1Z4HA

The response regulator tori belongs to a new family of atypical excisionase
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
66
structure length
66
Chain Sequence
MQHELQPDSLVDLKFIMADTGFGKTFIYDRIKSGDLPKAKVIHGRARWLYRDHCEFKNKLLSRANG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding, dna binding protein
molecule keywords Tor inhibition protein
publication title Structural and genetic analyses reveal a key role in prophage excision for the TorI response regulator inhibitor
pubmed doi rcsb
source organism Escherichia coli
total genus 18
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2005-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.160 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 1z4hA01
1Z4HA
chains in the Genus database with same CATH superfamily
3R1VA 2WCMA 1DJZA 2O5GA 2FOTA 1C7VA 2JNFA 3R1PA 2I94A 5I2QA 1F70A 2GV5A 1XO5A 2JU0A 1KK8C 4BY5A 1MUXA 4YI8A 1B4CA 1DMOA 3LL8B 2ZRSA 4PE1A 1UHIA 1XFYO 1ZFSA 4ORBB 5FI6A 3EK8A 2QEBA 1W7IB 3IQOA 1CDMA 2L51A 5D3OA 2M0RA 2Q4UA 2E6WA 3PALA 1YUUA 4PE4A 5CSIA 3WNXB 1QATA 3JVTB 2OPOA 2BECA 2JWWA 3D0YB 3SIBA 1S3PA 4GGNA 1QWVA 4I5LB 1L2OC 1UUSA 2ZNEA 4INWA 1DJWA 3M0WA 3FE9A 2EC6B 2VRGA 4YGAA 1KK7Y 3KPXA 3OHMB 3VB1A 1ODBA 4IL1A 4MVFA 1QIVA 1DGUA 1K94A 1KK8B 3SG2A 1CKKA 1TRFA 1OSAA 4P5OE 1CDPA 3CGAA 1IJ6A 1ZMZA 3S0DA 4E68A 1ZOTB 1ZACA 1J7QA 2M7LA 2QPTA 3I5GC 1CLBA 1NSHA 1TIZA 1KSOA 4USLA 3MSEB 1DF0A 3I5FC 1RK9A 2F3YA 2BKHB 2L4HA 1LKJA 5KSZA 1DTLA 2KAXA 3OX5A 2HQ8A 1AK8A 1YVLA 2A4JA 1MHOA 3NSKA 3D77A 3GK2A 1LA3A 1JC2A 2KDHA 1QXPA 1SMGA 2M7NA 1QS7A 4DIRA 4KYNA 1J1EA 1E8AA 2KAVA 3OP0A 2FCEA 1DJHA 3VRNA 1QASA 3I5HB 3S0AA 1DGVA 1LA0A 1DVIA 3D10A 1L7ZA 4JKTA 4A4CA 4YBHB 3EVRA 1PSRA 5TNCA 5DICA 4CIDA 3L4AA 2JNXA 3I5FB 4U8DA 3DVMA 1XFVO 3VRRA 2MHHA 2MRDA 3DZTA 3I5IC 1BLQA 2CCMA 3WHTB 1F4QA 1QTXA 1K9KA 2M8UA 1SY9A 1X02A 2JPOA 2L50A 1WDCB 2MLEC 2OS8B 5JOLA 1UURA 2LVVA 3O4XA 4P2YB 3FWCA 3EG5B 1KFUL 1JBAA 1YRTB 2DOQA 1OOJA 2JXCA 2WCFA 4I5JA 1BR4B 2F3ZA 2IS9A 3EKJA 3K21A 1GM0A 2BL0C 3HCMA 3UO9A 2LMUA 1J55A 2WORA 1HQVA 1IGVA 1QJTA 2LUCA 1NP8A 4PDZA 1QVIZ 1RECA 1FBVA 5AERA 4M2QA 1SYMA 3CZ0A 2BBNA 4ORAB 3IF7A 1ORGA 1IJ5A 3FS7A 3O78A 1AP4A 1YRUB 2KPHA 1OOFA 2KNEA 2QACA 4QJ5B 3BFBA 1A03A 3LCPC 1TOPA 4HRGA 1QX7A 2WCLA 3DF0B 2K7BA 1MF8B 1S6IA 3BFHA 3JTDC 2K2AA 1NCXA 1MQ1A 1TUJA 3BUMB 3DVKA 3OBVA 2NXQA 4M2OA 3PFVA 2QEHA 2YGUA 1DEKA 5I2OA 1CB1A 1YURA 4AQIA 1KSMA 3L4LA 2EHBA 1GQMA 1KWOB 2AMIA 1MR8A 2WOSA 3PJIA 1Y6WA 5DKRA 3WXAA 2JQ6A 2JTTA 1CM4A 3SG5A 4R1EA 1CMGA 2QDIA 1W9ZA 1A75A 2JT3A 1QLSA 2CT9A 3OX6A 3TDUA 5B8IB 4GBAA 3PN7B 2WCEA 1JUOA 1IQ3A 1KQMB 4PE0A 2SASA 2WNDA 4PALA 1DC1A 1TCFA 1TTXA 3EVVA 1SCMB 3TZ1A 1BODA 2PSRA 2LE9B 3HX4A 1Y1AA 1OZSA 3B6XA 3OB2B 2HQWA 3VRQA 5HKWA 2KBMA 1F8HA 2LM5A 2WC6A 3BOWA 1YVHA 3TDIA 5KTYA 1J7PA 3DXLA 1F71A 1K2HA 3BUNB 1N65A 3CR5X 2JC2A 1SL9A 1LINA 2M3WA 1BU3A 2KI4C 2KGBC 1LS8A 3CZ2A 1B7TZ 3TUYC 2KI6C 5K89A 3SG6A 1JSAA 1K93D 3BUXB 1BJFA 1OOIX 3GOFA 1CMFA 3N7HA 1NX2A 1R2UA 1EG3A 1RWYA 2L98A 3AKAA 1R6PA 3D74A 4ZCUA 4GFTA 2LV7A 2L0PA 3CLNA 2L5XB 3DY9A 3TDZA 2SCPA 1G4YR 2KOTA 1FI6A 2P71A 1QVIY 1DELA 1YR5A 2JXLA 4MRYA 1F54A 1AJ4A 4YGDB 1F55A 4FTGA 2KQ6A 1BMOA 2P6BB 1NCZA 2KSPA 1SK6D 1YX7A 3CYZA 1JFKA 1OOHA 3BFAA 4MZKA 5EL2A 5I8NA 2KGRA 1FF1A 3TUYB 4I5NB 1NYAA 1K90D 1S6CA 1H4BA 2PMYA 1AUIB 1GGZA 1M45A 1A29A 4F7FA 3IVTA 1RTP1 1PVBA 1QX5B 2COLB 2ZKMX 1LXFC 4Q04A 2F2OA 3D73A 3ICBA 5FYXA 5DKNA 1L2OB 3CZTX 3EK4A 3FE8A 3R72A 3ZNIA 1SRAA 2PALA 3VRPA 3BUOB 1DJYA 5CSFA 1S1EA 1C7WA 2JPTA 3NGVA 1XA5A 2BCBA 2MJWB 3SS5A 5I94A 1CNPA 1WLMA 2EGDA 1C3YA 1NX1A 1TWOA 2H2KA 1YUTA 2FJYA 1K96A 2ZN9A 3RLZA 1J7OA 3KO0A 5AXIA 1YUSA 2LAPA 4QJ3B 2M97A 5HKYA 1CLMA 3B87A 1FI5A 1JF0A 1Y0VH 2K60A 2K61A 5CSJA 4PHNA 3I5GB 2TN4A 4PHKA 1C3ZA 3F45A 2HPSA 4N5XA 4FQTA 2LNKA 1U5IA 3RM1A 4WRIA 1P28A 4CFRA 3L47A 1SL8A 2JT8A 1QV0A 2KI6D 2LANA 3S0BA 5AANA 3KHEA 1M63B 2L2CA 4XJKA 2BNXA 1VRKA 2M29A 1TCOB 2OTGC 1SKTA 2JULA 1TN4A 3PM2A 2FCDA 4DCKA 4NQGA 5HKZA 1SR6C 2LC5A 5BPJA 1SSEB 3ZWHA 1S26D 2K7OA 5ER5A 1MXLC 4MLWA 2AAOA 3CABA 1DF0B 4I5KA 4D1EA 2LVJA 3PLFB 4M2PA 1BT6A 2K7DA 3I5IB 2KBIA 2GGZA 3PATA 3A4UB 2QEOA 1DJGA 2Q91A 4YGCB 2KLDA 1CLLA 1QX2A 1XFUO 5AEQA 4N1FA 2ZRTA 1M31A 3SS3A 3GK4X 1NUBA 1NIWA 4WQ3A 1Z4HA 2H8VA 1S36A 2LLUA 3NHIA 1NCYA 1QV1A 2BL0B 2R2IA 1PULA 2JZIA 2LMTA 3AAJA 4MEWA 5J3XA 1J1DA 1CFCA 2I18A 1QIWA 3S0GA 3IQQA 4MSPA 4BY4A 3DVEA 4HREE 3SS4A 3BXKA 1CFFA 1JWDA 1KFUS 1SCVA 2P70A 5CPVA 3O2PA 3SJSA 1RROA 2KQYA 1IKUA 2BE4A 1W7JB 4ORCB 5ER4X 5PALA 3RZSA 1AHRA 1CFDA 1TNQA 1NX0A 1OMRA 1WRLA 4XJKB 2JTZA 4ETOA 3JTDB 1NX3A 2KHNA 2WCJA 2WCKA 3K1EA 3KEVA 3VGOA 1ZUZA 2WCBA 2KFFA 2GTEA 1DQEA 1B8RA 1K95A 2KYCA 4PCWA 4XYNA 4YGBB 1CDLA 2NZ0A 2I2RE 4OR9B 1KCYA 2F2PA 3AAKA 1XK4A 2M9GA 1PVAA 2BCAA 2B1UA 1GJYA 3JVTC 3LLEA 3KF9A 3QRXA 1WRZA 3CWGA 3B88A 5IBWA 1B47A 4NDDA 1UWOA 3CTNA 5HLVA 4PE7A 1Y1UA 3BJHA 4ZCVA 2BBMA 1SW8A 1J7RA 3O4YA 4YRUA 3OGNA 3SG7A 3NSIA 1PALA 1OOGA 1GGWA 1KFXS 1WY9A 3AKBA 1Z2CB 3Q8IA 1V1FA 2CTNA 2E30A 4QJ4B 1IQ5A 1XFWO 4INXA 3EKHA 2BKIB 1B8LA 2BCXA 4AOMA 4JPZB 2FJUB 1XK4C 2K8MB 3GK1A 2PQLA 1IG5A 2H61A 2KI4B 3BQ3A 1A4PA 2LCPA 1A75B 2V53A 1H8BA 4OZDA 1DJXA 2KAYA 3FE6A 3EVUA 1DT7B 1MWNA 1K8UA 2CNPA 1CTRA 1KQVA 1TUZA 1RJVA 4TNCA 1N2DA 1SNLA 3S0EA 2M1KB 4IJ7A 1SBJA 3CR2A 2M1UA 1ALWA 1FW4A 4MZLA 3TS5C 2WC5A 3C1VA 1FPWA 2KFHA 3OB1B 2LMVA 4WQ2A 2PVBA 3BOWB 3B86A 2BAPA 4OKHA 5JJGA 1YX8A 3S0FA 1B1GA 4C0LA 3D75A 4MBEA 2H61C 3I5HC 2L5YA 4A4BA 2MAZA 5FI7A 4DS7A 1CDNA 2L4IA 5KU1A 3V2LA 4DRWA 2MLFC 1EXRA 1N0YA 1S5GZ 1V1GA 5D7FA 3CR4X 3EK7A 3O6BA 1BR1B 2LLSA 3DYEA 1NWDA 2ZN8A 1G33A 3QMEA 3LK1A 4GGFA 4OCIA 2HETA 4PHJA 1G8IA 2CXJA 1WDCC 2OS8C 1A2XA 2LHIA 3DF0A 3VROA 1NPQA 3TS5B 5F6TA 2I7AA 1XFZO 4UPGA 1B7TY 3BUWB 2LP2A 1TNXA 3BYAA 4F0ZB 2AUCA 1XFRA 3SG4A 2K7CA 2RGIA 4C0KA 2GGMA 3UNWA 2G2BA 4ICBA 4CLNA 1OW4A 3CS1A 2G9BA 3PSRA 1PSBA 3A8RA 1IIOA 1UHJA 1UHKA 4CPVA 4DUQA 3B7AA 1WRKA 3NXAA 1XVJA 3SIAA 2ZFDA 3DVJA 4GGFC 1UHNA 1EG4A 4YGEB 2MBXA 1QLKA 1EL4A 3FIAA 2JRFA 3SG3A 4AQJA 4MN0A 2WCHA 1K9PA 3D76A 4NDBA 1BOCA 2HF5A 1EH2A 2NCOA 2JT0A 3DD4A 3NSLA 1BG1A 4C0JA 1LVCD 2KLEA 4MZJA 4PHMA 4JD9A 4JQ0D 1S6JA 2K2FA 2PASA 1B8CA 2OTGB 2F33A 2ZNDA 3NHTA 1YTZC 2F8PA 1IH0A 1SR6B 1OZOA 5I2LA 4PT1A 1KWOC 2D8NA 4OVNF 2LP3A 3LK0A 3R1OA 2NLNA 1PK0D 3CZ1A 2ISDA 4CFQA 1ALVA 4YI9A 1OE9B 4JWQA 1OMVA 1C07A 2JOJA 1KK7Z 2LLTA 3PN7C 2K0JA 4HSZA 3FWBA 5HYDA 2QEVA 3E3RA 1KQMC 5HL1A 1JFJA 3D0YA 4GAOA 4MRXA 1U5IB 4N1GA 1EJ3A 1IWQA 1SCMC 1IRJA 5CSNA 1TNWA 3D78A 4GUKA 1UP5A 1S5GY 2LVIA 4GPLB 1JF2A 1M39A 4GNKB 4NDCA 1SPYA 3CDNA 1F4OA 2ERBA 1DJIA 2Y1MA 4OV2A 5GQQC 1K9UA 1PRWA 2BE6A 2WC8A 3H4SE 2Y4QA 1OMDA 1UHHA 1T14A 2PRUA 1Q80A 3NSOA 2O60A 5DKQA 1M46A 1TNPA 2KFGA 2Y1NA 2PYQA 2LUXA 1AVSA 1XYDA 2Y5IA 1D1OA 1KFXL 1Y1XA 2M49B 1AJ5A 2CBLA 5FI2A 1CFPA 2NCPA 3WHUB 1XFXO 2L2EA 2KYFA 1OQPA 1B9AA 2LVKA 1BF5A 5AFPA 1CM1A 1SL7A 5G08A 1HT9A 2LHLA 1RFJA 5HLOA 1MXEA 4FQOA 5D69A 3PM8A 4HRHA 4L9MA 1WLZA 2MA2A 2EC6C
chains in the Genus database with same CATH topology
3O4XA 3SS3A 3EG5B 2BNXA 3OBVA 3KEVA 5I94A 1Z2CB 2BAPA 4I5JA 3SS5A 1Z4HA 2YGUA 3PM2A 1DEKA 4KYNA 3UNWA 3UO9A 2L5YA 4MEWA 5FI7A 5FI6A 4I5NB 4JKTA 1W9ZA 5FI2A 5D3OA 2K60A 3SS4A 4I5KA 4GBAA 3IVTA 5HL1A 4GAOA 1DC1A 4I5LB 4IJ7A 1DELA 2KLDA 2KLEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z4H A; 
#chains in the Genus database with same CATH topology
 3R1V A;  2WCM A;  1DJZ A;  2O5G A;  2FOT A;  1C7V A;  2JNF A;  3R1P A;  2I94 A;  5I2Q A;  1F70 A;  2GV5 A;  1XO5 A;  2JU0 A;  1KK8 C;  4BY5 A;  1MUX A;  4YI8 A;  1B4C A;  1DMO A;  3LL8 B;  2ZRS A;  4PE1 A;  1UHI A;  1XFY O;  1ZFS A;  4ORB B;  5FI6 A;  3EK8 A;  2QEB A;  1W7I B;  3IQO A;  1CDM A;  2L51 A;  5D3O A;  2M0R A;  2Q4U A;  2E6W A;  3PAL A;  1YUU A;  4PE4 A;  5CSI A;  3WNX B;  1QAT A;  3JVT B;  2OPO A;  2BEC A;  2JWW A;  3D0Y B;  3SIB A;  1S3P A;  4GGN A;  1QWV A;  4I5L B;  1L2O C;  1UUS A;  2ZNE A;  4INW A;  1DJW A;  3M0W A;  3FE9 A;  2EC6 B;  2VRG A;  4YGA A;  1KK7 Y;  3KPX A;  3OHM B;  3VB1 A;  1ODB A;  4IL1 A;  4MVF A;  1QIV A;  1DGU A;  1K94 A;  1KK8 B;  3SG2 A;  1CKK A;  1TRF A;  1OSA A;  4P5O E;  1CDP A;  3CGA A;  1IJ6 A;  1ZMZ A;  3S0D A;  4E68 A;  1ZOT B;  1ZAC A;  1J7Q A;  2M7L A;  2QPT A;  3I5G C;  1CLB A;  1NSH A;  1TIZ A;  1KSO A;  4USL A;  3MSE B;  1DF0 A;  3I5F C;  1RK9 A;  2F3Y A;  2BKH B;  2L4H A;  1LKJ A;  5KSZ A;  1DTL A;  2KAX A;  3OX5 A;  2HQ8 A;  1AK8 A;  1YVL A;  2A4J A;  1MHO A;  3NSK A;  3D77 A;  3GK2 A;  1LA3 A;  1JC2 A;  2KDH A;  1QXP A;  1SMG A;  2M7N A;  1QS7 A;  4DIR A;  4KYN A;  1J1E A;  1E8A A;  2KAV A;  3OP0 A;  2FCE A;  1DJH A;  3VRN A;  1QAS A;  3I5H B;  3S0A A;  1DGV A;  1LA0 A;  1DVI A;  3D10 A;  1L7Z A;  4JKT A;  4A4C A;  4YBH B;  3EVR A;  1PSR A;  5TNC A;  5DIC A;  4CID A;  3L4A A;  2JNX A;  3I5F B;  4U8D A;  3DVM A;  1XFV O;  3VRR A;  2MHH A;  2MRD A;  3DZT A;  3I5I C;  1BLQ A;  2CCM A;  3WHT B;  1F4Q A;  1QTX A;  1K9K A;  2M8U A;  1SY9 A;  1X02 A;  2JPO A;  2L50 A;  1WDC B;  2MLE C;  2OS8 B;  5JOL A;  1UUR A;  2LVV A;  3O4X A;  4P2Y B;  3FWC A;  3EG5 B;  1KFU L;  1JBA A;  1YRT B;  2DOQ A;  1OOJ A;  2JXC A;  2WCF A;  4I5J A;  1BR4 B;  2F3Z A;  2IS9 A;  3EKJ A;  3K21 A;  1GM0 A;  2BL0 C;  3HCM A;  3UO9 A;  2LMU A;  1J55 A;  2WOR A;  1HQV A;  1IGV A;  1QJT A;  2LUC A;  1NP8 A;  4PDZ A;  1QVI Z;  1REC A;  1FBV A;  5AER A;  4M2Q A;  1SYM A;  3CZ0 A;  2BBN A;  4ORA B;  3IF7 A;  1ORG A;  1IJ5 A;  3FS7 A;  3O78 A;  1AP4 A;  1YRU B;  2KPH A;  1OOF A;  2KNE A;  2QAC A;  4QJ5 B;  3BFB A;  1A03 A;  3LCP C;  1TOP A;  4HRG A;  1QX7 A;  2WCL A;  3DF0 B;  2K7B A;  1MF8 B;  1S6I A;  3BFH A;  3JTD C;  2K2A A;  1NCX A;  1MQ1 A;  1TUJ A;  3BUM B;  3DVK A;  3OBV A;  2NXQ A;  4M2O A;  3PFV A;  2QEH A;  2YGU A;  1DEK A;  5I2O A;  1CB1 A;  1YUR A;  4AQI A;  1KSM A;  3L4L A;  2EHB A;  1GQM A;  1KWO B;  2AMI A;  1MR8 A;  2WOS A;  3PJI A;  1Y6W A;  5DKR A;  3WXA A;  2JQ6 A;  2JTT A;  1CM4 A;  3SG5 A;  4R1E A;  1CMG A;  2QDI A;  1W9Z A;  1A75 A;  2JT3 A;  1QLS A;  2CT9 A;  3OX6 A;  3TDU A;  5B8I B;  4GBA A;  3PN7 B;  2WCE A;  1JUO A;  1IQ3 A;  1KQM B;  4PE0 A;  2SAS A;  2WND A;  4PAL A;  1DC1 A;  1TCF A;  1TTX A;  3EVV A;  1SCM B;  3TZ1 A;  1BOD A;  2PSR A;  2LE9 B;  3HX4 A;  1Y1A A;  1OZS A;  3B6X A;  3OB2 B;  2HQW A;  3VRQ A;  5HKW A;  2KBM A;  1F8H A;  2LM5 A;  2WC6 A;  3BOW A;  1YVH A;  3TDI A;  5KTY A;  1J7P A;  3DXL A;  1F71 A;  1K2H A;  3BUN B;  1N65 A;  3CR5 X;  2JC2 A;  1SL9 A;  1LIN A;  2M3W A;  1BU3 A;  2KI4 C;  2KGB C;  1LS8 A;  3CZ2 A;  1B7T Z;  3TUY C;  2KI6 C;  5K89 A;  3SG6 A;  1JSA A;  1K93 D;  3BUX B;  1BJF A;  1OOI X;  3GOF A;  1CMF A;  3N7H A;  1NX2 A;  1R2U A;  1EG3 A;  1RWY A;  2L98 A;  3AKA A;  1R6P A;  3D74 A;  4ZCU A;  4GFT A;  2LV7 A;  2L0P A;  3CLN A;  2L5X B;  3DY9 A;  3TDZ A;  2SCP A;  1G4Y R;  2KOT A;  1FI6 A;  2P71 A;  1QVI Y;  1DEL A;  1YR5 A;  2JXL A;  4MRY A;  1F54 A;  1AJ4 A;  4YGD B;  1F55 A;  4FTG A;  2KQ6 A;  1BMO A;  2P6B B;  1NCZ A;  2KSP A;  1SK6 D;  1YX7 A;  3CYZ A;  1JFK A;  1OOH A;  3BFA A;  4MZK A;  5EL2 A;  5I8N A;  2KGR A;  1FF1 A;  3TUY B;  4I5N B;  1NYA A;  1K90 D;  1S6C A;  1H4B A;  2PMY A;  1AUI B;  1GGZ A;  1M45 A;  1A29 A;  4F7F A;  3IVT A;  1RTP 1;  1PVB A;  1QX5 B;  2COL B;  2ZKM X;  1LXF C;  4Q04 A;  2F2O A;  3D73 A;  3ICB A;  5FYX A;  5DKN A;  1L2O B;  3CZT X;  3EK4 A;  3FE8 A;  3R72 A;  3ZNI A;  1SRA A;  2PAL A;  3VRP A;  3BUO B;  1DJY A;  5CSF A;  1S1E A;  1C7W A;  2JPT A;  3NGV A;  1XA5 A;  2BCB A;  2MJW B;  3SS5 A;  5I94 A;  1CNP A;  1WLM A;  2EGD A;  1C3Y A;  1NX1 A;  1TWO A;  2H2K A;  1YUT A;  2FJY A;  1K96 A;  2ZN9 A;  3RLZ A;  1J7O A;  3KO0 A;  5AXI A;  1YUS A;  2LAP A;  4QJ3 B;  2M97 A;  5HKY A;  1CLM A;  3B87 A;  1FI5 A;  1JF0 A;  1Y0V H;  2K60 A;  2K61 A;  5CSJ A;  4PHN A;  3I5G B;  2TN4 A;  4PHK A;  1C3Z A;  3F45 A;  2HPS A;  4N5X A;  4FQT A;  2LNK A;  1U5I A;  3RM1 A;  4WRI A;  1P28 A;  4CFR A;  3L47 A;  1SL8 A;  2JT8 A;  1QV0 A;  2KI6 D;  2LAN A;  3S0B A;  5AAN A;  3KHE A;  1M63 B;  2L2C A;  4XJK A;  2BNX A;  1VRK A;  2M29 A;  1TCO B;  2OTG C;  1SKT A;  2JUL A;  1TN4 A;  3PM2 A;  2FCD A;  4DCK A;  4NQG A;  5HKZ A;  1SR6 C;  2LC5 A;  5BPJ A;  1SSE B;  3ZWH A;  1S26 D;  2K7O A;  5ER5 A;  1MXL C;  4MLW A;  2AAO A;  3CAB A;  1DF0 B;  4I5K A;  4D1E A;  2LVJ A;  3PLF B;  4M2P A;  1BT6 A;  2K7D A;  3I5I B;  2KBI A;  2GGZ A;  3PAT A;  3A4U B;  2QEO A;  1DJG A;  2Q91 A;  4YGC B;  2KLD A;  1CLL A;  1QX2 A;  1XFU O;  5AEQ A;  4N1F A;  2ZRT A;  1M31 A;  3SS3 A;  3GK4 X;  1NUB A;  1NIW A;  4WQ3 A;  1Z4H A;  2H8V A;  1S36 A;  2LLU A;  3NHI A;  1NCY A;  1QV1 A;  2BL0 B;  2R2I A;  1PUL A;  2JZI A;  2LMT A;  3AAJ A;  4MEW A;  5J3X A;  1J1D A;  1CFC A;  2I18 A;  1QIW A;  3S0G A;  3IQQ A;  4MSP A;  4BY4 A;  3DVE A;  4HRE E;  3SS4 A;  3BXK A;  1CFF A;  1JWD A;  1KFU S;  1SCV A;  2P70 A;  5CPV A;  3O2P A;  3SJS A;  1RRO A;  2KQY A;  1IKU A;  2BE4 A;  1W7J B;  4ORC B;  5ER4 X;  5PAL A;  3RZS A;  1AHR A;  1CFD A;  1TNQ A;  1NX0 A;  1OMR A;  1WRL A;  4XJK B;  2JTZ A;  4ETO A;  3JTD B;  1NX3 A;  2KHN A;  2WCJ A;  2WCK A;  3K1E A;  3KEV A;  3VGO A;  1ZUZ A;  2WCB A;  2KFF A;  2GTE A;  1DQE A;  1B8R A;  1K95 A;  2KYC A;  4PCW A;  4XYN A;  4YGB B;  1CDL A;  2NZ0 A;  2I2R E;  4OR9 B;  1KCY A;  2F2P A;  3AAK A;  1XK4 A;  2M9G A;  1PVA A;  2BCA A;  2B1U A;  1GJY A;  3JVT C;  3LLE A;  3KF9 A;  3QRX A;  1WRZ A;  3CWG A;  3B88 A;  5IBW A;  1B47 A;  4NDD A;  1UWO A;  3CTN A;  5HLV A;  4PE7 A;  1Y1U A;  3BJH A;  4ZCV A;  2BBM A;  1SW8 A;  1J7R A;  3O4Y A;  4YRU A;  3OGN A;  3SG7 A;  3NSI A;  1PAL A;  1OOG A;  1GGW A;  1KFX S;  1WY9 A;  3AKB A;  1Z2C B;  3Q8I A;  1V1F A;  2CTN A;  2E30 A;  4QJ4 B;  1IQ5 A;  1XFW O;  4INX A;  3EKH A;  2BKI B;  1B8L A;  2BCX A;  4AOM A;  4JPZ B;  2FJU B;  1XK4 C;  2K8M B;  3GK1 A;  2PQL A;  1IG5 A;  2H61 A;  2KI4 B;  3BQ3 A;  1A4P A;  2LCP A;  1A75 B;  2V53 A;  1H8B A;  4OZD A;  1DJX A;  2KAY A;  3FE6 A;  3EVU A;  1DT7 B;  1MWN A;  1K8U A;  2CNP A;  1CTR A;  1KQV A;  1TUZ A;  1RJV A;  4TNC A;  1N2D A;  1SNL A;  3S0E A;  2M1K B;  4IJ7 A;  1SBJ A;  3CR2 A;  2M1U A;  1ALW A;  1FW4 A;  4MZL A;  3TS5 C;  2WC5 A;  3C1V A;  1FPW A;  2KFH A;  3OB1 B;  2LMV A;  4WQ2 A;  2PVB A;  3BOW B;  3B86 A;  2BAP A;  4OKH A;  5JJG A;  1YX8 A;  3S0F A;  1B1G A;  4C0L A;  3D75 A;  4MBE A;  2H61 C;  3I5H C;  2L5Y A;  4A4B A;  2MAZ A;  5FI7 A;  4DS7 A;  1CDN A;  2L4I A;  5KU1 A;  3V2L A;  4DRW A;  2MLF C;  1EXR A;  1N0Y A;  1S5G Z;  1V1G A;  5D7F A;  3CR4 X;  3EK7 A;  3O6B A;  1BR1 B;  2LLS A;  3DYE A;  1NWD A;  2ZN8 A;  1G33 A;  3QME A;  3LK1 A;  4GGF A;  4OCI A;  2HET A;  4PHJ A;  1G8I A;  2CXJ A;  1WDC C;  2OS8 C;  1A2X A;  2LHI A;  3DF0 A;  3VRO A;  1NPQ A;  3TS5 B;  5F6T A;  2I7A A;  1XFZ O;  4UPG A;  1B7T Y;  3BUW B;  2LP2 A;  1TNX A;  3BYA A;  4F0Z B;  2AUC A;  1XFR A;  3SG4 A;  2K7C A;  2RGI A;  4C0K A;  2GGM A;  3UNW A;  2G2B A;  4ICB A;  4CLN A;  1OW4 A;  3CS1 A;  2G9B A;  3PSR A;  1PSB A;  3A8R A;  1IIO A;  1UHJ A;  1UHK A;  4CPV A;  4DUQ A;  3B7A A;  1WRK A;  3NXA A;  1XVJ A;  3SIA A;  2ZFD A;  3DVJ A;  4GGF C;  1UHN A;  1EG4 A;  4YGE B;  2MBX A;  1QLK A;  1EL4 A;  3FIA A;  2JRF A;  3SG3 A;  4AQJ A;  4MN0 A;  2WCH A;  1K9P A;  3D76 A;  4NDB A;  1BOC A;  2HF5 A;  1EH2 A;  2NCO A;  2JT0 A;  3DD4 A;  3NSL A;  1BG1 A;  4C0J A;  1LVC D;  2KLE A;  4MZJ A;  4PHM A;  4JD9 A;  4JQ0 D;  1S6J A;  2K2F A;  2PAS A;  1B8C A;  2OTG B;  2F33 A;  2ZND A;  3NHT A;  1YTZ C;  2F8P A;  1IH0 A;  1SR6 B;  1OZO A;  5I2L A;  4PT1 A;  1KWO C;  2D8N A;  4OVN F;  2LP3 A;  3LK0 A;  3R1O A;  2NLN A;  1PK0 D;  3CZ1 A;  2ISD A;  4CFQ A;  1ALV A;  4YI9 A;  1OE9 B;  4JWQ A;  1OMV A;  1C07 A;  2JOJ A;  1KK7 Z;  2LLT A;  3PN7 C;  2K0J A;  4HSZ A;  3FWB A;  5HYD A;  2QEV A;  3E3R A;  1KQM C;  5HL1 A;  1JFJ A;  3D0Y A;  4GAO A;  4MRX A;  1U5I B;  4N1G A;  1EJ3 A;  1IWQ A;  1SCM C;  1IRJ A;  5CSN A;  1TNW A;  3D78 A;  4GUK A;  1UP5 A;  1S5G Y;  2LVI A;  4GPL B;  1JF2 A;  1M39 A;  4GNK B;  4NDC A;  1SPY A;  3CDN A;  1F4O A;  2ERB A;  1DJI A;  2Y1M A;  4OV2 A;  5GQQ C;  1K9U A;  1PRW A;  2BE6 A;  2WC8 A;  3H4S E;  2Y4Q A;  1OMD A;  1UHH A;  1T14 A;  2PRU A;  1Q80 A;  3NSO A;  2O60 A;  5DKQ A;  1M46 A;  1TNP A;  2KFG A;  2Y1N A;  2PYQ A;  2LUX A;  1AVS A;  1XYD A;  2Y5I A;  1D1O A;  1KFX L;  1Y1X A;  2M49 B;  1AJ5 A;  2CBL A;  5FI2 A;  1CFP A;  2NCP A;  3WHU B;  1XFX O;  2L2E A;  2KYF A;  1OQP A;  1B9A A;  2LVK A;  1BF5 A;  5AFP A;  1CM1 A;  1SL7 A;  5G08 A;  1HT9 A;  2LHL A;  1RFJ A;  5HLO A;  1MXE A;  4FQO A;  5D69 A;  3PM8 A;  4HRH A;  4L9M A;  1WLZ A;  2MA2 A;  2EC6 C; 
#chains in the Genus database with same CATH homology
 3O4X A;  3SS3 A;  3EG5 B;  2BNX A;  3OBV A;  3KEV A;  5I94 A;  1Z2C B;  2BAP A;  4I5J A;  3SS5 A;  1Z4H A;  2YGU A;  3PM2 A;  1DEK A;  4KYN A;  3UNW A;  3UO9 A;  2L5Y A;  4MEW A;  5FI7 A;  5FI6 A;  4I5N B;  4JKT A;  1W9Z A;  5FI2 A;  5D3O A;  2K60 A;  3SS4 A;  4I5K A;  4GBA A;  3IVT A;  5HL1 A;  4GAO A;  1DC1 A;  4I5L B;  4IJ7 A;  1DEL A;  2KLD A;  2KLE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...