2WC8A

S100a12 complex with zinc in the absence of calcium
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
92
structure length
88
Chain Sequence
STKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDAQVDFQEFISLVAIALKAAHYHTHKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN S100-A12
publication title The Crystal Structures of Human S100A12 in Apo Form and in Complex with Zinc: New Insights Into S100A12 Oligomerisation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 35
structure length 88
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2wc8A00
1CKKA 2CT9A 3SG2A 3M0WA 1ZUZA 2JT3A 4OKHA 2BKIB 1SRAA 1WRLA 1X02A 2NZ0A 1MHOA 4XJKA 5JJGA 3H4SE 4PALA 2M0RA 1CDMA 1JC2A 1TCFA 2COLB 1D1OA 1PK0D 1A75B 1IH0A 2EC6B 1DVIA 2FJUB 4NQGA 1SNLA 3NSOA 3DVKA 1NIWA 1EG4A 2M8UA 5KTYA 2F3ZA 1PSRA 5B8IB 4NDDA 2H2KA 2ZN9A 4CPVA 2HQWA 1QLKA 2LLSA 2F2PA 1OMDA 2WCFA 1YUTA 2OPOA 1QATA 1TOPA 2G2BA 1FW4A 3VRQA 1J7PA 1K9PA 1SMGA 5AXIA 4FQOA 1DF0B 4YGBB 5D7FA 4MVFA 1CFFA 3IQOA 1N2DA 1QVIY 2L50A 2MA2A 3DF0B 5D69A 1CTRA 1ZACA 1DJHA 1F54A 4I5LB 1KQMC 2CXJA 1JFJA 4IL1A 5HKWA 2JULA 1RK9A 1BODA 1TNXA 1KWOC 3VROA 2KI6D 1BU3A 1DF0A 1NCYA 1TCOB 1IQ5A 2GGZA 2LV7A 1B7TZ 1YUUA 4YI9A 1CLBA 3CR5X 1Y1XA 2BKHB 2CBLA 3TUYB 1LA3A 3CR2A 2LLUA 2L4IA 1B8CA 3IF7A 3LK1A 1XK4A 2HPSA 3I5HC 2KFFA 2LAPA 4PE0A 2KYFA 5DKRA 1S6IA 5DKNA 2LHIA 3TDUA 4PDZA 5AEQA 3HCMA 2M29A 1UHJA 1DJIA 1QTXA 3D0YB 2L0PA 4A4CA 2KFHA 1DJGA 1G8IA 1VRKA 2M9GA 1A03A 1CM4A 1LXFC 2KBMA 2TN4A 1OMVA 4MBEA 4NDBA 2Y5IA 1KK7Z 2NCPA 1BMOA 2ZN8A 2BCBA 4U8DA 1MWNA 3I5GB 4YBHB 2BCXA 1NP8A 1NX3A 2AAOA 3DD4A 1FI6A 1RTP1 1OZOA 3RM1A 3OHMB 1IJ6A 1UHIA 1MXLC 3DVJA 1TNPA 4ETOA 2KDHA 4WQ3A 1YURA 4UPGA 1NWDA 4YRUA 2CCMA 2KQYA 4PHKA 1KFXL 4HSZA 3I5IB 3AAJA 3KHEA 3OX6A 1JFKA 2P6BB 2QACA 1WY9A 4DS7A 2O5GA 2WCEA 3WHTB 1KK8C 2LMTA 3CS1A 5HLOA 1G4YR 2G9BA 2KYCA 1L2OB 1C7WA 1PALA 2K2AA 3FIAA 3NXAA 5KU1A 3GOFA 3NSKA 3A8RA 3DVMA 4GGNA 4YGDB 3VRRA 1S1EA 3KF9A 3BUXB 1YTZC 5HLVA 3EVRA 2LP3A 1B8RA 2JNFA 2BE4A 1K8UA 3LL8B 1M31A 1BLQA 4GPLB 1A2XA 1LVCD 2LM5A 2JQ6A 4PE7A 2A4JA 1CM1A 1QX7A 5DKQA 2PASA 4OVNF 3TDZA 1WLZA 1XFYO 1NX2A 2V53A 1BR4B 2NLNA 3VRPA 1CLMA 4L9MA 3JTDC 4HREE 2AUCA 2JZIA 1KSMA 5I8NA 1A4PA 2LVIA 4GFTA 4GAOA 1LINA 1UHHA 2Y1MA 1DJXA 3SG4A 1KFXS 1SCMC 1FBVA 2KI4C 1JF0A 2M7LA 4I5NB 1DJYA 4I5KA 2WCBA 1TNWA 2L5XB 5FYXA 1DJWA 1Y0VH 1YVLA 1AUIB 1EXRA 1ZOTB 2LNKA 1SL9A 2B1UA 3JVTB 1KQMB 1SPYA 2KFGA 2I18A 1R6PA 1YX7A 1KWOB 1ODBA 1JBAA 4CIDA 4PHMA 2BE6A 4CFQA 3IQQA 5K89A 2F33A 1UP5A 2O60A 2E30A 1GJYA 4N1GA 1QVIZ 2H61C 1JWDA 3PATA 3GK4X 4YGEB 1K93D 2BCAA 3LCPC 4ORAB 2M1KB 2F8PA 1A75A 2CNPA 2BBNA 1G33A 1IJ5A 1IG5A 4YI8A 1YRUB 1OQPA 2LHLA 1XA5A 3I5HB 1QASA 1CB1A 4DRWA 1J7RA 4BY5A 2AMIA 1DTLA 4P2YB 4Q04A 1GGZA 4M2PA 4P5OE 3OB1B 1XFVO 3FS7A 1SBJA 1XVJA 1K9KA 4TNCA 5CSNA 3SG6A 2ZRSA 4ORBB 2L51A 2L2EA 4GUKA 1H4BA 1RECA 3AAKA 1K2HA 4F0ZB 5AANA 4AOMA 1M45A 2BBMA 2BECA 1J7OA 1WDCB 3DF0A 4OV2A 4CFRA 2M7NA 5I2QA 1B1GA 2GGMA 1EH2A 3MSEB 3KO0A 1C07A 1N0YA 1SL7A 4AQJA 3FWCA 3AKAA 2K61A 4JWQA 2JU0A 1XFWO 3I5FB 1AK8A 3FWBA 2R2IA 2K7DA 2PALA 3PLFB 3SJSA 2OS8B 2MBXA 2E6WA 1XFXO 1XYDA 1YX8A 4WRIA 1H8BA 2L4HA 1S26D 2M1UA 1GQMA 3ICBA 1TTXA 1XO5A 2KGBC 1V1FA 1WLMA 4USLA 1QIVA 2OTGC 1TIZA 1GGWA 2Q91A 1S3PA 1TNQA 1SR6C 1Y6WA 2WC8A 3SG5A 5AFPA 2KI6C 5ER4X 2LVVA 1B47A 1M39A 1SK6D 1M63B 1B7TY 5J3XA 4ZCVA 3D0YA 1B8LA 2LE9B 1ZFSA 4M2OA 2KGRA 1SW8A 1W7IB 2KNEA 1CMGA 1B4CA 1W7JB 3BOWB 5G08A 1NX1A 1XK4C 3CR4X 3CWGA 1S6CA 1UUSA 1MXEA 3EK8A 3JTDB 1IGVA 3VRNA 4OR9B 1CDPA 1IKUA 2MLFC 1IQ3A 1QIWA 2JXLA 2JTTA 1QV1A 2K2FA 1SCMB 1SKTA 2LP2A 1KK7Y 2KAXA 3LLEA 4GGFA 1CFCA 2KI4B 5PALA 1V1GA 1BG1A 4E68A 3PN7C 1S5GZ 1YVHA 1J55A 3EK4A 1HQVA 1MF8B 3EKJA 1MR8A 1UWOA 3RLZA 4A4BA 2ZRTA 5BPJA 1CFPA 1MQ1A 1SCVA 1PVBA 4ICBA 5AERA 2HQ8A 1MUXA 2SASA 1DMOA 2JT8A 2L98A 4DIRA 2JWWA 2K7BA 1F55A 3PALA 2KHNA 3BUOB 1K96A 1K95A 1CFDA 1EG3A 2LANA 3K21A 2PVBA 3KPXA 4MSPA 2KQ6A 3SG3A 1FPWA 1KQVA 1UHNA 4GNKB 3EVUA 1U5IB 2F3YA 3VGOA 4N5XA 3BYAA 2IS9A 2BL0C 3DVEA 2JT0A 4PHNA 2Q4UA 1OZSA 3TS5C 2KOTA 2FCEA 3CTNA 4PHJA 5CPVA 2LMUA 1CMFA 1CDLA 2SCPA 2MHHA 2JRFA 1OE9B 4XYNA 4QJ5B 1DGUA 3CZTX 1DT7B 3TDIA 4DCKA 1HT9A 1J1DA 4HRHA 1QXPA 1TN4A 1U5IA 2I94A 4AQIA 3BXKA 4C0JA 4M2QA 1QJTA 3SIAA 1KSOA 1UHKA 1QX2A 1LKJA 1CLLA 3O6BA 4N1FA 1CNPA 1LA0A 2LCPA 1F4OA 4ORCB 3OP0A 1SY9A 2LUCA 1QLSA 1YRTB 2LVJA 5HKYA 2D8NA 4ZCUA 1UURA 3QRXA 4OCIA 1ZMZA 1RWYA 2JXCA 2JPTA 2NXQA 2ISDA 1AJ4A 1OMRA 1WRKA 4MRYA 1BOCA 1NX0A 1KFUL 4MRXA 1F8HA 2MLEC 2LLTA 3O78A 2ZNDA 1J1EA 1XFUO 1AHRA 1QX5B 1FF1A 1NSHA 2QPTA 1DJZA 1DGVA 3HX4A 3KEVA 3WXAA 1AVSA 1SL8A 2OTGB 5ER5A 1A29A 1SR6B 3TZ1A 1JSAA 2KBIA 3BUWB 2I2RE 3A4UB 4MZKA 1Q80A 2ZFDA 2M3WA 3ZWHA 1EL4A 1RFJA 2KSPA 2PMYA 1SYMA 4C0KA 2EHBA 2EC6C 3PFVA 1F71A 1Y1AA 3JVTC 5CSFA 2ZNEA 2JC2A 3OX5A 3O4YA 2CTNA 1NUBA 1PRWA 3CGAA 4PCWA 4D1EA 2K7OA 4JPZB 1KCYA 1YR5A 1NCZA 2LC5A 1KK8B 3NSIA 5I2LA 1FI5A 3WHUB 4YGCB 3EVVA 1K9UA 2LVKA 2ZKMX 4QJ4B 3EK7A 2DOQA 5KSZA 2MJWB 4YGAA 4R1EA 1N65A 3CLNA 3PM8A 5CSIA 1KFUS 2JTZA 1TRFA 2FOTA 3PN7B 1CDNA 2WNDA 5CSJA 4GBAA 5HYDA 2Y1NA 3BUNB 2K7CA 1IWQA 5GQQC 1BT6A 4NDCA 3SIBA 4FTGA 1R2UA 3AKBA 2HETA 2VRGA 1K94A 1RJVA 5IBWA 1QV0A 3GK1A 5HKZA 3LK0A 3OB2B 1Y1UA 2WORA 1M46A 1S36A 2F2OA 1OSAA 4MEWA 2RGIA 4BY4A 2MAZA 1JF2A 4PE4A 4MZLA 1ALVA 4CLNA 1NCXA 1PSBA 3WNXB 1NPQA 1WRZA 1QS7A 1WDCC 2GV5A 3ZNIA 3TUYC 4MN0A 2FCDA 4WQ2A 2JNXA 2BL0B 3NSLA 1NYAA 3TS5B 3BOWA 1PULA 1RROA 1BR1B 3I5FC 3BQ3A 5TNCA 4QJ3B 4PE1A 2OS8C 1C7VA 3GK2A 1EJ3A 1F70A 3BUMB 3F45A 1AP4A 3D10A 1JUOA 1K90D 2K0JA 5F6TA 1L7ZA 2Y4QA 4MLWA 3I5GC 3EKHA 3C1VA 2MRDA 1AJ5A 2K8MB 3E3RA 2NCOA 4JQ0D 1BF5A 3SG7A 4C0LA 5JOLA 1PVAA 2M97A 4I5JA 2HF5A 2PSRA 1E8AA 2EGDA 2PRUA 1B9AA 1IRJA 2M49B 4GGFC 3O2PA 2KAYA 4MZJA 1S5GY 4HRGA 1BJFA 2LMVA 4XJKB 3I5IC 1ALWA 1XFZO 2JOJA 2I7AA 3PSRA 5I2OA 1OOJA 2H61A 1J7QA 2KAVA 1YUSA 1F4QA 1L2OC 1S6JA 4DUQA 2LUXA 2WOSA
chains in the Genus database with same CATH superfamily
1CKKA 2CT9A 3L47A 3SG2A 3M0WA 1ZUZA 3BFHA 2JT3A 3PM2A 4OKHA 2BKIB 1SRAA 1WRLA 1X02A 2NZ0A 1MHOA 2KPHA 4XJKA 3BJHA 5JJGA 3H4SE 1QWVA 2M0RA 4PALA 3CZ0A 1CDMA 3CZ1A 1JC2A 1TCFA 2COLB 1D1OA 1PK0D 1A75B 1IH0A 2EC6B 1DVIA 2FJUB 4NQGA 4KYNA 1SNLA 3NSOA 3DVKA 3PJIA 1NIWA 1T14A 1EG4A 3EG5B 2M8UA 5KTYA 2F3ZA 1PSRA 2WCKA 5B8IB 4NDDA 2H2KA 2ZN9A 4CPVA 2HQWA 1QLKA 2LLSA 2F2PA 1OMDA 2QEOA 2WCFA 1ORGA 1YUTA 2OPOA 1QATA 1TOPA 2G2BA 1FW4A 3CZ2A 3VRQA 4JKTA 1J7PA 1K9PA 1SMGA 5AXIA 4FQOA 1DF0B 4YGBB 5D7FA 4MVFA 1CFFA 3IQOA 1N2DA 1QVIY 2L50A 2MA2A 3DF0B 5D69A 1CTRA 3UNWA 1ZACA 1DEKA 1DJHA 1F54A 4I5LB 1KQMC 2CXJA 3L4LA 1JFJA 4IL1A 5HKWA 2JULA 1RK9A 1BODA 1TNXA 1KWOC 3VROA 2KI6D 1BU3A 1DF0A 1NCYA 1TCOB 1IQ5A 2GGZA 2KLEA 2LV7A 1B7TZ 1YUUA 4YI9A 1CLBA 3CR5X 3B6XA 1Y1XA 2BKHB 2CBLA 3TUYB 1LA3A 3CR2A 2LLUA 2L4IA 1B8CA 1OOHA 3IF7A 3LK1A 1XK4A 2HPSA 3D73A 3I5HC 2KFFA 2LAPA 4PE0A 2KYFA 5DKRA 1S6IA 5DKNA 2LHIA 3TDUA 4PDZA 5AEQA 3HCMA 2BAPA 2M29A 1UHJA 1DJIA 1QTXA 3D0YB 2L0PA 4A4CA 2KFHA 1DJGA 1G8IA 1VRKA 2M9GA 1A03A 1CM4A 1LXFC 2KBMA 2TN4A 1OMVA 4MBEA 4NDBA 2Y5IA 1KK7Z 2NCPA 1BMOA 2ZN8A 3DXLA 3K1EA 2BCBA 4U8DA 1MWNA 3I5GB 4YBHB 2BCXA 1NP8A 1NX3A 2AAOA 3DD4A 1TWOA 1RTP1 1FI6A 1OZOA 3RM1A 2WC6A 3OHMB 1IJ6A 5DICA 1UHIA 1MXLC 3DVJA 1TNPA 4ETOA 2KDHA 3B7AA 4WQ3A 1W9ZA 2WC5A 1YURA 3S0GA 3SS5A 4UPGA 1NWDA 4YRUA 2CCMA 2KQYA 4PHKA 1KFXL 4HSZA 3I5IB 3AAJA 3KHEA 3OX6A 1JFKA 2P6BB 2QACA 1WY9A 4DS7A 2O5GA 2WCEA 3WHTB 1KK8C 2LMTA 3CS1A 5HLOA 1G4YR 2G9BA 2KYCA 1L2OB 3S0AA 1C7WA 1PALA 2K2AA 3FIAA 3NXAA 3VB1A 5KU1A 3GOFA 3NSKA 3A8RA 3DVMA 4GGNA 1DQEA 4YGDB 3VRRA 1S1EA 3KF9A 3BUXB 1YTZC 3S0BA 1TUZA 3EVRA 5HLVA 2PQLA 2LP3A 1XFRA 1B8RA 2WCMA 3DYEA 2P71A 2JNFA 2BE4A 1K8UA 3LL8B 1M31A 1BLQA 4GPLB 3R72A 1A2XA 1LVCD 2LM5A 2JQ6A 4PE7A 2A4JA 1CM1A 1QX7A 5DKQA 2PASA 4OVNF 3TDZA 3S0EA 1WLZA 1XFYO 1NX2A 1Z2CB 1BR4B 2V53A 2NLNA 3VRPA 1GM0A 1CLMA 2BNXA 4L9MA 3JTDC 4HREE 2AUCA 2JZIA 1KSMA 5I8NA 1A4PA 2LVIA 4GFTA 4GAOA 5FI2A 1OOIX 1LINA 1UHHA 2Y1MA 1DJXA 3SG4A 3S0FA 1KFXS 1SCMC 1FBVA 2KI4C 1JF0A 3QMEA 4I5NB 2M7LA 1DJYA 4I5KA 2WCBA 1TNWA 2L5XB 5FYXA 1DJWA 1Y0VH 1YVLA 3SS4A 3B86A 1AUIB 1EXRA 5FI6A 1Z4HA 1ZOTB 2LNKA 1SL9A 2B1UA 3JVTB 5EL2A 2QEHA 1KQMB 1SPYA 2KFGA 2I18A 3O4XA 1R6PA 1YX7A 1KWOB 1ODBA 1JBAA 4CIDA 4PHMA 2BE6A 4CFQA 3IQQA 5K89A 2F33A 1UP5A 2O60A 2E30A 1GJYA 4N1GA 1QVIZ 2H61C 2GTEA 1JWDA 3PATA 3GK4X 4YGEB 1K93D 2BCAA 3LCPC 4ORAB 2M1KB 2F8PA 1A75A 2CNPA 2BBNA 1G33A 1IIOA 2P70A 1IJ5A 1IG5A 4YI8A 1YRUB 1OQPA 2LHLA 1XA5A 3I5HB 1QASA 1CB1A 4DRWA 1J7RA 4BY5A 2AMIA 1DTLA 4P2YB 4Q04A 1GGZA 4M2PA 4P5OE 3OB1B 1XFVO 3CABA 3FS7A 1SBJA 1XVJA 1K9KA 4TNCA 5CSNA 3SG6A 2ZRSA 4ORBB 2L51A 2L2EA 5FI7A 4GUKA 1H4BA 1RECA 3AAKA 1K2HA 4F0ZB 5AANA 4AOMA 3IVTA 1M45A 2BBMA 2BECA 2L2CA 1J7OA 1WDCB 3DF0A 4OV2A 4CFRA 2M7NA 5I2QA 1B1GA 2GGMA 1EH2A 3MSEB 3KO0A 1C07A 1N0YA 1SL7A 2JPOA 3FWCA 4AQJA 3AKAA 2K61A 4JWQA 2JU0A 1XFWO 3I5FB 1AK8A 3FWBA 2R2IA 2K7DA 2PALA 3PLFB 3SJSA 2OS8B 2MBXA 2E6WA 1XFXO 1XYDA 1YX8A 4WRIA 1H8BA 3N7HA 2L4HA 1S26D 2M1UA 1GQMA 3ICBA 2H8VA 1TTXA 1XO5A 2KGBC 1V1FA 3B87A 1WLMA 4USLA 1QIVA 2OTGC 1TIZA 1GGWA 2Q91A 1S3PA 1TNQA 1SR6C 1Y6WA 2WC8A 3SG5A 5AFPA 2KI6C 4JD9A 2LVVA 5ER4X 1B47A 1M39A 1SK6D 2KLDA 1M63B 1B7TY 5J3XA 4ZCVA 3D0YA 3S0DA 3R1VA 1B8LA 2LE9B 1ZFSA 3FE6A 4M2OA 2KGRA 1SW8A 1W7IB 2KNEA 1CMGA 1B4CA 1W7JB 3BOWB 5G08A 1KQVA 1NX1A 1XK4C 3CR4X 3CWGA 1S6CA 1UUSA 1MXEA 3EK8A 3JTDB 1IGVA 4INXA 3VRNA 4OR9B 1CDPA 3OGNA 1IKUA 2MLFC 1IQ3A 1QIWA 2JXLA 2JTTA 1QV1A 2K2FA 1SCMB 1SKTA 2LP2A 1KK7Y 2KAXA 3LLEA 4GGFA 1CFCA 2KI4B 5PALA 1V1GA 1BG1A 4E68A 3PN7C 3FE9A 1S5GZ 1YVHA 1J55A 3EK4A 1HQVA 1MF8B 3EKJA 1MR8A 1UWOA 3RLZA 4A4BA 2ZRTA 5BPJA 1CFPA 1MQ1A 1SCVA 1PVBA 4ICBA 5AERA 2HQ8A 1MUXA 3D74A 2SASA 1DMOA 2JT8A 2L98A 4DIRA 2JWWA 2K7BA 1F55A 3PALA 2KHNA 3BUOB 4FQTA 1K96A 1OOGA 2QDIA 1K95A 3SS3A 1CFDA 1DELA 1EG3A 2LANA 1C3ZA 2PVBA 3DY9A 2KQ6A 3K21A 3KPXA 4MSPA 1UHNA 4OZDA 4GNKB 3EVUA 1FPWA 1U5IB 2F3YA 4PT1A 3VGOA 4N5XA 2WCHA 3BYAA 2IS9A 2BL0C 1C3YA 3DVEA 2JT0A 4PHNA 2Q4UA 1OZSA 3TS5C 2KOTA 5CSFA 2FCEA 3CTNA 3BFBA 4PHJA 5CPVA 2LMUA 1CMFA 1CDLA 2SCPA 5HL1A 2MHHA 2JRFA 1OE9B 4XYNA 4QJ5B 1DGUA 2L5YA 3CZTX 1DT7B 3TDIA 4DCKA 1HT9A 4F7FA 1J1DA 4HRHA 1QXPA 1TN4A 1U5IA 2I94A 4AQIA 3BXKA 4C0JA 4M2QA 1QJTA 2QEVA 3SIAA 1KSOA 1UHKA 1QX2A 1LKJA 1CLLA 3O6BA 2FJYA 4N1FA 1CNPA 1LA0A 2LCPA 1F4OA 4ORCB 3OP0A 1SY9A 3D76A 2LUCA 1QLSA 1YRTB 2LVJA 3BFAA 5HKYA 2D8NA 4ZCUA 1UURA 3QRXA 4OCIA 1ZMZA 1RWYA 2JXCA 2JPTA 2NXQA 2ISDA 1AJ4A 1OMRA 1WRKA 4MRYA 1BOCA 1NX0A 1KFUL 4MRXA 1F8HA 2MLEC 2LLTA 3O78A 2ZNDA 1J1EA 1XFUO 1AHRA 1QX5B 1FF1A 1NSHA 2QPTA 1DJZA 1DGVA 3HX4A 3KEVA 4INWA 3WXAA 1AVSA 1SL8A 2OTGB 5ER5A 1A29A 1SR6B 3TZ1A 2K60A 1JSAA 2KBIA 3BUWB 2I2RE 3A4UB 4MZKA 1Q80A 2ZFDA 3UO9A 2M3WA 3ZWHA 1EL4A 1RFJA 2KSPA 2PMYA 1SYMA 4C0KA 2EHBA 2EC6C 3CDNA 3D78A 3NHIA 3PFVA 1Y1AA 3D75A 3JVTC 2ZNEA 2JC2A 3OX5A 3O4YA 2CTNA 1NUBA 1PRWA 3CGAA 4PCWA 4D1EA 2K7OA 4JPZB 1KCYA 1YR5A 1NCZA 2LC5A 1KK8B 3NSIA 5I2LA 1OW4A 1FI5A 3WHUB 4YGCB 3EVVA 1K9UA 2LVKA 3D77A 2ZKMX 4QJ4B 3EK7A 2DOQA 5KSZA 5D3OA 2MJWB 3R1PA 4R1EA 4YGAA 3V2LA 1N65A 3CLNA 3PM8A 3DZTA 5CSIA 1KFUS 2JTZA 1TRFA 2FOTA 3PN7B 1CDNA 2WNDA 5CSJA 4GBAA 5HYDA 2Y1NA 3BUNB 2K7CA 3FE8A 1IWQA 5GQQC 1BT6A 4NDCA 3SIBA 2WCLA 3CYZA 4FTGA 3RZSA 1R2UA 3AKBA 2HETA 4IJ7A 2VRGA 1K94A 2PYQA 1RJVA 5IBWA 1QV0A 3GK1A 5HKZA 3LK0A 3OB2B 1Y1UA 2WORA 1M46A 1S36A 2F2OA 1OSAA 4MEWA 2RGIA 4BY4A 2MAZA 1JF2A 4PE4A 4MZLA 1ALVA 2ERBA 4CLNA 1NCXA 1PSBA 3WNXB 1NPQA 1WRZA 1QS7A 1WDCC 2GV5A 3ZNIA 3TUYC 4MN0A 2FCDA 4WQ2A 2JNXA 2BL0B 3NSLA 1NYAA 3L4AA 5I94A 3TS5B 3BOWA 1PULA 1RROA 1BR1B 3I5FC 3BQ3A 3SG3A 5TNCA 4QJ3B 4PE1A 3NHTA 3B88A 2OS8C 1C7VA 2WCJA 3GK2A 1EJ3A 1F70A 1SSEB 3BUMB 3F45A 1AP4A 3D10A 1JUOA 1K90D 2K0JA 5F6TA 1L7ZA 1P28A 2Y4QA 4MLWA 3I5GC 3EKHA 3C1VA 2MRDA 1AJ5A 2K8MB 3E3RA 2NCOA 4JQ0D 1BF5A 3SG7A 4C0LA 5JOLA 3OBVA 1PVAA 2M97A 2QEBA 3NGVA 4I5JA 2HF5A 1TUJA 2PSRA 1E8AA 2EGDA 2PRUA 1B9AA 1IRJA 2M49B 4GGFC 1OOFA 2KAYA 3O2PA 2YGUA 3R1OA 1DC1A 4MZJA 1S5GY 4HRGA 1BJFA 2LMVA 4XJKB 1F71A 3I5IC 1ALWA 1XFZO 2JOJA 2I7AA 3PSRA 5I2OA 1OOJA 2H61A 3Q8IA 1J7QA 2KAVA 1LS8A 1F4QA 1YUSA 1L2OC 1S6JA 4DUQA 2LUXA 2WOSA
chains in the Genus database with same CATH topology
1CKKA 2CT9A 3SG2A 3M0WA 1ZUZA 2JT3A 4OKHA 2BKIB 1SRAA 1WRLA 1X02A 2NZ0A 1MHOA 4XJKA 5JJGA 3H4SE 4PALA 2M0RA 1CDMA 1JC2A 1TCFA 2COLB 1D1OA 1PK0D 1A75B 1IH0A 2EC6B 1DVIA 2FJUB 4NQGA 1SNLA 3NSOA 3DVKA 1NIWA 1EG4A 2M8UA 5KTYA 2F3ZA 1PSRA 5B8IB 4NDDA 2H2KA 2ZN9A 4CPVA 2HQWA 1QLKA 2LLSA 2F2PA 1OMDA 2WCFA 1YUTA 2OPOA 1QATA 1TOPA 2G2BA 1FW4A 3VRQA 1J7PA 1K9PA 1SMGA 5AXIA 4FQOA 1DF0B 4YGBB 5D7FA 4MVFA 1CFFA 3IQOA 1N2DA 1QVIY 2L50A 2MA2A 3DF0B 5D69A 1CTRA 1ZACA 1DJHA 1F54A 4I5LB 1KQMC 2CXJA 1JFJA 4IL1A 5HKWA 2JULA 1RK9A 1BODA 1TNXA 1KWOC 3VROA 2KI6D 1BU3A 1DF0A 1NCYA 1TCOB 1IQ5A 2GGZA 2LV7A 1B7TZ 1YUUA 4YI9A 1CLBA 3CR5X 1Y1XA 2BKHB 2CBLA 3TUYB 1LA3A 3CR2A 2LLUA 2L4IA 1B8CA 3IF7A 3LK1A 1XK4A 2HPSA 3I5HC 2KFFA 2LAPA 4PE0A 2KYFA 5DKRA 1S6IA 5DKNA 2LHIA 3TDUA 4PDZA 5AEQA 3HCMA 2M29A 1UHJA 1DJIA 1QTXA 3D0YB 2L0PA 4A4CA 2KFHA 1DJGA 1G8IA 1VRKA 2M9GA 1A03A 1CM4A 1LXFC 2KBMA 2TN4A 1OMVA 4MBEA 4NDBA 2Y5IA 1KK7Z 2NCPA 1BMOA 2ZN8A 2BCBA 4U8DA 1MWNA 3I5GB 4YBHB 2BCXA 1NP8A 1NX3A 2AAOA 3DD4A 1FI6A 1RTP1 1OZOA 3RM1A 3OHMB 1IJ6A 1UHIA 1MXLC 3DVJA 1TNPA 4ETOA 2KDHA 4WQ3A 1YURA 4UPGA 1NWDA 4YRUA 2CCMA 2KQYA 4PHKA 1KFXL 4HSZA 3I5IB 3AAJA 3KHEA 3OX6A 1JFKA 2P6BB 2QACA 1WY9A 4DS7A 2O5GA 2WCEA 3WHTB 1KK8C 2LMTA 3CS1A 5HLOA 1G4YR 2G9BA 2KYCA 1L2OB 1C7WA 1PALA 2K2AA 3FIAA 3NXAA 5KU1A 3GOFA 3NSKA 3A8RA 3DVMA 4GGNA 4YGDB 3VRRA 1S1EA 3KF9A 3BUXB 1YTZC 5HLVA 3EVRA 2LP3A 1B8RA 2JNFA 2BE4A 1K8UA 3LL8B 1M31A 1BLQA 4GPLB 1A2XA 1LVCD 2LM5A 2JQ6A 4PE7A 2A4JA 1CM1A 1QX7A 5DKQA 2PASA 4OVNF 3TDZA 1WLZA 1XFYO 1NX2A 2V53A 1BR4B 2NLNA 3VRPA 1CLMA 4L9MA 3JTDC 4HREE 2AUCA 2JZIA 1KSMA 5I8NA 1A4PA 2LVIA 4GFTA 4GAOA 1LINA 1UHHA 2Y1MA 1DJXA 3SG4A 1KFXS 1SCMC 1FBVA 2KI4C 1JF0A 2M7LA 4I5NB 1DJYA 4I5KA 2WCBA 1TNWA 2L5XB 5FYXA 1DJWA 1Y0VH 1YVLA 1AUIB 1EXRA 1ZOTB 2LNKA 1SL9A 2B1UA 3JVTB 1KQMB 1SPYA 2KFGA 2I18A 1R6PA 1YX7A 1KWOB 1ODBA 1JBAA 4CIDA 4PHMA 2BE6A 4CFQA 3IQQA 5K89A 2F33A 1UP5A 2O60A 2E30A 1GJYA 4N1GA 1QVIZ 2H61C 1JWDA 3PATA 3GK4X 4YGEB 1K93D 2BCAA 3LCPC 4ORAB 2M1KB 2F8PA 1A75A 2CNPA 2BBNA 1G33A 1IJ5A 1IG5A 4YI8A 1YRUB 1OQPA 2LHLA 1XA5A 3I5HB 1QASA 1CB1A 4DRWA 1J7RA 4BY5A 2AMIA 1DTLA 4P2YB 4Q04A 1GGZA 4M2PA 4P5OE 3OB1B 1XFVO 3FS7A 1SBJA 1XVJA 1K9KA 4TNCA 5CSNA 3SG6A 2ZRSA 4ORBB 2L51A 2L2EA 4GUKA 1H4BA 1RECA 3AAKA 1K2HA 4F0ZB 5AANA 4AOMA 1M45A 2BBMA 2BECA 1J7OA 1WDCB 3DF0A 4OV2A 4CFRA 2M7NA 5I2QA 1B1GA 2GGMA 1EH2A 3MSEB 3KO0A 1C07A 1N0YA 1SL7A 4AQJA 3FWCA 3AKAA 2K61A 4JWQA 2JU0A 1XFWO 3I5FB 1AK8A 3FWBA 2R2IA 2K7DA 2PALA 3PLFB 3SJSA 2OS8B 2MBXA 2E6WA 1XFXO 1XYDA 1YX8A 4WRIA 1H8BA 2L4HA 1S26D 2M1UA 1GQMA 3ICBA 1TTXA 1XO5A 2KGBC 1V1FA 1WLMA 4USLA 1QIVA 2OTGC 1TIZA 1GGWA 2Q91A 1S3PA 1TNQA 1SR6C 1Y6WA 2WC8A 3SG5A 5AFPA 2KI6C 5ER4X 2LVVA 1B47A 1M39A 1SK6D 1M63B 1B7TY 5J3XA 4ZCVA 3D0YA 1B8LA 2LE9B 1ZFSA 4M2OA 2KGRA 1SW8A 1W7IB 2KNEA 1CMGA 1B4CA 1W7JB 3BOWB 5G08A 1NX1A 1XK4C 3CR4X 3CWGA 1S6CA 1UUSA 1MXEA 3EK8A 3JTDB 1IGVA 3VRNA 4OR9B 1CDPA 1IKUA 2MLFC 1IQ3A 1QIWA 2JXLA 2JTTA 1QV1A 2K2FA 1SCMB 1SKTA 2LP2A 1KK7Y 2KAXA 3LLEA 4GGFA 1CFCA 2KI4B 5PALA 1V1GA 1BG1A 4E68A 3PN7C 1S5GZ 1YVHA 1J55A 3EK4A 1HQVA 1MF8B 3EKJA 1MR8A 1UWOA 3RLZA 4A4BA 2ZRTA 5BPJA 1CFPA 1MQ1A 1SCVA 1PVBA 4ICBA 5AERA 2HQ8A 1MUXA 2SASA 1DMOA 2JT8A 2L98A 4DIRA 2JWWA 2K7BA 1F55A 3PALA 2KHNA 3BUOB 1K96A 1K95A 1CFDA 1EG3A 2LANA 3K21A 2PVBA 3KPXA 4MSPA 2KQ6A 3SG3A 1FPWA 1KQVA 1UHNA 4GNKB 3EVUA 1U5IB 2F3YA 3VGOA 4N5XA 3BYAA 2IS9A 2BL0C 3DVEA 2JT0A 4PHNA 2Q4UA 1OZSA 3TS5C 2KOTA 2FCEA 3CTNA 4PHJA 5CPVA 2LMUA 1CMFA 1CDLA 2SCPA 2MHHA 2JRFA 1OE9B 4XYNA 4QJ5B 1DGUA 3CZTX 1DT7B 3TDIA 4DCKA 1HT9A 1J1DA 4HRHA 1QXPA 1TN4A 1U5IA 2I94A 4AQIA 3BXKA 4C0JA 4M2QA 1QJTA 3SIAA 1KSOA 1UHKA 1QX2A 1LKJA 1CLLA 3O6BA 4N1FA 1CNPA 1LA0A 2LCPA 1F4OA 4ORCB 3OP0A 1SY9A 2LUCA 1QLSA 1YRTB 2LVJA 5HKYA 2D8NA 4ZCUA 1UURA 3QRXA 4OCIA 1ZMZA 1RWYA 2JXCA 2JPTA 2NXQA 2ISDA 1AJ4A 1OMRA 1WRKA 4MRYA 1BOCA 1NX0A 1KFUL 4MRXA 1F8HA 2MLEC 2LLTA 3O78A 2ZNDA 1J1EA 1XFUO 1AHRA 1QX5B 1FF1A 1NSHA 2QPTA 1DJZA 1DGVA 3HX4A 3KEVA 3WXAA 1AVSA 1SL8A 2OTGB 5ER5A 1A29A 1SR6B 3TZ1A 1JSAA 2KBIA 3BUWB 2I2RE 3A4UB 4MZKA 1Q80A 2ZFDA 2M3WA 3ZWHA 1EL4A 1RFJA 2KSPA 2PMYA 1SYMA 4C0KA 2EHBA 2EC6C 3PFVA 1F71A 1Y1AA 3JVTC 5CSFA 2ZNEA 2JC2A 3OX5A 3O4YA 2CTNA 1NUBA 1PRWA 3CGAA 4PCWA 4D1EA 2K7OA 4JPZB 1KCYA 1YR5A 1NCZA 2LC5A 1KK8B 3NSIA 5I2LA 1FI5A 3WHUB 4YGCB 3EVVA 1K9UA 2LVKA 2ZKMX 4QJ4B 3EK7A 2DOQA 5KSZA 2MJWB 4YGAA 4R1EA 1N65A 3CLNA 3PM8A 5CSIA 1KFUS 2JTZA 1TRFA 2FOTA 3PN7B 1CDNA 2WNDA 5CSJA 4GBAA 5HYDA 2Y1NA 3BUNB 2K7CA 1IWQA 5GQQC 1BT6A 4NDCA 3SIBA 4FTGA 1R2UA 3AKBA 2HETA 2VRGA 1K94A 1RJVA 5IBWA 1QV0A 3GK1A 5HKZA 3LK0A 3OB2B 1Y1UA 2WORA 1M46A 1S36A 2F2OA 1OSAA 4MEWA 2RGIA 4BY4A 2MAZA 1JF2A 4PE4A 4MZLA 1ALVA 4CLNA 1NCXA 1PSBA 3WNXB 1NPQA 1WRZA 1QS7A 1WDCC 2GV5A 3ZNIA 3TUYC 4MN0A 2FCDA 4WQ2A 2JNXA 2BL0B 3NSLA 1NYAA 3TS5B 3BOWA 1PULA 1RROA 1BR1B 3I5FC 3BQ3A 5TNCA 4QJ3B 4PE1A 2OS8C 1C7VA 3GK2A 1EJ3A 1F70A 3BUMB 3F45A 1AP4A 3D10A 1JUOA 1K90D 2K0JA 5F6TA 1L7ZA 2Y4QA 4MLWA 3I5GC 3EKHA 3C1VA 2MRDA 1AJ5A 2K8MB 3E3RA 2NCOA 4JQ0D 1BF5A 3SG7A 4C0LA 5JOLA 1PVAA 2M97A 4I5JA 2HF5A 2PSRA 1E8AA 2EGDA 2PRUA 1B9AA 1IRJA 2M49B 4GGFC 3O2PA 2KAYA 4MZJA 1S5GY 4HRGA 1BJFA 2LMVA 4XJKB 3I5IC 1ALWA 1XFZO 2JOJA 2I7AA 3PSRA 5I2OA 1OOJA 2H61A 1J7QA 2KAVA 1YUSA 1F4QA 1L2OC 1S6JA 4DUQA 2LUXA 2WOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CKK A;  2CT9 A;  3SG2 A;  3M0W A;  1ZUZ A;  2JT3 A;  4OKH A;  2BKI B;  1SRA A;  1WRL A;  1X02 A;  2NZ0 A;  1MHO A;  4XJK A;  5JJG A;  3H4S E;  4PAL A;  2M0R A;  1CDM A;  1JC2 A;  1TCF A;  2COL B;  1D1O A;  1PK0 D;  1A75 B;  1IH0 A;  2EC6 B;  1DVI A;  2FJU B;  4NQG A;  1SNL A;  3NSO A;  3DVK A;  1NIW A;  1EG4 A;  2M8U A;  5KTY A;  2F3Z A;  1PSR A;  5B8I B;  4NDD A;  2H2K A;  2ZN9 A;  4CPV A;  2HQW A;  1QLK A;  2LLS A;  2F2P A;  1OMD A;  2WCF A;  1YUT A;  2OPO A;  1QAT A;  1TOP A;  2G2B A;  1FW4 A;  3VRQ A;  1J7P A;  1K9P A;  1SMG A;  5AXI A;  4FQO A;  1DF0 B;  4YGB B;  5D7F A;  4MVF A;  1CFF A;  3IQO A;  1N2D A;  1QVI Y;  2L50 A;  2MA2 A;  3DF0 B;  5D69 A;  1CTR A;  1ZAC A;  1DJH A;  1F54 A;  4I5L B;  1KQM C;  2CXJ A;  1JFJ A;  4IL1 A;  5HKW A;  2JUL A;  1RK9 A;  1BOD A;  1TNX A;  1KWO C;  3VRO A;  2KI6 D;  1BU3 A;  1DF0 A;  1NCY A;  1TCO B;  1IQ5 A;  2GGZ A;  2LV7 A;  1B7T Z;  1YUU A;  4YI9 A;  1CLB A;  3CR5 X;  1Y1X A;  2BKH B;  2CBL A;  3TUY B;  1LA3 A;  3CR2 A;  2LLU A;  2L4I A;  1B8C A;  3IF7 A;  3LK1 A;  1XK4 A;  2HPS A;  3I5H C;  2KFF A;  2LAP A;  4PE0 A;  2KYF A;  5DKR A;  1S6I A;  5DKN A;  2LHI A;  3TDU A;  4PDZ A;  5AEQ A;  3HCM A;  2M29 A;  1UHJ A;  1DJI A;  1QTX A;  3D0Y B;  2L0P A;  4A4C A;  2KFH A;  1DJG A;  1G8I A;  1VRK A;  2M9G A;  1A03 A;  1CM4 A;  1LXF C;  2KBM A;  2TN4 A;  1OMV A;  4MBE A;  4NDB A;  2Y5I A;  1KK7 Z;  2NCP A;  1BMO A;  2ZN8 A;  2BCB A;  4U8D A;  1MWN A;  3I5G B;  4YBH B;  2BCX A;  1NP8 A;  1NX3 A;  2AAO A;  3DD4 A;  1FI6 A;  1RTP 1;  1OZO A;  3RM1 A;  3OHM B;  1IJ6 A;  1UHI A;  1MXL C;  3DVJ A;  1TNP A;  4ETO A;  2KDH A;  4WQ3 A;  1YUR A;  4UPG A;  1NWD A;  4YRU A;  2CCM A;  2KQY A;  4PHK A;  1KFX L;  4HSZ A;  3I5I B;  3AAJ A;  3KHE A;  3OX6 A;  1JFK A;  2P6B B;  2QAC A;  1WY9 A;  4DS7 A;  2O5G A;  2WCE A;  3WHT B;  1KK8 C;  2LMT A;  3CS1 A;  5HLO A;  1G4Y R;  2G9B A;  2KYC A;  1L2O B;  1C7W A;  1PAL A;  2K2A A;  3FIA A;  3NXA A;  5KU1 A;  3GOF A;  3NSK A;  3A8R A;  3DVM A;  4GGN A;  4YGD B;  3VRR A;  1S1E A;  3KF9 A;  3BUX B;  1YTZ C;  5HLV A;  3EVR A;  2LP3 A;  1B8R A;  2JNF A;  2BE4 A;  1K8U A;  3LL8 B;  1M31 A;  1BLQ A;  4GPL B;  1A2X A;  1LVC D;  2LM5 A;  2JQ6 A;  4PE7 A;  2A4J A;  1CM1 A;  1QX7 A;  5DKQ A;  2PAS A;  4OVN F;  3TDZ A;  1WLZ A;  1XFY O;  1NX2 A;  2V53 A;  1BR4 B;  2NLN A;  3VRP A;  1CLM A;  4L9M A;  3JTD C;  4HRE E;  2AUC A;  2JZI A;  1KSM A;  5I8N A;  1A4P A;  2LVI A;  4GFT A;  4GAO A;  1LIN A;  1UHH A;  2Y1M A;  1DJX A;  3SG4 A;  1KFX S;  1SCM C;  1FBV A;  2KI4 C;  1JF0 A;  2M7L A;  4I5N B;  1DJY A;  4I5K A;  2WCB A;  1TNW A;  2L5X B;  5FYX A;  1DJW A;  1Y0V H;  1YVL A;  1AUI B;  1EXR A;  1ZOT B;  2LNK A;  1SL9 A;  2B1U A;  3JVT B;  1KQM B;  1SPY A;  2KFG A;  2I18 A;  1R6P A;  1YX7 A;  1KWO B;  1ODB A;  1JBA A;  4CID A;  4PHM A;  2BE6 A;  4CFQ A;  3IQQ A;  5K89 A;  2F33 A;  1UP5 A;  2O60 A;  2E30 A;  1GJY A;  4N1G A;  1QVI Z;  2H61 C;  1JWD A;  3PAT A;  3GK4 X;  4YGE B;  1K93 D;  2BCA A;  3LCP C;  4ORA B;  2M1K B;  2F8P A;  1A75 A;  2CNP A;  2BBN A;  1G33 A;  1IJ5 A;  1IG5 A;  4YI8 A;  1YRU B;  1OQP A;  2LHL A;  1XA5 A;  3I5H B;  1QAS A;  1CB1 A;  4DRW A;  1J7R A;  4BY5 A;  2AMI A;  1DTL A;  4P2Y B;  4Q04 A;  1GGZ A;  4M2P A;  4P5O E;  3OB1 B;  1XFV O;  3FS7 A;  1SBJ A;  1XVJ A;  1K9K A;  4TNC A;  5CSN A;  3SG6 A;  2ZRS A;  4ORB B;  2L51 A;  2L2E A;  4GUK A;  1H4B A;  1REC A;  3AAK A;  1K2H A;  4F0Z B;  5AAN A;  4AOM A;  1M45 A;  2BBM A;  2BEC A;  1J7O A;  1WDC B;  3DF0 A;  4OV2 A;  4CFR A;  2M7N A;  5I2Q A;  1B1G A;  2GGM A;  1EH2 A;  3MSE B;  3KO0 A;  1C07 A;  1N0Y A;  1SL7 A;  4AQJ A;  3FWC A;  3AKA A;  2K61 A;  4JWQ A;  2JU0 A;  1XFW O;  3I5F B;  1AK8 A;  3FWB A;  2R2I A;  2K7D A;  2PAL A;  3PLF B;  3SJS A;  2OS8 B;  2MBX A;  2E6W A;  1XFX O;  1XYD A;  1YX8 A;  4WRI A;  1H8B A;  2L4H A;  1S26 D;  2M1U A;  1GQM A;  3ICB A;  1TTX A;  1XO5 A;  2KGB C;  1V1F A;  1WLM A;  4USL A;  1QIV A;  2OTG C;  1TIZ A;  1GGW A;  2Q91 A;  1S3P A;  1TNQ A;  1SR6 C;  1Y6W A;  2WC8 A;  3SG5 A;  5AFP A;  2KI6 C;  5ER4 X;  2LVV A;  1B47 A;  1M39 A;  1SK6 D;  1M63 B;  1B7T Y;  5J3X A;  4ZCV A;  3D0Y A;  1B8L A;  2LE9 B;  1ZFS A;  4M2O A;  2KGR A;  1SW8 A;  1W7I B;  2KNE A;  1CMG A;  1B4C A;  1W7J B;  3BOW B;  5G08 A;  1NX1 A;  1XK4 C;  3CR4 X;  3CWG A;  1S6C A;  1UUS A;  1MXE A;  3EK8 A;  3JTD B;  1IGV A;  3VRN A;  4OR9 B;  1CDP A;  1IKU A;  2MLF C;  1IQ3 A;  1QIW A;  2JXL A;  2JTT A;  1QV1 A;  2K2F A;  1SCM B;  1SKT A;  2LP2 A;  1KK7 Y;  2KAX A;  3LLE A;  4GGF A;  1CFC A;  2KI4 B;  5PAL A;  1V1G A;  1BG1 A;  4E68 A;  3PN7 C;  1S5G Z;  1YVH A;  1J55 A;  3EK4 A;  1HQV A;  1MF8 B;  3EKJ A;  1MR8 A;  1UWO A;  3RLZ A;  4A4B A;  2ZRT A;  5BPJ A;  1CFP A;  1MQ1 A;  1SCV A;  1PVB A;  4ICB A;  5AER A;  2HQ8 A;  1MUX A;  2SAS A;  1DMO A;  2JT8 A;  2L98 A;  4DIR A;  2JWW A;  2K7B A;  1F55 A;  3PAL A;  2KHN A;  3BUO B;  1K96 A;  1K95 A;  1CFD A;  1EG3 A;  2LAN A;  3K21 A;  2PVB A;  3KPX A;  4MSP A;  2KQ6 A;  3SG3 A;  1FPW A;  1KQV A;  1UHN A;  4GNK B;  3EVU A;  1U5I B;  2F3Y A;  3VGO A;  4N5X A;  3BYA A;  2IS9 A;  2BL0 C;  3DVE A;  2JT0 A;  4PHN A;  2Q4U A;  1OZS A;  3TS5 C;  2KOT A;  2FCE A;  3CTN A;  4PHJ A;  5CPV A;  2LMU A;  1CMF A;  1CDL A;  2SCP A;  2MHH A;  2JRF A;  1OE9 B;  4XYN A;  4QJ5 B;  1DGU A;  3CZT X;  1DT7 B;  3TDI A;  4DCK A;  1HT9 A;  1J1D A;  4HRH A;  1QXP A;  1TN4 A;  1U5I A;  2I94 A;  4AQI A;  3BXK A;  4C0J A;  4M2Q A;  1QJT A;  3SIA A;  1KSO A;  1UHK A;  1QX2 A;  1LKJ A;  1CLL A;  3O6B A;  4N1F A;  1CNP A;  1LA0 A;  2LCP A;  1F4O A;  4ORC B;  3OP0 A;  1SY9 A;  2LUC A;  1QLS A;  1YRT B;  2LVJ A;  5HKY A;  2D8N A;  4ZCU A;  1UUR A;  3QRX A;  4OCI A;  1ZMZ A;  1RWY A;  2JXC A;  2JPT A;  2NXQ A;  2ISD A;  1AJ4 A;  1OMR A;  1WRK A;  4MRY A;  1BOC A;  1NX0 A;  1KFU L;  4MRX A;  1F8H A;  2MLE C;  2LLT A;  3O78 A;  2ZND A;  1J1E A;  1XFU O;  1AHR A;  1QX5 B;  1FF1 A;  1NSH A;  2QPT A;  1DJZ A;  1DGV A;  3HX4 A;  3KEV A;  3WXA A;  1AVS A;  1SL8 A;  2OTG B;  5ER5 A;  1A29 A;  1SR6 B;  3TZ1 A;  1JSA A;  2KBI A;  3BUW B;  2I2R E;  3A4U B;  4MZK A;  1Q80 A;  2ZFD A;  2M3W A;  3ZWH A;  1EL4 A;  1RFJ A;  2KSP A;  2PMY A;  1SYM A;  4C0K A;  2EHB A;  2EC6 C;  3PFV A;  1F71 A;  1Y1A A;  3JVT C;  5CSF A;  2ZNE A;  2JC2 A;  3OX5 A;  3O4Y A;  2CTN A;  1NUB A;  1PRW A;  3CGA A;  4PCW A;  4D1E A;  2K7O A;  4JPZ B;  1KCY A;  1YR5 A;  1NCZ A;  2LC5 A;  1KK8 B;  3NSI A;  5I2L A;  1FI5 A;  3WHU B;  4YGC B;  3EVV A;  1K9U A;  2LVK A;  2ZKM X;  4QJ4 B;  3EK7 A;  2DOQ A;  5KSZ A;  2MJW B;  4YGA A;  4R1E A;  1N65 A;  3CLN A;  3PM8 A;  5CSI A;  1KFU S;  2JTZ A;  1TRF A;  2FOT A;  3PN7 B;  1CDN A;  2WND A;  5CSJ A;  4GBA A;  5HYD A;  2Y1N A;  3BUN B;  2K7C A;  1IWQ A;  5GQQ C;  1BT6 A;  4NDC A;  3SIB A;  4FTG A;  1R2U A;  3AKB A;  2HET A;  2VRG A;  1K94 A;  1RJV A;  5IBW A;  1QV0 A;  3GK1 A;  5HKZ A;  3LK0 A;  3OB2 B;  1Y1U A;  2WOR A;  1M46 A;  1S36 A;  2F2O A;  1OSA A;  4MEW A;  2RGI A;  4BY4 A;  2MAZ A;  1JF2 A;  4PE4 A;  4MZL A;  1ALV A;  4CLN A;  1NCX A;  1PSB A;  3WNX B;  1NPQ A;  1WRZ A;  1QS7 A;  1WDC C;  2GV5 A;  3ZNI A;  3TUY C;  4MN0 A;  2FCD A;  4WQ2 A;  2JNX A;  2BL0 B;  3NSL A;  1NYA A;  3TS5 B;  3BOW A;  1PUL A;  1RRO A;  1BR1 B;  3I5F C;  3BQ3 A;  5TNC A;  4QJ3 B;  4PE1 A;  2OS8 C;  1C7V A;  3GK2 A;  1EJ3 A;  1F70 A;  3BUM B;  3F45 A;  1AP4 A;  3D10 A;  1JUO A;  1K90 D;  2K0J A;  5F6T A;  1L7Z A;  2Y4Q A;  4MLW A;  3I5G C;  3EKH A;  3C1V A;  2MRD A;  1AJ5 A;  2K8M B;  3E3R A;  2NCO A;  4JQ0 D;  1BF5 A;  3SG7 A;  4C0L A;  5JOL A;  1PVA A;  2M97 A;  4I5J A;  2HF5 A;  2PSR A;  1E8A A;  2EGD A;  2PRU A;  1B9A A;  1IRJ A;  2M49 B;  4GGF C;  3O2P A;  2KAY A;  4MZJ A;  1S5G Y;  4HRG A;  1BJF A;  2LMV A;  4XJK B;  3I5I C;  1ALW A;  1XFZ O;  2JOJ A;  2I7A A;  3PSR A;  5I2O A;  1OOJ A;  2H61 A;  1J7Q A;  2KAV A;  1YUS A;  1F4Q A;  1L2O C;  1S6J A;  4DUQ A;  2LUX A;  2WOS A; 
#chains in the Genus database with same CATH topology
 1CKK A;  2CT9 A;  3L47 A;  3SG2 A;  3M0W A;  1ZUZ A;  3BFH A;  2JT3 A;  3PM2 A;  4OKH A;  2BKI B;  1SRA A;  1WRL A;  1X02 A;  2NZ0 A;  1MHO A;  2KPH A;  4XJK A;  3BJH A;  5JJG A;  3H4S E;  1QWV A;  2M0R A;  4PAL A;  3CZ0 A;  1CDM A;  3CZ1 A;  1JC2 A;  1TCF A;  2COL B;  1D1O A;  1PK0 D;  1A75 B;  1IH0 A;  2EC6 B;  1DVI A;  2FJU B;  4NQG A;  4KYN A;  1SNL A;  3NSO A;  3DVK A;  3PJI A;  1NIW A;  1T14 A;  1EG4 A;  3EG5 B;  2M8U A;  5KTY A;  2F3Z A;  1PSR A;  2WCK A;  5B8I B;  4NDD A;  2H2K A;  2ZN9 A;  4CPV A;  2HQW A;  1QLK A;  2LLS A;  2F2P A;  1OMD A;  2QEO A;  2WCF A;  1ORG A;  1YUT A;  2OPO A;  1QAT A;  1TOP A;  2G2B A;  1FW4 A;  3CZ2 A;  3VRQ A;  4JKT A;  1J7P A;  1K9P A;  1SMG A;  5AXI A;  4FQO A;  1DF0 B;  4YGB B;  5D7F A;  4MVF A;  1CFF A;  3IQO A;  1N2D A;  1QVI Y;  2L50 A;  2MA2 A;  3DF0 B;  5D69 A;  1CTR A;  3UNW A;  1ZAC A;  1DEK A;  1DJH A;  1F54 A;  4I5L B;  1KQM C;  2CXJ A;  3L4L A;  1JFJ A;  4IL1 A;  5HKW A;  2JUL A;  1RK9 A;  1BOD A;  1TNX A;  1KWO C;  3VRO A;  2KI6 D;  1BU3 A;  1DF0 A;  1NCY A;  1TCO B;  1IQ5 A;  2GGZ A;  2KLE A;  2LV7 A;  1B7T Z;  1YUU A;  4YI9 A;  1CLB A;  3CR5 X;  3B6X A;  1Y1X A;  2BKH B;  2CBL A;  3TUY B;  1LA3 A;  3CR2 A;  2LLU A;  2L4I A;  1B8C A;  1OOH A;  3IF7 A;  3LK1 A;  1XK4 A;  2HPS A;  3D73 A;  3I5H C;  2KFF A;  2LAP A;  4PE0 A;  2KYF A;  5DKR A;  1S6I A;  5DKN A;  2LHI A;  3TDU A;  4PDZ A;  5AEQ A;  3HCM A;  2BAP A;  2M29 A;  1UHJ A;  1DJI A;  1QTX A;  3D0Y B;  2L0P A;  4A4C A;  2KFH A;  1DJG A;  1G8I A;  1VRK A;  2M9G A;  1A03 A;  1CM4 A;  1LXF C;  2KBM A;  2TN4 A;  1OMV A;  4MBE A;  4NDB A;  2Y5I A;  1KK7 Z;  2NCP A;  1BMO A;  2ZN8 A;  3DXL A;  3K1E A;  2BCB A;  4U8D A;  1MWN A;  3I5G B;  4YBH B;  2BCX A;  1NP8 A;  1NX3 A;  2AAO A;  3DD4 A;  1TWO A;  1RTP 1;  1FI6 A;  1OZO A;  3RM1 A;  2WC6 A;  3OHM B;  1IJ6 A;  5DIC A;  1UHI A;  1MXL C;  3DVJ A;  1TNP A;  4ETO A;  2KDH A;  3B7A A;  4WQ3 A;  1W9Z A;  2WC5 A;  1YUR A;  3S0G A;  3SS5 A;  4UPG A;  1NWD A;  4YRU A;  2CCM A;  2KQY A;  4PHK A;  1KFX L;  4HSZ A;  3I5I B;  3AAJ A;  3KHE A;  3OX6 A;  1JFK A;  2P6B B;  2QAC A;  1WY9 A;  4DS7 A;  2O5G A;  2WCE A;  3WHT B;  1KK8 C;  2LMT A;  3CS1 A;  5HLO A;  1G4Y R;  2G9B A;  2KYC A;  1L2O B;  3S0A A;  1C7W A;  1PAL A;  2K2A A;  3FIA A;  3NXA A;  3VB1 A;  5KU1 A;  3GOF A;  3NSK A;  3A8R A;  3DVM A;  4GGN A;  1DQE A;  4YGD B;  3VRR A;  1S1E A;  3KF9 A;  3BUX B;  1YTZ C;  3S0B A;  1TUZ A;  3EVR A;  5HLV A;  2PQL A;  2LP3 A;  1XFR A;  1B8R A;  2WCM A;  3DYE A;  2P71 A;  2JNF A;  2BE4 A;  1K8U A;  3LL8 B;  1M31 A;  1BLQ A;  4GPL B;  3R72 A;  1A2X A;  1LVC D;  2LM5 A;  2JQ6 A;  4PE7 A;  2A4J A;  1CM1 A;  1QX7 A;  5DKQ A;  2PAS A;  4OVN F;  3TDZ A;  3S0E A;  1WLZ A;  1XFY O;  1NX2 A;  1Z2C B;  1BR4 B;  2V53 A;  2NLN A;  3VRP A;  1GM0 A;  1CLM A;  2BNX A;  4L9M A;  3JTD C;  4HRE E;  2AUC A;  2JZI A;  1KSM A;  5I8N A;  1A4P A;  2LVI A;  4GFT A;  4GAO A;  5FI2 A;  1OOI X;  1LIN A;  1UHH A;  2Y1M A;  1DJX A;  3SG4 A;  3S0F A;  1KFX S;  1SCM C;  1FBV A;  2KI4 C;  1JF0 A;  3QME A;  4I5N B;  2M7L A;  1DJY A;  4I5K A;  2WCB A;  1TNW A;  2L5X B;  5FYX A;  1DJW A;  1Y0V H;  1YVL A;  3SS4 A;  3B86 A;  1AUI B;  1EXR A;  5FI6 A;  1Z4H A;  1ZOT B;  2LNK A;  1SL9 A;  2B1U A;  3JVT B;  5EL2 A;  2QEH A;  1KQM B;  1SPY A;  2KFG A;  2I18 A;  3O4X A;  1R6P A;  1YX7 A;  1KWO B;  1ODB A;  1JBA A;  4CID A;  4PHM A;  2BE6 A;  4CFQ A;  3IQQ A;  5K89 A;  2F33 A;  1UP5 A;  2O60 A;  2E30 A;  1GJY A;  4N1G A;  1QVI Z;  2H61 C;  2GTE A;  1JWD A;  3PAT A;  3GK4 X;  4YGE B;  1K93 D;  2BCA A;  3LCP C;  4ORA B;  2M1K B;  2F8P A;  1A75 A;  2CNP A;  2BBN A;  1G33 A;  1IIO A;  2P70 A;  1IJ5 A;  1IG5 A;  4YI8 A;  1YRU B;  1OQP A;  2LHL A;  1XA5 A;  3I5H B;  1QAS A;  1CB1 A;  4DRW A;  1J7R A;  4BY5 A;  2AMI A;  1DTL A;  4P2Y B;  4Q04 A;  1GGZ A;  4M2P A;  4P5O E;  3OB1 B;  1XFV O;  3CAB A;  3FS7 A;  1SBJ A;  1XVJ A;  1K9K A;  4TNC A;  5CSN A;  3SG6 A;  2ZRS A;  4ORB B;  2L51 A;  2L2E A;  5FI7 A;  4GUK A;  1H4B A;  1REC A;  3AAK A;  1K2H A;  4F0Z B;  5AAN A;  4AOM A;  3IVT A;  1M45 A;  2BBM A;  2BEC A;  2L2C A;  1J7O A;  1WDC B;  3DF0 A;  4OV2 A;  4CFR A;  2M7N A;  5I2Q A;  1B1G A;  2GGM A;  1EH2 A;  3MSE B;  3KO0 A;  1C07 A;  1N0Y A;  1SL7 A;  2JPO A;  3FWC A;  4AQJ A;  3AKA A;  2K61 A;  4JWQ A;  2JU0 A;  1XFW O;  3I5F B;  1AK8 A;  3FWB A;  2R2I A;  2K7D A;  2PAL A;  3PLF B;  3SJS A;  2OS8 B;  2MBX A;  2E6W A;  1XFX O;  1XYD A;  1YX8 A;  4WRI A;  1H8B A;  3N7H A;  2L4H A;  1S26 D;  2M1U A;  1GQM A;  3ICB A;  2H8V A;  1TTX A;  1XO5 A;  2KGB C;  1V1F A;  3B87 A;  1WLM A;  4USL A;  1QIV A;  2OTG C;  1TIZ A;  1GGW A;  2Q91 A;  1S3P A;  1TNQ A;  1SR6 C;  1Y6W A;  2WC8 A;  3SG5 A;  5AFP A;  2KI6 C;  4JD9 A;  2LVV A;  5ER4 X;  1B47 A;  1M39 A;  1SK6 D;  2KLD A;  1M63 B;  1B7T Y;  5J3X A;  4ZCV A;  3D0Y A;  3S0D A;  3R1V A;  1B8L A;  2LE9 B;  1ZFS A;  3FE6 A;  4M2O A;  2KGR A;  1SW8 A;  1W7I B;  2KNE A;  1CMG A;  1B4C A;  1W7J B;  3BOW B;  5G08 A;  1KQV A;  1NX1 A;  1XK4 C;  3CR4 X;  3CWG A;  1S6C A;  1UUS A;  1MXE A;  3EK8 A;  3JTD B;  1IGV A;  4INX A;  3VRN A;  4OR9 B;  1CDP A;  3OGN A;  1IKU A;  2MLF C;  1IQ3 A;  1QIW A;  2JXL A;  2JTT A;  1QV1 A;  2K2F A;  1SCM B;  1SKT A;  2LP2 A;  1KK7 Y;  2KAX A;  3LLE A;  4GGF A;  1CFC A;  2KI4 B;  5PAL A;  1V1G A;  1BG1 A;  4E68 A;  3PN7 C;  3FE9 A;  1S5G Z;  1YVH A;  1J55 A;  3EK4 A;  1HQV A;  1MF8 B;  3EKJ A;  1MR8 A;  1UWO A;  3RLZ A;  4A4B A;  2ZRT A;  5BPJ A;  1CFP A;  1MQ1 A;  1SCV A;  1PVB A;  4ICB A;  5AER A;  2HQ8 A;  1MUX A;  3D74 A;  2SAS A;  1DMO A;  2JT8 A;  2L98 A;  4DIR A;  2JWW A;  2K7B A;  1F55 A;  3PAL A;  2KHN A;  3BUO B;  4FQT A;  1K96 A;  1OOG A;  2QDI A;  1K95 A;  3SS3 A;  1CFD A;  1DEL A;  1EG3 A;  2LAN A;  1C3Z A;  2PVB A;  3DY9 A;  2KQ6 A;  3K21 A;  3KPX A;  4MSP A;  1UHN A;  4OZD A;  4GNK B;  3EVU A;  1FPW A;  1U5I B;  2F3Y A;  4PT1 A;  3VGO A;  4N5X A;  2WCH A;  3BYA A;  2IS9 A;  2BL0 C;  1C3Y A;  3DVE A;  2JT0 A;  4PHN A;  2Q4U A;  1OZS A;  3TS5 C;  2KOT A;  5CSF A;  2FCE A;  3CTN A;  3BFB A;  4PHJ A;  5CPV A;  2LMU A;  1CMF A;  1CDL A;  2SCP A;  5HL1 A;  2MHH A;  2JRF A;  1OE9 B;  4XYN A;  4QJ5 B;  1DGU A;  2L5Y A;  3CZT X;  1DT7 B;  3TDI A;  4DCK A;  1HT9 A;  4F7F A;  1J1D A;  4HRH A;  1QXP A;  1TN4 A;  1U5I A;  2I94 A;  4AQI A;  3BXK A;  4C0J A;  4M2Q A;  1QJT A;  2QEV A;  3SIA A;  1KSO A;  1UHK A;  1QX2 A;  1LKJ A;  1CLL A;  3O6B A;  2FJY A;  4N1F A;  1CNP A;  1LA0 A;  2LCP A;  1F4O A;  4ORC B;  3OP0 A;  1SY9 A;  3D76 A;  2LUC A;  1QLS A;  1YRT B;  2LVJ A;  3BFA A;  5HKY A;  2D8N A;  4ZCU A;  1UUR A;  3QRX A;  4OCI A;  1ZMZ A;  1RWY A;  2JXC A;  2JPT A;  2NXQ A;  2ISD A;  1AJ4 A;  1OMR A;  1WRK A;  4MRY A;  1BOC A;  1NX0 A;  1KFU L;  4MRX A;  1F8H A;  2MLE C;  2LLT A;  3O78 A;  2ZND A;  1J1E A;  1XFU O;  1AHR A;  1QX5 B;  1FF1 A;  1NSH A;  2QPT A;  1DJZ A;  1DGV A;  3HX4 A;  3KEV A;  4INW A;  3WXA A;  1AVS A;  1SL8 A;  2OTG B;  5ER5 A;  1A29 A;  1SR6 B;  3TZ1 A;  2K60 A;  1JSA A;  2KBI A;  3BUW B;  2I2R E;  3A4U B;  4MZK A;  1Q80 A;  2ZFD A;  3UO9 A;  2M3W A;  3ZWH A;  1EL4 A;  1RFJ A;  2KSP A;  2PMY A;  1SYM A;  4C0K A;  2EHB A;  2EC6 C;  3CDN A;  3D78 A;  3NHI A;  3PFV A;  1Y1A A;  3D75 A;  3JVT C;  2ZNE A;  2JC2 A;  3OX5 A;  3O4Y A;  2CTN A;  1NUB A;  1PRW A;  3CGA A;  4PCW A;  4D1E A;  2K7O A;  4JPZ B;  1KCY A;  1YR5 A;  1NCZ A;  2LC5 A;  1KK8 B;  3NSI A;  5I2L A;  1OW4 A;  1FI5 A;  3WHU B;  4YGC B;  3EVV A;  1K9U A;  2LVK A;  3D77 A;  2ZKM X;  4QJ4 B;  3EK7 A;  2DOQ A;  5KSZ A;  5D3O A;  2MJW B;  3R1P A;  4R1E A;  4YGA A;  3V2L A;  1N65 A;  3CLN A;  3PM8 A;  3DZT A;  5CSI A;  1KFU S;  2JTZ A;  1TRF A;  2FOT A;  3PN7 B;  1CDN A;  2WND A;  5CSJ A;  4GBA A;  5HYD A;  2Y1N A;  3BUN B;  2K7C A;  3FE8 A;  1IWQ A;  5GQQ C;  1BT6 A;  4NDC A;  3SIB A;  2WCL A;  3CYZ A;  4FTG A;  3RZS A;  1R2U A;  3AKB A;  2HET A;  4IJ7 A;  2VRG A;  1K94 A;  2PYQ A;  1RJV A;  5IBW A;  1QV0 A;  3GK1 A;  5HKZ A;  3LK0 A;  3OB2 B;  1Y1U A;  2WOR A;  1M46 A;  1S36 A;  2F2O A;  1OSA A;  4MEW A;  2RGI A;  4BY4 A;  2MAZ A;  1JF2 A;  4PE4 A;  4MZL A;  1ALV A;  2ERB A;  4CLN A;  1NCX A;  1PSB A;  3WNX B;  1NPQ A;  1WRZ A;  1QS7 A;  1WDC C;  2GV5 A;  3ZNI A;  3TUY C;  4MN0 A;  2FCD A;  4WQ2 A;  2JNX A;  2BL0 B;  3NSL A;  1NYA A;  3L4A A;  5I94 A;  3TS5 B;  3BOW A;  1PUL A;  1RRO A;  1BR1 B;  3I5F C;  3BQ3 A;  3SG3 A;  5TNC A;  4QJ3 B;  4PE1 A;  3NHT A;  3B88 A;  2OS8 C;  1C7V A;  2WCJ A;  3GK2 A;  1EJ3 A;  1F70 A;  1SSE B;  3BUM B;  3F45 A;  1AP4 A;  3D10 A;  1JUO A;  1K90 D;  2K0J A;  5F6T A;  1L7Z A;  1P28 A;  2Y4Q A;  4MLW A;  3I5G C;  3EKH A;  3C1V A;  2MRD A;  1AJ5 A;  2K8M B;  3E3R A;  2NCO A;  4JQ0 D;  1BF5 A;  3SG7 A;  4C0L A;  5JOL A;  3OBV A;  1PVA A;  2M97 A;  2QEB A;  3NGV A;  4I5J A;  2HF5 A;  1TUJ A;  2PSR A;  1E8A A;  2EGD A;  2PRU A;  1B9A A;  1IRJ A;  2M49 B;  4GGF C;  1OOF A;  2KAY A;  3O2P A;  2YGU A;  3R1O A;  1DC1 A;  4MZJ A;  1S5G Y;  4HRG A;  1BJF A;  2LMV A;  4XJK B;  1F71 A;  3I5I C;  1ALW A;  1XFZ O;  2JOJ A;  2I7A A;  3PSR A;  5I2O A;  1OOJ A;  2H61 A;  3Q8I A;  1J7Q A;  2KAV A;  1LS8 A;  1F4Q A;  1YUS A;  1L2O C;  1S6J A;  4DUQ A;  2LUX A;  2WOS A; 
#chains in the Genus database with same CATH homology
 1CKK A;  2CT9 A;  3SG2 A;  3M0W A;  1ZUZ A;  2JT3 A;  4OKH A;  2BKI B;  1SRA A;  1WRL A;  1X02 A;  2NZ0 A;  1MHO A;  4XJK A;  5JJG A;  3H4S E;  4PAL A;  2M0R A;  1CDM A;  1JC2 A;  1TCF A;  2COL B;  1D1O A;  1PK0 D;  1A75 B;  1IH0 A;  2EC6 B;  1DVI A;  2FJU B;  4NQG A;  1SNL A;  3NSO A;  3DVK A;  1NIW A;  1EG4 A;  2M8U A;  5KTY A;  2F3Z A;  1PSR A;  5B8I B;  4NDD A;  2H2K A;  2ZN9 A;  4CPV A;  2HQW A;  1QLK A;  2LLS A;  2F2P A;  1OMD A;  2WCF A;  1YUT A;  2OPO A;  1QAT A;  1TOP A;  2G2B A;  1FW4 A;  3VRQ A;  1J7P A;  1K9P A;  1SMG A;  5AXI A;  4FQO A;  1DF0 B;  4YGB B;  5D7F A;  4MVF A;  1CFF A;  3IQO A;  1N2D A;  1QVI Y;  2L50 A;  2MA2 A;  3DF0 B;  5D69 A;  1CTR A;  1ZAC A;  1DJH A;  1F54 A;  4I5L B;  1KQM C;  2CXJ A;  1JFJ A;  4IL1 A;  5HKW A;  2JUL A;  1RK9 A;  1BOD A;  1TNX A;  1KWO C;  3VRO A;  2KI6 D;  1BU3 A;  1DF0 A;  1NCY A;  1TCO B;  1IQ5 A;  2GGZ A;  2LV7 A;  1B7T Z;  1YUU A;  4YI9 A;  1CLB A;  3CR5 X;  1Y1X A;  2BKH B;  2CBL A;  3TUY B;  1LA3 A;  3CR2 A;  2LLU A;  2L4I A;  1B8C A;  3IF7 A;  3LK1 A;  1XK4 A;  2HPS A;  3I5H C;  2KFF A;  2LAP A;  4PE0 A;  2KYF A;  5DKR A;  1S6I A;  5DKN A;  2LHI A;  3TDU A;  4PDZ A;  5AEQ A;  3HCM A;  2M29 A;  1UHJ A;  1DJI A;  1QTX A;  3D0Y B;  2L0P A;  4A4C A;  2KFH A;  1DJG A;  1G8I A;  1VRK A;  2M9G A;  1A03 A;  1CM4 A;  1LXF C;  2KBM A;  2TN4 A;  1OMV A;  4MBE A;  4NDB A;  2Y5I A;  1KK7 Z;  2NCP A;  1BMO A;  2ZN8 A;  2BCB A;  4U8D A;  1MWN A;  3I5G B;  4YBH B;  2BCX A;  1NP8 A;  1NX3 A;  2AAO A;  3DD4 A;  1FI6 A;  1RTP 1;  1OZO A;  3RM1 A;  3OHM B;  1IJ6 A;  1UHI A;  1MXL C;  3DVJ A;  1TNP A;  4ETO A;  2KDH A;  4WQ3 A;  1YUR A;  4UPG A;  1NWD A;  4YRU A;  2CCM A;  2KQY A;  4PHK A;  1KFX L;  4HSZ A;  3I5I B;  3AAJ A;  3KHE A;  3OX6 A;  1JFK A;  2P6B B;  2QAC A;  1WY9 A;  4DS7 A;  2O5G A;  2WCE A;  3WHT B;  1KK8 C;  2LMT A;  3CS1 A;  5HLO A;  1G4Y R;  2G9B A;  2KYC A;  1L2O B;  1C7W A;  1PAL A;  2K2A A;  3FIA A;  3NXA A;  5KU1 A;  3GOF A;  3NSK A;  3A8R A;  3DVM A;  4GGN A;  4YGD B;  3VRR A;  1S1E A;  3KF9 A;  3BUX B;  1YTZ C;  5HLV A;  3EVR A;  2LP3 A;  1B8R A;  2JNF A;  2BE4 A;  1K8U A;  3LL8 B;  1M31 A;  1BLQ A;  4GPL B;  1A2X A;  1LVC D;  2LM5 A;  2JQ6 A;  4PE7 A;  2A4J A;  1CM1 A;  1QX7 A;  5DKQ A;  2PAS A;  4OVN F;  3TDZ A;  1WLZ A;  1XFY O;  1NX2 A;  2V53 A;  1BR4 B;  2NLN A;  3VRP A;  1CLM A;  4L9M A;  3JTD C;  4HRE E;  2AUC A;  2JZI A;  1KSM A;  5I8N A;  1A4P A;  2LVI A;  4GFT A;  4GAO A;  1LIN A;  1UHH A;  2Y1M A;  1DJX A;  3SG4 A;  1KFX S;  1SCM C;  1FBV A;  2KI4 C;  1JF0 A;  2M7L A;  4I5N B;  1DJY A;  4I5K A;  2WCB A;  1TNW A;  2L5X B;  5FYX A;  1DJW A;  1Y0V H;  1YVL A;  1AUI B;  1EXR A;  1ZOT B;  2LNK A;  1SL9 A;  2B1U A;  3JVT B;  1KQM B;  1SPY A;  2KFG A;  2I18 A;  1R6P A;  1YX7 A;  1KWO B;  1ODB A;  1JBA A;  4CID A;  4PHM A;  2BE6 A;  4CFQ A;  3IQQ A;  5K89 A;  2F33 A;  1UP5 A;  2O60 A;  2E30 A;  1GJY A;  4N1G A;  1QVI Z;  2H61 C;  1JWD A;  3PAT A;  3GK4 X;  4YGE B;  1K93 D;  2BCA A;  3LCP C;  4ORA B;  2M1K B;  2F8P A;  1A75 A;  2CNP A;  2BBN A;  1G33 A;  1IJ5 A;  1IG5 A;  4YI8 A;  1YRU B;  1OQP A;  2LHL A;  1XA5 A;  3I5H B;  1QAS A;  1CB1 A;  4DRW A;  1J7R A;  4BY5 A;  2AMI A;  1DTL A;  4P2Y B;  4Q04 A;  1GGZ A;  4M2P A;  4P5O E;  3OB1 B;  1XFV O;  3FS7 A;  1SBJ A;  1XVJ A;  1K9K A;  4TNC A;  5CSN A;  3SG6 A;  2ZRS A;  4ORB B;  2L51 A;  2L2E A;  4GUK A;  1H4B A;  1REC A;  3AAK A;  1K2H A;  4F0Z B;  5AAN A;  4AOM A;  1M45 A;  2BBM A;  2BEC A;  1J7O A;  1WDC B;  3DF0 A;  4OV2 A;  4CFR A;  2M7N A;  5I2Q A;  1B1G A;  2GGM A;  1EH2 A;  3MSE B;  3KO0 A;  1C07 A;  1N0Y A;  1SL7 A;  4AQJ A;  3FWC A;  3AKA A;  2K61 A;  4JWQ A;  2JU0 A;  1XFW O;  3I5F B;  1AK8 A;  3FWB A;  2R2I A;  2K7D A;  2PAL A;  3PLF B;  3SJS A;  2OS8 B;  2MBX A;  2E6W A;  1XFX O;  1XYD A;  1YX8 A;  4WRI A;  1H8B A;  2L4H A;  1S26 D;  2M1U A;  1GQM A;  3ICB A;  1TTX A;  1XO5 A;  2KGB C;  1V1F A;  1WLM A;  4USL A;  1QIV A;  2OTG C;  1TIZ A;  1GGW A;  2Q91 A;  1S3P A;  1TNQ A;  1SR6 C;  1Y6W A;  2WC8 A;  3SG5 A;  5AFP A;  2KI6 C;  5ER4 X;  2LVV A;  1B47 A;  1M39 A;  1SK6 D;  1M63 B;  1B7T Y;  5J3X A;  4ZCV A;  3D0Y A;  1B8L A;  2LE9 B;  1ZFS A;  4M2O A;  2KGR A;  1SW8 A;  1W7I B;  2KNE A;  1CMG A;  1B4C A;  1W7J B;  3BOW B;  5G08 A;  1NX1 A;  1XK4 C;  3CR4 X;  3CWG A;  1S6C A;  1UUS A;  1MXE A;  3EK8 A;  3JTD B;  1IGV A;  3VRN A;  4OR9 B;  1CDP A;  1IKU A;  2MLF C;  1IQ3 A;  1QIW A;  2JXL A;  2JTT A;  1QV1 A;  2K2F A;  1SCM B;  1SKT A;  2LP2 A;  1KK7 Y;  2KAX A;  3LLE A;  4GGF A;  1CFC A;  2KI4 B;  5PAL A;  1V1G A;  1BG1 A;  4E68 A;  3PN7 C;  1S5G Z;  1YVH A;  1J55 A;  3EK4 A;  1HQV A;  1MF8 B;  3EKJ A;  1MR8 A;  1UWO A;  3RLZ A;  4A4B A;  2ZRT A;  5BPJ A;  1CFP A;  1MQ1 A;  1SCV A;  1PVB A;  4ICB A;  5AER A;  2HQ8 A;  1MUX A;  2SAS A;  1DMO A;  2JT8 A;  2L98 A;  4DIR A;  2JWW A;  2K7B A;  1F55 A;  3PAL A;  2KHN A;  3BUO B;  1K96 A;  1K95 A;  1CFD A;  1EG3 A;  2LAN A;  3K21 A;  2PVB A;  3KPX A;  4MSP A;  2KQ6 A;  3SG3 A;  1FPW A;  1KQV A;  1UHN A;  4GNK B;  3EVU A;  1U5I B;  2F3Y A;  3VGO A;  4N5X A;  3BYA A;  2IS9 A;  2BL0 C;  3DVE A;  2JT0 A;  4PHN A;  2Q4U A;  1OZS A;  3TS5 C;  2KOT A;  2FCE A;  3CTN A;  4PHJ A;  5CPV A;  2LMU A;  1CMF A;  1CDL A;  2SCP A;  2MHH A;  2JRF A;  1OE9 B;  4XYN A;  4QJ5 B;  1DGU A;  3CZT X;  1DT7 B;  3TDI A;  4DCK A;  1HT9 A;  1J1D A;  4HRH A;  1QXP A;  1TN4 A;  1U5I A;  2I94 A;  4AQI A;  3BXK A;  4C0J A;  4M2Q A;  1QJT A;  3SIA A;  1KSO A;  1UHK A;  1QX2 A;  1LKJ A;  1CLL A;  3O6B A;  4N1F A;  1CNP A;  1LA0 A;  2LCP A;  1F4O A;  4ORC B;  3OP0 A;  1SY9 A;  2LUC A;  1QLS A;  1YRT B;  2LVJ A;  5HKY A;  2D8N A;  4ZCU A;  1UUR A;  3QRX A;  4OCI A;  1ZMZ A;  1RWY A;  2JXC A;  2JPT A;  2NXQ A;  2ISD A;  1AJ4 A;  1OMR A;  1WRK A;  4MRY A;  1BOC A;  1NX0 A;  1KFU L;  4MRX A;  1F8H A;  2MLE C;  2LLT A;  3O78 A;  2ZND A;  1J1E A;  1XFU O;  1AHR A;  1QX5 B;  1FF1 A;  1NSH A;  2QPT A;  1DJZ A;  1DGV A;  3HX4 A;  3KEV A;  3WXA A;  1AVS A;  1SL8 A;  2OTG B;  5ER5 A;  1A29 A;  1SR6 B;  3TZ1 A;  1JSA A;  2KBI A;  3BUW B;  2I2R E;  3A4U B;  4MZK A;  1Q80 A;  2ZFD A;  2M3W A;  3ZWH A;  1EL4 A;  1RFJ A;  2KSP A;  2PMY A;  1SYM A;  4C0K A;  2EHB A;  2EC6 C;  3PFV A;  1F71 A;  1Y1A A;  3JVT C;  5CSF A;  2ZNE A;  2JC2 A;  3OX5 A;  3O4Y A;  2CTN A;  1NUB A;  1PRW A;  3CGA A;  4PCW A;  4D1E A;  2K7O A;  4JPZ B;  1KCY A;  1YR5 A;  1NCZ A;  2LC5 A;  1KK8 B;  3NSI A;  5I2L A;  1FI5 A;  3WHU B;  4YGC B;  3EVV A;  1K9U A;  2LVK A;  2ZKM X;  4QJ4 B;  3EK7 A;  2DOQ A;  5KSZ A;  2MJW B;  4YGA A;  4R1E A;  1N65 A;  3CLN A;  3PM8 A;  5CSI A;  1KFU S;  2JTZ A;  1TRF A;  2FOT A;  3PN7 B;  1CDN A;  2WND A;  5CSJ A;  4GBA A;  5HYD A;  2Y1N A;  3BUN B;  2K7C A;  1IWQ A;  5GQQ C;  1BT6 A;  4NDC A;  3SIB A;  4FTG A;  1R2U A;  3AKB A;  2HET A;  2VRG A;  1K94 A;  1RJV A;  5IBW A;  1QV0 A;  3GK1 A;  5HKZ A;  3LK0 A;  3OB2 B;  1Y1U A;  2WOR A;  1M46 A;  1S36 A;  2F2O A;  1OSA A;  4MEW A;  2RGI A;  4BY4 A;  2MAZ A;  1JF2 A;  4PE4 A;  4MZL A;  1ALV A;  4CLN A;  1NCX A;  1PSB A;  3WNX B;  1NPQ A;  1WRZ A;  1QS7 A;  1WDC C;  2GV5 A;  3ZNI A;  3TUY C;  4MN0 A;  2FCD A;  4WQ2 A;  2JNX A;  2BL0 B;  3NSL A;  1NYA A;  3TS5 B;  3BOW A;  1PUL A;  1RRO A;  1BR1 B;  3I5F C;  3BQ3 A;  5TNC A;  4QJ3 B;  4PE1 A;  2OS8 C;  1C7V A;  3GK2 A;  1EJ3 A;  1F70 A;  3BUM B;  3F45 A;  1AP4 A;  3D10 A;  1JUO A;  1K90 D;  2K0J A;  5F6T A;  1L7Z A;  2Y4Q A;  4MLW A;  3I5G C;  3EKH A;  3C1V A;  2MRD A;  1AJ5 A;  2K8M B;  3E3R A;  2NCO A;  4JQ0 D;  1BF5 A;  3SG7 A;  4C0L A;  5JOL A;  1PVA A;  2M97 A;  4I5J A;  2HF5 A;  2PSR A;  1E8A A;  2EGD A;  2PRU A;  1B9A A;  1IRJ A;  2M49 B;  4GGF C;  3O2P A;  2KAY A;  4MZJ A;  1S5G Y;  4HRG A;  1BJF A;  2LMV A;  4XJK B;  3I5I C;  1ALW A;  1XFZ O;  2JOJ A;  2I7A A;  3PSR A;  5I2O A;  1OOJ A;  2H61 A;  1J7Q A;  2KAV A;  1YUS A;  1F4Q A;  1L2O C;  1S6J A;  4DUQ A;  2LUX A;  2WOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...