFV A;  1XFZ O;  4PE1 A;  2LAP A;  1NSH A;  1YRT B;  3EK4 A;  4PE7 A;  2MBX A;  2WCE A;  5KSZ A;  1FBV A;  1QTX A;  4DRW A;  2D8N A;  2MLE C;  2M3W A;  1A4P A;  2ZN9 A;  2ZRT A;  3M0W A;  3C1V A;  1YTZ C;  2WCB A;  1IKU A;  2K7D A;  1PVB A;  2ZRS A;  1TRF A;  2ZNE A;  1TNQ A;  1UHJ A;  1UHH A;  3SIB A;  4HRE E;  4XJK A;  4I5K A;  4FTG A;  3OB2 B;  2BBN A;  1CNP A;  2NZ0 A;  4OKH A;  4L9M A;  2JUL A;  4MN0 A;  3QRX A;  2Q91 A;  3AAJ A;  2JU0 A;  1QAS A;  2JNX A;  3BOW A;  3KHE A;  3NSI A;  4AQJ A;  1K2H A;  3JTD B;  2M1U A;  1EXR A;  3BUX B;  2LC5 A;  3BYA A;  2KFH A;  1LKJ A;  1AJ4 A;  1MR8 A;  4JPZ B;  5PAL A;  2FOT A;  2M7N A;  3SG7 A;  1QX7 A;  2WCF A;  1KWO B;  4MZJ A;  1XFY O;  2KI6 D;  1JFJ A;  1HT9 A;  1SK6 D;  1UHK A;  2BE6 A;  2SCP A;  1A75 B;  1QXP A;  1M31 A;  4YBH B;  4M2Q A;  2KNE A;  2V53 A;  2NXQ A;  2KI4 B;  1G33 A;  1IQ5 A;  1F71 A;  1BOC A;  3IQQ A;  5I8N A;  3AKB A;  1WRZ A;  1C7W A;  1DMO A;  1SPY A;  2LP3 A;  4TNC A;  3CS1 A;  1IJ5 A;  4MVF A;  2QPT A;  1QV0 A;  3SIA A;  1TTX A;  2L4I A;  1KFU L;  1XK4 A;  1S36 A;  4IL1 A;  2P6B B;  1TIZ A;  2K7O A;  3BUO B;  2HQW A;  2F33 A;  4DUQ A;  2M1K B;  1CTR A;  2JXC A;  4YGD B;  1LA0 A;  3O6B A;  3CR2 A;  5KTY A;  1YRU B;  1U5I A;  1X02 A;  4GGF A;  5IBW A;  4N1G A;  4R1E A;  1B8L A;  2B1U A;  4GGN A;  1JFK A;  2LE9 B;  3LK1 A;  1XK4 C;  4DS7 A;  3F45 A;  1F70 A;  2WND A;  2CT9 A;  3D10 A;  1K9U A;  2BBM A;  2BCB A;  3TUY B;  2F3Y A;  1UHI A;  1RFJ A;  1GJY A;  1QLK A;  4BY4 A;  1M45 A;  3FWC A;  4MRX A;  4P5O E;  1FW4 A;  1A29 A;  3SG6 A;  1L7Z A;  1DJI A;  5G08 A;  2LMU A;  1B8C A;  2SAS A;  1FI6 A;  3ZNI A;  1NP8 A;  4QJ4 B;  2K7C A;  1A03 A;  4GGF C;  1EL4 A;  4XJK B;  1CMF A;  1ODB A;  3TDI A;  4NDC A;  2LV7 A;  1DVI A;  3OHM B;  4YGB B;  3NXA A;  1WLM A;  2DOQ A;  1K93 D;  1IRJ A;  2I94 A;  3I5H B;  1AHR A;  3BOW B;  3BUW B;  3O78 A;  1NPQ A;  2E30 A;  1NCX A;  1CM1 A;  5HKY A;  1EH2 A;  2NLN A;  1F8H A;  1K9K A;  2PRU A;  1S6C A;  3SJS A;  4YI8 A;  4XYN A;  3I5F C;  2JTT A;  4Q04 A;  3EK8 A;  1SR6 B;  1CFP A;  2CBL A;  2BL0 C;  2K7B A;  1QIV A;  2Y1N A;  1CFC A;  3WHT B;  2LHI A;  3BQ3 A;  3VRR A;  2KYF A;  4QJ5 B;  1ZFS A;  1DJX A;  3DVE A;  1IGV A;  2JOJ A;  2JZI A;  4YGA A;  1FPW A;  2CTN A;  5D69 A;  1K95 A;  2F3Z A;  2I7A A;  1JUO A;  2LP2 A;  2QAC A;  1RTP 1;  1V1G A;  4DIR A;  2F8P A;  2HET A;  3SG4 A;  3PLF B;  4CFQ A;  1J7P A;  2M8U A;  2JXL A;  1G4Y R;  1PAL A;  4PE0 A;  1DJW A;  2PMY A;  5JJG A;  1NWD A;  1IG5 A;  1S1E A;  3D0Y A;  1B1G A;  4GPL B;  5CPV A;  1XFU O;  1QLS A;  2IS9 A;  2HF5 A;  2KGR A;  1Y1X A;  1MWN A;  2CXJ A;  3IF7 A;  2MA2 A;  2ZKM X;  5AFP A;  2MJW B;  3IQO A;  3I5G C;  2LCP A;  1KQM C;  2JC2 A;  1BOD A;  1QS7 A;  1L2O C;  1U5I B;  1UUS A;  1YVL A;  4HSZ A;  4MSP A;  1G8I A;  1YX8 A;  2AUC A;  2L4H A;  1OZO A;  2L0P A;  3HX4 A;  1SW8 A;  4JWQ A;  3FWB A;  3O4Y A;  5TNC A;  1LVC D;  4MRY A;  3PM8 A;  3CR4 X;  4PAL A;  2G2B A;  1PUL A;  2F2P A;  4WQ3 A;  2JTZ A;  2LLS A;  4N5X A;  1OMD A;  5HKW A;  1NCY A;  1S26 D;  1V1F A;  2A4J A;  2KSP A;  3CGA A;  1SCM C;  1WRL A;  4F0Z B;  1YR5 A;  2G9B A;  3PN7 C;  1IQ3 A;  1WLZ A;  1BG1 A;  2FCD A;  5JOL A;  3CWG A;  3SG3 A;  3AKA A;  4NQG A;  5HLO A;  4UPG A;  1CDM A;  4I5L B;  5FYX A;  3I5F B;  1YX7 A;  4ZCV A;  3KPX A;  2LLT A;  4WRI A;  1PSB A;  1DT7 B;  2OTG B;  2PSR A;  3ICB A;  3KF9 A;  1AK8 A;  1S3P A;  1RRO A;  5DKQ A;  5K89 A;  2KQ6 A;  3EKJ A;  1AUI B;  1MHO A;  4AOM A;  1J1E A;  3LL8 B;  2O5G A;  3E3R A;  4ORB B;  1XA5 A;  1NCZ A;  3OB1 B;  1OMR A;  3PAT A;  1AJ5 A;  1DJG A;  1RJV A;  2M9G A;  4A4C A;  2OPO A;  1ZOT B;  4BY5 A;  2KHN A;  3AAK A;  1BR1 B;  3A8R A;  1PK0 D;  2LAN A;  1S5G Y;  1NX0 A;  3JVT C;  2LVI A;  5BPJ A;  4PCW A;  2R2I A;  3OX5 A;  2EC6 C;  5I2L A;  1BMO A;  2KAX A;  2H61 C;  1B7T Z;  3ZWH A;  4I5J A;  1QIW A;  1Y6W A;  4E68 A;  4MEW A;  1KFU S;  3EVU A;  2L98 A;  3PSR A;  2KGB C;  3I5G B;  1KQM B;  3SG5 A;  1BJF A;  1L2O B;  1UP5 A;  2CNP A;  3KO0 A;  3FIA A;  1SMG A;  2JT0 A;  2AMI A;  1NX3 A;  2K61 A;  4M2P A;  1SBJ A;  3FS7 A;  3NSK A;  1J55 A;  4YGC B;  4GFT A;  1CMG A;  4PHJ A;  3HCM A;  2M49 B;  3NSL A;  5ER5 A;  1N2D A;  1Y1A A;  1QJT A;  5AEQ A;  1R2U A;  3D0Y B;  1SCM B;  2I18 A;  3CTN A;  3PN7 B;  2LLU A;  4PHN A;  2CCM A;  2HPS A;  1CFD A;  3EK7 A;  3LLE A;  3TDU A;  1GQM A;  1XVJ A;  1DF0 A;  2NCO A;  4ZCU A;  5CSN A;  1EG3 A;  4ETO A;  1GGZ A;  2K8M B;  1B7T Y;  1BR4 B;  1K8U A;  4M2O A;  1K94 A;  1S6I A;  2I2R E;  1K96 A;  3KEV A;  5DKN A;  2LUC A;  1ALW A;  4MZK A;  2LMT A;  1M46 A;  1UWO A;  1IJ6 A;  1B8R A;  5AXI A;  5HLV A;  2JPT A;  1J7R A;  2NCP A;  1B9A A;  2KOT A;  1JBA A;  1NYA A;  2BEC A;  2LVV A;  2L5X B;  5ER4 X;  1LXF C;  1TNP A;  2LM5 A;  4PDZ A;  2M0R A;  2L51 A;  3DF0 A;  2MLF C;  3CZT X;  3PAL A;  4C0J A;  1F4O A;  2KBM A;  1MQ1 A;  1J1D A;  2FJU B;  3JVT B;  1SYM A;  1J7O A;  1E8A A;  4CLN A;  3VRQ A;  4P2Y B;  3WXA A;  2JNF A;  1YVH A;  1LA3 A;  2K0J A;  1SRA A;  1OE9 B;  3DD4 A;  4PHM A;  2OS8 C;  1XFV O;  1CLM A;  3EKH A;  4YI9 A;  4C0L A;  1KSM A;  1FF1 A;  1R6P A;  1J7Q A;  1REC A;  3LCP C;  1C7V A;  4ICB A;  3NSO A;  2EGD A;  4NDB A;  2LNK A;  1SL7 A;  4C0K A;  1JSA A;  1CDL A;  1KFX L;  2AAO A;  1BT6 A;  1TNW A;  2BCX A;  3BUN B;  1CFF A;  2ZN8 A;  1QVI Z;  5HKZ A;  2M7L A;  2GGM A;  2PAL A;  1CDN A;  3SG2 A;  2H2K A;  3GK4 X;  1D1O A;  1YUT A;  2KFG A;  2MRD A;  4USL A;  1WRK A;  3TS5 C;  2WOR A;  1MXE A;  2LHL A;  1AVS A;  5D7F A;  2ISD A;  1CM4 A;  2BCA A;  2LVK A;  4HRH A;  3WNX B;  5GQQ C;  1VRK A;  1KFX S;  4FQO A;  1CLL A;  3OX6 A;  3A4U B;  1W7I B;  2EHB A;  3I5I C;  1JF2 A;  1RK9 A;  4WQ2 A;  4MLW A;  1NX1 A;  2MHH A;  1QX5 B;  1DGV A;  4QJ3 B;  3CLN A;  1K9P A;  1WDC C;  1S5G Z;  1TCF A;  3DVM A;  2VRG A;  1SL8 A;  2BE4 A;  1ZMZ A;  4YGE B;  1MUX A;  3VRN A;  1SNL A;  3DVJ A;  1UHN A;  1XFW O;  2JT3 A;  4HRG A;  2BL0 B;  1DF0 B;  1QVI Y;  4CFR A;  1OMV A;  3BUM B;  1FI5 A;  1DJZ A;  4D1E A;  3MSE B;  2LUX A;  4GAO A;  1SY9 A;  2L2E A;  4YRU A;  3TUY C;  2H61 A;  2LMV A;  1XFX O;  2COL B;  3TZ1 A;  1KSO A;  1DJY A;  1SKT A;  1XO5 A;  5KU1 A;  4AQI A;  1DJH A;  1Y1U A;  2KYC A;  3VRO A;  5I2O A;  2WC8 A;  1CLB A;  1RWY A;  1Y0V H;  1TNX A;  1YUU A;  1YUR A;  4CID A;  1CB1 A;  2OS8 B;  3GK2 A;  3VRP A;  4DCK A;  3BXK A;  3LK0 A;  3RM1 A;  2WOS A;  1OZS A;  1S6J A;  2PAS A;  1PSR A;  3DF0 B;  3I5H C;  4GNK B;  4N1F A;  5F6T A;  1KK8 C;  1DTL A;  3O2P A;  1SCV A;  4OV2 A;  1K90 D;  1PRW A;  1SL9 A;  2RGI A;  1TOP A;  1QAT A;  2GV5 A;  2K2A A;  2Y5I A;  3RLZ A;  3VGO A;  1OOJ A;  1HQV A;  5CSF A;  1B47 A;  3TS5 B;  1SR6 C;  2JRF A;  2KI6 C;  4U8D A;  5CSI A;  2Y1M A;  1KQV A;  2M97 A;  5AAN A;  1QX2 A;  1UUR A;  2FCE A;  3WHU B;  1ZAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...