1Z4HA

The response regulator tori belongs to a new family of atypical excisionase
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
66
structure length
66
Chain Sequence
MQHELQPDSLVDLKFIMADTGFGKTFIYDRIKSGDLPKAKVIHGRARWLYRDHCEFKNKLLSRANG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tor inhibition protein
publication title Structural and genetic analyses reveal a key role in prophage excision for the TorI response regulator inhibitor
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding, dna binding protein
total genus 18
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2005-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.160 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 1z4hA01
1Z4HA
chains in the Genus database with same CATH superfamily
4DUQA 2CTNA 1IKUA 3K21A 3KEVA 1A29A 4CFRA 1XFYO 1W9ZA 1NCZA 1BMOA 2KAYA 2K7CA 2BKIB 4YI9A 1JF0A 4OR9B 2QEBA 4PHNA 1PK0D 3IQQA 3CZ0A 1IQ3A 2B1UA 1K8UA 4DCKA 3JTDB 1VRKA 4N1FA 1RK9A 1CB1A 3HCMA 3BOWA 3V2LA 4YI8A 3SS4A 1CM4A 1XFXO 1CLLA 1PALA 2ZNDA 1KFXS 4OKHA 1SL7A 2HQWA 3DZTA 1CNPA 1KK8C 1OZSA 1ZMZA 1G33A 2PSRA 5AERA 1XVJA 1L7ZA 1K90D 1NSHA 2K2FA 3D78A 2KI6D 3QMEA 5G08A 3SG7A 1SSEB 1KSMA 2FCDA 2JOJA 1QS7A 1Y1AA 2P70A 5FYXA 1SBJA 1QJTA 5CPVA 4JQ0D 1SK6D 1S1EA 3SG2A 1K95A 1BR1B 1CFCA 2WCHA 2NCPA 2KPHA 2HPSA 2KBMA 2PALA 3CLNA 2PASA 3DVKA 4YGBB 1R6PA 1MXEA 2ZFDA 1PSBA 3IF7A 3PJIA 1F4OA 3CR4X 2BCAA 1FBVA 3DYEA 4F0ZB 1RFJA 3PSRA 1XFUO 3LK1A 1ZACA 3CR5X 2SCPA 3PM8A 2SASA 1ALVA 1QXPA 1XFVO 1TCFA 5ER5A 2KQYA 4ICBA 4WRIA 5HLVA 2JRFA 4CLNA 1YVHA 2Y1MA 3EG5B 4GNKB 1ZOTB 1J55A 1K93D 4NDBA 3NSLA 1G8IA 4PALA 3D77A 2K2AA 3DF0B 1NIWA 3OB2B 3I5FB 4DS7A 3S0DA 1DTLA 1B9AA 1DF0A 2JULA 3R1VA 1M31A 1JSAA 1YR5A 2JWWA 3BOWB 1SKTA 1S5GZ 3L4LA 2MJWB 4GBAA 1SW8A 2F2OA 2PMYA 1KSOA 2E6WA 4FQTA 1TRFA 4R1EA 1MF8B 1Y0VH 3JTDC 4GGNA 5I2QA 4JD9A 4U8DA 1HT9A 4FTGA 2H61C 1Y6WA 1NX0A 1XFRA 2EHBA 2I2RE 2LVJA 2WNDA 1MQ1A 3VRPA 4A4BA 3B7AA 1EG4A 1YX7A 1RTP1 1TTXA 1KWOB 4IJ7A 1B8RA 4FQOA 2I18A 2WC8A 5D3OA 1V1GA 4YGEB 1J7RA 3RLZA 2LHLA 2L0PA 4CPVA 2P71A 5HKZA 1K96A 4DRWA 1F70A 1UHIA 2KAXA 1QX7A 1MXLC 1JBAA 1QV0A 1CTRA 1QVIZ 2WORA 4MRXA 1M46A 5GQQC 4HREE 1AK8A 3PALA 2L2CA 3D0YA 1LS8A 3PN7B 1DJIA 5HL1A 2BE4A 2M29A 2ZN9A 1KFUS 4NDCA 2ZNEA 1E8AA 1EG3A 1W7IB 5FI6A 5CSNA 4WQ3A 1WRLA 2G2BA 2L50A 3AAKA 1PVBA 1K9PA 2WCFA 3TDIA 1C7WA 2JXLA 2P6BB 2MA2A 5FI2A 1DF0B 1C07A 3TZ1A 5J3XA 4MLWA 4CIDA 3BUNB 1XA5A 4GFTA 3L4AA 3NHTA 2GV5A 1Q80A 1NX1A 2HF5A 1AVSA 4QJ3B 4YBHB 1RWYA 3TUYB 1PSRA 3A4UB 3PATA 1IJ5A 3BJHA 4JWQA 2WCBA 4A4CA 2K8MB 2NZ0A 2WOSA 3L47A 3VB1A 3RM1A 1FI6A 2K7BA 1Y1UA 1K94A 1R2UA 2QEHA 3NHIA 3FS7A 5ER4X 5I2LA 2G9BA 3SS5A 5DKQA 1DJWA 2COLB 1CDLA 2LANA 4ZCVA 1S36A 5KSZA 1BOCA 4F7FA 4YGAA 1EL4A 3FIAA 3NGVA 2BKHB 1OOJA 2KYFA 1SMGA 1T14A 1ZFSA 2L51A 1EXRA 1PRWA 3GK2A 4PHMA 5I8NA 1S26D 1SRAA 5CSIA 1TUJA 3GK1A 4ORAB 1WDCB 5D7FA 1DJYA 1M39A 1OMVA 2CCMA 4ORCB 5K89A 1IGVA 1ZUZA 2HETA 3D0YB 3S0EA 3SIBA 3VRNA 2EGDA 3FWBA 3DF0A 4INXA 1NX3A 5DICA 3PLFB 1WY9A 2WCLA 4JKTA 1CFPA 1QASA 3RZSA 2LLUA 1QX5B 1KFXL 3ICBA 3UNWA 3PN7C 2CNPA 1XYDA 4OCIA 1J1DA 3EKHA 2KGRA 1KQMC 2F8PA 5DKNA 4M2PA 4MRYA 1OOHA 3TDUA 1DGVA 2M3WA 2E30A 3SG3A 1B8LA 2M1UA 3D10A 3M0WA 3SS3A 2DOQA 3FE6A 2K60A 2MRDA 3DD4A 1XO5A 3F45A 1C7VA 2L5YA 3BUOB 3CABA 3I5GB 1DELA 1ODBA 3OBVA 4TNCA 4DIRA 3TUYC 2JT8A 3N7HA 2Y4QA 4P5OE 1ALWA 1IWQA 4MEWA 1HQVA 4MSPA 1J7QA 5AFPA 1CMGA 1Y1XA 3EVUA 3BFHA 2AUCA 5HYDA 1TN4A 3VGOA 1UUSA 1QLKA 2JZIA 3PM2A 1NP8A 1Z2CB 2NLNA 4XYNA 1K9UA 1SCMB 3O4YA 1OQPA 5DKRA 3LLEA 1TNPA 1X02A 3CTNA 3KO0A 5B8IB 1U5IB 2RGIA 1A4PA 1IRJA 4JPZB 4C0LA 3BYAA 1V1FA 4OV2A 1RROA 5BPJA 1H8BA 1OOGA 1WDCC 3KHEA 1ORGA 4GPLB 1S6CA 3EK8A 3JVTB 2KAVA 1UHJA 3BFBA 5AXIA 3WNXB 1N0YA 2JPTA 1CFFA 2M49B 1CM1A 3E3RA 4Q04A 2M7LA 1QX2A 4BY4A 1QTXA 4QJ4B 1FPWA 2M9GA 2YGUA 2FJYA 2LMTA 3I5IB 2LNKA 1A03A 1QV1A 4D1EA 1RJVA 2FJUB 2I94A 2CBLA 1BT6A 3Q8IA 2KI6C 4OZDA 1DVIA 3BUWB 1YX8A 1B8CA 4I5LB 1K2HA 3S0BA 3GK4X 3AKAA 3DY9A 2MLFC 3OP0A 4MZLA 1B4CA 1H4BA 1IIOA 1F55A 1CDMA 2LLTA 1XK4A 1L2OB 1YRUB 1YUSA 3I5HB 1TWOA 2BBMA 2NXQA 2WCEA 4I5NB 4C0KA 4E68A 1CLBA 1KFUL 4AOMA 4PCWA 4M2OA 2ZN8A 3D73A 2LVIA 1NWDA 4N1GA 3FE9A 2JTTA 2KFHA 2ISDA 3B87A 1IQ5A 1QWVA 3KF9A 1LA0A 2JT0A 1UP5A 4C0JA 2K0JA 2H8VA 3BXKA 3R72A 1A2XA 1B7TZ 1A75A 2LLSA 3EK7A 1FF1A 1OZOA 1IJ6A 2Q91A 4MN0A 1KCYA 1SCMC 2LHIA 2WCKA 5KU1A 1SCVA 2JNXA 2JPOA 2F3ZA 3FE8A 4USLA 1LINA 2FCEA 4PE7A 5D69A 1J7PA 4I5JA 2CT9A 1NX2A 2KLDA 1LXFC 1NCYA 3I5FC 3SG5A 1YVLA 4ORBB 3JVTC 1EJ3A 5EL2A 2ERBA 1TUZA 2KFFA 1KK7Z 4HRGA 2Y1NA 3VROA 4MZJA 2M97A 1AJ5A 1BODA 1UHNA 5F6TA 2F3YA 2I7AA 1B7TY 2L5XB 1TNXA 4XJKB 1DJZA 1XFWO 2WCMA 4YRUA 1TCOB 3CZ2A 3CDNA 2BL0B 3I5IC 3CZTX 1D1OA 2L4IA 1JFKA 3OGNA 3WXAA 1OSAA 1CFDA 1XFZO 2QACA 3S0GA 2JQ6A 1QIWA 1N65A 1QLSA 2KDHA 3O6BA 1UWOA 1KWOC 2KSPA 3B86A 1J1EA 1TNWA 1NYAA 2M1KB 1KK7Y 2LAPA 2QPTA 1U5IA 4INWA 5CSJA 2K7DA 5IBWA 4N5XA 1WLZA 2OS8B 2MAZA 1TOPA 1LKJA 1L2OC 1GQMA 5HKWA 1GM0A 3I5HC 4BY5A 2M0RA 1N2DA 1A75B 3DVMA 2PYQA 1UURA 2WC5A 3EVVA 1DJGA 3FWCA 2BNXA 1IH0A 2GGZA 2LMUA 1S3PA 4PHKA 2LC5A 3S0AA 1BG1A 4PHJA 1PULA 3UO9A 2KGBC 3R1PA 2KLEA 2AMIA 1QIVA 2LMVA 4MVFA 2MLEC 2Y5IA 2AAOA 3A8RA 4AQIA 3TS5B 1FI5A 1DC1A 1NPQA 2A4JA 4PDZA 3EK4A 3D75A 4UPGA 1F71A 1UHHA 2JU0A 1M45A 4HRHA 3KPXA 1LA3A 4AQJA 3BQ3A 3IVTA 2HQ8A 5AANA 2L98A 4CFQA 1BLQA 3OX5A 2D8NA 1C3ZA 3ZNIA 1SR6B 1C3YA 3O4XA 2H2KA 2O5GA 3MSEB 2PRUA 2BL0C 3TDZA 2ZRTA 1TNQA 1MHOA 3NXAA 1B1GA 2LCPA 5JJGA 2M8UA 2KI4B 2WCJA 2BCBA 3BUXB 1DJHA 2KQ6A 4MBEA 3DVEA 1DMOA 3S0FA 1XK4C 2VRGA 1OMRA 4MZKA 3CS1A 4GAOA 2L2EA 2LUCA 4PE4A 2QDIA 4PE0A 2F33A 2LE9B 3CYZA 1DEKA 1OOFA 3AKBA 3H4SE 2FOTA 4I5KA 2LUXA 2L4HA 1EH2A 2KOTA 2KHNA 2OS8C 2BCXA 2GTEA 1AHRA 3C1VA 3PFVA 1F4QA 3NSIA 2KFGA 2V53A 2LP2A 1WRKA 3CR2A 3SG6A 3EKJA 1BF5A 4YGCB 4XJKA 2ZKMX 1BR4B 1YTZC 1UHKA 3IQOA 1OOIX 5I2OA 1JWDA 3ZWHA 1BJFA 2OTGB 4P2YB 1MWNA 2JTZA 3DVJA 1JFJA 1LVCD 1YRTB 1SPYA 2K7OA 3BFAA 2CXJA 4M2QA 1YUUA 1P28A 3TS5C 1SNLA 4GUKA 3D74A 2O60A 2ZRSA 3I5GC 1GGWA 1OE9B 3OHMB 5FI7A 2OPOA 3O2PA 3SJSA 2EC6B 4NDDA 1RECA 2PQLA 1FW4A 3K1EA 3OX6A 3R1OA 1CLMA 3WHTB 2Q4UA 3B6XA 1W7JB 1SR6C 2JC2A 2GGMA 5TNCA 1GJYA 1DQEA 1B47A 3VRQA 1S5GY 2WC6A 2M7NA 1J7OA 5HKYA 2KI4C 1JF2A 1S6JA 2LVKA 3CGAA 2QEVA 2LVVA 3WHUB 1F54A 1OW4A 3CWGA 3SG4A 1NUBA 3NSKA 2NCOA 2TN4A 1CMFA 1AUIB 1KQMB 3SIAA 1F8HA 5AEQA 1AJ4A 1MUXA 5I94A 1DT7B 1NCXA 4IL1A 1CDPA 1DGUA 1JUOA 1KK8B 2BECA 1WRZA 1IG5A 1Z4HA 2F2PA 2LV7A 3DXLA 3NSOA 4GGFC 4HSZA 2JXCA 4NQGA 2K61A 2BBNA 4PT1A 2H61A 3LK0A 3EVRA 2JNFA 1SY9A 1OMDA 1GGZA 5PALA 1MR8A 5HLOA 5KTYA 1G4YR 1DJXA 2JT3A 4OVNF 2LP3A 1QVIY 2PVBA 2QEOA 3OB1B 3B88A 3CZ1A 4ETOA 1AP4A 1SL8A 2OTGC 5JOLA 1CDNA 2BE6A 1BU3A 1M63B 2MHHA 2R2IA 2BAPA 3VRRA 3D76A 1YURA 4ZCUA 4PE1A 4KYNA 4YGDB 1QATA 1SL9A 1S6IA 2LM5A 1KQVA 1YUTA 2KNEA 3O78A 1CKKA 4L9MA 1K9KA 3GOFA 1TIZA 3LL8B 1SYMA 4GGFA 2KYCA 3LCPC 5CSFA 4WQ2A 4QJ5B 3AAJA 3BUMB 2EC6C 2KBIA 2IS9A 2MBXA 1WLMA 3QRXA 1PVAA 1JC2A 3HX4A
chains in the Genus database with same CATH topology
4I5LB 5D3OA 3SS3A 3KEVA 2K60A 1W9ZA 4I5JA 2L5YA 2KLDA 4GAOA 1DC1A 2BAPA 3OBVA 4GBAA 1DELA 4JKTA 4I5NB 1DEKA 4KYNA 4MEWA 5HL1A 5I94A 2YGUA 3IVTA 4I5KA 3SS5A 3SS4A 3UNWA 1Z4HA 5FI7A 5FI6A 2BNXA 3O4XA 3PM2A 1Z2CB 3EG5B 4IJ7A 3UO9A 5FI2A 2KLEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z4H A; 
#chains in the Genus database with same CATH topology
 4DUQ A;  2CTN A;  1IKU A;  3K21 A;  3KEV A;  1A29 A;  4CFR A;  1XFY O;  1W9Z A;  1NCZ A;  1BMO A;  2KAY A;  2K7C A;  2BKI B;  4YI9 A;  1JF0 A;  4OR9 B;  2QEB A;  4PHN A;  1PK0 D;  3IQQ A;  3CZ0 A;  1IQ3 A;  2B1U A;  1K8U A;  4DCK A;  3JTD B;  1VRK A;  4N1F A;  1RK9 A;  1CB1 A;  3HCM A;  3BOW A;  3V2L A;  4YI8 A;  3SS4 A;  1CM4 A;  1XFX O;  1CLL A;  1PAL A;  2ZND A;  1KFX S;  4OKH A;  1SL7 A;  2HQW A;  3DZT A;  1CNP A;  1KK8 C;  1OZS A;  1ZMZ A;  1G33 A;  2PSR A;  5AER A;  1XVJ A;  1L7Z A;  1K90 D;  1NSH A;  2K2F A;  3D78 A;  2KI6 D;  3QME A;  5G08 A;  3SG7 A;  1SSE B;  1KSM A;  2FCD A;  2JOJ A;  1QS7 A;  1Y1A A;  2P70 A;  5FYX A;  1SBJ A;  1QJT A;  5CPV A;  4JQ0 D;  1SK6 D;  1S1E A;  3SG2 A;  1K95 A;  1BR1 B;  1CFC A;  2WCH A;  2NCP A;  2KPH A;  2HPS A;  2KBM A;  2PAL A;  3CLN A;  2PAS A;  3DVK A;  4YGB B;  1R6P A;  1MXE A;  2ZFD A;  1PSB A;  3IF7 A;  3PJI A;  1F4O A;  3CR4 X;  2BCA A;  1FBV A;  3DYE A;  4F0Z B;  1RFJ A;  3PSR A;  1XFU O;  3LK1 A;  1ZAC A;  3CR5 X;  2SCP A;  3PM8 A;  2SAS A;  1ALV A;  1QXP A;  1XFV O;  1TCF A;  5ER5 A;  2KQY A;  4ICB A;  4WRI A;  5HLV A;  2JRF A;  4CLN A;  1YVH A;  2Y1M A;  3EG5 B;  4GNK B;  1ZOT B;  1J55 A;  1K93 D;  4NDB A;  3NSL A;  1G8I A;  4PAL A;  3D77 A;  2K2A A;  3DF0 B;  1NIW A;  3OB2 B;  3I5F B;  4DS7 A;  3S0D A;  1DTL A;  1B9A A;  1DF0 A;  2JUL A;  3R1V A;  1M31 A;  1JSA A;  1YR5 A;  2JWW A;  3BOW B;  1SKT A;  1S5G Z;  3L4L A;  2MJW B;  4GBA A;  1SW8 A;  2F2O A;  2PMY A;  1KSO A;  2E6W A;  4FQT A;  1TRF A;  4R1E A;  1MF8 B;  1Y0V H;  3JTD C;  4GGN A;  5I2Q A;  4JD9 A;  4U8D A;  1HT9 A;  4FTG A;  2H61 C;  1Y6W A;  1NX0 A;  1XFR A;  2EHB A;  2I2R E;  2LVJ A;  2WND A;  1MQ1 A;  3VRP A;  4A4B A;  3B7A A;  1EG4 A;  1YX7 A;  1RTP 1;  1TTX A;  1KWO B;  4IJ7 A;  1B8R A;  4FQO A;  2I18 A;  2WC8 A;  5D3O A;  1V1G A;  4YGE B;  1J7R A;  3RLZ A;  2LHL A;  2L0P A;  4CPV A;  2P71 A;  5HKZ A;  1K96 A;  4DRW A;  1F70 A;  1UHI A;  2KAX A;  1QX7 A;  1MXL C;  1JBA A;  1QV0 A;  1CTR A;  1QVI Z;  2WOR A;  4MRX A;  1M46 A;  5GQQ C;  4HRE E;  1AK8 A;  3PAL A;  2L2C A;  3D0Y A;  1LS8 A;  3PN7 B;  1DJI A;  5HL1 A;  2BE4 A;  2M29 A;  2ZN9 A;  1KFU S;  4NDC A;  2ZNE A;  1E8A A;  1EG3 A;  1W7I B;  5FI6 A;  5CSN A;  4WQ3 A;  1WRL A;  2G2B A;  2L50 A;  3AAK A;  1PVB A;  1K9P A;  2WCF A;  3TDI A;  1C7W A;  2JXL A;  2P6B B;  2MA2 A;  5FI2 A;  1DF0 B;  1C07 A;  3TZ1 A;  5J3X A;  4MLW A;  4CID A;  3BUN B;  1XA5 A;  4GFT A;  3L4A A;  3NHT A;  2GV5 A;  1Q80 A;  1NX1 A;  2HF5 A;  1AVS A;  4QJ3 B;  4YBH B;  1RWY A;  3TUY B;  1PSR A;  3A4U B;  3PAT A;  1IJ5 A;  3BJH A;  4JWQ A;  2WCB A;  4A4C A;  2K8M B;  2NZ0 A;  2WOS A;  3L47 A;  3VB1 A;  3RM1 A;  1FI6 A;  2K7B A;  1Y1U A;  1K94 A;  1R2U A;  2QEH A;  3NHI A;  3FS7 A;  5ER4 X;  5I2L A;  2G9B A;  3SS5 A;  5DKQ A;  1DJW A;  2COL B;  1CDL A;  2LAN A;  4ZCV A;  1S36 A;  5KSZ A;  1BOC A;  4F7F A;  4YGA A;  1EL4 A;  3FIA A;  3NGV A;  2BKH B;  1OOJ A;  2KYF A;  1SMG A;  1T14 A;  1ZFS A;  2L51 A;  1EXR A;  1PRW A;  3GK2 A;  4PHM A;  5I8N A;  1S26 D;  1SRA A;  5CSI A;  1TUJ A;  3GK1 A;  4ORA B;  1WDC B;  5D7F A;  1DJY A;  1M39 A;  1OMV A;  2CCM A;  4ORC B;  5K89 A;  1IGV A;  1ZUZ A;  2HET A;  3D0Y B;  3S0E A;  3SIB A;  3VRN A;  2EGD A;  3FWB A;  3DF0 A;  4INX A;  1NX3 A;  5DIC A;  3PLF B;  1WY9 A;  2WCL A;  4JKT A;  1CFP A;  1QAS A;  3RZS A;  2LLU A;  1QX5 B;  1KFX L;  3ICB A;  3UNW A;  3PN7 C;  2CNP A;  1XYD A;  4OCI A;  1J1D A;  3EKH A;  2KGR A;  1KQM C;  2F8P A;  5DKN A;  4M2P A;  4MRY A;  1OOH A;  3TDU A;  1DGV A;  2M3W A;  2E30 A;  3SG3 A;  1B8L A;  2M1U A;  3D10 A;  3M0W A;  3SS3 A;  2DOQ A;  3FE6 A;  2K60 A;  2MRD A;  3DD4 A;  1XO5 A;  3F45 A;  1C7V A;  2L5Y A;  3BUO B;  3CAB A;  3I5G B;  1DEL A;  1ODB A;  3OBV A;  4TNC A;  4DIR A;  3TUY C;  2JT8 A;  3N7H A;  2Y4Q A;  4P5O E;  1ALW A;  1IWQ A;  4MEW A;  1HQV A;  4MSP A;  1J7Q A;  5AFP A;  1CMG A;  1Y1X A;  3EVU A;  3BFH A;  2AUC A;  5HYD A;  1TN4 A;  3VGO A;  1UUS A;  1QLK A;  2JZI A;  3PM2 A;  1NP8 A;  1Z2C B;  2NLN A;  4XYN A;  1K9U A;  1SCM B;  3O4Y A;  1OQP A;  5DKR A;  3LLE A;  1TNP A;  1X02 A;  3CTN A;  3KO0 A;  5B8I B;  1U5I B;  2RGI A;  1A4P A;  1IRJ A;  4JPZ B;  4C0L A;  3BYA A;  1V1F A;  4OV2 A;  1RRO A;  5BPJ A;  1H8B A;  1OOG A;  1WDC C;  3KHE A;  1ORG A;  4GPL B;  1S6C A;  3EK8 A;  3JVT B;  2KAV A;  1UHJ A;  3BFB A;  5AXI A;  3WNX B;  1N0Y A;  2JPT A;  1CFF A;  2M49 B;  1CM1 A;  3E3R A;  4Q04 A;  2M7L A;  1QX2 A;  4BY4 A;  1QTX A;  4QJ4 B;  1FPW A;  2M9G A;  2YGU A;  2FJY A;  2LMT A;  3I5I B;  2LNK A;  1A03 A;  1QV1 A;  4D1E A;  1RJV A;  2FJU B;  2I94 A;  2CBL A;  1BT6 A;  3Q8I A;  2KI6 C;  4OZD A;  1DVI A;  3BUW B;  1YX8 A;  1B8C A;  4I5L B;  1K2H A;  3S0B A;  3GK4 X;  3AKA A;  3DY9 A;  2MLF C;  3OP0 A;  4MZL A;  1B4C A;  1H4B A;  1IIO A;  1F55 A;  1CDM A;  2LLT A;  1XK4 A;  1L2O B;  1YRU B;  1YUS A;  3I5H B;  1TWO A;  2BBM A;  2NXQ A;  2WCE A;  4I5N B;  4C0K A;  4E68 A;  1CLB A;  1KFU L;  4AOM A;  4PCW A;  4M2O A;  2ZN8 A;  3D73 A;  2LVI A;  1NWD A;  4N1G A;  3FE9 A;  2JTT A;  2KFH A;  2ISD A;  3B87 A;  1IQ5 A;  1QWV A;  3KF9 A;  1LA0 A;  2JT0 A;  1UP5 A;  4C0J A;  2K0J A;  2H8V A;  3BXK A;  3R72 A;  1A2X A;  1B7T Z;  1A75 A;  2LLS A;  3EK7 A;  1FF1 A;  1OZO A;  1IJ6 A;  2Q91 A;  4MN0 A;  1KCY A;  1SCM C;  2LHI A;  2WCK A;  5KU1 A;  1SCV A;  2JNX A;  2JPO A;  2F3Z A;  3FE8 A;  4USL A;  1LIN A;  2FCE A;  4PE7 A;  5D69 A;  1J7P A;  4I5J A;  2CT9 A;  1NX2 A;  2KLD A;  1LXF C;  1NCY A;  3I5F C;  3SG5 A;  1YVL A;  4ORB B;  3JVT C;  1EJ3 A;  5EL2 A;  2ERB A;  1TUZ A;  2KFF A;  1KK7 Z;  4HRG A;  2Y1N A;  3VRO A;  4MZJ A;  2M97 A;  1AJ5 A;  1BOD A;  1UHN A;  5F6T A;  2F3Y A;  2I7A A;  1B7T Y;  2L5X B;  1TNX A;  4XJK B;  1DJZ A;  1XFW O;  2WCM A;  4YRU A;  1TCO B;  3CZ2 A;  3CDN A;  2BL0 B;  3I5I C;  3CZT X;  1D1O A;  2L4I A;  1JFK A;  3OGN A;  3WXA A;  1OSA A;  1CFD A;  1XFZ O;  2QAC A;  3S0G A;  2JQ6 A;  1QIW A;  1N65 A;  1QLS A;  2KDH A;  3O6B A;  1UWO A;  1KWO C;  2KSP A;  3B86 A;  1J1E A;  1TNW A;  1NYA A;  2M1K B;  1KK7 Y;  2LAP A;  2QPT A;  1U5I A;  4INW A;  5CSJ A;  2K7D A;  5IBW A;  4N5X A;  1WLZ A;  2OS8 B;  2MAZ A;  1TOP A;  1LKJ A;  1L2O C;  1GQM A;  5HKW A;  1GM0 A;  3I5H C;  4BY5 A;  2M0R A;  1N2D A;  1A75 B;  3DVM A;  2PYQ A;  1UUR A;  2WC5 A;  3EVV A;  1DJG A;  3FWC A;  2BNX A;  1IH0 A;  2GGZ A;  2LMU A;  1S3P A;  4PHK A;  2LC5 A;  3S0A A;  1BG1 A;  4PHJ A;  1PUL A;  3UO9 A;  2KGB C;  3R1P A;  2KLE A;  2AMI A;  1QIV A;  2LMV A;  4MVF A;  2MLE C;  2Y5I A;  2AAO A;  3A8R A;  4AQI A;  3TS5 B;  1FI5 A;  1DC1 A;  1NPQ A;  2A4J A;  4PDZ A;  3EK4 A;  3D75 A;  4UPG A;  1F71 A;  1UHH A;  2JU0 A;  1M45 A;  4HRH A;  3KPX A;  1LA3 A;  4AQJ A;  3BQ3 A;  3IVT A;  2HQ8 A;  5AAN A;  2L98 A;  4CFQ A;  1BLQ A;  3OX5 A;  2D8N A;  1C3Z A;  3ZNI A;  1SR6 B;  1C3Y A;  3O4X A;  2H2K A;  2O5G A;  3MSE B;  2PRU A;  2BL0 C;  3TDZ A;  2ZRT A;  1TNQ A;  1MHO A;  3NXA A;  1B1G A;  2LCP A;  5JJG A;  2M8U A;  2KI4 B;  2WCJ A;  2BCB A;  3BUX B;  1DJH A;  2KQ6 A;  4MBE A;  3DVE A;  1DMO A;  3S0F A;  1XK4 C;  2VRG A;  1OMR A;  4MZK A;  3CS1 A;  4GAO A;  2L2E A;  2LUC A;  4PE4 A;  2QDI A;  4PE0 A;  2F33 A;  2LE9 B;  3CYZ A;  1DEK A;  1OOF A;  3AKB A;  3H4S E;  2FOT A;  4I5K A;  2LUX A;  2L4H A;  1EH2 A;  2KOT A;  2KHN A;  2OS8 C;  2BCX A;  2GTE A;  1AHR A;  3C1V A;  3PFV A;  1F4Q A;  3NSI A;  2KFG A;  2V53 A;  2LP2 A;  1WRK A;  3CR2 A;  3SG6 A;  3EKJ A;  1BF5 A;  4YGC B;  4XJK A;  2ZKM X;  1BR4 B;  1YTZ C;  1UHK A;  3IQO A;  1OOI X;  5I2O A;  1JWD A;  3ZWH A;  1BJF A;  2OTG B;  4P2Y B;  1MWN A;  2JTZ A;  3DVJ A;  1JFJ A;  1LVC D;  1YRT B;  1SPY A;  2K7O A;  3BFA A;  2CXJ A;  4M2Q A;  1YUU A;  1P28 A;  3TS5 C;  1SNL A;  4GUK A;  3D74 A;  2O60 A;  2ZRS A;  3I5G C;  1GGW A;  1OE9 B;  3OHM B;  5FI7 A;  2OPO A;  3O2P A;  3SJS A;  2EC6 B;  4NDD A;  1REC A;  2PQL A;  1FW4 A;  3K1E A;  3OX6 A;  3R1O A;  1CLM A;  3WHT B;  2Q4U A;  3B6X A;  1W7J B;  1SR6 C;  2JC2 A;  2GGM A;  5TNC A;  1GJY A;  1DQE A;  1B47 A;  3VRQ A;  1S5G Y;  2WC6 A;  2M7N A;  1J7O A;  5HKY A;  2KI4 C;  1JF2 A;  1S6J A;  2LVK A;  3CGA A;  2QEV A;  2LVV A;  3WHU B;  1F54 A;  1OW4 A;  3CWG A;  3SG4 A;  1NUB A;  3NSK A;  2NCO A;  2TN4 A;  1CMF A;  1AUI B;  1KQM B;  3SIA A;  1F8H A;  5AEQ A;  1AJ4 A;  1MUX A;  5I94 A;  1DT7 B;  1NCX A;  4IL1 A;  1CDP A;  1DGU A;  1JUO A;  1KK8 B;  2BEC A;  1WRZ A;  1IG5 A;  1Z4H A;  2F2P A;  2LV7 A;  3DXL A;  3NSO A;  4GGF C;  4HSZ A;  2JXC A;  4NQG A;  2K61 A;  2BBN A;  4PT1 A;  2H61 A;  3LK0 A;  3EVR A;  2JNF A;  1SY9 A;  1OMD A;  1GGZ A;  5PAL A;  1MR8 A;  5HLO A;  5KTY A;  1G4Y R;  1DJX A;  2JT3 A;  4OVN F;  2LP3 A;  1QVI Y;  2PVB A;  2QEO A;  3OB1 B;  3B88 A;  3CZ1 A;  4ETO A;  1AP4 A;  1SL8 A;  2OTG C;  5JOL A;  1CDN A;  2BE6 A;  1BU3 A;  1M63 B;  2MHH A;  2R2I A;  2BAP A;  3VRR A;  3D76 A;  1YUR A;  4ZCU A;  4PE1 A;  4KYN A;  4YGD B;  1QAT A;  1SL9 A;  1S6I A;  2LM5 A;  1KQV A;  1YUT A;  2KNE A;  3O78 A;  1CKK A;  4L9M A;  1K9K A;  3GOF A;  1TIZ A;  3LL8 B;  1SYM A;  4GGF A;  2KYC A;  3LCP C;  5CSF A;  4WQ2 A;  4QJ5 B;  3AAJ A;  3BUM B;  2EC6 C;  2KBI A;  2IS9 A;  2MBX A;  1WLM A;  3QRX A;  1PVA A;  1JC2 A;  3HX4 A; 
#chains in the Genus database with same CATH homology
 4I5L B;  5D3O A;  3SS3 A;  3KEV A;  2K60 A;  1W9Z A;  4I5J A;  2L5Y A;  2KLD A;  4GAO A;  1DC1 A;  2BAP A;  3OBV A;  4GBA A;  1DEL A;  4JKT A;  4I5N B;  1DEK A;  4KYN A;  4MEW A;  5HL1 A;  5I94 A;  2YGU A;  3IVT A;  4I5K A;  3SS5 A;  3SS4 A;  3UNW A;  1Z4H A;  5FI7 A;  5FI6 A;  2BNX A;  3O4X A;  3PM2 A;  1Z2C B;  3EG5 B;  4IJ7 A;  3UO9 A;  5FI2 A;  2KLE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...