1Z4HA

The response regulator tori belongs to a new family of atypical excisionase
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
66
structure length
66
Chain Sequence
b'MQHELQPDSLVDLKFIMADTGFGKTFIYDRIKSGDLPKAKVIHGRARWLYRDHCEFKNKLLSRANG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tor inhibition protein
publication title Structural and genetic analyses reveal a key role in prophage excision for the TorI response regulator inhibitor
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding, dna binding protein
total genus 18
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2005-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.160 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 1z4hA01
1Z4HA
chains in the Genus database with same CATH superfamily
1NCXA 4YGAA 4PHMA 1K9PA 1BR4B 5HLVA 1GM0A 2FJYA 2KGBC 1NPQA 1DT7B 1QIVA 1S6IA 1SPYA 2LM5A 1FW4A 3CTNA 4OVNF 4PALA 3SIAA 3VB1A 2WCJA 3GK2A 1CM1A 2LMUA 1SYMA 3QMEA 2WC5A 4MSPA 1KSMA 2L2EA 2LVVA 5FI6A 1LINA 1IH0A 2E30A 3A8RA 4INWA 4DIRA 2KAVA 1TN4A 3D0YB 1NX1A 1OMDA 1G33A 2K2FA 1NSHA 1MXLC 2KGRA 3KEVA 1NWDA 1OE9B 1AHRA 4XJKA 1KK8C 1FPWA 1DF0B 3BFAA 1IIOA 3BOWA 1K9KA 2KBIA 3SS4A 2SASA 2MHHA 3GK4X 3LK1A 2JWWA 4NDCA 3CWGA 1TUJA 3SS5A 5I8NA 4C0LA 2ISDA 4WQ2A 1NCZA 1NCYA 2JPOA 2QDIA 1HQVA 1A2XA 1GQMA 2SCPA 1L2OB 3TDIA 2KAYA 2NCPA 5DKQA 1CFPA 2Y1MA 2EC6C 4A4CA 1KFXL 4MBEA 3K1EA 1YRTB 1WRKA 2CTNA 2LUCA 2MA2A 3R1VA 4QJ5B 4CFRA 3VROA 1R6PA 1F70A 2P71A 4GGFA 2L2CA 3OHMB 2LCPA 5I2OA 2M49B 2K0JA 5BPJA 3PM8A 1QLKA 2LP3A 2KYCA 4ZCVA 5JJGA 1CNPA 3S0FA 2ZN9A 2Q4UA 1J7RA 3CGAA 5D7FA 3UNWA 1AVSA 1JF2A 4ETOA 1N65A 4YGDB 4YGEB 1OSAA 2F2PA 2BAPA 3LL8B 1DTLA 1AP4A 1XK4A 5DKNA 4GBAA 3O4XA 3I5IB 3BUXB 1WLMA 1UHNA 2OTGC 2JT0A 1IG5A 2L4IA 3EK4A 2LC5A 3I5FB 2KAXA 1J7QA 2JOJA 1J1EA 4PE0A 3LK0A 4WQ3A 3EVVA 2Y4QA 1S6CA 1DEKA 1S26D 1JF0A 3WNXB 3PLFB 1TRFA 3JVTB 2AMIA 4JPZB 5ER5A 5FI2A 4DCKA 1QTXA 3KO0A 3KHEA 2EHBA 2PALA 1XA5A 1XFZO 1UP5A 4N5XA 3EG5B 4NDDA 5DICA 3NSKA 3R1OA 3SIBA 1EG3A 2KFFA 2L0PA 2JXCA 1K94A 1SL8A 1MR8A 1BMOA 2K7BA 4FQTA 3D77A 1L2OC 2KI4C 3D78A 3DF0A 3CABA 3SG5A 4DRWA 2HQWA 3DVEA 2KYFA 1ALVA 3OX5A 5AXIA 3NXAA 2ZFDA 1CLLA 1BU3A 1VRKA 1N2DA 1YR5A 2CNPA 1J55A 2GTEA 2WCMA 4OCIA 5HKZA 3SG4A 4C0KA 4OR9B 2M97A 5KTYA 1KWOB 1EL4A 1KQVA 3TZ1A 1WDCB 3OX6A 2BCBA 5AERA 2CT9A 2ZRSA 1UHHA 3AKBA 1C3ZA 4D1EA 2BL0B 3NSLA 3I5GB 1J7PA 1MUXA 1Q80A 1DGUA 1S5GZ 1FF1A 1BLQA 3KPXA 2GGZA 2Y5IA 1TIZA 2JULA 1K90D 1U5IA 1LKJA 3CZ2A 2GV5A 3Q8IA 4YGBB 3I5IC 1AJ5A 1EXRA 4HRGA 4JKTA 1QJTA 3SG3A 1R2UA 4PHNA 2LLUA 5F6TA 3NSIA 3TDUA 3I5FC 4GAOA 2K8MB 1SBJA 2BKHB 2LMTA 2LLSA 2OPOA 2WCKA 2ZRTA 3BUOB 1BF5A 1K96A 1OOGA 1OW4A 3IF7A 1NX2A 2MAZA 3JVTC 2F3YA 4PHKA 1TNXA 1QLSA 1B7TZ 3I5HB 1CFCA 1DJGA 1SK6D 3CLNA 1JFKA 2MRDA 1PSBA 2PMYA 5AFPA 3EKJA 1MQ1A 1QX7A 5D3OA 1C7WA 1QATA 3NHIA 3BUMB 2WCHA 2I18A 3JTDB 2L5YA 2WNDA 3N7HA 4USLA 4PHJA 5K89A 1RWYA 1M63B 1KSOA 1PVAA 2JPTA 2WCFA 3R1PA 2L5XB 3CZTX 3S0AA 4M2QA 2FCEA 4PE7A 1YUSA 1CLMA 1J1DA 3IQQA 4MZLA 1K95A 2WC8A 3FWBA 3CR4X 2R2IA 1N0YA 2LVJA 2L98A 3CZ0A 1LA0A 1OMVA 3O78A 1QV1A 1CFDA 3L47A 2IS9A 2LVKA 1A75A 3I5GC 1DJHA 1CLBA 2WORA 4MN0A 4PCWA 3GOFA 1SRAA 3E3RA 3PJIA 3ICBA 1W7IB 1M45A 3EK8A 1TCOB 3PALA 1ZOTB 1Y0VH 2JC2A 3OBVA 4P5OE 3MSEB 4INXA 2LLTA 1DC1A 1QV0A 5FI7A 4GNKB 2P70A 3DVKA 1GJYA 1PRWA 4YI9A 2LNKA 2PSRA 3PSRA 3DVJA 3PN7C 2F2OA 1K9UA 1B8CA 1QS7A 1CMFA 2M9GA 1WRLA 3B88A 3DYEA 2TN4A 1SCMB 1RK9A 3S0BA 5JOLA 4DUQA 4KYNA 3I5HC 2G2BA 1DF0A 1OOFA 2NCOA 1YTZC 3H4SE 1UWOA 2CXJA 5HL1A 1RJVA 2JQ6A 1RFJA 3JTDC 1ODBA 3UO9A 2G9BA 2I94A 1KK7Y 1L7ZA 1IGVA 2JU0A 3TS5B 4I5JA 1M31A 4R1EA 1AK8A 1QXPA 1DMOA 2BBMA 1TNWA 3B7AA 1NIWA 1SL9A 3BQ3A 4YGCB 1OMRA 3D10A 5GQQC 3OGNA 2ZN8A 1S3PA 3B86A 4NDBA 2AAOA 1G8IA 4HSZA 1OQPA 1FBVA 4ORAB 1XFUO 1BT6A 4ZCUA 3TUYB 2FJUB 1ZUZA 1DGVA 3WHUB 3DD4A 1B4CA 1AJ4A 1KQMB 2KHNA 2L51A 2MLEC 3O4YA 4I5LB 1D1OA 1ZMZA 2BCAA 1B9AA 5KSZA 3K21A 1IJ5A 2DOQA 3S0EA 1XFRA 1XFXO 3EKHA 4IL1A 1CMGA 1Z2CB 1J7OA 1YUTA 2BECA 1NP8A 2HF5A 3ZWHA 2NLNA 2LE9B 3PATA 2K2AA 1DQEA 1XFVO 3DXLA 3EVRA 2BBNA 3CYZA 3FE6A 4TNCA 4CFQA 1B1GA 4NQGA 4I5KA 1H8BA 4WRIA 4ORBB 1YVLA 3PM2A 1SSEB 1WY9A 5CSIA 1QWVA 2YGUA 1TNPA 1F54A 3C1VA 2WCEA 1DJXA 1CKKA 2KFHA 4M2PA 4BY5A 1MHOA 4PDZA 4AQJA 4MRYA 1JC2A 1ZACA 3NSOA 3RM1A 4N1FA 2KPHA 5HLOA 1ZFSA 1CDNA 1PALA 1SKTA 4YBHB 2PASA 2M7LA 2KDHA 1CDPA 2H2KA 2QEBA 1T14A 1K8UA 2HPSA 3BUWB 1CDMA 1DJWA 1SNLA 4GUKA 5CSFA 2AUCA 2BE6A 2KI6D 3HCMA 1BJFA 1QASA 1YVHA 2LHLA 3TS5C 2H8VA 2HETA 2I2RE 3EVUA 3ZNIA 1K2HA 2QACA 5AEQA 3FE9A 2L4HA 5PALA 1S6JA 4P2YB 3CR2A 3SG6A 3TUYC 3GK1A 1NYAA 5AANA 1W9ZA 1E8AA 1X02A 1OOJA 4GFTA 1M46A 4MZKA 2L50A 4OZDA 1KQMC 4XJKB 1DVIA 4N1GA 1SMGA 4A4BA 2EGDA 2LANA 3BOWB 4F7FA 3O2PA 4MZJA 5D69A 1WLZA 2BCXA 2RGIA 4CPVA 4HREE 3SG7A 4L9MA 2E6WA 3S0DA 1GGZA 2BKIB 2LVIA 2WCBA 3BJHA 4Q04A 2HQ8A 1A75B 1B47A 1PK0D 4UPGA 3B6XA 4U8DA 1MXEA 1C7VA 5I94A 1KWOC 2OS8B 4MVFA 1B8LA 3VRPA 1QVIZ 1BG1A 1A03A 5HKWA 1WDCC 2K7DA 2JT8A 3RZSA 5CPVA 1KCYA 1F4QA 3BXKA 2LP2A 1BODA 2F33A 2H61C 3D75A 3SG2A 4IJ7A 2ZNEA 3AKAA 2QPTA 1K93D 1PSRA 1QX2A 3QRXA 5HKYA 2BL0C 3OB2B 3LLEA 2ZKMX 1LXFC 5CSNA 1OOHA 1IJ6A 1SCVA 1C07A 2PRUA 3RLZA 3FIAA 2JRFA 1TOPA 2ERBA 4GGNA 3SJSA 3AAKA 2OTGB 1F8HA 2KNEA 1YRUB 1XO5A 1LS8A 2WOSA 2GGMA 2A4JA 3PFVA 5CSJA 5J3XA 2JTTA 1MWNA 2KBMA 4ICBA 1BOCA 1SL7A 1DJYA 4YI8A 3BFHA 2KLEA 1P28A 1V1FA 3M0WA 1NX3A 1Y6WA 2K61A 1YX7A 3CR5X 1JBAA 2QEVA 1XFWO 4HRHA 1DJZA 5B8IB 1SR6B 4F0ZB 3FWCA 2PQLA 4GPLB 3FS7A 3VRQA 2O5GA 4CIDA 3D0YA 5EL2A 2FCDA 2KI4B 5I2QA 1DJIA 2Q91A 4C0JA 1CM4A 2QEHA 4BY4A 1IRJA 1TWOA 2M1UA 3IQOA 2Y1NA 2LV7A 1LA3A 2M1KB 1F55A 1UHIA 3WXAA 3BYAA 3CS1A 4M2OA 4PE1A 4QJ3B 4CLNA 3DZTA 1UHJA 5I2LA 5TNCA 1PULA 1TTXA 1C3YA 5DKRA 1UURA 3A4UB 5ER4X 2OS8C 1AUIB 1MF8B 2LHIA 3DF0B 3KF9A 1TNQA 5IBWA 4AOMA 2M29A 1BR1B 2BE4A 1RTP1 2F8PA 1H4BA 3D74A 4FTGA 1RROA 1Y1AA 3DY9A 1RECA 2B1UA 1IQ5A 3BFBA 1FI5A 2LMVA 1KK7Z 2BNXA 1QIWA 2K7OA 1EJ3A 2KOTA 3BUNB 1A4PA 2PYQA 4GGFC 1CB1A 1S36A 2MBXA 2JNXA 2MJWB 1KFUS 4JWQA 1XVJA 3F45A 3VRNA 1F71A 1ORGA 3VGOA 2JXLA 1JSAA 2V53A 3D73A 3SS3A 5HYDA 5KU1A 1F4OA 2KLDA 1EG4A 4YRUA 1IQ3A 2JZIA 5G08A 1OZOA 2COLB 2JTZA 4OV2A 4MEWA 1U5IB 2JNFA 2KSPA 1SW8A 2MLFC 4AQIA 1SR6C 4MRXA 1XK4C 1UHKA 4DS7A 1S1EA 1IWQA 1TCFA 1DELA 1SCMC 1SY9A 1V1GA 3CDNA 5FYXA 2M8UA 3WHTB 2K7CA 1ALWA 4XYNA 1Y1UA 2WCLA 3R72A 2WC6A 1OZSA 1S5GY 1WRZA 3LCPC 4PT1A 3B87A 2VRGA 3CZ1A 1YUUA 1NUBA 2CCMA 2JT3A 4OKHA 2LUXA 1GGWA 2ZNDA 2LAPA 1JUOA 2I7AA 1KK8B 1M39A 1B8RA 4FQOA 4E68A 1IKUA 1YX8A 2CBLA 1CTRA 3FE8A 2NZ0A 3L4LA 1LVCD 1JWDA 2D8NA 4JD9A 1W7JB 1KFXS 1Y1XA 3L4AA 2KI6C 2M0RA 1Z4HA 3D76A 4QJ4B 1EH2A 2EC6B 1FI6A 2KQYA 1B7TY 3OB1B 3OP0A 3IVTA 3NHTA 2H61A 2M7NA 4ORCB 3HX4A 1JFJA 2O60A 2FOTA 4I5NB 3AAJA 1CFFA 1OOIX 3VRRA 1YURA 2NXQA 3DVMA 3O6BA 4JQ0D 2QEOA 1HT9A 2F3ZA 3V2LA 4MLWA 1CDLA 3PN7B 1KFUL 3S0GA 1PVBA 4PE4A 2KFGA 2P6BB 1G4YR 1TUZA 3EK7A 2KQ6A 1NX0A 1QX5B 1XFYO 1UUSA 1A29A 2K60A 1QVIY 1XYDA 3NGVA 3TDZA 2M3WA 2PVBA
chains in the Genus database with same CATH topology
1DELA 1W9ZA 3UNWA 1Z4HA 5D3OA 4I5LB 2BAPA 2BNXA 5HL1A 3IVTA 4I5NB 1Z2CB 2L5YA 3OBVA 3O4XA 4GBAA 4JKTA 5FI6A 3UO9A 1DC1A 5FI7A 3SS3A 3KEVA 4GAOA 4I5KA 4I5JA 5I94A 2KLDA 2KLEA 1DEKA 3PM2A 3SS4A 4MEWA 5FI2A 2YGUA 3SS5A 4IJ7A 2K60A 3EG5B 4KYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z4H A; 
#chains in the Genus database with same CATH topology
 1NCX A;  4YGA A;  4PHM A;  1K9P A;  1BR4 B;  5HLV A;  1GM0 A;  2FJY A;  2KGB C;  1NPQ A;  1DT7 B;  1QIV A;  1S6I A;  1SPY A;  2LM5 A;  1FW4 A;  3CTN A;  4OVN F;  4PAL A;  3SIA A;  3VB1 A;  2WCJ A;  3GK2 A;  1CM1 A;  2LMU A;  1SYM A;  3QME A;  2WC5 A;  4MSP A;  1KSM A;  2L2E A;  2LVV A;  5FI6 A;  1LIN A;  1IH0 A;  2E30 A;  3A8R A;  4INW A;  4DIR A;  2KAV A;  1TN4 A;  3D0Y B;  1NX1 A;  1OMD A;  1G33 A;  2K2F A;  1NSH A;  1MXL C;  2KGR A;  3KEV A;  1NWD A;  1OE9 B;  1AHR A;  4XJK A;  1KK8 C;  1FPW A;  1DF0 B;  3BFA A;  1IIO A;  3BOW A;  1K9K A;  2KBI A;  3SS4 A;  2SAS A;  2MHH A;  3GK4 X;  3LK1 A;  2JWW A;  4NDC A;  3CWG A;  1TUJ A;  3SS5 A;  5I8N A;  4C0L A;  2ISD A;  4WQ2 A;  1NCZ A;  1NCY A;  2JPO A;  2QDI A;  1HQV A;  1A2X A;  1GQM A;  2SCP A;  1L2O B;  3TDI A;  2KAY A;  2NCP A;  5DKQ A;  1CFP A;  2Y1M A;  2EC6 C;  4A4C A;  1KFX L;  4MBE A;  3K1E A;  1YRT B;  1WRK A;  2CTN A;  2LUC A;  2MA2 A;  3R1V A;  4QJ5 B;  4CFR A;  3VRO A;  1R6P A;  1F70 A;  2P71 A;  4GGF A;  2L2C A;  3OHM B;  2LCP A;  5I2O A;  2M49 B;  2K0J A;  5BPJ A;  3PM8 A;  1QLK A;  2LP3 A;  2KYC A;  4ZCV A;  5JJG A;  1CNP A;  3S0F A;  2ZN9 A;  2Q4U A;  1J7R A;  3CGA A;  5D7F A;  3UNW A;  1AVS A;  1JF2 A;  4ETO A;  1N65 A;  4YGD B;  4YGE B;  1OSA A;  2F2P A;  2BAP A;  3LL8 B;  1DTL A;  1AP4 A;  1XK4 A;  5DKN A;  4GBA A;  3O4X A;  3I5I B;  3BUX B;  1WLM A;  1UHN A;  2OTG C;  2JT0 A;  1IG5 A;  2L4I A;  3EK4 A;  2LC5 A;  3I5F B;  2KAX A;  1J7Q A;  2JOJ A;  1J1E A;  4PE0 A;  3LK0 A;  4WQ3 A;  3EVV A;  2Y4Q A;  1S6C A;  1DEK A;  1S26 D;  1JF0 A;  3WNX B;  3PLF B;  1TRF A;  3JVT B;  2AMI A;  4JPZ B;  5ER5 A;  5FI2 A;  4DCK A;  1QTX A;  3KO0 A;  3KHE A;  2EHB A;  2PAL A;  1XA5 A;  1XFZ O;  1UP5 A;  4N5X A;  3EG5 B;  4NDD A;  5DIC A;  3NSK A;  3R1O A;  3SIB A;  1EG3 A;  2KFF A;  2L0P A;  2JXC A;  1K94 A;  1SL8 A;  1MR8 A;  1BMO A;  2K7B A;  4FQT A;  3D77 A;  1L2O C;  2KI4 C;  3D78 A;  3DF0 A;  3CAB A;  3SG5 A;  4DRW A;  2HQW A;  3DVE A;  2KYF A;  1ALV A;  3OX5 A;  5AXI A;  3NXA A;  2ZFD A;  1CLL A;  1BU3 A;  1VRK A;  1N2D A;  1YR5 A;  2CNP A;  1J55 A;  2GTE A;  2WCM A;  4OCI A;  5HKZ A;  3SG4 A;  4C0K A;  4OR9 B;  2M97 A;  5KTY A;  1KWO B;  1EL4 A;  1KQV A;  3TZ1 A;  1WDC B;  3OX6 A;  2BCB A;  5AER A;  2CT9 A;  2ZRS A;  1UHH A;  3AKB A;  1C3Z A;  4D1E A;  2BL0 B;  3NSL A;  3I5G B;  1J7P A;  1MUX A;  1Q80 A;  1DGU A;  1S5G Z;  1FF1 A;  1BLQ A;  3KPX A;  2GGZ A;  2Y5I A;  1TIZ A;  2JUL A;  1K90 D;  1U5I A;  1LKJ A;  3CZ2 A;  2GV5 A;  3Q8I A;  4YGB B;  3I5I C;  1AJ5 A;  1EXR A;  4HRG A;  4JKT A;  1QJT A;  3SG3 A;  1R2U A;  4PHN A;  2LLU A;  5F6T A;  3NSI A;  3TDU A;  3I5F C;  4GAO A;  2K8M B;  1SBJ A;  2BKH B;  2LMT A;  2LLS A;  2OPO A;  2WCK A;  2ZRT A;  3BUO B;  1BF5 A;  1K96 A;  1OOG A;  1OW4 A;  3IF7 A;  1NX2 A;  2MAZ A;  3JVT C;  2F3Y A;  4PHK A;  1TNX A;  1QLS A;  1B7T Z;  3I5H B;  1CFC A;  1DJG A;  1SK6 D;  3CLN A;  1JFK A;  2MRD A;  1PSB A;  2PMY A;  5AFP A;  3EKJ A;  1MQ1 A;  1QX7 A;  5D3O A;  1C7W A;  1QAT A;  3NHI A;  3BUM B;  2WCH A;  2I18 A;  3JTD B;  2L5Y A;  2WND A;  3N7H A;  4USL A;  4PHJ A;  5K89 A;  1RWY A;  1M63 B;  1KSO A;  1PVA A;  2JPT A;  2WCF A;  3R1P A;  2L5X B;  3CZT X;  3S0A A;  4M2Q A;  2FCE A;  4PE7 A;  1YUS A;  1CLM A;  1J1D A;  3IQQ A;  4MZL A;  1K95 A;  2WC8 A;  3FWB A;  3CR4 X;  2R2I A;  1N0Y A;  2LVJ A;  2L98 A;  3CZ0 A;  1LA0 A;  1OMV A;  3O78 A;  1QV1 A;  1CFD A;  3L47 A;  2IS9 A;  2LVK A;  1A75 A;  3I5G C;  1DJH A;  1CLB A;  2WOR A;  4MN0 A;  4PCW A;  3GOF A;  1SRA A;  3E3R A;  3PJI A;  3ICB A;  1W7I B;  1M45 A;  3EK8 A;  1TCO B;  3PAL A;  1ZOT B;  1Y0V H;  2JC2 A;  3OBV A;  4P5O E;  3MSE B;  4INX A;  2LLT A;  1DC1 A;  1QV0 A;  5FI7 A;  4GNK B;  2P70 A;  3DVK A;  1GJY A;  1PRW A;  4YI9 A;  2LNK A;  2PSR A;  3PSR A;  3DVJ A;  3PN7 C;  2F2O A;  1K9U A;  1B8C A;  1QS7 A;  1CMF A;  2M9G A;  1WRL A;  3B88 A;  3DYE A;  2TN4 A;  1SCM B;  1RK9 A;  3S0B A;  5JOL A;  4DUQ A;  4KYN A;  3I5H C;  2G2B A;  1DF0 A;  1OOF A;  2NCO A;  1YTZ C;  3H4S E;  1UWO A;  2CXJ A;  5HL1 A;  1RJV A;  2JQ6 A;  1RFJ A;  3JTD C;  1ODB A;  3UO9 A;  2G9B A;  2I94 A;  1KK7 Y;  1L7Z A;  1IGV A;  2JU0 A;  3TS5 B;  4I5J A;  1M31 A;  4R1E A;  1AK8 A;  1QXP A;  1DMO A;  2BBM A;  1TNW A;  3B7A A;  1NIW A;  1SL9 A;  3BQ3 A;  4YGC B;  1OMR A;  3D10 A;  5GQQ C;  3OGN A;  2ZN8 A;  1S3P A;  3B86 A;  4NDB A;  2AAO A;  1G8I A;  4HSZ A;  1OQP A;  1FBV A;  4ORA B;  1XFU O;  1BT6 A;  4ZCU A;  3TUY B;  2FJU B;  1ZUZ A;  1DGV A;  3WHU B;  3DD4 A;  1B4C A;  1AJ4 A;  1KQM B;  2KHN A;  2L51 A;  2MLE C;  3O4Y A;  4I5L B;  1D1O A;  1ZMZ A;  2BCA A;  1B9A A;  5KSZ A;  3K21 A;  1IJ5 A;  2DOQ A;  3S0E A;  1XFR A;  1XFX O;  3EKH A;  4IL1 A;  1CMG A;  1Z2C B;  1J7O A;  1YUT A;  2BEC A;  1NP8 A;  2HF5 A;  3ZWH A;  2NLN A;  2LE9 B;  3PAT A;  2K2A A;  1DQE A;  1XFV O;  3DXL A;  3EVR A;  2BBN A;  3CYZ A;  3FE6 A;  4TNC A;  4CFQ A;  1B1G A;  4NQG A;  4I5K A;  1H8B A;  4WRI A;  4ORB B;  1YVL A;  3PM2 A;  1SSE B;  1WY9 A;  5CSI A;  1QWV A;  2YGU A;  1TNP A;  1F54 A;  3C1V A;  2WCE A;  1DJX A;  1CKK A;  2KFH A;  4M2P A;  4BY5 A;  1MHO A;  4PDZ A;  4AQJ A;  4MRY A;  1JC2 A;  1ZAC A;  3NSO A;  3RM1 A;  4N1F A;  2KPH A;  5HLO A;  1ZFS A;  1CDN A;  1PAL A;  1SKT A;  4YBH B;  2PAS A;  2M7L A;  2KDH A;  1CDP A;  2H2K A;  2QEB A;  1T14 A;  1K8U A;  2HPS A;  3BUW B;  1CDM A;  1DJW A;  1SNL A;  4GUK A;  5CSF A;  2AUC A;  2BE6 A;  2KI6 D;  3HCM A;  1BJF A;  1QAS A;  1YVH A;  2LHL A;  3TS5 C;  2H8V A;  2HET A;  2I2R E;  3EVU A;  3ZNI A;  1K2H A;  2QAC A;  5AEQ A;  3FE9 A;  2L4H A;  5PAL A;  1S6J A;  4P2Y B;  3CR2 A;  3SG6 A;  3TUY C;  3GK1 A;  1NYA A;  5AAN A;  1W9Z A;  1E8A A;  1X02 A;  1OOJ A;  4GFT A;  1M46 A;  4MZK A;  2L50 A;  4OZD A;  1KQM C;  4XJK B;  1DVI A;  4N1G A;  1SMG A;  4A4B A;  2EGD A;  2LAN A;  3BOW B;  4F7F A;  3O2P A;  4MZJ A;  5D69 A;  1WLZ A;  2BCX A;  2RGI A;  4CPV A;  4HRE E;  3SG7 A;  4L9M A;  2E6W A;  3S0D A;  1GGZ A;  2BKI B;  2LVI A;  2WCB A;  3BJH A;  4Q04 A;  2HQ8 A;  1A75 B;  1B47 A;  1PK0 D;  4UPG A;  3B6X A;  4U8D A;  1MXE A;  1C7V A;  5I94 A;  1KWO C;  2OS8 B;  4MVF A;  1B8L A;  3VRP A;  1QVI Z;  1BG1 A;  1A03 A;  5HKW A;  1WDC C;  2K7D A;  2JT8 A;  3RZS A;  5CPV A;  1KCY A;  1F4Q A;  3BXK A;  2LP2 A;  1BOD A;  2F33 A;  2H61 C;  3D75 A;  3SG2 A;  4IJ7 A;  2ZNE A;  3AKA A;  2QPT A;  1K93 D;  1PSR A;  1QX2 A;  3QRX A;  5HKY A;  2BL0 C;  3OB2 B;  3LLE A;  2ZKM X;  1LXF C;  5CSN A;  1OOH A;  1IJ6 A;  1SCV A;  1C07 A;  2PRU A;  3RLZ A;  3FIA A;  2JRF A;  1TOP A;  2ERB A;  4GGN A;  3SJS A;  3AAK A;  2OTG B;  1F8H A;  2KNE A;  1YRU B;  1XO5 A;  1LS8 A;  2WOS A;  2GGM A;  2A4J A;  3PFV A;  5CSJ A;  5J3X A;  2JTT A;  1MWN A;  2KBM A;  4ICB A;  1BOC A;  1SL7 A;  1DJY A;  4YI8 A;  3BFH A;  2KLE A;  1P28 A;  1V1F A;  3M0W A;  1NX3 A;  1Y6W A;  2K61 A;  1YX7 A;  3CR5 X;  1JBA A;  2QEV A;  1XFW O;  4HRH A;  1DJZ A;  5B8I B;  1SR6 B;  4F0Z B;  3FWC A;  2PQL A;  4GPL B;  3FS7 A;  3VRQ A;  2O5G A;  4CID A;  3D0Y A;  5EL2 A;  2FCD A;  2KI4 B;  5I2Q A;  1DJI A;  2Q91 A;  4C0J A;  1CM4 A;  2QEH A;  4BY4 A;  1IRJ A;  1TWO A;  2M1U A;  3IQO A;  2Y1N A;  2LV7 A;  1LA3 A;  2M1K B;  1F55 A;  1UHI A;  3WXA A;  3BYA A;  3CS1 A;  4M2O A;  4PE1 A;  4QJ3 B;  4CLN A;  3DZT A;  1UHJ A;  5I2L A;  5TNC A;  1PUL A;  1TTX A;  1C3Y A;  5DKR A;  1UUR A;  3A4U B;  5ER4 X;  2OS8 C;  1AUI B;  1MF8 B;  2LHI A;  3DF0 B;  3KF9 A;  1TNQ A;  5IBW A;  4AOM A;  2M29 A;  1BR1 B;  2BE4 A;  1RTP 1;  2F8P A;  1H4B A;  3D74 A;  4FTG A;  1RRO A;  1Y1A A;  3DY9 A;  1REC A;  2B1U A;  1IQ5 A;  3BFB A;  1FI5 A;  2LMV A;  1KK7 Z;  2BNX A;  1QIW A;  2K7O A;  1EJ3 A;  2KOT A;  3BUN B;  1A4P A;  2PYQ A;  4GGF C;  1CB1 A;  1S36 A;  2MBX A;  2JNX A;  2MJW B;  1KFU S;  4JWQ A;  1XVJ A;  3F45 A;  3VRN A;  1F71 A;  1ORG A;  3VGO A;  2JXL A;  1JSA A;  2V53 A;  3D73 A;  3SS3 A;  5HYD A;  5KU1 A;  1F4O A;  2KLD A;  1EG4 A;  4YRU A;  1IQ3 A;  2JZI A;  5G08 A;  1OZO A;  2COL B;  2JTZ A;  4OV2 A;  4MEW A;  1U5I B;  2JNF A;  2KSP A;  1SW8 A;  2MLF C;  4AQI A;  1SR6 C;  4MRX A;  1XK4 C;  1UHK A;  4DS7 A;  1S1E A;  1IWQ A;  1TCF A;  1DEL A;  1SCM C;  1SY9 A;  1V1G A;  3CDN A;  5FYX A;  2M8U A;  3WHT B;  2K7C A;  1ALW A;  4XYN A;  1Y1U A;  2WCL A;  3R72 A;  2WC6 A;  1OZS A;  1S5G Y;  1WRZ A;  3LCP C;  4PT1 A;  3B87 A;  2VRG A;  3CZ1 A;  1YUU A;  1NUB A;  2CCM A;  2JT3 A;  4OKH A;  2LUX A;  1GGW A;  2ZND A;  2LAP A;  1JUO A;  2I7A A;  1KK8 B;  1M39 A;  1B8R A;  4FQO A;  4E68 A;  1IKU A;  1YX8 A;  2CBL A;  1CTR A;  3FE8 A;  2NZ0 A;  3L4L A;  1LVC D;  1JWD A;  2D8N A;  4JD9 A;  1W7J B;  1KFX S;  1Y1X A;  3L4A A;  2KI6 C;  2M0R A;  1Z4H A;  3D76 A;  4QJ4 B;  1EH2 A;  2EC6 B;  1FI6 A;  2KQY A;  1B7T Y;  3OB1 B;  3OP0 A;  3IVT A;  3NHT A;  2H61 A;  2M7N A;  4ORC B;  3HX4 A;  1JFJ A;  2O60 A;  2FOT A;  4I5N B;  3AAJ A;  1CFF A;  1OOI X;  3VRR A;  1YUR A;  2NXQ A;  3DVM A;  3O6B A;  4JQ0 D;  2QEO A;  1HT9 A;  2F3Z A;  3V2L A;  4MLW A;  1CDL A;  3PN7 B;  1KFU L;  3S0G A;  1PVB A;  4PE4 A;  2KFG A;  2P6B B;  1G4Y R;  1TUZ A;  3EK7 A;  2KQ6 A;  1NX0 A;  1QX5 B;  1XFY O;  1UUS A;  1A29 A;  2K60 A;  1QVI Y;  1XYD A;  3NGV A;  3TDZ A;  2M3W A;  2PVB A; 
#chains in the Genus database with same CATH homology
 1DEL A;  1W9Z A;  3UNW A;  1Z4H A;  5D3O A;  4I5L B;  2BAP A;  2BNX A;  5HL1 A;  3IVT A;  4I5N B;  1Z2C B;  2L5Y A;  3OBV A;  3O4X A;  4GBA A;  4JKT A;  5FI6 A;  3UO9 A;  1DC1 A;  5FI7 A;  3SS3 A;  3KEV A;  4GAO A;  4I5K A;  4I5J A;  5I94 A;  2KLD A;  2KLE A;  1DEK A;  3PM2 A;  3SS4 A;  4MEW A;  5FI2 A;  2YGU A;  3SS5 A;  4IJ7 A;  2K60 A;  3EG5 B;  4KYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...