2BBNA

Solution structure of a calmodulin-target peptide complex by multidimensional nmr
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
148
structure length
148
Chain Sequence
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALMODULIN
publication title Solution structure of a calmodulin-target peptide complex by multidimensional NMR.
pubmed rcsb
source organism Drosophila melanogaster
molecule tags Calcium-binding protein
total genus 32
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 1992-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2bbnA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2bbnA02
3QRXA 4N5XA 4ORBB 2BBMA 5PALA 3GK1A 3RLZA 2MRDA 1CFDA 1TCFA 3CWGA 5KU1A 2JNXA 3JTDC 1RJVA 3E3RA 1W7JB 1XA5A 1J7OA 1FBVA 1A75B 3CR4X 1S6CA 2O5GA 2GGZA 2LM5A 3LL8B 1XFXO 4PHKA 1LKJA 2LV7A 1CB1A 1BOCA 2G2BA 4YI9A 1YX8A 1XK4C 4NDCA 4N1FA 4PHJA 2LP3A 1FF1A 1VRKA 1X02A 1EJ3A 1FI6A 2K2AA 1SRAA 1SNLA 1PVAA 2A4JA 1EL4A 3I5HB 2JPTA 2GGMA 1AK8A 4N1GA 4CIDA 1JFJA 1JSAA 1SW8A 3BXKA 2KHNA 1IJ5A 1S3PA 3GK2A 1CM4A 1OZSA 3CS1A 2JXLA 4M2PA 5CSJA 2ZNEA 2M0RA 3TUYC 1AP4A 4YBHB 2JT8A 5CPVA 1XK4A 2FJUB 3JVTC 1IRJA 3DVMA 4ICBA 2JXCA 2HETA 2AMIA 2I18A 2KI6D 3FWBA 3ICBA 2PVBA 5F6TA 1K2HA 4DIRA 3AKBA 1QV0A 1JBAA 2AUCA 1B8CA 1DJIA 5FYXA 4HREE 5KTYA 1NP8A 2KQYA 1YVLA 1CLMA 4GAOA 4AOMA 1OQPA 5J3XA 1K96A 1Y1UA 3FS7A 4I5LB 4YI8A 3PN7B 3D0YB 1NYAA 1WDCC 4MSPA 1N0YA 3IQOA 1QX5B 1YURA 2L50A 2Y4QA 1CDLA 2BE4A 4YGAA 2MA2A 2QPTA 1DGVA 1KWOC 3DVEA 1A4PA 1E8AA 1MF8B 2CT9A 2KFFA 1UWOA 1RWYA 3BUNB 1NX1A 2OTGB 1QJTA 5CSIA 5HYDA 2LHLA 1OSAA 1UHKA 4GGNA 3VRQA 2KI4B 1Y0VH 1MQ1A 2VRGA 1MR8A 4ZCVA 4R1EA 1AHRA 3CGAA 3WHTB 4DCKA 1YR5A 2K8MB 5AERA 1IG5A 2L0PA 2LVIA 1DVIA 2E30A 4MBEA 2MAZA 3O4YA 5D7FA 2M8UA 1F4QA 1QV1A 1NIWA 1JUOA 1SY9A 3O2PA 2CTNA 3VROA 1EH2A 2WCBA 1C07A 1V1GA 5HKWA 2AAOA 2JULA 2LLUA 4FTGA 4PHNA 5HKZA 2KYFA 2ZN9A 1LA0A 2F2PA 2KI4C 2BECA 1N2DA 2KSPA 5KSZA 2Y1MA 1LINA 1CDPA 1QXPA 2PRUA 3OB1B 1SL9A 1SR6B 2OPOA 3CR5X 1DJXA 4USLA 1B47A 3CLNA 2COLB 2CBLA 2Q91A 1DGUA 4FQOA 2LMUA 5CSNA 2JTTA 4M2QA 2JWWA 2EHBA 1EXRA 4CPVA 3WNXB 3A4UB 2M7NA 3PSRA 2LCPA 3NSIA 2EC6C 1DF0A 3KHEA 4MEWA 3JTDB 1S36A 2B1UA 2IS9A 1KFXS 2KAVA 1F54A 1DT7B 5K89A 1YUTA 2BBNA 2CNPA 2M3WA 2BCXA 2NCOA 1L7ZA 2Q4UA 2PMYA 1W7IB 1QVIZ 4GPLB 1IH0A 1PSRA 2FOTA 4I5NB 3SG7A 2F3ZA 2M9GA 1IGVA 4PDZA 3K21A 1CKKA 2KGBC 3PLFB 1J55A 1CFFA 2K61A 2H2KA 3KEVA 5ER4X 4CFQA 1C7WA 3TS5C 4CLNA 1MHOA 2SASA 5G08A 2WCEA 5I2QA 3EKJA 3BUMB 4MVFA 1ALWA 1JWDA 1OZOA 2KQ6A 2JRFA 5DKQA 2FCEA 1QATA 1QX2A 2V53A 1TN4A 1YRUB 3EK7A 1Y1XA 2LE9B 3VRNA 2KI6C 2HQ8A 1QVIY 3TUYB 3AAJA 1TNWA 4XYNA 1S5GY 1NWDA 1OMVA 1F8HA 3CZTX 3JVTB 1WLZA 2JT0A 3ZNIA 1RROA 1A2XA 3I5FC 5HLVA 4YRUA 1XFYO 1AVSA 2NXQA 3GOFA 1YVHA 2I94A 1QTXA 1UHIA 4HSZA 3NXAA 3O6BA 1G8IA 4ETOA 3BYAA 4WQ2A 4JWQA 5I2OA 2MLFC 1WDCB 3GK4X 2KAYA 3NSOA 1NX3A 1WY9A 2BCBA 3NSLA 2BKHB 4YGDB 1KWOB 4HRGA 3SIAA 2GV5A 3DD4A 3FWCA 3VRRA 4E68A 1M31A 5D69A 2M7LA 1C7VA 3C1VA 4JQ0D 1SYMA 1YUUA 1MUXA 1ZMZA 4JPZB 1JF0A 1R6PA 2LMTA 1V1FA 2LC5A 1BT6A 3VRPA 2CXJA 4C0LA 4PALA 1K90D 4CFRA 1A29A 1DJHA 1QX7A 3BOWB 1NSHA 2ZRSA 5BPJA 4AQJA 3AAKA 1QLKA 1J1DA 4GFTA 1YTZC 2DOQA 3SG3A 1F71A 2D8NA 3H4SE 1UHJA 4A4CA 1M39A 2HPSA 2KYCA 2FCDA 1UURA 3O78A 1TIZA 3SG4A 1DF0B 1QLSA 2M97A 2H61A 1KK8C 3BQ3A 2JTZA 1TRFA 4GUKA 1CMFA 1G4YR 1AUIB 1SBJA 2ISDA 3TDUA 1K9UA 1U5IA 2M1UA 3OB2B 1HQVA 3SG2A 1RFJA 3BUWB 2BKIB 2WOSA 1FPWA 2Y5IA 2BL0C 4QJ3B 2EGDA 2PSRA 1ZACA 4P2YB 4OR9B 2EC6B 1K93D 1NCYA 3HCMA 1QIWA 4QJ5B 1FW4A 2MLEC 1CFCA 1XFUO 1CMGA 1HT9A 4WRIA 1R2UA 3D10A 4XJKA 1K8UA 3OHMB 3KPXA 2OS8C 1WRZA 4AQIA 4PE1A 2L2EA 2E6WA 3DF0A 2K7CA 2RGIA 1S6IA 4HRHA 2KBMA 2L98A 2LMVA 4PE7A 1FI5A 1Y1AA 2R2IA 3LCPC 3TS5B 2KOTA 4ORAB 4L9MA 4D1EA 1TNPA 4IL1A 2G9BA 3I5GC 3M0WA 2JC2A 2LVVA 5ER5A 2KNEA 3TDZA 2PALA 1XFVO 4WQ3A 4OKHA 1BMOA 1J1EA 1TCOB 2NLNA 3OP0A 2JQ6A 2K7DA 2LLTA 1S5GZ 2F3YA 3EVUA 1UUSA 2HF5A 3PM8A 5DKNA 2KFHA 1YUSA 1IWQA 1DMOA 1BU3A 1WRLA 3SG5A 3I5FB 2LP2A 1XFZO 3TDIA 4M2OA 2KGRA 1KFXL 1TNXA 1BLQA 3CR2A 2KDHA 1KCYA 1PSBA 5JJGA 1XYDA 2M29A 2MJWB 4I5JA 3F45A 1SCMC 1KQMC 2L4HA 2LNKA 1L2OC 3RM1A 1BF5A 1XO5A 3OX5A 4DUQA 2WORA 1UP5A 2BE6A 2P6BB 4GBAA 1MXEA 1PK0D 1NUBA 2KBIA 1JFKA 1DJWA 4YGEB 1B4CA 1GQMA 1ZFSA 1SL8A 2I2RE 4NDBA 3IF7A 2NZ0A 1SKTA 1B7TZ 1NX0A 2M1KB 1PRWA 4DS7A 2Y1NA 1ODBA 1KQVA 1OE9B 1IQ3A 2L4IA 2O60A 2HQWA 4PE4A 2L51A 3OX6A 1U5IB 2ZN8A 3I5IB 4OVNF 3BUOB 2K0JA 4OV2A 4BY4A 1CDMA 3SJSA 4U8DA 1TTXA 1WLMA 4GGFA 1CM1A 2ZNDA 1M45A 3DVKA 4QJ4B 1XVJA 3IQQA 3WHUB 4MZLA 1KK7Z 4DRWA 1B7TY 4A4BA 1BG1A 1KK8B 2H61C 1OMDA 2LAPA 2JNFA 2ZFDA 2QACA 3TZ1A 2JZIA 1KFUS 2M49B 4MZKA 4YGCB 1H4BA 4XJKB 1MXLC 2LVKA 4ORCB 1CNPA 1F55A 1IQ5A 3I5IC 1ZOTB 1WRKA 1DTLA 1S1EA 3VGOA 1AJ4A 2PASA 5AEQA 1B9AA 2BL0B 1XFWO 3WXAA 3DF0B 2WC8A 1F70A 3KF9A 1PVBA 1JF2A 1SPYA 3KO0A 4MRXA 5CSFA 5HLOA 5I8NA 1J7PA 3FIAA 1YRTB 1ZUZA 1GGWA 1KFUL 1SMGA 1KSOA 3HX4A 2K7OA 4OCIA 2SCPA 2WNDA 2ZKMX 1CLLA 1QS7A 1KK7Y 4GNKB 3SG6A 1JC2A 2JU0A 1G33A 3I5HC 2I7AA 3NSKA 1A75A 1RTP1 1CTRA 2OS8B 1B1GA 5AFPA 2K7BA 2LANA 3PALA 2LUCA 1RECA 2WCFA 1DJYA 5TNCA 1F4OA 1QASA 1ALVA 3CTNA 1GGZA 1NX2A 2F2OA 4C0JA 5B8IB 1H8BA 3I5GB 1BODA 1PULA 3MSEB 2KAXA 2KFGA 1LA3A 1S26D 1TNQA 3BUXB 5JOLA 5HKYA 5GQQC 1A03A 3PN7C 1BR1B 1EG3A 1TOPA 1K9PA 5IBWA 3EK8A 1MWNA 4Q04A 4MLWA 5AANA 1NPQA 4NQGA 2MHHA 4F0ZB 1DJZA 3ZWHA 3EKHA 1BR4B 1DJGA 1K94A 1K95A 2OTGC 1OMRA 1KSMA 2JT3A 2LHIA 3DVJA 1QIVA 2LLSA 1B8RA 4NDDA 1K9KA 2ZRTA 1Q80A 1NCZA 1Y6WA 1LVCD 1UHNA 2NCPA 4I5KA 1SCMB 1KQMB 3A8RA 1PALA 1L2OB 4MN0A 3BOWA 1GJYA 3D0YA 3SIBA 3PFVA 1SL7A 2BCAA 1B8LA 1N65A 1SK6D 3EVRA 1SCVA 1YX7A 2L5XB 4PCWA 4PHMA 4BY5A 2LVJA 4MRYA 4ZCUA 3EK4A 3EVVA 1J7QA 2F33A 5DKRA 3LLEA 2TN4A 4UPGA 4PE0A 4C0KA 1S6JA 1AJ5A 5I2LA 1NCXA 2K2FA 1RK9A 1UHHA 2LUXA 1M63B 1EG4A 3AKAA 3PATA 2CCMA 3LK1A 1CDNA 1CFPA 1SR6C 5AXIA 4MZJA 1M46A 2JOJA 2F8PA 4YGBB 2MBXA 1BJFA 4GGFC 1D1OA 4P5OE 1LXFC 1J7RA 1IKUA 4TNCA 1IJ6A 3LK0A 1CLBA 1OOJA
chains in the Genus database with same CATH superfamily
3QRXA 4N5XA 4ORBB 2BBMA 2H8VA 1P28A 5PALA 3GK1A 3RLZA 4INWA 2MRDA 1CFDA 1TCFA 3CWGA 5KU1A 2JNXA 3JTDC 1RJVA 3E3RA 1W7JB 1XA5A 1J7OA 1DQEA 1FBVA 1A75B 3CR4X 1S6CA 2O5GA 2GGZA 2LM5A 3LL8B 1XFXO 4PHKA 1LKJA 2LV7A 1CB1A 1BOCA 3O4XA 2G2BA 4YI9A 1YX8A 1XK4C 2WC6A 4NDCA 4N1FA 4PHJA 2LP3A 1FF1A 1VRKA 1X02A 1EJ3A 1FI6A 2K2AA 1SRAA 1SNLA 3D75A 1PVAA 2A4JA 1EL4A 3I5HB 2JPTA 3R72A 2GGMA 1AK8A 4N1GA 4CIDA 1JFJA 1JSAA 1SW8A 3BXKA 2KHNA 1IJ5A 1S3PA 3GK2A 1CM4A 1OZSA 2WCJA 3CS1A 2JXLA 4M2PA 5CSJA 2ZNEA 2M0RA 3TUYC 1AP4A 4YBHB 2JT8A 5CPVA 1XK4A 2FJUB 3JVTC 1IRJA 3DVMA 4ICBA 2JXCA 2HETA 2AMIA 2I18A 2KI6D 2L2CA 3FWBA 2PVBA 3ICBA 5F6TA 1K2HA 4DIRA 3AKBA 1QV0A 1JBAA 2AUCA 1B8CA 1DJIA 5FYXA 1Z2CB 4HREE 5KTYA 1NP8A 2KQYA 1YVLA 1CLMA 4INXA 3PM2A 4GAOA 3DY9A 1OQPA 5J3XA 4AOMA 1K96A 1Y1UA 3FS7A 4I5LB 4YI8A 3PN7B 3D0YB 1NYAA 1WDCC 4JKTA 4MSPA 1N0YA 3IQOA 1QX5B 1YURA 2L50A 1TWOA 1CDLA 2BE4A 2Y4QA 4YGAA 2MA2A 2QPTA 5HL1A 2L5YA 1DGVA 1KWOC 3DVEA 1A4PA 1E8AA 1MF8B 2CT9A 2FJYA 1UWOA 1RWYA 2KFFA 3BUNB 3Q8IA 1NX1A 2OTGB 1QJTA 5CSIA 5HYDA 2LHLA 1OSAA 1UHKA 4GGNA 3VRQA 2KI4B 1Y0VH 1MQ1A 1OW4A 3CYZA 2VRGA 1MR8A 4ZCVA 4R1EA 1AHRA 1XFRA 3CGAA 3WHTB 4DCKA 1YR5A 2K8MB 5AERA 1IG5A 2L0PA 2LVIA 1DVIA 2E30A 4MBEA 2MAZA 3O4YA 5D7FA 2M8UA 1F4QA 1QV1A 1NIWA 1JUOA 1SY9A 3O2PA 2CTNA 4FQTA 3VROA 1EH2A 2WCBA 2BNXA 1V1GA 5HKWA 1C07A 2AAOA 2JULA 2LLUA 4FTGA 3B87A 2BAPA 4PHNA 5HKZA 2KYFA 3CZ2A 1TUJA 1IIOA 2ZN9A 1LA0A 2F2PA 1T14A 2BECA 1N2DA 2KI4C 2KSPA 5KSZA 2Y1MA 1LINA 1CDPA 1QXPA 2PRUA 3OB1B 4IJ7A 1SL9A 1SR6B 2OPOA 3CR5X 1DJXA 4USLA 1B47A 3CLNA 2CBLA 2COLB 2PQLA 2Q91A 1DGUA 3D76A 2LMUA 4FQOA 5CSNA 2JTTA 4M2QA 2JWWA 2EHBA 1EXRA 4CPVA 3WNXB 3A4UB 2M7NA 3PSRA 2LCPA 3NSIA 2EC6C 1DF0A 3KHEA 2K60A 4MEWA 3JTDB 1S36A 2B1UA 2IS9A 1KFXS 2KAVA 1F54A 1DT7B 5K89A 1YUTA 2BBNA 2CNPA 2M3WA 2BCXA 2NCOA 1L7ZA 1DEKA 2PMYA 1W7IB 1QVIZ 2Q4UA 3FE9A 4GPLB 1PSRA 1IH0A 2FOTA 4I5NB 3SG7A 2F3ZA 2M9GA 1IGVA 4PDZA 1LS8A 3K21A 1CKKA 2KGBC 3PLFB 1J55A 1CFFA 3B88A 2K61A 2H2KA 3KEVA 5ER4X 4CFQA 1C7WA 3B6XA 3TS5C 4CLNA 1MHOA 2SASA 5DICA 5G08A 2WCEA 5I2QA 3EKJA 3BUMB 4MVFA 1ALWA 3SS4A 1JWDA 1OZOA 2KQ6A 2JRFA 5DKQA 3S0EA 2FCEA 2P70A 1QATA 1QX2A 2V53A 1TN4A 1YRUB 3EK7A 1Y1XA 2LE9B 3VRNA 2KI6C 2HQ8A 5EL2A 1QVIY 3TUYB 2KLDA 3AAJA 1TNWA 4XYNA 1S5GY 2GTEA 3QMEA 1NWDA 1OMVA 5FI7A 1F8HA 3CZTX 3JVTB 1WLZA 2JT0A 3ZNIA 1RROA 1A2XA 3I5FC 5HLVA 4YRUA 3B7AA 1XFYO 4PT1A 1AVSA 1W9ZA 2NXQA 3GOFA 1YVHA 2I94A 1QTXA 1UHIA 4HSZA 3NXAA 3O6BA 1G8IA 5FI6A 4ETOA 3BYAA 3DZTA 4WQ2A 4JWQA 5I2OA 2MLFC 1WDCB 3GK4X 2KAYA 3NSOA 1NX3A 1WY9A 2BCBA 3NSLA 2BKHB 4YGDB 1KWOB 4HRGA 3SIAA 2GV5A 3DD4A 3FWCA 3L4AA 3VRRA 4E68A 1M31A 5D69A 2M7LA 1C7VA 3C1VA 4JQ0D 1SYMA 1YUUA 1MUXA 1ZMZA 4JPZB 1JF0A 1R6PA 2LMTA 1V1FA 2LC5A 1BT6A 3VRPA 2CXJA 2QEVA 4C0LA 4PALA 1K90D 4CFRA 1A29A 3S0AA 1DJHA 1QX7A 3BOWB 1NSHA 2ZRSA 5BPJA 4AQJA 3R1VA 3AAKA 1QLKA 1J1DA 4GFTA 1YTZC 2DOQA 3SG3A 1F71A 2D8NA 3H4SE 1UHJA 3EG5B 4A4CA 1M39A 2HPSA 2KYCA 2FCDA 1UURA 3S0GA 3O78A 1TIZA 3SG4A 1DF0B 1QLSA 2M97A 5FI2A 2H61A 1KK8C 1OOIX 3BQ3A 2JTZA 1TRFA 4GUKA 1CMFA 1G4YR 1AUIB 1SBJA 2ISDA 3TDUA 1K9UA 1U5IA 2M1UA 3OB2B 1HQVA 3RZSA 3SG2A 1RFJA 3BUWB 2BKIB 2WOSA 1FPWA 2Y5IA 2BL0C 3K1EA 4QJ3B 2EGDA 2PSRA 1ZACA 3BJHA 4P2YB 2QEOA 3BFAA 4OR9B 2EC6B 1K93D 1NCYA 3HCMA 1QIWA 2YGUA 4QJ5B 1FW4A 2MLEC 1CFCA 1XFUO 1CMGA 1HT9A 3D78A 1R2UA 4WRIA 3D10A 4XJKA 1K8UA 3DYEA 3OHMB 3KPXA 2OS8C 3UNWA 1WRZA 4AQIA 4PE1A 2L2EA 2E6WA 3DF0A 3S0FA 2K7CA 2RGIA 1S6IA 4HRHA 2KBMA 1OOHA 2L98A 2LMVA 4PE7A 1FI5A 1Y1AA 2R2IA 3LCPC 3TS5B 2KOTA 4ORAB 1CLBA 4L9MA 4D1EA 1TNPA 4IL1A 2G9BA 3I5GC 3M0WA 2JC2A 2LVVA 5ER5A 2KNEA 3TDZA 2PALA 1XFVO 4WQ3A 4OKHA 1BMOA 1J1EA 1TCOB 2NLNA 3OP0A 2JQ6A 2K7DA 2LLTA 1S5GZ 2F3YA 3EVUA 1UUSA 2HF5A 3PM8A 5DKNA 2KFHA 1YUSA 1IWQA 1DMOA 1BU3A 1TUZA 1WRLA 3SG5A 2PYQA 3I5FB 2LP2A 1XFZO 3TDIA 4M2OA 2KGRA 1KFXL 1TNXA 1BLQA 3CR2A 2KDHA 3NHTA 1KCYA 1PSBA 5JJGA 1XYDA 3FE6A 2M29A 2MJWB 4I5JA 3F45A 1SCMC 1KQMC 2L4HA 2LNKA 1L2OC 3RM1A 1BF5A 1XO5A 2QEHA 3OX5A 4DUQA 2WORA 1UP5A 2BE6A 2P6BB 4GBAA 2WC5A 1MXEA 1PK0D 1ORGA 1NUBA 2KBIA 1JFKA 1DJWA 3L47A 4YGEB 1B4CA 1GQMA 1ZFSA 1SL8A 2I2RE 4NDBA 3IF7A 3VB1A 2NZ0A 1SKTA 1B7TZ 1NX0A 3SS5A 2M1KB 1PRWA 4DS7A 2Y1NA 3BFBA 1ODBA 1KQVA 3PJIA 1OE9B 1IQ3A 2L4IA 2O60A 3B86A 2HQWA 4PE4A 2L51A 3OX6A 1U5IB 2ZN8A 3I5IB 4OVNF 3BUOB 2K0JA 4OV2A 5D3OA 4BY4A 1CDMA 3SJSA 4U8DA 1TTXA 1WLMA 4GGFA 1CM1A 2ZNDA 1M45A 3DVKA 1C3ZA 4QJ4B 1XVJA 3IQQA 3WHUB 4MZLA 1KK7Z 4DRWA 1B7TY 4A4BA 1BG1A 1KK8B 2H61C 1OMDA 2LAPA 2JNFA 2ZFDA 2QACA 2QDIA 3TZ1A 3D73A 2JZIA 1KFUS 2M49B 4MZKA 4YGCB 1H4BA 4XJKB 1MXLC 3IVTA 2LVKA 4ORCB 1CNPA 1F55A 1IQ5A 3I5IC 1ZOTB 1WRKA 3OBVA 1DTLA 1S1EA 3VGOA 1AJ4A 2WCLA 2PASA 5AEQA 1B9AA 2BL0B 1XFWO 2QEBA 3WXAA 3DF0B 2WC8A 1F70A 3KF9A 1PVBA 1JF2A 1SPYA 3D74A 3D77A 3KO0A 4MRXA 5CSFA 5HLOA 5I8NA 3FIAA 1YRTB 1J7PA 1ZUZA 1GGWA 1KFUL 1SMGA 1KSOA 3HX4A 2K7OA 4OCIA 2SCPA 2WNDA 2ZKMX 1CLLA 1QS7A 1KK7Y 4GNKB 1QWVA 3SG6A 1Z4HA 1JC2A 3NHIA 2JU0A 3R1PA 1G33A 3I5HC 2I7AA 3NSKA 1A75A 1RTP1 1CTRA 2OS8B 1B1GA 5AFPA 2K7BA 2LANA 3PALA 2LUCA 3UO9A 1RECA 2WCFA 3CDNA 1DJYA 5TNCA 1F4OA 2KLEA 1QASA 1ALVA 3CTNA 1GGZA 1NX2A 2F2OA 2KPHA 4C0JA 3S0BA 4KYNA 5B8IB 1OOFA 1H8BA 3I5GB 1BODA 3L4LA 1PULA 3MSEB 1DC1A 2KAXA 2KFGA 1LA3A 1S26D 1TNQA 3BUXB 5JOLA 5HKYA 5GQQC 3V2LA 1A03A 3PN7C 1BR1B 1EG3A 3S0DA 1TOPA 1K9PA 5IBWA 3EK8A 1MWNA 4Q04A 4MLWA 5AANA 4OZDA 1NPQA 1C3YA 4NQGA 2MHHA 4F0ZB 4F7FA 1DJZA 3ZWHA 3EKHA 1BR4B 3DXLA 1DJGA 1K94A 1K95A 2OTGC 1OMRA 1KSMA 2JT3A 2LHIA 3CZ1A 3DVJA 1QIVA 2LLSA 3OGNA 1B8RA 4NDDA 1K9KA 2ZRTA 1Q80A 1NCZA 1Y6WA 2WCKA 1LVCD 1UHNA 2NCPA 3CZ0A 4I5KA 5I94A 1SCMB 1KQMB 3A8RA 1PALA 1L2OB 3N7HA 4MN0A 3BFHA 3BOWA 1GJYA 3D0YA 3SIBA 3SS3A 3PFVA 1SL7A 2BCAA 2WCMA 1B8LA 3NGVA 1N65A 1SK6D 3EVRA 1SCVA 1YX7A 2L5XB 2P71A 4JD9A 4PCWA 4PHMA 4BY5A 2LVJA 4MRYA 4ZCUA 3EK4A 3CABA 3EVVA 1J7QA 2F33A 5DKRA 1OOGA 2TN4A 3LLEA 4UPGA 4PE0A 3FE8A 4C0KA 1S6JA 1AJ5A 1GM0A 3R1OA 1NCXA 2WCHA 5I2LA 2K2FA 1RK9A 1UHHA 1DELA 1M63B 2LUXA 1EG4A 3AKAA 3PATA 2CCMA 3LK1A 1CDNA 2ERBA 1CFPA 1SR6C 5AXIA 4MZJA 1M46A 2JOJA 2F8PA 4YGBB 2JPOA 2MBXA 1BJFA 4GGFC 1D1OA 4P5OE 1LXFC 1J7RA 1IKUA 4TNCA 1IJ6A 3LK0A 1SSEB 1OOJA
chains in the Genus database with same CATH topology
3QRXA 4N5XA 4ORBB 2BBMA 5PALA 3GK1A 3RLZA 2MRDA 1CFDA 1TCFA 3CWGA 5KU1A 2JNXA 3JTDC 1RJVA 3E3RA 1W7JB 1XA5A 1J7OA 1FBVA 1A75B 3CR4X 1S6CA 2O5GA 2GGZA 2LM5A 3LL8B 1XFXO 4PHKA 1LKJA 2LV7A 1CB1A 1BOCA 2G2BA 4YI9A 1YX8A 1XK4C 4NDCA 4N1FA 4PHJA 2LP3A 1FF1A 1VRKA 1X02A 1EJ3A 1FI6A 2K2AA 1SRAA 1SNLA 1PVAA 2A4JA 1EL4A 3I5HB 2JPTA 2GGMA 1AK8A 4N1GA 4CIDA 1JFJA 1JSAA 1SW8A 3BXKA 2KHNA 1IJ5A 1S3PA 3GK2A 1CM4A 1OZSA 3CS1A 2JXLA 4M2PA 5CSJA 2ZNEA 2M0RA 3TUYC 1AP4A 4YBHB 2JT8A 5CPVA 1XK4A 2FJUB 3JVTC 1IRJA 3DVMA 4ICBA 2JXCA 2HETA 2AMIA 2I18A 2KI6D 3FWBA 3ICBA 2PVBA 5F6TA 1K2HA 4DIRA 3AKBA 1QV0A 1JBAA 2AUCA 1B8CA 1DJIA 5FYXA 4HREE 5KTYA 1NP8A 2KQYA 1YVLA 1CLMA 4GAOA 4AOMA 1OQPA 5J3XA 1K96A 1Y1UA 3FS7A 4I5LB 4YI8A 3PN7B 3D0YB 1NYAA 1WDCC 4MSPA 1N0YA 3IQOA 1QX5B 1YURA 2L50A 2Y4QA 1CDLA 2BE4A 4YGAA 2MA2A 2QPTA 1DGVA 1KWOC 3DVEA 1A4PA 1E8AA 1MF8B 2CT9A 2KFFA 1UWOA 1RWYA 3BUNB 1NX1A 2OTGB 1QJTA 5CSIA 5HYDA 2LHLA 1OSAA 1UHKA 4GGNA 3VRQA 2KI4B 1Y0VH 1MQ1A 2VRGA 1MR8A 4ZCVA 4R1EA 1AHRA 3CGAA 3WHTB 4DCKA 1YR5A 2K8MB 5AERA 1IG5A 2L0PA 2LVIA 1DVIA 2E30A 4MBEA 2MAZA 3O4YA 5D7FA 2M8UA 1F4QA 1QV1A 1NIWA 1JUOA 1SY9A 3O2PA 2CTNA 3VROA 1EH2A 2WCBA 1C07A 1V1GA 5HKWA 2AAOA 2JULA 2LLUA 4FTGA 4PHNA 5HKZA 2KYFA 2ZN9A 1LA0A 2F2PA 2KI4C 2BECA 1N2DA 2KSPA 5KSZA 2Y1MA 1LINA 1CDPA 1QXPA 2PRUA 3OB1B 1SL9A 1SR6B 2OPOA 3CR5X 1DJXA 4USLA 1B47A 3CLNA 2COLB 2CBLA 2Q91A 1DGUA 4FQOA 2LMUA 5CSNA 2JTTA 4M2QA 2JWWA 2EHBA 1EXRA 4CPVA 3WNXB 3A4UB 2M7NA 3PSRA 2LCPA 3NSIA 2EC6C 1DF0A 3KHEA 4MEWA 3JTDB 1S36A 2B1UA 2IS9A 1KFXS 2KAVA 1F54A 1DT7B 5K89A 1YUTA 2BBNA 2CNPA 2M3WA 2BCXA 2NCOA 1L7ZA 2Q4UA 2PMYA 1W7IB 1QVIZ 4GPLB 1IH0A 1PSRA 2FOTA 4I5NB 3SG7A 2F3ZA 2M9GA 1IGVA 4PDZA 3K21A 1CKKA 2KGBC 3PLFB 1J55A 1CFFA 2K61A 2H2KA 3KEVA 5ER4X 4CFQA 1C7WA 3TS5C 4CLNA 1MHOA 2SASA 5G08A 2WCEA 5I2QA 3EKJA 3BUMB 4MVFA 1ALWA 1JWDA 1OZOA 2KQ6A 2JRFA 5DKQA 2FCEA 1QATA 1QX2A 2V53A 1TN4A 1YRUB 3EK7A 1Y1XA 2LE9B 3VRNA 2KI6C 2HQ8A 1QVIY 3TUYB 3AAJA 1TNWA 4XYNA 1S5GY 1NWDA 1OMVA 1F8HA 3CZTX 3JVTB 1WLZA 2JT0A 3ZNIA 1RROA 1A2XA 3I5FC 5HLVA 4YRUA 1XFYO 1AVSA 2NXQA 3GOFA 1YVHA 2I94A 1QTXA 1UHIA 4HSZA 3NXAA 3O6BA 1G8IA 4ETOA 3BYAA 4WQ2A 4JWQA 5I2OA 2MLFC 1WDCB 3GK4X 2KAYA 3NSOA 1NX3A 1WY9A 2BCBA 3NSLA 2BKHB 4YGDB 1KWOB 4HRGA 3SIAA 2GV5A 3DD4A 3FWCA 3VRRA 4E68A 1M31A 5D69A 2M7LA 1C7VA 3C1VA 4JQ0D 1SYMA 1YUUA 1MUXA 1ZMZA 4JPZB 1JF0A 1R6PA 2LMTA 1V1FA 2LC5A 1BT6A 3VRPA 2CXJA 4C0LA 4PALA 1K90D 4CFRA 1A29A 1DJHA 1QX7A 3BOWB 1NSHA 2ZRSA 5BPJA 4AQJA 3AAKA 1QLKA 1J1DA 4GFTA 1YTZC 2DOQA 3SG3A 1F71A 2D8NA 3H4SE 1UHJA 4A4CA 1M39A 2HPSA 2KYCA 2FCDA 1UURA 3O78A 1TIZA 3SG4A 1DF0B 1QLSA 2M97A 2H61A 1KK8C 3BQ3A 2JTZA 1TRFA 4GUKA 1CMFA 1G4YR 1AUIB 1SBJA 2ISDA 3TDUA 1K9UA 1U5IA 2M1UA 3OB2B 1HQVA 3SG2A 1RFJA 3BUWB 2BKIB 2WOSA 1FPWA 2Y5IA 2BL0C 4QJ3B 2EGDA 2PSRA 1ZACA 4P2YB 4OR9B 2EC6B 1K93D 1NCYA 3HCMA 1QIWA 4QJ5B 1FW4A 2MLEC 1CFCA 1XFUO 1CMGA 1HT9A 4WRIA 1R2UA 3D10A 4XJKA 1K8UA 3OHMB 3KPXA 2OS8C 1WRZA 4AQIA 4PE1A 2L2EA 2E6WA 3DF0A 2K7CA 2RGIA 1S6IA 4HRHA 2KBMA 2L98A 2LMVA 4PE7A 1FI5A 1Y1AA 2R2IA 3LCPC 3TS5B 2KOTA 4ORAB 4L9MA 4D1EA 1TNPA 4IL1A 2G9BA 3I5GC 3M0WA 2JC2A 2LVVA 5ER5A 2KNEA 3TDZA 2PALA 1XFVO 4WQ3A 4OKHA 1BMOA 1J1EA 1TCOB 2NLNA 3OP0A 2JQ6A 2K7DA 2LLTA 1S5GZ 2F3YA 3EVUA 1UUSA 2HF5A 3PM8A 5DKNA 2KFHA 1YUSA 1IWQA 1DMOA 1BU3A 1WRLA 3SG5A 3I5FB 2LP2A 1XFZO 3TDIA 4M2OA 2KGRA 1KFXL 1TNXA 1BLQA 3CR2A 2KDHA 1KCYA 1PSBA 5JJGA 1XYDA 2M29A 2MJWB 4I5JA 3F45A 1SCMC 1KQMC 2L4HA 2LNKA 1L2OC 3RM1A 1BF5A 1XO5A 3OX5A 4DUQA 2WORA 1UP5A 2BE6A 2P6BB 4GBAA 1MXEA 1PK0D 1NUBA 2KBIA 1JFKA 1DJWA 4YGEB 1B4CA 1GQMA 1ZFSA 1SL8A 2I2RE 4NDBA 3IF7A 2NZ0A 1SKTA 1B7TZ 1NX0A 2M1KB 1PRWA 4DS7A 2Y1NA 1ODBA 1KQVA 1OE9B 1IQ3A 2L4IA 2O60A 2HQWA 4PE4A 2L51A 3OX6A 1U5IB 2ZN8A 3I5IB 4OVNF 3BUOB 2K0JA 4OV2A 4BY4A 1CDMA 3SJSA 4U8DA 1TTXA 1WLMA 4GGFA 1CM1A 2ZNDA 1M45A 3DVKA 4QJ4B 1XVJA 3IQQA 3WHUB 4MZLA 1KK7Z 4DRWA 1B7TY 4A4BA 1BG1A 1KK8B 2H61C 1OMDA 2LAPA 2JNFA 2ZFDA 2QACA 3TZ1A 2JZIA 1KFUS 2M49B 4MZKA 4YGCB 1H4BA 4XJKB 1MXLC 2LVKA 4ORCB 1CNPA 1F55A 1IQ5A 3I5IC 1ZOTB 1WRKA 1DTLA 1S1EA 3VGOA 1AJ4A 2PASA 5AEQA 1B9AA 2BL0B 1XFWO 3WXAA 3DF0B 2WC8A 1F70A 3KF9A 1PVBA 1JF2A 1SPYA 3KO0A 4MRXA 5CSFA 5HLOA 5I8NA 1J7PA 3FIAA 1YRTB 1ZUZA 1GGWA 1KFUL 1SMGA 1KSOA 3HX4A 2K7OA 4OCIA 2SCPA 2WNDA 2ZKMX 1CLLA 1QS7A 1KK7Y 4GNKB 3SG6A 1JC2A 2JU0A 1G33A 3I5HC 2I7AA 3NSKA 1A75A 1RTP1 1CTRA 2OS8B 1B1GA 5AFPA 2K7BA 2LANA 3PALA 2LUCA 1RECA 2WCFA 1DJYA 5TNCA 1F4OA 1QASA 1ALVA 3CTNA 1GGZA 1NX2A 2F2OA 4C0JA 5B8IB 1H8BA 3I5GB 1BODA 1PULA 3MSEB 2KAXA 2KFGA 1LA3A 1S26D 1TNQA 3BUXB 5JOLA 5HKYA 5GQQC 1A03A 3PN7C 1BR1B 1EG3A 1TOPA 1K9PA 5IBWA 3EK8A 1MWNA 4Q04A 4MLWA 5AANA 1NPQA 4NQGA 2MHHA 4F0ZB 1DJZA 3ZWHA 3EKHA 1BR4B 1DJGA 1K94A 1K95A 2OTGC 1OMRA 1KSMA 2JT3A 2LHIA 3DVJA 1QIVA 2LLSA 1B8RA 4NDDA 1K9KA 2ZRTA 1Q80A 1NCZA 1Y6WA 1LVCD 1UHNA 2NCPA 4I5KA 1SCMB 1KQMB 3A8RA 1PALA 1L2OB 4MN0A 3BOWA 1GJYA 3D0YA 3SIBA 3PFVA 1SL7A 2BCAA 1B8LA 1N65A 1SK6D 3EVRA 1SCVA 1YX7A 2L5XB 4PCWA 4PHMA 4BY5A 2LVJA 4MRYA 4ZCUA 3EK4A 3EVVA 1J7QA 2F33A 5DKRA 3LLEA 2TN4A 4UPGA 4PE0A 4C0KA 1S6JA 1AJ5A 5I2LA 1NCXA 2K2FA 1RK9A 1UHHA 2LUXA 1M63B 1EG4A 3AKAA 3PATA 2CCMA 3LK1A 1CDNA 1CFPA 1SR6C 5AXIA 4MZJA 1M46A 2JOJA 2F8PA 4YGBB 2MBXA 1BJFA 4GGFC 1D1OA 4P5OE 1LXFC 1J7RA 1IKUA 4TNCA 1IJ6A 3LK0A 1CLBA 1OOJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QRX A;  4N5X A;  4ORB B;  2BBM A;  5PAL A;  3GK1 A;  3RLZ A;  2MRD A;  1CFD A;  1TCF A;  3CWG A;  5KU1 A;  2JNX A;  3JTD C;  1RJV A;  3E3R A;  1W7J B;  1XA5 A;  1J7O A;  1FBV A;  1A75 B;  3CR4 X;  1S6C A;  2O5G A;  2GGZ A;  2LM5 A;  3LL8 B;  1XFX O;  4PHK A;  1LKJ A;  2LV7 A;  1CB1 A;  1BOC A;  2G2B A;  4YI9 A;  1YX8 A;  1XK4 C;  4NDC A;  4N1F A;  4PHJ A;  2LP3 A;  1FF1 A;  1VRK A;  1X02 A;  1EJ3 A;  1FI6 A;  2K2A A;  1SRA A;  1SNL A;  1PVA A;  2A4J A;  1EL4 A;  3I5H B;  2JPT A;  2GGM A;  1AK8 A;  4N1G A;  4CID A;  1JFJ A;  1JSA A;  1SW8 A;  3BXK A;  2KHN A;  1IJ5 A;  1S3P A;  3GK2 A;  1CM4 A;  1OZS A;  3CS1 A;  2JXL A;  4M2P A;  5CSJ A;  2ZNE A;  2M0R A;  3TUY C;  1AP4 A;  4YBH B;  2JT8 A;  5CPV A;  1XK4 A;  2FJU B;  3JVT C;  1IRJ A;  3DVM A;  4ICB A;  2JXC A;  2HET A;  2AMI A;  2I18 A;  2KI6 D;  3FWB A;  3ICB A;  2PVB A;  5F6T A;  1K2H A;  4DIR A;  3AKB A;  1QV0 A;  1JBA A;  2AUC A;  1B8C A;  1DJI A;  5FYX A;  4HRE E;  5KTY A;  1NP8 A;  2KQY A;  1YVL A;  1CLM A;  4GAO A;  4AOM A;  1OQP A;  5J3X A;  1K96 A;  1Y1U A;  3FS7 A;  4I5L B;  4YI8 A;  3PN7 B;  3D0Y B;  1NYA A;  1WDC C;  4MSP A;  1N0Y A;  3IQO A;  1QX5 B;  1YUR A;  2L50 A;  2Y4Q A;  1CDL A;  2BE4 A;  4YGA A;  2MA2 A;  2QPT A;  1DGV A;  1KWO C;  3DVE A;  1A4P A;  1E8A A;  1MF8 B;  2CT9 A;  2KFF A;  1UWO A;  1RWY A;  3BUN B;  1NX1 A;  2OTG B;  1QJT A;  5CSI A;  5HYD A;  2LHL A;  1OSA A;  1UHK A;  4GGN A;  3VRQ A;  2KI4 B;  1Y0V H;  1MQ1 A;  2VRG A;  1MR8 A;  4ZCV A;  4R1E A;  1AHR A;  3CGA A;  3WHT B;  4DCK A;  1YR5 A;  2K8M B;  5AER A;  1IG5 A;  2L0P A;  2LVI A;  1DVI A;  2E30 A;  4MBE A;  2MAZ A;  3O4Y A;  5D7F A;  2M8U A;  1F4Q A;  1QV1 A;  1NIW A;  1JUO A;  1SY9 A;  3O2P A;  2CTN A;  3VRO A;  1EH2 A;  2WCB A;  1C07 A;  1V1G A;  5HKW A;  2AAO A;  2JUL A;  2LLU A;  4FTG A;  4PHN A;  5HKZ A;  2KYF A;  2ZN9 A;  1LA0 A;  2F2P A;  2KI4 C;  2BEC A;  1N2D A;  2KSP A;  5KSZ A;  2Y1M A;  1LIN A;  1CDP A;  1QXP A;  2PRU A;  3OB1 B;  1SL9 A;  1SR6 B;  2OPO A;  3CR5 X;  1DJX A;  4USL A;  1B47 A;  3CLN A;  2COL B;  2CBL A;  2Q91 A;  1DGU A;  4FQO A;  2LMU A;  5CSN A;  2JTT A;  4M2Q A;  2JWW A;  2EHB A;  1EXR A;  4CPV A;  3WNX B;  3A4U B;  2M7N A;  3PSR A;  2LCP A;  3NSI A;  2EC6 C;  1DF0 A;  3KHE A;  4MEW A;  3JTD B;  1S36 A;  2B1U A;  2IS9 A;  1KFX S;  2KAV A;  1F54 A;  1DT7 B;  5K89 A;  1YUT A;  2BBN A;  2CNP A;  2M3W A;  2BCX A;  2NCO A;  1L7Z A;  2Q4U A;  2PMY A;  1W7I B;  1QVI Z;  4GPL B;  1IH0 A;  1PSR A;  2FOT A;  4I5N B;  3SG7 A;  2F3Z A;  2M9G A;  1IGV A;  4PDZ A;  3K21 A;  1CKK A;  2KGB C;  3PLF B;  1J55 A;  1CFF A;  2K61 A;  2H2K A;  3KEV A;  5ER4 X;  4CFQ A;  1C7W A;  3TS5 C;  4CLN A;  1MHO A;  2SAS A;  5G08 A;  2WCE A;  5I2Q A;  3EKJ A;  3BUM B;  4MVF A;  1ALW A;  1JWD A;  1OZO A;  2KQ6 A;  2JRF A;  5DKQ A;  2FCE A;  1QAT A;  1QX2 A;  2V53 A;  1TN4 A;  1YRU B;  3EK7 A;  1Y1X A;  2LE9 B;  3VRN A;  2KI6 C;  2HQ8 A;  1QVI Y;  3TUY B;  3AAJ A;  1TNW A;  4XYN A;  1S5G Y;  1NWD A;  1OMV A;  1F8H A;  3CZT X;  3JVT B;  1WLZ A;  2JT0 A;  3ZNI A;  1RRO A;  1A2X A;  3I5F C;  5HLV A;  4YRU A;  1XFY O;  1AVS A;  2NXQ A;  3GOF A;  1YVH A;  2I94 A;  1QTX A;  1UHI A;  4HSZ A;  3NXA A;  3O6B A;  1G8I A;  4ETO A;  3BYA A;  4WQ2 A;  4JWQ A;  5I2O A;  2MLF C;  1WDC B;  3GK4 X;  2KAY A;  3NSO A;  1NX3 A;  1WY9 A;  2BCB A;  3NSL A;  2BKH B;  4YGD B;  1KWO B;  4HRG A;  3SIA A;  2GV5 A;  3DD4 A;  3FWC A;  3VRR A;  4E68 A;  1M31 A;  5D69 A;  2M7L A;  1C7V A;  3C1V A;  4JQ0 D;  1SYM A;  1YUU A;  1MUX A;  1ZMZ A;  4JPZ B;  1JF0 A;  1R6P A;  2LMT A;  1V1F A;  2LC5 A;  1BT6 A;  3VRP A;  2CXJ A;  4C0L A;  4PAL A;  1K90 D;  4CFR A;  1A29 A;  1DJH A;  1QX7 A;  3BOW B;  1NSH A;  2ZRS A;  5BPJ A;  4AQJ A;  3AAK A;  1QLK A;  1J1D A;  4GFT A;  1YTZ C;  2DOQ A;  3SG3 A;  1F71 A;  2D8N A;  3H4S E;  1UHJ A;  4A4C A;  1M39 A;  2HPS A;  2KYC A;  2FCD A;  1UUR A;  3O78 A;  1TIZ A;  3SG4 A;  1DF0 B;  1QLS A;  2M97 A;  2H61 A;  1KK8 C;  3BQ3 A;  2JTZ A;  1TRF A;  4GUK A;  1CMF A;  1G4Y R;  1AUI B;  1SBJ A;  2ISD A;  3TDU A;  1K9U A;  1U5I A;  2M1U A;  3OB2 B;  1HQV A;  3SG2 A;  1RFJ A;  3BUW B;  2BKI B;  2WOS A;  1FPW A;  2Y5I A;  2BL0 C;  4QJ3 B;  2EGD A;  2PSR A;  1ZAC A;  4P2Y B;  4OR9 B;  2EC6 B;  1K93 D;  1NCY A;  3HCM A;  1QIW A;  4QJ5 B;  1FW4 A;  2MLE C;  1CFC A;  1XFU O;  1CMG A;  1HT9 A;  4WRI A;  1R2U A;  3D10 A;  4XJK A;  1K8U A;  3OHM B;  3KPX A;  2OS8 C;  1WRZ A;  4AQI A;  4PE1 A;  2L2E A;  2E6W A;  3DF0 A;  2K7C A;  2RGI A;  1S6I A;  4HRH A;  2KBM A;  2L98 A;  2LMV A;  4PE7 A;  1FI5 A;  1Y1A A;  2R2I A;  3LCP C;  3TS5 B;  2KOT A;  4ORA B;  4L9M A;  4D1E A;  1TNP A;  4IL1 A;  2G9B A;  3I5G C;  3M0W A;  2JC2 A;  2LVV A;  5ER5 A;  2KNE A;  3TDZ A;  2PAL A;  1XFV O;  4WQ3 A;  4OKH A;  1BMO A;  1J1E A;  1TCO B;  2NLN A;  3OP0 A;  2JQ6 A;  2K7D A;  2LLT A;  1S5G Z;  2F3Y A;  3EVU A;  1UUS A;  2HF5 A;  3PM8 A;  5DKN A;  2KFH A;  1YUS A;  1IWQ A;  1DMO A;  1BU3 A;  1WRL A;  3SG5 A;  3I5F B;  2LP2 A;  1XFZ O;  3TDI A;  4M2O A;  2KGR A;  1KFX L;  1TNX A;  1BLQ A;  3CR2 A;  2KDH A;  1KCY A;  1PSB A;  5JJG A;  1XYD A;  2M29 A;  2MJW B;  4I5J A;  3F45 A;  1SCM C;  1KQM C;  2L4H A;  2LNK A;  1L2O C;  3RM1 A;  1BF5 A;  1XO5 A;  3OX5 A;  4DUQ A;  2WOR A;  1UP5 A;  2BE6 A;  2P6B B;  4GBA A;  1MXE A;  1PK0 D;  1NUB A;  2KBI A;  1JFK A;  1DJW A;  4YGE B;  1B4C A;  1GQM A;  1ZFS A;  1SL8 A;  2I2R E;  4NDB A;  3IF7 A;  2NZ0 A;  1SKT A;  1B7T Z;  1NX0 A;  2M1K B;  1PRW A;  4DS7 A;  2Y1N A;  1ODB A;  1KQV A;  1OE9 B;  1IQ3 A;  2L4I A;  2O60 A;  2HQW A;  4PE4 A;  2L51 A;  3OX6 A;  1U5I B;  2ZN8 A;  3I5I B;  4OVN F;  3BUO B;  2K0J A;  4OV2 A;  4BY4 A;  1CDM A;  3SJS A;  4U8D A;  1TTX A;  1WLM A;  4GGF A;  1CM1 A;  2ZND A;  1M45 A;  3DVK A;  4QJ4 B;  1XVJ A;  3IQQ A;  3WHU B;  4MZL A;  1KK7 Z;  4DRW A;  1B7T Y;  4A4B A;  1BG1 A;  1KK8 B;  2H61 C;  1OMD A;  2LAP A;  2JNF A;  2ZFD A;  2QAC A;  3TZ1 A;  2JZI A;  1KFU S;  2M49 B;  4MZK A;  4YGC B;  1H4B A;  4XJK B;  1MXL C;  2LVK A;  4ORC B;  1CNP A;  1F55 A;  1IQ5 A;  3I5I C;  1ZOT B;  1WRK A;  1DTL A;  1S1E A;  3VGO A;  1AJ4 A;  2PAS A;  5AEQ A;  1B9A A;  2BL0 B;  1XFW O;  3WXA A;  3DF0 B;  2WC8 A;  1F70 A;  3KF9 A;  1PVB A;  1JF2 A;  1SPY A;  3KO0 A;  4MRX A;  5CSF A;  5HLO A;  5I8N A;  1J7P A;  3FIA A;  1YRT B;  1ZUZ A;  1GGW A;  1KFU L;  1SMG A;  1KSO A;  3HX4 A;  2K7O A;  4OCI A;  2SCP A;  2WND A;  2ZKM X;  1CLL A;  1QS7 A;  1KK7 Y;  4GNK B;  3SG6 A;  1JC2 A;  2JU0 A;  1G33 A;  3I5H C;  2I7A A;  3NSK A;  1A75 A;  1RTP 1;  1CTR A;  2OS8 B;  1B1G A;  5AFP A;  2K7B A;  2LAN A;  3PAL A;  2LUC A;  1REC A;  2WCF A;  1DJY A;  5TNC A;  1F4O A;  1QAS A;  1ALV A;  3CTN A;  1GGZ A;  1NX2 A;  2F2O A;  4C0J A;  5B8I B;  1H8B A;  3I5G B;  1BOD A;  1PUL A;  3MSE B;  2KAX A;  2KFG A;  1LA3 A;  1S26 D;  1TNQ A;  3BUX B;  5JOL A;  5HKY A;  5GQQ C;  1A03 A;  3PN7 C;  1BR1 B;  1EG3 A;  1TOP A;  1K9P A;  5IBW A;  3EK8 A;  1MWN A;  4Q04 A;  4MLW A;  5AAN A;  1NPQ A;  4NQG A;  2MHH A;  4F0Z B;  1DJZ A;  3ZWH A;  3EKH A;  1BR4 B;  1DJG A;  1K94 A;  1K95 A;  2OTG C;  1OMR A;  1KSM A;  2JT3 A;  2LHI A;  3DVJ A;  1QIV A;  2LLS A;  1B8R A;  4NDD A;  1K9K A;  2ZRT A;  1Q80 A;  1NCZ A;  1Y6W A;  1LVC D;  1UHN A;  2NCP A;  4I5K A;  1SCM B;  1KQM B;  3A8R A;  1PAL A;  1L2O B;  4MN0 A;  3BOW A;  1GJY A;  3D0Y A;  3SIB A;  3PFV A;  1SL7 A;  2BCA A;  1B8L A;  1N65 A;  1SK6 D;  3EVR A;  1SCV A;  1YX7 A;  2L5X B;  4PCW A;  4PHM A;  4BY5 A;  2LVJ A;  4MRY A;  4ZCU A;  3EK4 A;  3EVV A;  1J7Q A;  2F33 A;  5DKR A;  3LLE A;  2TN4 A;  4UPG A;  4PE0 A;  4C0K A;  1S6J A;  1AJ5 A;  5I2L A;  1NCX A;  2K2F A;  1RK9 A;  1UHH A;  2LUX A;  1M63 B;  1EG4 A;  3AKA A;  3PAT A;  2CCM A;  3LK1 A;  1CDN A;  1CFP A;  1SR6 C;  5AXI A;  4MZJ A;  1M46 A;  2JOJ A;  2F8P A;  4YGB B;  2MBX A;  1BJF A;  4GGF C;  1D1O A;  4P5O E;  1LXF C;  1J7R A;  1IKU A;  4TNC A;  1IJ6 A;  3LK0 A;  1CLB A;  1OOJ A; 
#chains in the Genus database with same CATH topology
 3QRX A;  4N5X A;  4ORB B;  2BBM A;  2H8V A;  1P28 A;  5PAL A;  3GK1 A;  3RLZ A;  4INW A;  2MRD A;  1CFD A;  1TCF A;  3CWG A;  5KU1 A;  2JNX A;  3JTD C;  1RJV A;  3E3R A;  1W7J B;  1XA5 A;  1J7O A;  1DQE A;  1FBV A;  1A75 B;  3CR4 X;  1S6C A;  2O5G A;  2GGZ A;  2LM5 A;  3LL8 B;  1XFX O;  4PHK A;  1LKJ A;  2LV7 A;  1CB1 A;  1BOC A;  3O4X A;  2G2B A;  4YI9 A;  1YX8 A;  1XK4 C;  2WC6 A;  4NDC A;  4N1F A;  4PHJ A;  2LP3 A;  1FF1 A;  1VRK A;  1X02 A;  1EJ3 A;  1FI6 A;  2K2A A;  1SRA A;  1SNL A;  3D75 A;  1PVA A;  2A4J A;  1EL4 A;  3I5H B;  2JPT A;  3R72 A;  2GGM A;  1AK8 A;  4N1G A;  4CID A;  1JFJ A;  1JSA A;  1SW8 A;  3BXK A;  2KHN A;  1IJ5 A;  1S3P A;  3GK2 A;  1CM4 A;  1OZS A;  2WCJ A;  3CS1 A;  2JXL A;  4M2P A;  5CSJ A;  2ZNE A;  2M0R A;  3TUY C;  1AP4 A;  4YBH B;  2JT8 A;  5CPV A;  1XK4 A;  2FJU B;  3JVT C;  1IRJ A;  3DVM A;  4ICB A;  2JXC A;  2HET A;  2AMI A;  2I18 A;  2KI6 D;  2L2C A;  3FWB A;  2PVB A;  3ICB A;  5F6T A;  1K2H A;  4DIR A;  3AKB A;  1QV0 A;  1JBA A;  2AUC A;  1B8C A;  1DJI A;  5FYX A;  1Z2C B;  4HRE E;  5KTY A;  1NP8 A;  2KQY A;  1YVL A;  1CLM A;  4INX A;  3PM2 A;  4GAO A;  3DY9 A;  1OQP A;  5J3X A;  4AOM A;  1K96 A;  1Y1U A;  3FS7 A;  4I5L B;  4YI8 A;  3PN7 B;  3D0Y B;  1NYA A;  1WDC C;  4JKT A;  4MSP A;  1N0Y A;  3IQO A;  1QX5 B;  1YUR A;  2L50 A;  1TWO A;  1CDL A;  2BE4 A;  2Y4Q A;  4YGA A;  2MA2 A;  2QPT A;  5HL1 A;  2L5Y A;  1DGV A;  1KWO C;  3DVE A;  1A4P A;  1E8A A;  1MF8 B;  2CT9 A;  2FJY A;  1UWO A;  1RWY A;  2KFF A;  3BUN B;  3Q8I A;  1NX1 A;  2OTG B;  1QJT A;  5CSI A;  5HYD A;  2LHL A;  1OSA A;  1UHK A;  4GGN A;  3VRQ A;  2KI4 B;  1Y0V H;  1MQ1 A;  1OW4 A;  3CYZ A;  2VRG A;  1MR8 A;  4ZCV A;  4R1E A;  1AHR A;  1XFR A;  3CGA A;  3WHT B;  4DCK A;  1YR5 A;  2K8M B;  5AER A;  1IG5 A;  2L0P A;  2LVI A;  1DVI A;  2E30 A;  4MBE A;  2MAZ A;  3O4Y A;  5D7F A;  2M8U A;  1F4Q A;  1QV1 A;  1NIW A;  1JUO A;  1SY9 A;  3O2P A;  2CTN A;  4FQT A;  3VRO A;  1EH2 A;  2WCB A;  2BNX A;  1V1G A;  5HKW A;  1C07 A;  2AAO A;  2JUL A;  2LLU A;  4FTG A;  3B87 A;  2BAP A;  4PHN A;  5HKZ A;  2KYF A;  3CZ2 A;  1TUJ A;  1IIO A;  2ZN9 A;  1LA0 A;  2F2P A;  1T14 A;  2BEC A;  1N2D A;  2KI4 C;  2KSP A;  5KSZ A;  2Y1M A;  1LIN A;  1CDP A;  1QXP A;  2PRU A;  3OB1 B;  4IJ7 A;  1SL9 A;  1SR6 B;  2OPO A;  3CR5 X;  1DJX A;  4USL A;  1B47 A;  3CLN A;  2CBL A;  2COL B;  2PQL A;  2Q91 A;  1DGU A;  3D76 A;  2LMU A;  4FQO A;  5CSN A;  2JTT A;  4M2Q A;  2JWW A;  2EHB A;  1EXR A;  4CPV A;  3WNX B;  3A4U B;  2M7N A;  3PSR A;  2LCP A;  3NSI A;  2EC6 C;  1DF0 A;  3KHE A;  2K60 A;  4MEW A;  3JTD B;  1S36 A;  2B1U A;  2IS9 A;  1KFX S;  2KAV A;  1F54 A;  1DT7 B;  5K89 A;  1YUT A;  2BBN A;  2CNP A;  2M3W A;  2BCX A;  2NCO A;  1L7Z A;  1DEK A;  2PMY A;  1W7I B;  1QVI Z;  2Q4U A;  3FE9 A;  4GPL B;  1PSR A;  1IH0 A;  2FOT A;  4I5N B;  3SG7 A;  2F3Z A;  2M9G A;  1IGV A;  4PDZ A;  1LS8 A;  3K21 A;  1CKK A;  2KGB C;  3PLF B;  1J55 A;  1CFF A;  3B88 A;  2K61 A;  2H2K A;  3KEV A;  5ER4 X;  4CFQ A;  1C7W A;  3B6X A;  3TS5 C;  4CLN A;  1MHO A;  2SAS A;  5DIC A;  5G08 A;  2WCE A;  5I2Q A;  3EKJ A;  3BUM B;  4MVF A;  1ALW A;  3SS4 A;  1JWD A;  1OZO A;  2KQ6 A;  2JRF A;  5DKQ A;  3S0E A;  2FCE A;  2P70 A;  1QAT A;  1QX2 A;  2V53 A;  1TN4 A;  1YRU B;  3EK7 A;  1Y1X A;  2LE9 B;  3VRN A;  2KI6 C;  2HQ8 A;  5EL2 A;  1QVI Y;  3TUY B;  2KLD A;  3AAJ A;  1TNW A;  4XYN A;  1S5G Y;  2GTE A;  3QME A;  1NWD A;  1OMV A;  5FI7 A;  1F8H A;  3CZT X;  3JVT B;  1WLZ A;  2JT0 A;  3ZNI A;  1RRO A;  1A2X A;  3I5F C;  5HLV A;  4YRU A;  3B7A A;  1XFY O;  4PT1 A;  1AVS A;  1W9Z A;  2NXQ A;  3GOF A;  1YVH A;  2I94 A;  1QTX A;  1UHI A;  4HSZ A;  3NXA A;  3O6B A;  1G8I A;  5FI6 A;  4ETO A;  3BYA A;  3DZT A;  4WQ2 A;  4JWQ A;  5I2O A;  2MLF C;  1WDC B;  3GK4 X;  2KAY A;  3NSO A;  1NX3 A;  1WY9 A;  2BCB A;  3NSL A;  2BKH B;  4YGD B;  1KWO B;  4HRG A;  3SIA A;  2GV5 A;  3DD4 A;  3FWC A;  3L4A A;  3VRR A;  4E68 A;  1M31 A;  5D69 A;  2M7L A;  1C7V A;  3C1V A;  4JQ0 D;  1SYM A;  1YUU A;  1MUX A;  1ZMZ A;  4JPZ B;  1JF0 A;  1R6P A;  2LMT A;  1V1F A;  2LC5 A;  1BT6 A;  3VRP A;  2CXJ A;  2QEV A;  4C0L A;  4PAL A;  1K90 D;  4CFR A;  1A29 A;  3S0A A;  1DJH A;  1QX7 A;  3BOW B;  1NSH A;  2ZRS A;  5BPJ A;  4AQJ A;  3R1V A;  3AAK A;  1QLK A;  1J1D A;  4GFT A;  1YTZ C;  2DOQ A;  3SG3 A;  1F71 A;  2D8N A;  3H4S E;  1UHJ A;  3EG5 B;  4A4C A;  1M39 A;  2HPS A;  2KYC A;  2FCD A;  1UUR A;  3S0G A;  3O78 A;  1TIZ A;  3SG4 A;  1DF0 B;  1QLS A;  2M97 A;  5FI2 A;  2H61 A;  1KK8 C;  1OOI X;  3BQ3 A;  2JTZ A;  1TRF A;  4GUK A;  1CMF A;  1G4Y R;  1AUI B;  1SBJ A;  2ISD A;  3TDU A;  1K9U A;  1U5I A;  2M1U A;  3OB2 B;  1HQV A;  3RZS A;  3SG2 A;  1RFJ A;  3BUW B;  2BKI B;  2WOS A;  1FPW A;  2Y5I A;  2BL0 C;  3K1E A;  4QJ3 B;  2EGD A;  2PSR A;  1ZAC A;  3BJH A;  4P2Y B;  2QEO A;  3BFA A;  4OR9 B;  2EC6 B;  1K93 D;  1NCY A;  3HCM A;  1QIW A;  2YGU A;  4QJ5 B;  1FW4 A;  2MLE C;  1CFC A;  1XFU O;  1CMG A;  1HT9 A;  3D78 A;  1R2U A;  4WRI A;  3D10 A;  4XJK A;  1K8U A;  3DYE A;  3OHM B;  3KPX A;  2OS8 C;  3UNW A;  1WRZ A;  4AQI A;  4PE1 A;  2L2E A;  2E6W A;  3DF0 A;  3S0F A;  2K7C A;  2RGI A;  1S6I A;  4HRH A;  2KBM A;  1OOH A;  2L98 A;  2LMV A;  4PE7 A;  1FI5 A;  1Y1A A;  2R2I A;  3LCP C;  3TS5 B;  2KOT A;  4ORA B;  1CLB A;  4L9M A;  4D1E A;  1TNP A;  4IL1 A;  2G9B A;  3I5G C;  3M0W A;  2JC2 A;  2LVV A;  5ER5 A;  2KNE A;  3TDZ A;  2PAL A;  1XFV O;  4WQ3 A;  4OKH A;  1BMO A;  1J1E A;  1TCO B;  2NLN A;  3OP0 A;  2JQ6 A;  2K7D A;  2LLT A;  1S5G Z;  2F3Y A;  3EVU A;  1UUS A;  2HF5 A;  3PM8 A;  5DKN A;  2KFH A;  1YUS A;  1IWQ A;  1DMO A;  1BU3 A;  1TUZ A;  1WRL A;  3SG5 A;  2PYQ A;  3I5F B;  2LP2 A;  1XFZ O;  3TDI A;  4M2O A;  2KGR A;  1KFX L;  1TNX A;  1BLQ A;  3CR2 A;  2KDH A;  3NHT A;  1KCY A;  1PSB A;  5JJG A;  1XYD A;  3FE6 A;  2M29 A;  2MJW B;  4I5J A;  3F45 A;  1SCM C;  1KQM C;  2L4H A;  2LNK A;  1L2O C;  3RM1 A;  1BF5 A;  1XO5 A;  2QEH A;  3OX5 A;  4DUQ A;  2WOR A;  1UP5 A;  2BE6 A;  2P6B B;  4GBA A;  2WC5 A;  1MXE A;  1PK0 D;  1ORG A;  1NUB A;  2KBI A;  1JFK A;  1DJW A;  3L47 A;  4YGE B;  1B4C A;  1GQM A;  1ZFS A;  1SL8 A;  2I2R E;  4NDB A;  3IF7 A;  3VB1 A;  2NZ0 A;  1SKT A;  1B7T Z;  1NX0 A;  3SS5 A;  2M1K B;  1PRW A;  4DS7 A;  2Y1N A;  3BFB A;  1ODB A;  1KQV A;  3PJI A;  1OE9 B;  1IQ3 A;  2L4I A;  2O60 A;  3B86 A;  2HQW A;  4PE4 A;  2L51 A;  3OX6 A;  1U5I B;  2ZN8 A;  3I5I B;  4OVN F;  3BUO B;  2K0J A;  4OV2 A;  5D3O A;  4BY4 A;  1CDM A;  3SJS A;  4U8D A;  1TTX A;  1WLM A;  4GGF A;  1CM1 A;  2ZND A;  1M45 A;  3DVK A;  1C3Z A;  4QJ4 B;  1XVJ A;  3IQQ A;  3WHU B;  4MZL A;  1KK7 Z;  4DRW A;  1B7T Y;  4A4B A;  1BG1 A;  1KK8 B;  2H61 C;  1OMD A;  2LAP A;  2JNF A;  2ZFD A;  2QAC A;  2QDI A;  3TZ1 A;  3D73 A;  2JZI A;  1KFU S;  2M49 B;  4MZK A;  4YGC B;  1H4B A;  4XJK B;  1MXL C;  3IVT A;  2LVK A;  4ORC B;  1CNP A;  1F55 A;  1IQ5 A;  3I5I C;  1ZOT B;  1WRK A;  3OBV A;  1DTL A;  1S1E A;  3VGO A;  1AJ4 A;  2WCL A;  2PAS A;  5AEQ A;  1B9A A;  2BL0 B;  1XFW O;  2QEB A;  3WXA A;  3DF0 B;  2WC8 A;  1F70 A;  3KF9 A;  1PVB A;  1JF2 A;  1SPY A;  3D74 A;  3D77 A;  3KO0 A;  4MRX A;  5CSF A;  5HLO A;  5I8N A;  3FIA A;  1YRT B;  1J7P A;  1ZUZ A;  1GGW A;  1KFU L;  1SMG A;  1KSO A;  3HX4 A;  2K7O A;  4OCI A;  2SCP A;  2WND A;  2ZKM X;  1CLL A;  1QS7 A;  1KK7 Y;  4GNK B;  1QWV A;  3SG6 A;  1Z4H A;  1JC2 A;  3NHI A;  2JU0 A;  3R1P A;  1G33 A;  3I5H C;  2I7A A;  3NSK A;  1A75 A;  1RTP 1;  1CTR A;  2OS8 B;  1B1G A;  5AFP A;  2K7B A;  2LAN A;  3PAL A;  2LUC A;  3UO9 A;  1REC A;  2WCF A;  3CDN A;  1DJY A;  5TNC A;  1F4O A;  2KLE A;  1QAS A;  1ALV A;  3CTN A;  1GGZ A;  1NX2 A;  2F2O A;  2KPH A;  4C0J A;  3S0B A;  4KYN A;  5B8I B;  1OOF A;  1H8B A;  3I5G B;  1BOD A;  3L4L A;  1PUL A;  3MSE B;  1DC1 A;  2KAX A;  2KFG A;  1LA3 A;  1S26 D;  1TNQ A;  3BUX B;  5JOL A;  5HKY A;  5GQQ C;  3V2L A;  1A03 A;  3PN7 C;  1BR1 B;  1EG3 A;  3S0D A;  1TOP A;  1K9P A;  5IBW A;  3EK8 A;  1MWN A;  4Q04 A;  4MLW A;  5AAN A;  4OZD A;  1NPQ A;  1C3Y A;  4NQG A;  2MHH A;  4F0Z B;  4F7F A;  1DJZ A;  3ZWH A;  3EKH A;  1BR4 B;  3DXL A;  1DJG A;  1K94 A;  1K95 A;  2OTG C;  1OMR A;  1KSM A;  2JT3 A;  2LHI A;  3CZ1 A;  3DVJ A;  1QIV A;  2LLS A;  3OGN A;  1B8R A;  4NDD A;  1K9K A;  2ZRT A;  1Q80 A;  1NCZ A;  1Y6W A;  2WCK A;  1LVC D;  1UHN A;  2NCP A;  3CZ0 A;  4I5K A;  5I94 A;  1SCM B;  1KQM B;  3A8R A;  1PAL A;  1L2O B;  3N7H A;  4MN0 A;  3BFH A;  3BOW A;  1GJY A;  3D0Y A;  3SIB A;  3SS3 A;  3PFV A;  1SL7 A;  2BCA A;  2WCM A;  1B8L A;  3NGV A;  1N65 A;  1SK6 D;  3EVR A;  1SCV A;  1YX7 A;  2L5X B;  2P71 A;  4JD9 A;  4PCW A;  4PHM A;  4BY5 A;  2LVJ A;  4MRY A;  4ZCU A;  3EK4 A;  3CAB A;  3EVV A;  1J7Q A;  2F33 A;  5DKR A;  1OOG A;  2TN4 A;  3LLE A;  4UPG A;  4PE0 A;  3FE8 A;  4C0K A;  1S6J A;  1AJ5 A;  1GM0 A;  3R1O A;  1NCX A;  2WCH A;  5I2L A;  2K2F A;  1RK9 A;  1UHH A;  1DEL A;  1M63 B;  2LUX A;  1EG4 A;  3AKA A;  3PAT A;  2CCM A;  3LK1 A;  1CDN A;  2ERB A;  1CFP A;  1SR6 C;  5AXI A;  4MZJ A;  1M46 A;  2JOJ A;  2F8P A;  4YGB B;  2JPO A;  2MBX A;  1BJF A;  4GGF C;  1D1O A;  4P5O E;  1LXF C;  1J7R A;  1IKU A;  4TNC A;  1IJ6 A;  3LK0 A;  1SSE B;  1OOJ A; 
#chains in the Genus database with same CATH homology
 3QRX A;  4N5X A;  4ORB B;  2BBM A;  5PAL A;  3GK1 A;  3RLZ A;  2MRD A;  1CFD A;  1TCF A;  3CWG A;  5KU1 A;  2JNX A;  3JTD C;  1RJV A;  3E3R A;  1W7J B;  1XA5 A;  1J7O A;  1FBV A;  1A75 B;  3CR4 X;  1S6C A;  2O5G A;  2GGZ A;  2LM5 A;  3LL8 B;  1XFX O;  4PHK A;  1LKJ A;  2LV7 A;  1CB1 A;  1BOC A;  2G2B A;  4YI9 A;  1YX8 A;  1XK4 C;  4NDC A;  4N1F A;  4PHJ A;  2LP3 A;  1FF1 A;  1VRK A;  1X02 A;  1EJ3 A;  1FI6 A;  2K2A A;  1SRA A;  1SNL A;  1PVA A;  2A4J A;  1EL4 A;  3I5H B;  2JPT A;  2GGM A;  1AK8 A;  4N1G A;  4CID A;  1JFJ A;  1JSA A;  1SW8 A;  3BXK A;  2KHN A;  1IJ5 A;  1S3P A;  3GK2 A;  1CM4 A;  1OZS A;  3CS1 A;  2JXL A;  4M2P A;  5CSJ A;  2ZNE A;  2M0R A;  3TUY C;  1AP4 A;  4YBH B;  2JT8 A;  5CPV A;  1XK4 A;  2FJU B;  3JVT C;  1IRJ A;  3DVM A;  4ICB A;  2JXC A;  2HET A;  2AMI A;  2I18 A;  2KI6 D;  3FWB A;  3ICB A;  2PVB A;  5F6T A;  1K2H A;  4DIR A;  3AKB A;  1QV0 A;  1JBA A;  2AUC A;  1B8C A;  1DJI A;  5FYX A;  4HRE E;  5KTY A;  1NP8 A;  2KQY A;  1YVL A;  1CLM A;  4GAO A;  4AOM A;  1OQP A;  5J3X A;  1K96 A;  1Y1U A;  3FS7 A;  4I5L B;  4YI8 A;  3PN7 B;  3D0Y B;  1NYA A;  1WDC C;  4MSP A;  1N0Y A;  3IQO A;  1QX5 B;  1YUR A;  2L50 A;  2Y4Q A;  1CDL A;  2BE4 A;  4YGA A;  2MA2 A;  2QPT A;  1DGV A;  1KWO C;  3DVE A;  1A4P A;  1E8A A;  1MF8 B;  2CT9 A;  2KFF A;  1UWO A;  1RWY A;  3BUN B;  1NX1 A;  2OTG B;  1QJT A;  5CSI A;  5HYD A;  2LHL A;  1OSA A;  1UHK A;  4GGN A;  3VRQ A;  2KI4 B;  1Y0V H;  1MQ1 A;  2VRG A;  1MR8 A;  4ZCV A;  4R1E A;  1AHR A;  3CGA A;  3WHT B;  4DCK A;  1YR5 A;  2K8M B;  5AER A;  1IG5 A;  2L0P A;  2LVI A;  1DVI A;  2E30 A;  4MBE A;  2MAZ A;  3O4Y A;  5D7F A;  2M8U A;  1F4Q A;  1QV1 A;  1NIW A;  1JUO A;  1SY9 A;  3O2P A;  2CTN A;  3VRO A;  1EH2 A;  2WCB A;  1C07 A;  1V1G A;  5HKW A;  2AAO A;  2JUL A;  2LLU A;  4FTG A;  4PHN A;  5HKZ A;  2KYF A;  2ZN9 A;  1LA0 A;  2F2P A;  2KI4 C;  2BEC A;  1N2D A;  2KSP A;  5KSZ A;  2Y1M A;  1LIN A;  1CDP A;  1QXP A;  2PRU A;  3OB1 B;  1SL9 A;  1SR6 B;  2OPO A;  3CR5 X;  1DJX A;  4USL A;  1B47 A;  3CLN A;  2COL B;  2CBL A;  2Q91 A;  1DGU A;  4FQO A;  2LMU A;  5CSN A;  2JTT A;  4M2Q A;  2JWW A;  2EHB A;  1EXR A;  4CPV A;  3WNX B;  3A4U B;  2M7N A;  3PSR A;  2LCP A;  3NSI A;  2EC6 C;  1DF0 A;  3KHE A;  4MEW A;  3JTD B;  1S36 A;  2B1U A;  2IS9 A;  1KFX S;  2KAV A;  1F54 A;  1DT7 B;  5K89 A;  1YUT A;  2BBN A;  2CNP A;  2M3W A;  2BCX A;  2NCO A;  1L7Z A;  2Q4U A;  2PMY A;  1W7I B;  1QVI Z;  4GPL B;  1IH0 A;  1PSR A;  2FOT A;  4I5N B;  3SG7 A;  2F3Z A;  2M9G A;  1IGV A;  4PDZ A;  3K21 A;  1CKK A;  2KGB C;  3PLF B;  1J55 A;  1CFF A;  2K61 A;  2H2K A;  3KEV A;  5ER4 X;  4CFQ A;  1C7W A;  3TS5 C;  4CLN A;  1MHO A;  2SAS A;  5G08 A;  2WCE A;  5I2Q A;  3EKJ A;  3BUM B;  4MVF A;  1ALW A;  1JWD A;  1OZO A;  2KQ6 A;  2JRF A;  5DKQ A;  2FCE A;  1QAT A;  1QX2 A;  2V53 A;  1TN4 A;  1YRU B;  3EK7 A;  1Y1X A;  2LE9 B;  3VRN A;  2KI6 C;  2HQ8 A;  1QVI Y;  3TUY B;  3AAJ A;  1TNW A;  4XYN A;  1S5G Y;  1NWD A;  1OMV A;  1F8H A;  3CZT X;  3JVT B;  1WLZ A;  2JT0 A;  3ZNI A;  1RRO A;  1A2X A;  3I5F C;  5HLV A;  4YRU A;  1XFY O;  1AVS A;  2NXQ A;  3GOF A;  1YVH A;  2I94 A;  1QTX A;  1UHI A;  4HSZ A;  3NXA A;  3O6B A;  1G8I A;  4ETO A;  3BYA A;  4WQ2 A;  4JWQ A;  5I2O A;  2MLF C;  1WDC B;  3GK4 X;  2KAY A;  3NSO A;  1NX3 A;  1WY9 A;  2BCB A;  3NSL A;  2BKH B;  4YGD B;  1KWO B;  4HRG A;  3SIA A;  2GV5 A;  3DD4 A;  3FWC A;  3VRR A;  4E68 A;  1M31 A;  5D69 A;  2M7L A;  1C7V A;  3C1V A;  4JQ0 D;  1SYM A;  1YUU A;  1MUX A;  1ZMZ A;  4JPZ B;  1JF0 A;  1R6P A;  2LMT A;  1V1F A;  2LC5 A;  1BT6 A;  3VRP A;  2CXJ A;  4C0L A;  4PAL A;  1K90 D;  4CFR A;  1A29 A;  1DJH A;  1QX7 A;  3BOW B;  1NSH A;  2ZRS A;  5BPJ A;  4AQJ A;  3AAK A;  1QLK A;  1J1D A;  4GFT A;  1YTZ C;  2DOQ A;  3SG3 A;  1F71 A;  2D8N A;  3H4S E;  1UHJ A;  4A4C A;  1M39 A;  2HPS A;  2KYC A;  2FCD A;  1UUR A;  3O78 A;  1TIZ A;  3SG4 A;  1DF0 B;  1QLS A;  2M97 A;  2H61 A;  1KK8 C;  3BQ3 A;  2JTZ A;  1TRF A;  4GUK A;  1CMF A;  1G4Y R;  1AUI B;  1SBJ A;  2ISD A;  3TDU A;  1K9U A;  1U5I A;  2M1U A;  3OB2 B;  1HQV A;  3SG2 A;  1RFJ A;  3BUW B;  2BKI B;  2WOS A;  1FPW A;  2Y5I A;  2BL0 C;  4QJ3 B;  2EGD A;  2PSR A;  1ZAC A;  4P2Y B;  4OR9 B;  2EC6 B;  1K93 D;  1NCY A;  3HCM A;  1QIW A;  4QJ5 B;  1FW4 A;  2MLE C;  1CFC A;  1XFU O;  1CMG A;  1HT9 A;  4WRI A;  1R2U A;  3D10 A;  4XJK A;  1K8U A;  3OHM B;  3KPX A;  2OS8 C;  1WRZ A;  4AQI A;  4PE1 A;  2L2E A;  2E6W A;  3DF0 A;  2K7C A;  2RGI A;  1S6I A;  4HRH A;  2KBM A;  2L98 A;  2LMV A;  4PE7 A;  1FI5 A;  1Y1A A;  2R2I A;  3LCP C;  3TS5 B;  2KOT A;  4ORA B;  4L9M A;  4D1E A;  1TNP A;  4IL1 A;  2G9B A;  3I5G C;  3M0W A;  2JC2 A;  2LVV A;  5ER5 A;  2KNE A;  3TDZ A;  2PAL A;  1XFV O;  4WQ3 A;  4OKH A;  1BMO A;  1J1E A;  1TCO B;  2NLN A;  3OP0 A;  2JQ6 A;  2K7D A;  2LLT A;  1S5G Z;  2F3Y A;  3EVU A;  1UUS A;  2HF5 A;  3PM8 A;  5DKN A;  2KFH A;  1YUS A;  1IWQ A;  1DMO A;  1BU3 A;  1WRL A;  3SG5 A;  3I5F B;  2LP2 A;  1XFZ O;  3TDI A;  4M2O A;  2KGR A;  1KFX L;  1TNX A;  1BLQ A;  3CR2 A;  2KDH A;  1KCY A;  1PSB A;  5JJG A;  1XYD A;  2M29 A;  2MJW B;  4I5J A;  3F45 A;  1SCM C;  1KQM C;  2L4H A;  2LNK A;  1L2O C;  3RM1 A;  1BF5 A;  1XO5 A;  3OX5 A;  4DUQ A;  2WOR A;  1UP5 A;  2BE6 A;  2P6B B;  4GBA A;  1MXE A;  1PK0 D;  1NUB A;  2KBI A;  1JFK A;  1DJW A;  4YGE B;  1B4C A;  1GQM A;  1ZFS A;  1SL8 A;  2I2R E;  4NDB A;  3IF7 A;  2NZ0 A;  1SKT A;  1B7T Z;  1NX0 A;  2M1K B;  1PRW A;  4DS7 A;  2Y1N A;  1ODB A;  1KQV A;  1OE9 B;  1IQ3 A;  2L4I A;  2O60 A;  2HQW A;  4PE4 A;  2L51 A;  3OX6 A;  1U5I B;  2ZN8 A;  3I5I B;  4OVN F;  3BUO B;  2K0J A;  4OV2 A;  4BY4 A;  1CDM A;  3SJS A;  4U8D A;  1TTX A;  1WLM A;  4GGF A;  1CM1 A;  2ZND A;  1M45 A;  3DVK A;  4QJ4 B;  1XVJ A;  3IQQ A;  3WHU B;  4MZL A;  1KK7 Z;  4DRW A;  1B7T Y;  4A4B A;  1BG1 A;  1KK8 B;  2H61 C;  1OMD A;  2LAP A;  2JNF A;  2ZFD A;  2QAC A;  3TZ1 A;  2JZI A;  1KFU S;  2M49 B;  4MZK A;  4YGC B;  1H4B A;  4XJK B;  1MXL C;  2LVK A;  4ORC B;  1CNP A;  1F55 A;  1IQ5 A;  3I5I C;  1ZOT B;  1WRK A;  1DTL A;  1S1E A;  3VGO A;  1AJ4 A;  2PAS A;  5AEQ A;  1B9A A;  2BL0 B;  1XFW O;  3WXA A;  3DF0 B;  2WC8 A;  1F70 A;  3KF9 A;  1PVB A;  1JF2 A;  1SPY A;  3KO0 A;  4MRX A;  5CSF A;  5HLO A;  5I8N A;  1J7P A;  3FIA A;  1YRT B;  1ZUZ A;  1GGW A;  1KFU L;  1SMG A;  1KSO A;  3HX4 A;  2K7O A;  4OCI A;  2SCP A;  2WND A;  2ZKM X;  1CLL A;  1QS7 A;  1KK7 Y;  4GNK B;  3SG6 A;  1JC2 A;  2JU0 A;  1G33 A;  3I5H C;  2I7A A;  3NSK A;  1A75 A;  1RTP 1;  1CTR A;  2OS8 B;  1B1G A;  5AFP A;  2K7B A;  2LAN A;  3PAL A;  2LUC A;  1REC A;  2WCF A;  1DJY A;  5TNC A;  1F4O A;  1QAS A;  1ALV A;  3CTN A;  1GGZ A;  1NX2 A;  2F2O A;  4C0J A;  5B8I B;  1H8B A;  3I5G B;  1BOD A;  1PUL A;  3MSE B;  2KAX A;  2KFG A;  1LA3 A;  1S26 D;  1TNQ A;  3BUX B;  5JOL A;  5HKY A;  5GQQ C;  1A03 A;  3PN7 C;  1BR1 B;  1EG3 A;  1TOP A;  1K9P A;  5IBW A;  3EK8 A;  1MWN A;  4Q04 A;  4MLW A;  5AAN A;  1NPQ A;  4NQG A;  2MHH A;  4F0Z B;  1DJZ A;  3ZWH A;  3EKH A;  1BR4 B;  1DJG A;  1K94 A;  1K95 A;  2OTG C;  1OMR A;  1KSM A;  2JT3 A;  2LHI A;  3DVJ A;  1QIV A;  2LLS A;  1B8R A;  4NDD A;  1K9K A;  2ZRT A;  1Q80 A;  1NCZ A;  1Y6W A;  1LVC D;  1UHN A;  2NCP A;  4I5K A;  1SCM B;  1KQM B;  3A8R A;  1PAL A;  1L2O B;  4MN0 A;  3BOW A;  1GJY A;  3D0Y A;  3SIB A;  3PFV A;  1SL7 A;  2BCA A;  1B8L A;  1N65 A;  1SK6 D;  3EVR A;  1SCV A;  1YX7 A;  2L5X B;  4PCW A;  4PHM A;  4BY5 A;  2LVJ A;  4MRY A;  4ZCU A;  3EK4 A;  3EVV A;  1J7Q A;  2F33 A;  5DKR A;  3LLE A;  2TN4 A;  4UPG A;  4PE0 A;  4C0K A;  1S6J A;  1AJ5 A;  5I2L A;  1NCX A;  2K2F A;  1RK9 A;  1UHH A;  2LUX A;  1M63 B;  1EG4 A;  3AKA A;  3PAT A;  2CCM A;  3LK1 A;  1CDN A;  1CFP A;  1SR6 C;  5AXI A;  4MZJ A;  1M46 A;  2JOJ A;  2F8P A;  4YGB B;  2MBX A;  1BJF A;  4GGF C;  1D1O A;  4P5O E;  1LXF C;  1J7R A;  1IKU A;  4TNC A;  1IJ6 A;  3LK0 A;  1CLB A;  1OOJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...