1Z4HA

The response regulator tori belongs to a new family of atypical excisionase
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
66
structure length
66
Chain Sequence
MQHELQPDSLVDLKFIMADTGFGKTFIYDRIKSGDLPKAKVIHGRARWLYRDHCEFKNKLLSRANG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and genetic analyses reveal a key role in prophage excision for the TorI response regulator inhibitor
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding, dna binding protein
molecule keywords Tor inhibition protein
total genus 18
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2005-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.160 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 1z4hA01
1Z4HA
chains in the Genus database with same CATH superfamily
3R1OA 3Q8IA 4USLA 2GGMA 2I7AA 1N65A 2GV5A 2WORA 3WXAA 2HPSA 3D77A 1DTLA 1KFXS 2JXLA 4WQ3A 1CKKA 1AVSA 4PDZA 1IRJA 3BYAA 4XJKA 1GQMA 1ZOTB 2LMTA 2Q4UA 1ZACA 1EXRA 3S0GA 2KBMA 1ALVA 4F7FA 1AP4A 2ZRTA 2LP2A 3D0YB 1UHNA 5CSIA 1CDLA 3BFAA 4A4CA 2JTTA 1KWOC 4ORCB 3FWCA 2LUXA 3SS4A 1XK4C 2HQ8A 2JU0A 4MRYA 1D1OA 3DYEA 2NZ0A 2AUCA 2LC5A 1XFXO 2K7CA 3EK4A 1K9PA 1IKUA 1AJ4A 4PALA 4CIDA 1YUTA 2L4IA 4R1EA 3I5HB 3I5HC 3TDUA 1LVCD 4YGAA 3NSIA 3TS5B 5EL2A 1HT9A 2LMVA 1DF0B 1PALA 4DIRA 1XO5A 1LA0A 4N5XA 1YUUA 3D74A 1CFFA 1L2OB 3CZTX 1J1DA 2KGBC 2LANA 3R1VA 5HL1A 1PRWA 1QVIY 1QXPA 4GNKB 4IJ7A 1B4CA 1K9KA 1N0YA 3CYZA 1OMDA 3CZ0A 3ICBA 4GBAA 1B47A 2KFHA 1G4YR 3S0EA 4GAOA 3AKAA 2AAOA 3DVJA 1BJFA 3KF9A 3TDIA 1EJ3A 4GUKA 2CNPA 1PK0D 3IVTA 4YI8A 3TS5C 1JC2A 1YTZC 4XYNA 1DGVA 1TCFA 2K8MB 3NHIA 2LM5A 1NX0A 3O4XA 2PALA 2DOQA 2KYFA 1W9ZA 2WCKA 1KFXL 1KSMA 3NXAA 2M1UA 2K7DA 1OOFA 2F3YA 2PRUA 1UHHA 1BG1A 1F55A 2LAPA 1WY9A 2HF5A 2BECA 1LINA 2LVKA 2JULA 1A75B 1S1EA 1SSEB 3DY9A 3PFVA 3KO0A 2H61A 2CXJA 3L4AA 2BAPA 1B7TY 3I5IB 1C3YA 1XFYO 2PSRA 3D10A 2KPHA 2JPTA 3TUYC 2CCMA 3CS1A 5GQQC 1MF8B 2P6BB 2WCJA 1J7PA 1DF0A 3FIAA 3CWGA 3JVTC 3JTDB 2O60A 2BCXA 1XFVO 1F4OA 4YGBB 1B1GA 3B86A 3VRRA 4UPGA 1Y1UA 3I5GC 5ER4X 1R6PA 5FI2A 3I5FB 3AAKA 1UP5A 3I5FC 1CDPA 1JWDA 1W7IB 2EC6B 2NCPA 2KDHA 4INWA 2AMIA 4OZDA 4DCKA 3OX5A 1HQVA 3D0YA 1F8HA 1SYMA 1UHJA 1DGUA 2G2BA 1QTXA 1NX1A 1NX3A 4HSZA 3R72A 1TNXA 2K7OA 1SPYA 1WRZA 2JT8A 2CBLA 2M7NA 3BXKA 1W7JB 2P70A 2QDIA 1Z4HA 4XJKB 3LK0A 3VGOA 1JBAA 1KK8B 2MLEC 5CPVA 1PSRA 1MHOA 1XA5A 4MZKA 1XVJA 3SIAA 1UUSA 4DRWA 4C0LA 2QEBA 4L9MA 5I2LA 1M39A 3EK7A 2PMYA 3CABA 1C3ZA 1IJ5A 1AUIB 1RFJA 3SJSA 3O78A 1CFDA 5JOLA 3WNXB 4I5LB 1FW4A 2JXCA 5DICA 3SG2A 2E30A 3QRXA 2IS9A 1LA3A 2F8PA 3CLNA 1NCXA 2H8VA 3DF0A 1JUOA 3EKHA 2LVIA 2KSPA 4AQJA 1JFKA 2ZNEA 2EHBA 1DC1A 1EG4A 4AQIA 3KHEA 1F71A 4GGFA 1PULA 3DZTA 1BU3A 1V1GA 2L2EA 1J1EA 1U5IA 2JNXA 2WCHA 4YGEB 1QV0A 2WNDA 4NDBA 4OKHA 3EK8A 4I5NB 2WCEA 3O2PA 3VRNA 4WQ2A 4FQTA 2NXQA 2M3WA 3RLZA 2PQLA 1JF2A 1KWOB 3D78A 2M9GA 5B8IB 1CNPA 2LHLA 1SNLA 1C7WA 3CR4X 1DJHA 4PE7A 1B9AA 1A4PA 1E8AA 1S6JA 4PHKA 1ODBA 2MLFC 4JKTA 4C0JA 2BNXA 4JD9A 1Y6WA 1ALWA 2A4JA 1S26D 5G08A 1OE9B 2LNKA 3FWBA 5DKNA 1MQ1A 4YI9A 4MN0A 1MXEA 5D69A 3DVMA 4ORAB 4NQGA 1GGWA 1QATA 1ZUZA 1SL7A 5KSZA 1YRUB 3IF7A 4KYNA 1SL8A 1R2UA 2JQ6A 2L51A 1SBJA 2TN4A 4ZCVA 1G33A 1SY9A 4CLNA 1OW4A 1A2XA 1B8LA 3S0FA 3I5GB 1KFUL 1SCMC 1TWOA 2COLB 1QIWA 1PVBA 1WDCC 1TUJA 4WRIA 5HYDA 2CTNA 1CDNA 2WCMA 4MVFA 1RECA 4P5OE 1OMVA 1OSAA 2L98A 1UURA 2M97A 3TUYB 3C1VA 1DVIA 1M63B 1TCOB 2LLUA 3K21A 2F3ZA 3GOFA 3B7AA 3IQQA 3MSEB 2OS8C 4BY5A 1ZFSA 2RGIA 1YVHA 1QWVA 3EKJA 1F4QA 1SR6B 4MRXA 1OZSA 2WC5A 1DEKA 1BMOA 1YURA 4U8DA 2JC2A 1PSBA 3KEVA 1X02A 1IQ5A 1RWYA 1XFUO 3FE8A 3CTNA 1OOGA 1EH2A 3L4LA 3CGAA 1MWNA 4F0ZB 1BODA 1BR4B 2WCBA 1S6CA 2HETA 5HKWA 1IH0A 3BQ3A 5HKYA 1CM1A 1QVIZ 1EG3A 1YR5A 2JT3A 1CLBA 4PHMA 1J7QA 4CFQA 1YRTB 1ZMZA 2D8NA 1QX5B 2H61C 5AEQA 3NSKA 1V1FA 1K96A 3D75A 2KFGA 1CTRA 3HCMA 4PHNA 3SS3A 3TDZA 4HREE 3NSLA 2KGRA 1U5IB 4PT1A 1Q80A 3VROA 1K94A 2KYCA 3GK1A 4IL1A 5AXIA 3GK4X 1QJTA 2WC8A 1WLMA 1C07A 2LHIA 4QJ5B 1ORGA 1XFRA 2L4HA 3EVUA 5KU1A 2KAXA 1CMFA 3A8RA 1TNQA 1CDMA 2L5YA 2MHHA 1SCVA 2O5GA 1QASA 4FTGA 3S0AA 5DKRA 3PN7C 1IJ6A 3BFHA 3ZNIA 4A4BA 2KI6C 2LVVA 2LLTA 2JOJA 3CDNA 3CZ2A 4INXA 1Y1AA 2HQWA 1CFCA 3VB1A 1QIVA 3LLEA 3D76A 1WLZA 4OV2A 4N1FA 2F2OA 4YBHB 2L5XB 3RZSA 3PM8A 1TNWA 1CFPA 4CPVA 4D1EA 4ICBA 1FI5A 2K60A 3B88A 4CFRA 1UHKA 2JPOA 5FI7A 2KOTA 2Y1MA 1KCYA 1SKTA 1K2HA 1B8RA 1NP8A 1SL9A 2OS8B 1Y1XA 3DVEA 2F33A 4I5KA 1OZOA 3LCPC 4Q04A 3JVTB 1QX7A 2K2AA 4BY4A 1MXLC 3CZ1A 1FI6A 1S6IA 1H8BA 1J7RA 3R1PA 1MR8A 4MZLA 4DS7A 1QLSA 2WOSA 5AANA 1NUBA 2BL0B 1A75A 2L2CA 1OMRA 2K61A 2KBIA 2LLSA 2KI4C 1WRKA 2WC6A 1P28A 3CR2A 3H4SE 5I2QA 1K8UA 3AKBA 3PN7B 1AJ5A 1OOJA 1UWOA 1C7VA 1BR1B 3DF0B 4JWQA 2K2FA 1JSAA 1K9UA 1YUSA 5KTYA 3OP0A 1DJWA 1UHIA 1YX7A 2BCBA 3EG5B 3BJHA 2FJYA 4GPLB 1EL4A 5IBWA 1RJVA 3L47A 1TTXA 2ZKMX 5HLVA 3O6BA 5F6TA 2OPOA 1SW8A 3BOWB 2R2IA 3IQOA 1IG5A 3EVVA 4PE0A 1MUXA 5AERA 1GM0A 1A29A 1KSOA 1NSHA 2KQ6A 2LE9B 2LP3A 3SG3A 5I8NA 1F54A 5TNCA 1L2OC 1TUZA 4MBEA 5I94A 2LVJA 1CM4A 1TN4A 1IIOA 2ERBA 2GTEA 2I94A 5HKZA 2NCOA 4E68A 1IGVA 3SG7A 4HRHA 1NYAA 2M8UA 4ZCUA 2MRDA 2OTGB 1F70A 4MZJA 4QJ4B 4MSPA 2SASA 3O4YA 2M0RA 5FYXA 4ETOA 1OOIX 2FOTA 1DELA 2PYQA 2LUCA 3B87A 5CSJA 3CR5X 2KLEA 3M0WA 3SG6A 1BT6A 1DJYA 1TIZA 4OR9B 2KFFA 3BUMB 5AFPA 1JF0A 3FE6A 1RK9A 5D3OA 4QJ3B 1FBVA 3SIBA 1XK4A 2ZN8A 1DJXA 2BL0C 3S0BA 3VRQA 1KFUS 3D73A 3BUOB 1S36A 2EC6C 1S5GZ 1WDCB 1GJYA 4P2YB 1BOCA 4OVNF 1SCMB 1PVAA 1Y0VH 1VRKA 5CSNA 3DD4A 1KK8C 2V53A 2FCEA 1QS7A 2Y4QA 3A4UB 3E3RA 3LL8B 2K7BA 1SR6C 1RROA 1KK7Y 2CT9A 2LV7A 3HX4A 5FI6A 2ZFDA 1GGZA 3OB1B 4N1GA 1NX2A 1OQPA 3NHTA 3OB2B 2FJUB 4MEWA 1DQEA 3PM2A 1RTP1 4PHJA 3OBVA 5K89A 1CMGA 1DJGA 3S0DA 1OOHA 1DJZA 3RM1A 2M29A 2NLNA 4NDDA 3OGNA 2JRFA 2ZRSA 1KQVA 1L7ZA 2BKHB 2I2RE 2L50A 1NCYA 2Y5IA 2YGUA 4PCWA 3UNWA 2QEHA 2QPTA 4TNCA 5PALA 3BFBA 1YX8A 2KLDA 4HRGA 2BCAA 2JNFA 4MLWA 3ZWHA 1LS8A 1NIWA 2EGDA 5D7FA 3WHTB 1KQMB 2I18A 5BPJA 2SCPA 5JJGA 1CLLA 1FPWA 1B8CA 3PLFB 5DKQA 2M1KB 1NWDA 3N7HA 1S5GY 1H4BA 5CSFA 1TNPA 3GK2A 2KAYA 2GGZA 1KK7Z 3EVRA 2JT0A 2JZIA 3JTDC 2FCDA 2G9BA 4PE4A 2ISDA 1NPQA 1XFWO 4I5JA 1QV1A 2BBMA 3BUWB 3PATA 1M31A 3OHMB 3V2LA 2QEVA 1B7TZ 2KNEA 2LCPA 2PASA 3DXLA 2WCLA 1LXFC 3BUXB 1FF1A 1QX2A 1SMGA 2JTZA 3NSOA 1AK8A 3OX6A 2B1UA 2QACA 4YGDB 2Q91A 1CLMA 3FS7A 1DMOA 4PE1A 3SG5A 1JFJA 4GFTA 3UO9A 1BF5A 1DJIA 4YRUA 4M2PA 3BOWA 3WHUB 5ER5A 1QLKA 2QEOA 2M7LA 2F2PA 3K1EA 4M2OA 4DUQA 5HLOA 5J3XA 1CB1A 3PSRA 2Y1NA 3SS5A 2MA2A 4OCIA 1WRLA 4YGCB 1SRAA 2VRGA 3B6XA 2BKIB 2OTGC 1YVLA 2H2KA 1M46A 4NDCA 1K93D 4JPZB 2MBXA 1AHRA 1K90D 2K0JA 2PVBA 3BUNB 2M49B 2KHNA 2KQYA 1BLQA 1Z2CB 3DVKA 3TZ1A 2KI6D 1J7OA 1N2DA 1XFZO 1A03A 1TRFA 1M45A 2ZNDA 3VRPA 3PALA 3FE9A 1S3PA 2E6WA 1KQMC 1G8IA 4M2QA 1DT7B 1IQ3A 2JWWA 1XYDA 1TOPA 1LKJA 3AAJA 2KAVA 2ZN9A 1NCZA 4C0KA 4GGNA 4JQ0D 2LMUA 3KPXA 3NGVA 2L0PA 5I2OA 2MAZA 2KI4B 3PJIA 4ORBB 2WCFA 2BE6A 3QMEA 3SG4A 4FQOA 1T14A 1K95A 3I5IC 1J55A 4GGFC 2P71A 3F45A 2MJWB 2BBNA 1IWQA 2BE4A 3LK1A 4AOMA 1SK6D
chains in the Genus database with same CATH topology
3O4XA 5FI2A 1DEKA 2K60A 1W9ZA 3KEVA 4KYNA 5FI7A 3EG5B 5FI6A 1DELA 4I5KA 4MEWA 3SS5A 2L5YA 3PM2A 4I5NB 2KLEA 3OBVA 4I5JA 5HL1A 4IJ7A 2BAPA 5D3OA 2YGUA 4GBAA 4I5LB 3UNWA 4GAOA 5I94A 2KLDA 4JKTA 2BNXA 1Z2CB 3SS4A 3UO9A 3IVTA 3SS3A 1Z4HA 1DC1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z4H A; 
#chains in the Genus database with same CATH topology
 3R1O A;  3Q8I A;  4USL A;  2GGM A;  2I7A A;  1N65 A;  2GV5 A;  2WOR A;  3WXA A;  2HPS A;  3D77 A;  1DTL A;  1KFX S;  2JXL A;  4WQ3 A;  1CKK A;  1AVS A;  4PDZ A;  1IRJ A;  3BYA A;  4XJK A;  1GQM A;  1ZOT B;  2LMT A;  2Q4U A;  1ZAC A;  1EXR A;  3S0G A;  2KBM A;  1ALV A;  4F7F A;  1AP4 A;  2ZRT A;  2LP2 A;  3D0Y B;  1UHN A;  5CSI A;  1CDL A;  3BFA A;  4A4C A;  2JTT A;  1KWO C;  4ORC B;  3FWC A;  2LUX A;  3SS4 A;  1XK4 C;  2HQ8 A;  2JU0 A;  4MRY A;  1D1O A;  3DYE A;  2NZ0 A;  2AUC A;  2LC5 A;  1XFX O;  2K7C A;  3EK4 A;  1K9P A;  1IKU A;  1AJ4 A;  4PAL A;  4CID A;  1YUT A;  2L4I A;  4R1E A;  3I5H B;  3I5H C;  3TDU A;  1LVC D;  4YGA A;  3NSI A;  3TS5 B;  5EL2 A;  1HT9 A;  2LMV A;  1DF0 B;  1PAL A;  4DIR A;  1XO5 A;  1LA0 A;  4N5X A;  1YUU A;  3D74 A;  1CFF A;  1L2O B;  3CZT X;  1J1D A;  2KGB C;  2LAN A;  3R1V A;  5HL1 A;  1PRW A;  1QVI Y;  1QXP A;  4GNK B;  4IJ7 A;  1B4C A;  1K9K A;  1N0Y A;  3CYZ A;  1OMD A;  3CZ0 A;  3ICB A;  4GBA A;  1B47 A;  2KFH A;  1G4Y R;  3S0E A;  4GAO A;  3AKA A;  2AAO A;  3DVJ A;  1BJF A;  3KF9 A;  3TDI A;  1EJ3 A;  4GUK A;  2CNP A;  1PK0 D;  3IVT A;  4YI8 A;  3TS5 C;  1JC2 A;  1YTZ C;  4XYN A;  1DGV A;  1TCF A;  2K8M B;  3NHI A;  2LM5 A;  1NX0 A;  3O4X A;  2PAL A;  2DOQ A;  2KYF A;  1W9Z A;  2WCK A;  1KFX L;  1KSM A;  3NXA A;  2M1U A;  2K7D A;  1OOF A;  2F3Y A;  2PRU A;  1UHH A;  1BG1 A;  1F55 A;  2LAP A;  1WY9 A;  2HF5 A;  2BEC A;  1LIN A;  2LVK A;  2JUL A;  1A75 B;  1S1E A;  1SSE B;  3DY9 A;  3PFV A;  3KO0 A;  2H61 A;  2CXJ A;  3L4A A;  2BAP A;  1B7T Y;  3I5I B;  1C3Y A;  1XFY O;  2PSR A;  3D10 A;  2KPH A;  2JPT A;  3TUY C;  2CCM A;  3CS1 A;  5GQQ C;  1MF8 B;  2P6B B;  2WCJ A;  1J7P A;  1DF0 A;  3FIA A;  3CWG A;  3JVT C;  3JTD B;  2O60 A;  2BCX A;  1XFV O;  1F4O A;  4YGB B;  1B1G A;  3B86 A;  3VRR A;  4UPG A;  1Y1U A;  3I5G C;  5ER4 X;  1R6P A;  5FI2 A;  3I5F B;  3AAK A;  1UP5 A;  3I5F C;  1CDP A;  1JWD A;  1W7I B;  2EC6 B;  2NCP A;  2KDH A;  4INW A;  2AMI A;  4OZD A;  4DCK A;  3OX5 A;  1HQV A;  3D0Y A;  1F8H A;  1SYM A;  1UHJ A;  1DGU A;  2G2B A;  1QTX A;  1NX1 A;  1NX3 A;  4HSZ A;  3R72 A;  1TNX A;  2K7O A;  1SPY A;  1WRZ A;  2JT8 A;  2CBL A;  2M7N A;  3BXK A;  1W7J B;  2P70 A;  2QDI A;  1Z4H A;  4XJK B;  3LK0 A;  3VGO A;  1JBA A;  1KK8 B;  2MLE C;  5CPV A;  1PSR A;  1MHO A;  1XA5 A;  4MZK A;  1XVJ A;  3SIA A;  1UUS A;  4DRW A;  4C0L A;  2QEB A;  4L9M A;  5I2L A;  1M39 A;  3EK7 A;  2PMY A;  3CAB A;  1C3Z A;  1IJ5 A;  1AUI B;  1RFJ A;  3SJS A;  3O78 A;  1CFD A;  5JOL A;  3WNX B;  4I5L B;  1FW4 A;  2JXC A;  5DIC A;  3SG2 A;  2E30 A;  3QRX A;  2IS9 A;  1LA3 A;  2F8P A;  3CLN A;  1NCX A;  2H8V A;  3DF0 A;  1JUO A;  3EKH A;  2LVI A;  2KSP A;  4AQJ A;  1JFK A;  2ZNE A;  2EHB A;  1DC1 A;  1EG4 A;  4AQI A;  3KHE A;  1F71 A;  4GGF A;  1PUL A;  3DZT A;  1BU3 A;  1V1G A;  2L2E A;  1J1E A;  1U5I A;  2JNX A;  2WCH A;  4YGE B;  1QV0 A;  2WND A;  4NDB A;  4OKH A;  3EK8 A;  4I5N B;  2WCE A;  3O2P A;  3VRN A;  4WQ2 A;  4FQT A;  2NXQ A;  2M3W A;  3RLZ A;  2PQL A;  1JF2 A;  1KWO B;  3D78 A;  2M9G A;  5B8I B;  1CNP A;  2LHL A;  1SNL A;  1C7W A;  3CR4 X;  1DJH A;  4PE7 A;  1B9A A;  1A4P A;  1E8A A;  1S6J A;  4PHK A;  1ODB A;  2MLF C;  4JKT A;  4C0J A;  2BNX A;  4JD9 A;  1Y6W A;  1ALW A;  2A4J A;  1S26 D;  5G08 A;  1OE9 B;  2LNK A;  3FWB A;  5DKN A;  1MQ1 A;  4YI9 A;  4MN0 A;  1MXE A;  5D69 A;  3DVM A;  4ORA B;  4NQG A;  1GGW A;  1QAT A;  1ZUZ A;  1SL7 A;  5KSZ A;  1YRU B;  3IF7 A;  4KYN A;  1SL8 A;  1R2U A;  2JQ6 A;  2L51 A;  1SBJ A;  2TN4 A;  4ZCV A;  1G33 A;  1SY9 A;  4CLN A;  1OW4 A;  1A2X A;  1B8L A;  3S0F A;  3I5G B;  1KFU L;  1SCM C;  1TWO A;  2COL B;  1QIW A;  1PVB A;  1WDC C;  1TUJ A;  4WRI A;  5HYD A;  2CTN A;  1CDN A;  2WCM A;  4MVF A;  1REC A;  4P5O E;  1OMV A;  1OSA A;  2L98 A;  1UUR A;  2M97 A;  3TUY B;  3C1V A;  1DVI A;  1M63 B;  1TCO B;  2LLU A;  3K21 A;  2F3Z A;  3GOF A;  3B7A A;  3IQQ A;  3MSE B;  2OS8 C;  4BY5 A;  1ZFS A;  2RGI A;  1YVH A;  1QWV A;  3EKJ A;  1F4Q A;  1SR6 B;  4MRX A;  1OZS A;  2WC5 A;  1DEK A;  1BMO A;  1YUR A;  4U8D A;  2JC2 A;  1PSB A;  3KEV A;  1X02 A;  1IQ5 A;  1RWY A;  1XFU O;  3FE8 A;  3CTN A;  1OOG A;  1EH2 A;  3L4L A;  3CGA A;  1MWN A;  4F0Z B;  1BOD A;  1BR4 B;  2WCB A;  1S6C A;  2HET A;  5HKW A;  1IH0 A;  3BQ3 A;  5HKY A;  1CM1 A;  1QVI Z;  1EG3 A;  1YR5 A;  2JT3 A;  1CLB A;  4PHM A;  1J7Q A;  4CFQ A;  1YRT B;  1ZMZ A;  2D8N A;  1QX5 B;  2H61 C;  5AEQ A;  3NSK A;  1V1F A;  1K96 A;  3D75 A;  2KFG A;  1CTR A;  3HCM A;  4PHN A;  3SS3 A;  3TDZ A;  4HRE E;  3NSL A;  2KGR A;  1U5I B;  4PT1 A;  1Q80 A;  3VRO A;  1K94 A;  2KYC A;  3GK1 A;  4IL1 A;  5AXI A;  3GK4 X;  1QJT A;  2WC8 A;  1WLM A;  1C07 A;  2LHI A;  4QJ5 B;  1ORG A;  1XFR A;  2L4H A;  3EVU A;  5KU1 A;  2KAX A;  1CMF A;  3A8R A;  1TNQ A;  1CDM A;  2L5Y A;  2MHH A;  1SCV A;  2O5G A;  1QAS A;  4FTG A;  3S0A A;  5DKR A;  3PN7 C;  1IJ6 A;  3BFH A;  3ZNI A;  4A4B A;  2KI6 C;  2LVV A;  2LLT A;  2JOJ A;  3CDN A;  3CZ2 A;  4INX A;  1Y1A A;  2HQW A;  1CFC A;  3VB1 A;  1QIV A;  3LLE A;  3D76 A;  1WLZ A;  4OV2 A;  4N1F A;  2F2O A;  4YBH B;  2L5X B;  3RZS A;  3PM8 A;  1TNW A;  1CFP A;  4CPV A;  4D1E A;  4ICB A;  1FI5 A;  2K60 A;  3B88 A;  4CFR A;  1UHK A;  2JPO A;  5FI7 A;  2KOT A;  2Y1M A;  1KCY A;  1SKT A;  1K2H A;  1B8R A;  1NP8 A;  1SL9 A;  2OS8 B;  1Y1X A;  3DVE A;  2F33 A;  4I5K A;  1OZO A;  3LCP C;  4Q04 A;  3JVT B;  1QX7 A;  2K2A A;  4BY4 A;  1MXL C;  3CZ1 A;  1FI6 A;  1S6I A;  1H8B A;  1J7R A;  3R1P A;  1MR8 A;  4MZL A;  4DS7 A;  1QLS A;  2WOS A;  5AAN A;  1NUB A;  2BL0 B;  1A75 A;  2L2C A;  1OMR A;  2K61 A;  2KBI A;  2LLS A;  2KI4 C;  1WRK A;  2WC6 A;  1P28 A;  3CR2 A;  3H4S E;  5I2Q A;  1K8U A;  3AKB A;  3PN7 B;  1AJ5 A;  1OOJ A;  1UWO A;  1C7V A;  1BR1 B;  3DF0 B;  4JWQ A;  2K2F A;  1JSA A;  1K9U A;  1YUS A;  5KTY A;  3OP0 A;  1DJW A;  1UHI A;  1YX7 A;  2BCB A;  3EG5 B;  3BJH A;  2FJY A;  4GPL B;  1EL4 A;  5IBW A;  1RJV A;  3L47 A;  1TTX A;  2ZKM X;  5HLV A;  3O6B A;  5F6T A;  2OPO A;  1SW8 A;  3BOW B;  2R2I A;  3IQO A;  1IG5 A;  3EVV A;  4PE0 A;  1MUX A;  5AER A;  1GM0 A;  1A29 A;  1KSO A;  1NSH A;  2KQ6 A;  2LE9 B;  2LP3 A;  3SG3 A;  5I8N A;  1F54 A;  5TNC A;  1L2O C;  1TUZ A;  4MBE A;  5I94 A;  2LVJ A;  1CM4 A;  1TN4 A;  1IIO A;  2ERB A;  2GTE A;  2I94 A;  5HKZ A;  2NCO A;  4E68 A;  1IGV A;  3SG7 A;  4HRH A;  1NYA A;  2M8U A;  4ZCU A;  2MRD A;  2OTG B;  1F70 A;  4MZJ A;  4QJ4 B;  4MSP A;  2SAS A;  3O4Y A;  2M0R A;  5FYX A;  4ETO A;  1OOI X;  2FOT A;  1DEL A;  2PYQ A;  2LUC A;  3B87 A;  5CSJ A;  3CR5 X;  2KLE A;  3M0W A;  3SG6 A;  1BT6 A;  1DJY A;  1TIZ A;  4OR9 B;  2KFF A;  3BUM B;  5AFP A;  1JF0 A;  3FE6 A;  1RK9 A;  5D3O A;  4QJ3 B;  1FBV A;  3SIB A;  1XK4 A;  2ZN8 A;  1DJX A;  2BL0 C;  3S0B A;  3VRQ A;  1KFU S;  3D73 A;  3BUO B;  1S36 A;  2EC6 C;  1S5G Z;  1WDC B;  1GJY A;  4P2Y B;  1BOC A;  4OVN F;  1SCM B;  1PVA A;  1Y0V H;  1VRK A;  5CSN A;  3DD4 A;  1KK8 C;  2V53 A;  2FCE A;  1QS7 A;  2Y4Q A;  3A4U B;  3E3R A;  3LL8 B;  2K7B A;  1SR6 C;  1RRO A;  1KK7 Y;  2CT9 A;  2LV7 A;  3HX4 A;  5FI6 A;  2ZFD A;  1GGZ A;  3OB1 B;  4N1G A;  1NX2 A;  1OQP A;  3NHT A;  3OB2 B;  2FJU B;  4MEW A;  1DQE A;  3PM2 A;  1RTP 1;  4PHJ A;  3OBV A;  5K89 A;  1CMG A;  1DJG A;  3S0D A;  1OOH A;  1DJZ A;  3RM1 A;  2M29 A;  2NLN A;  4NDD A;  3OGN A;  2JRF A;  2ZRS A;  1KQV A;  1L7Z A;  2BKH B;  2I2R E;  2L50 A;  1NCY A;  2Y5I A;  2YGU A;  4PCW A;  3UNW A;  2QEH A;  2QPT A;  4TNC A;  5PAL A;  3BFB A;  1YX8 A;  2KLD A;  4HRG A;  2BCA A;  2JNF A;  4MLW A;  3ZWH A;  1LS8 A;  1NIW A;  2EGD A;  5D7F A;  3WHT B;  1KQM B;  2I18 A;  5BPJ A;  2SCP A;  5JJG A;  1CLL A;  1FPW A;  1B8C A;  3PLF B;  5DKQ A;  2M1K B;  1NWD A;  3N7H A;  1S5G Y;  1H4B A;  5CSF A;  1TNP A;  3GK2 A;  2KAY A;  2GGZ A;  1KK7 Z;  3EVR A;  2JT0 A;  2JZI A;  3JTD C;  2FCD A;  2G9B A;  4PE4 A;  2ISD A;  1NPQ A;  1XFW O;  4I5J A;  1QV1 A;  2BBM A;  3BUW B;  3PAT A;  1M31 A;  3OHM B;  3V2L A;  2QEV A;  1B7T Z;  2KNE A;  2LCP A;  2PAS A;  3DXL A;  2WCL A;  1LXF C;  3BUX B;  1FF1 A;  1QX2 A;  1SMG A;  2JTZ A;  3NSO A;  1AK8 A;  3OX6 A;  2B1U A;  2QAC A;  4YGD B;  2Q91 A;  1CLM A;  3FS7 A;  1DMO A;  4PE1 A;  3SG5 A;  1JFJ A;  4GFT A;  3UO9 A;  1BF5 A;  1DJI A;  4YRU A;  4M2P A;  3BOW A;  3WHU B;  5ER5 A;  1QLK A;  2QEO A;  2M7L A;  2F2P A;  3K1E A;  4M2O A;  4DUQ A;  5HLO A;  5J3X A;  1CB1 A;  3PSR A;  2Y1N A;  3SS5 A;  2MA2 A;  4OCI A;  1WRL A;  4YGC B;  1SRA A;  2VRG A;  3B6X A;  2BKI B;  2OTG C;  1YVL A;  2H2K A;  1M46 A;  4NDC A;  1K93 D;  4JPZ B;  2MBX A;  1AHR A;  1K90 D;  2K0J A;  2PVB A;  3BUN B;  2M49 B;  2KHN A;  2KQY A;  1BLQ A;  1Z2C B;  3DVK A;  3TZ1 A;  2KI6 D;  1J7O A;  1N2D A;  1XFZ O;  1A03 A;  1TRF A;  1M45 A;  2ZND A;  3VRP A;  3PAL A;  3FE9 A;  1S3P A;  2E6W A;  1KQM C;  1G8I A;  4M2Q A;  1DT7 B;  1IQ3 A;  2JWW A;  1XYD A;  1TOP A;  1LKJ A;  3AAJ A;  2KAV A;  2ZN9 A;  1NCZ A;  4C0K A;  4GGN A;  4JQ0 D;  2LMU A;  3KPX A;  3NGV A;  2L0P A;  5I2O A;  2MAZ A;  2KI4 B;  3PJI A;  4ORB B;  2WCF A;  2BE6 A;  3QME A;  3SG4 A;  4FQO A;  1T14 A;  1K95 A;  3I5I C;  1J55 A;  4GGF C;  2P71 A;  3F45 A;  2MJW B;  2BBN A;  1IWQ A;  2BE4 A;  3LK1 A;  4AOM A;  1SK6 D; 
#chains in the Genus database with same CATH homology
 3O4X A;  5FI2 A;  1DEK A;  2K60 A;  1W9Z A;  3KEV A;  4KYN A;  5FI7 A;  3EG5 B;  5FI6 A;  1DEL A;  4I5K A;  4MEW A;  3SS5 A;  2L5Y A;  3PM2 A;  4I5N B;  2KLE A;  3OBV A;  4I5J A;  5HL1 A;  4IJ7 A;  2BAP A;  5D3O A;  2YGU A;  4GBA A;  4I5L B;  3UNW A;  4GAO A;  5I94 A;  2KLD A;  4JKT A;  2BNX A;  1Z2C B;  3SS4 A;  3UO9 A;  3IVT A;  3SS3 A;  1Z4H A;  1DC1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...