2BBNA

Solution structure of a calmodulin-target peptide complex by multidimensional nmr
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
148
structure length
148
Chain Sequence
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of a calmodulin-target peptide complex by multidimensional NMR.
pubmed rcsb
source organism Drosophila melanogaster
molecule tags Calcium-binding protein
molecule keywords CALMODULIN
total genus 32
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 1992-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2bbnA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2bbnA02
2PRUA 1BR4B 3K21A 1DVIA 1N65A 4U8DA 3SIBA 2EHBA 4A4CA 1M46A 3D10A 2BBNA 3BUNB 1A29A 2M7LA 3DVEA 3GOFA 4MRYA 5JJGA 1B1GA 4Q04A 5PALA 1A4PA 1DF0B 2MHHA 4OCIA 1QX5B 4YGCB 1NSHA 3IQQA 1YX8A 3OX5A 5BPJA 2KI4B 1KSMA 4ORBB 1EH2A 5KSZA 3EKHA 4XJKB 2COLB 2ZRTA 1YX7A 2M1KB 2GGZA 1SCMB 3BOWB 3PFVA 5CSNA 3WXAA 1AK8A 1KK7Y 2GGMA 1DF0A 4I5KA 4MVFA 2Y1MA 1RWYA 2WCBA 1QXPA 5AERA 1QV1A 2BCXA 1F4OA 2L51A 1H4BA 3VRRA 1Y1UA 4DCKA 1J7RA 3BUWB 1RECA 1CKKA 1PK0D 1QLKA 4YGAA 2LUXA 1UP5A 4TNCA 1LINA 4MBEA 4PHNA 1KFXS 1KFXL 3KEVA 1SPYA 1B4CA 3OB2B 2WORA 4CIDA 1RTP1 1S6JA 3LL8B 5AEQA 3SIAA 5HKZA 1CB1A 2LLSA 1OZSA 2V53A 2OTGC 3JTDC 1TN4A 3ZWHA 2MLFC 1IWQA 3EVUA 1SW8A 1W7JB 5G08A 1NCXA 1N2DA 4HRHA 2KGBC 1J55A 5DKQA 1XA5A 2F2PA 5GQQC 2AUCA 2HPSA 2LE9B 1QTXA 3WNXB 2MJWB 1OSAA 2M29A 2KAXA 1W7IB 4USLA 1QV0A 4C0LA 2MLEC 3A4UB 3ICBA 1J1EA 1DJIA 2K7BA 1KQVA 3QRXA 1LXFC 4YGBB 1FBVA 3I5IB 5HLOA 1XFVO 4A4BA 1XFWO 2R2IA 2BL0B 2MA2A 2NLNA 1XFXO 2WCEA 1DJZA 1B7TZ 2QPTA 1KWOB 2RGIA 2BCBA 4FQOA 4GFTA 3CTNA 3SG6A 2KFHA 1NWDA 1KQMB 3I5GB 1L2OB 2LVJA 3TDZA 3TS5B 2MAZA 2NZ0A 5CPVA 1BMOA 1CTRA 1M45A 5HLVA 2BECA 1JF2A 3O2PA 1E8AA 1OMDA 3TUYB 4NDBA 2AMIA 5CSJA 3D0YB 5IBWA 3AKAA 5B8IB 5K89A 2CCMA 2LHLA 2JNXA 2LC5A 4M2OA 2DOQA 2K7OA 1A03A 1R2UA 3CWGA 1V1FA 2LMTA 4CLNA 2F33A 3O6BA 3I5IC 3FWCA 2M7NA 3VGOA 2KI4C 1G33A 3BQ3A 1BODA 1Y6WA 3M0WA 2E30A 4ICBA 2CT9A 1J7PA 1TCOB 2OS8B 3VRPA 2LUCA 1K94A 2B1UA 2NCOA 1AJ5A 2NCPA 1BG1A 1BR1B 1NCYA 2LVVA 2BE6A 1ZACA 1DJHA 2K7DA 2I94A 1YRTB 1L2OC 2Q4UA 4P2YB 1NX1A 4PE0A 3EKJA 4N1GA 4OV2A 1TNPA 1B47A 1YVLA 5I2OA 1F8HA 3A8RA 2LMUA 4YGDB 3CS1A 1FPWA 2LP3A 1AVSA 2KHNA 1QIVA 4DIRA 1A75B 2KOTA 2FOTA 2K2AA 2LHIA 2ZRSA 4YGEB 1NX3A 2CBLA 1SKTA 2JULA 2Q91A 1BOCA 2BBMA 1BLQA 2JRFA 2K2FA 3IF7A 2M0RA 1IRJA 2I7AA 4QJ4B 1SY9A 1V1GA 1JC2A 1KK8B 3D0YA 3PLFB 3BUMB 4MSPA 5JOLA 1TCFA 1OZOA 2LVKA 4C0KA 3JVTC 3I5GC 1ZFSA 4JQ0D 4D1EA 2L5XB 1SL8A 3PATA 4GGFC 1SK6D 1GQMA 4NDDA 1JF0A 2OPOA 3JTDB 3PM8A 1KFUS 1SRAA 4GUKA 4NQGA 1S26D 1YUUA 3NSIA 2KGRA 3O4YA 2F3YA 5D7FA 1YR5A 2JOJA 2KAYA 1H8BA 1CFCA 5FYXA 3DVJA 2KQYA 3CR4X 2ISDA 1XFYO 1K95A 1B8LA 1U5IA 2KSPA 5HKYA 2KYCA 1UURA 5ER4X 5AANA 1GGWA 1JUOA 4AQIA 1KCYA 1K9KA 3GK2A 1TRFA 2KAVA 1QVIZ 2HETA 1TOPA 3NXAA 1AUIB 1YUSA 2KI6D 3BUXB 2WCFA 3GK1A 2L2EA 2KYFA 4YI8A 1MUXA 2LVIA 1SCVA 2BCAA 2TN4A 3BXKA 4JWQA 2JT0A 3DF0B 1F54A 2L50A 4DRWA 4PDZA 2JU0A 3OX6A 2NXQA 1YURA 3LCPC 3H4SE 1JBAA 1FF1A 1EJ3A 3WHUB 1XYDA 1TTXA 4GPLB 2Y4QA 2WNDA 1UUSA 1SBJA 2D8NA 3LLEA 3PN7C 2E6WA 2JXLA 5AXIA 1ODBA 2LLUA 1A75A 1WLMA 1WRLA 3BOWA 4PE1A 1CFFA 1AJ4A 1XK4A 2H61C 4PHKA 1S1EA 2WC8A 2IS9A 1DJYA 1IKUA 1B9AA 1BT6A 3EK8A 1PVBA 3EVVA 4M2QA 4MEWA 1DJXA 3PN7B 4GAOA 1OMVA 2CXJA 2KNEA 2Y5IA 4ZCVA 1Y0VH 2M9GA 1IG5A 1N0YA 1C07A 4OR9B 1NCZA 2L4HA 3DD4A 2F8PA 2JQ6A 2F3ZA 4MN0A 1K8UA 3SG2A 1XK4C 1CNPA 3F45A 1OOJA 2VRGA 2BKIB 4WQ2A 3FIAA 1J1DA 1EXRA 1NIWA 1KK7Z 1KSOA 4XJKA 2PMYA 1EG4A 2KFGA 2EGDA 3VRNA 1K9PA 1DJWA 1S6IA 2SCPA 4DS7A 3I5FB 4N1FA 2Y1NA 3CLNA 3RLZA 4C0JA 1D1OA 1QX2A 1Y1XA 3NSLA 1SR6C 1PRWA 1S36A 1DGUA 2KFFA 4N5XA 4F0ZB 1WLZA 1R6PA 1XFZO 2CTNA 2JT3A 2KDHA 4MLWA 5KTYA 2M49B 3WHTB 3EVRA 3DF0A 1PULA 1CM1A 1IGVA 2G2BA 2SASA 1QJTA 2I18A 2ZN8A 3PSRA 3AKBA 1K96A 1CFPA 2ZNEA 1MQ1A 1YUTA 2LAPA 1F4QA 2JZIA 4P5OE 1CDMA 1CDPA 5DKRA 1MHOA 4PE4A 4MZKA 4OKHA 3TDUA 1DMOA 1DJGA 1CMFA 3CGAA 3PALA 1CDLA 1S6CA 1KQMC 2ZFDA 2LMVA 1JFJA 1MF8B 2GV5A 1PVAA 3C1VA 4IL1A 5CSIA 4ETOA 4L9MA 1CDNA 2PASA 4R1EA 1FI5A 1QX7A 4YRUA 3BYAA 5I2LA 5DKNA 2LANA 2WOSA 2JT8A 3HCMA 1LA3A 4I5LB 1QVIY 3MSEB 1BF5A 2BL0C 4ORCB 4PALA 3FWBA 4PE7A 2BKHB 1F55A 1F70A 1JWDA 1CFDA 4AQJA 1PALA 1TIZA 4HSZA 1AHRA 1UHKA 4PCWA 1PSRA 1RK9A 4QJ3B 4CPVA 2JTTA 1EL4A 2ZKMX 3CR5X 1LA0A 1ALWA 3VROA 1SMGA 1SL9A 2KBIA 1DTLA 1CLBA 1L7ZA 4YBHB 3TS5C 1NP8A 1KK8C 3DVKA 3SG3A 3TDIA 4MZJA 3KF9A 1B7TY 1MR8A 1CLLA 1K93D 4ORAB 4JPZB 4XYNA 1JFKA 1G4YR 3DVMA 1YRUB 1YVHA 4GBAA 4BY5A 3OHMB 4OVNF 5J3XA 2JNFA 1PSBA 1K2HA 1QS7A 3OP0A 1DT7B 3KO0A 2F2OA 1IH0A 1WRKA 1NX2A 1ZUZA 1FW4A 1TNQA 4MRXA 4QJ5B 2LM5A 1UHJA 2I2RE 2L98A 1G8IA 3NSOA 1IQ5A 5ER5A 4WQ3A 2CNPA 2AAOA 3VRQA 2HF5A 3ZNIA 1B8CA 1CLMA 2PALA 1SCMC 1WY9A 3JVTB 3HX4A 1KWOC 1OMRA 1XO5A 2HQ8A 1UHIA 1WDCB 2JXCA 2ZN9A 2FJUB 1SR6B 3IQOA 1DGVA 4MZLA 5HYDA 2A4JA 2L0PA 2JC2A 3FS7A 1NYAA 2OS8C 1TNWA 1HQVA 1GJYA 2HQWA 2PSRA 1HT9A 1QATA 2LCPA 2M97A 1IJ5A 1X02A 2JPTA 5AFPA 1XFUO 2M8UA 4GGFA 1B8RA 1FI6A 1F71A 1IJ6A 2EC6C 3I5FC 3SJSA 4ZCUA 3SG7A 1RROA 3TZ1A 2KBMA 4BY4A 3AAJA 4PHMA 2K7CA 1ZMZA 2JWWA 3CZTX 4UPGA 1S3PA 1QLSA 2FCEA 4CFRA 1K9UA 5HKWA 3GK4X 4CFQA 4GGNA 4PHJA 1C7VA 2EC6B 1J7QA 1VRKA 4M2PA 2H2KA 1SYMA 1UWOA 3KHEA 4WRIA 4AOMA 1J7OA 2MBXA 2H61A 1C7WA 3CR2A 1CMGA 1OQPA 3EK4A 4HREE 1MXLC 1ZOTB 4GNKB 1UHHA 5KU1A 1Y1AA 1AP4A 1Q80A 2O60A 5I8NA 1KFUL 3BUOB 1K90D 1CM4A 1LVCD 2MRDA 1M63B 3AAKA 2O5GA 1U5IB 4HRGA 1XVJA 2FCDA 2QACA 4I5NB 3E3RA 3KPXA 2LLTA 2BE4A 2JTZA 3EK7A 1S5GZ 2LP2A 1GGZA 1A2XA 1BJFA 2ZNDA 1M39A 2KQ6A 1M31A 1WRZA 3O78A 1QASA 4E68A 4YI9A 4FTGA 3LK1A 5F6TA 1S5GY 1OE9B 1YTZC 2P6BB 1WDCC 3I5HC 1MWNA 2OTGB 3LK0A 5CSFA 1RFJA 1QIWA 2G9BA 3RM1A 3OB1B 1MXEA 2K8MB 2M1UA 3SG5A 1LKJA 1SNLA 2K61A 3SG4A 1JSAA 1UHNA 2LNKA 1ALVA 1RJVA 4DUQA 1NX0A 3I5HB 1TNXA 1EG3A 2K0JA 2L4IA 1NPQA 4NDCA 2M3WA 5TNCA 2PVBA 1IQ3A 2KI6C 2LV7A 1NUBA 1SL7A 4I5JA 5I2QA 5D69A 3TUYC 3NSKA 1BU3A
chains in the Genus database with same CATH superfamily
2PRUA 1BR4B 3K21A 1DVIA 1N65A 4U8DA 3SIBA 2EHBA 4A4CA 1M46A 3D10A 2BBNA 3BUNB 1A29A 2M7LA 3DVEA 3GOFA 4MRYA 5JJGA 1B1GA 4Q04A 5PALA 1A4PA 1DF0B 2MHHA 4OCIA 1QX5B 4YGCB 1NSHA 3IQQA 1YX8A 3OX5A 5BPJA 2KI4B 1KSMA 4ORBB 3S0GA 1EH2A 5KSZA 3EKHA 4XJKB 2COLB 2ZRTA 1YX7A 2M1KB 2GGZA 1SCMB 3BOWB 3PFVA 5CSNA 3WXAA 1AK8A 1KK7Y 2GGMA 1DF0A 4I5KA 4MVFA 2Y1MA 1RWYA 3UNWA 2WCBA 1QXPA 2PQLA 5AERA 1QV1A 2BCXA 1F4OA 2L51A 1H4BA 3VRRA 1Y1UA 4DCKA 1J7RA 3BUWB 1RECA 1CKKA 1PK0D 1QLKA 4YGAA 2LUXA 1UP5A 4TNCA 1LINA 1OW4A 4MBEA 4PHNA 1KFXS 1KFXL 3KEVA 1SPYA 1B4CA 3OB2B 2WORA 4CIDA 1RTP1 1S6JA 3LL8B 5AEQA 3SIAA 5HKZA 1CB1A 2LLSA 3DYEA 1OZSA 2V53A 2OTGC 3B88A 3JTDC 1TN4A 3R1VA 3ZWHA 2MLFC 1IWQA 3PM2A 3EVUA 1SW8A 1W7JB 5G08A 2WCJA 1NCXA 1N2DA 4HRHA 2KGBC 1J55A 2JPOA 5DKQA 1XA5A 2F2PA 5GQQC 2AUCA 2HPSA 2LE9B 1QTXA 3WNXB 2MJWB 1OSAA 2M29A 2KAXA 1W7IB 4USLA 1QV0A 4C0LA 1DELA 2MLEC 3A4UB 3ICBA 1J1EA 1DJIA 2K7BA 1KQVA 3QRXA 3FE8A 3R72A 1LXFC 4YGBB 1FBVA 3I5IB 5HLOA 1XFVO 4A4BA 1XFWO 2R2IA 2BL0B 2MA2A 2NLNA 1XFXO 2WCEA 1DJZA 1B7TZ 3FE9A 2QPTA 1KWOB 2RGIA 2BCBA 1IIOA 3L47A 4FQOA 3IVTA 4GFTA 3CTNA 3SG6A 2KFHA 1NWDA 1KQMB 3I5GB 1L2OB 2LVJA 3TDZA 3TS5B 2MAZA 2NZ0A 4FQTA 1BMOA 1CTRA 3FE6A 5CPVA 3S0FA 1M45A 5HLVA 2BECA 1JF2A 3O2PA 1E8AA 1OMDA 3TUYB 4NDBA 2AMIA 5CSJA 3D0YB 4JWQA 5IBWA 3AKAA 5B8IB 5K89A 2CCMA 2LHLA 3SS4A 2JNXA 2LC5A 3CZ1A 4M2OA 2DOQA 2YGUA 2K7OA 1A03A 1R2UA 3CABA 3CWGA 3D78A 1V1FA 2LMTA 4CLNA 2F33A 3O6BA 3I5IC 3FWCA 2M7NA 3VGOA 2KI4C 1G33A 3D76A 3BQ3A 3D75A 1BODA 1Y6WA 3M0WA 1OOGA 2E30A 4ICBA 2CT9A 1J7PA 1TCOB 2OS8B 3VRPA 2LUCA 1K94A 2B1UA 2L5YA 2NCOA 1AJ5A 5D3OA 2NCPA 1BG1A 1TUJA 1BR1B 1NCYA 2LVVA 3NHTA 2BE6A 1ZACA 3CZ2A 1DJHA 2K7DA 5FI6A 2I94A 1YRTB 1L2OC 2Q4UA 4P2YB 1NX1A 3BFBA 4PE0A 3EKJA 4N1GA 4OV2A 3D77A 1TNPA 1B47A 1YVLA 5I2OA 1F8HA 3A8RA 2LMUA 3BFHA 4YGDB 3CS1A 1FPWA 2LP3A 1AVSA 2KHNA 2QEBA 1QIVA 4DIRA 1DQEA 1A75B 2KOTA 2FOTA 2K2AA 2LHIA 2ZRSA 4YGEB 1NX3A 2CBLA 2KLEA 1SKTA 2JULA 2Q91A 1BOCA 2BBMA 1BLQA 2JRFA 2K2FA 3IF7A 2M0RA 1IRJA 2I7AA 3D74A 1SY9A 1V1GA 4QJ4B 1JC2A 1KK8B 3D0YA 3PLFB 3BUMB 4MSPA 5JOLA 1TCFA 1OZOA 2LVKA 4C0KA 3JVTC 3I5GC 1ZFSA 4JQ0D 4D1EA 3PJIA 2L5XB 1SL8A 4INXA 3PATA 4GGFC 1SK6D 1OOIX 1GQMA 4NDDA 1JF0A 2OPOA 3JTDB 3PM8A 1KFUS 1SRAA 4GUKA 4NQGA 1S26D 1YUUA 3NSIA 2KGRA 3O4YA 2F3YA 5D7FA 1YR5A 1Z4HA 2JOJA 2KAYA 2P71A 1H8BA 1CFCA 5FYXA 3DVJA 3D73A 2KQYA 3CR4X 2ISDA 1XFYO 1K95A 1B8LA 1U5IA 2KSPA 3SS5A 5HKYA 3S0BA 2KYCA 1UURA 5ER4X 5AANA 1GGWA 1JUOA 4AQIA 3R1OA 1KCYA 1K9KA 1QWVA 2ERBA 3GK2A 1TRFA 2KAVA 1QVIZ 2HETA 1TOPA 3NXAA 1AUIB 1YUSA 2KI6D 3BUXB 3CYZA 2WCFA 3UO9A 3GK1A 3S0AA 2L2EA 2KYFA 4YI8A 2QDIA 1MUXA 2LVIA 1SCVA 2BCAA 2H8VA 2TN4A 3BXKA 2JT0A 3DF0B 4JD9A 2L50A 3VB1A 4DRWA 4PDZA 2JU0A 3OX6A 2NXQA 1YURA 3LCPC 3H4SE 1JBAA 1FF1A 2PYQA 1EJ3A 3WHUB 1XYDA 1TTXA 4GPLB 2Y4QA 2WNDA 1UUSA 1SBJA 2D8NA 3LLEA 3PN7C 2E6WA 2JXLA 4PT1A 5AXIA 1ODBA 2LLUA 1A75A 1WLMA 3BFAA 1WRLA 3BOWA 4PE1A 1CFFA 1AJ4A 1XK4A 2H61C 4PHKA 1S1EA 2WC8A 2IS9A 1DJYA 1IKUA 1B9AA 1BT6A 3EK8A 1PVBA 3EVVA 4M2QA 4MEWA 1DJXA 3PN7B 3R1PA 4GAOA 1OMVA 2CXJA 2KNEA 2Y5IA 4INWA 4ZCVA 1Y0VH 2M9GA 1IG5A 1N0YA 1C07A 4OR9B 2KPHA 1NCZA 2L4HA 3DD4A 2F8PA 2JQ6A 2F3ZA 4MN0A 1K8UA 3SG2A 1XK4C 1CNPA 3F45A 5KTYA 1OOJA 2VRGA 2BKIB 3OGNA 4WQ2A 3FIAA 1J1DA 1EXRA 1NIWA 1KK7Z 1OOHA 3B86A 1KSOA 3S0EA 4XJKA 2PMYA 1EG4A 2KFGA 2EGDA 3VRNA 1K9PA 1DJWA 1S6IA 2SCPA 2P70A 4DS7A 2WC5A 3I5FB 4N1FA 2Y1NA 3CLNA 3RLZA 4C0JA 1D1OA 1QX2A 1Y1XA 3NSLA 1SR6C 1PRWA 1S36A 1DGUA 2KFFA 4N5XA 4F0ZB 1WLZA 1R6PA 1XFZO 2CTNA 2JT3A 2KDHA 3B7AA 2QEOA 2M49B 4MLWA 3WHTB 3EVRA 3DF0A 1PULA 1CM1A 1IGVA 2G2BA 2SASA 1QJTA 2I18A 2ZN8A 3PSRA 3B6XA 5I94A 3AKBA 1K96A 1CFPA 2ZNEA 1MQ1A 1YUTA 2LAPA 1F4QA 2JZIA 4P5OE 1CDMA 1CDPA 5DKRA 1MHOA 4PE4A 4MZKA 4OKHA 3TDUA 1DMOA 1DJGA 1CMFA 3CGAA 3NHIA 1ORGA 1CDLA 1S6CA 1KQMC 3PALA 2ZFDA 2LMVA 1JFJA 1MF8B 2GV5A 1PVAA 2BNXA 3C1VA 4IL1A 5CSIA 4ETOA 4L9MA 1CDNA 2PASA 4R1EA 3RZSA 1FI5A 1QX7A 4YRUA 3BYAA 2QEHA 5I2LA 5DKNA 2LANA 1LS8A 2WOSA 2JT8A 3HCMA 1LA3A 4I5LB 1QVIY 3MSEB 1BF5A 2BL0C 4ORCB 4PALA 3FWBA 4PE7A 2BKHB 1F55A 1F70A 1JWDA 1CFDA 4AQJA 1PALA 1TIZA 1C3ZA 4HSZA 1AHRA 1UHKA 4PCWA 4OZDA 1PSRA 1RK9A 4QJ3B 4CPVA 2JTTA 1EL4A 2ZKMX 3CR5X 1LA0A 1ALWA 3VROA 1SMGA 1SL9A 2KBIA 1DTLA 1CLBA 1L7ZA 4YBHB 3TS5C 2KLDA 1NP8A 3SS3A 1KK8C 3DVKA 3SG3A 3TDIA 4MZJA 1P28A 4KYNA 3KF9A 2GTEA 1B7TY 1MR8A 1CLLA 1K93D 4ORAB 4JPZB 4XYNA 1JFKA 1G4YR 3DVMA 1YRUB 1YVHA 4GBAA 4BY5A 3OHMB 4OVNF 5J3XA 2JNFA 1PSBA 1K2HA 1QS7A 3OP0A 1DT7B 3KO0A 2F2OA 1IH0A 1WRKA 1NX2A 1ZUZA 3K1EA 1FW4A 1TNQA 4MRXA 4QJ5B 2LM5A 1UHJA 2I2RE 2L98A 1G8IA 3NSOA 1IQ5A 3CZ0A 4F7FA 5ER5A 2WC6A 4WQ3A 2CNPA 2AAOA 3VRQA 2HF5A 3ZNIA 1DC1A 1B8CA 3O4XA 1CLMA 2PALA 3CDNA 3BJHA 1SCMC 1WY9A 3JVTB 3HX4A 1KWOC 1OMRA 1XO5A 2HQ8A 1UHIA 1WDCB 1T14A 2JXCA 2ZN9A 1SSEB 2FJUB 1SR6B 3DZTA 1DGVA 3IQOA 4MZLA 5HYDA 2A4JA 2L0PA 2JC2A 3FS7A 5FI7A 1NYAA 2OS8C 2WCMA 1TNWA 1HQVA 1GJYA 2HQWA 2K60A 3DXLA 3QMEA 5HL1A 2PSRA 1HT9A 1QATA 2LCPA 2M97A 1IJ5A 1X02A 2JPTA 5AFPA 1XFUO 2M8UA 1OOFA 1XFRA 4GGFA 1B8RA 4IJ7A 1C3YA 1F71A 1IJ6A 2EC6C 3I5FC 3SJSA 4ZCUA 3SG7A 1RROA 3TZ1A 2KBMA 4BY4A 1F54A 3AAJA 4PHMA 2K7CA 2WCLA 1ZMZA 2JWWA 3CZTX 4UPGA 1S3PA 1QLSA 2FCEA 3S0DA 4CFRA 1K9UA 5HKWA 3GK4X 4CFQA 4GGNA 4PHJA 3V2LA 2EC6B 5DICA 1C7VA 1J7QA 1VRKA 2L2CA 4M2PA 2H2KA 1SYMA 1UWOA 3EG5B 3KHEA 3N7HA 4WRIA 4AOMA 1J7OA 2MBXA 2H61A 1C7WA 3CR2A 4JKTA 1CMGA 1OQPA 3EK4A 3DY9A 3OBVA 4HREE 1MXLC 1ZOTB 4GNKB 1UHHA 5KU1A 1Y1AA 1AP4A 1Q80A 2WCKA 3B87A 2O60A 5I8NA 1KFUL 3BUOB 1K90D 1CM4A 1LVCD 2MRDA 1M63B 3AAKA 2O5GA 1U5IB 4HRGA 1W9ZA 1XVJA 2FCDA 2QACA 4I5NB 3E3RA 5FI2A 2BAPA 2LLTA 2BE4A 3KPXA 1Z2CB 3Q8IA 2JTZA 3EK7A 1TUZA 1S5GZ 3L4AA 2FJYA 2LP2A 1DEKA 1GGZA 1A2XA 1BJFA 2ZNDA 1M39A 2KQ6A 1M31A 1WRZA 3O78A 1QASA 1TWOA 4E68A 4YI9A 4FTGA 3LK1A 5F6TA 1S5GY 1OE9B 1YTZC 2P6BB 3NGVA 5EL2A 1WDCC 3I5HC 1MWNA 2OTGB 3LK0A 5CSFA 1RFJA 1QIWA 2G9BA 3RM1A 2QEVA 3OB1B 1MXEA 2K8MB 2M1UA 3SG5A 1LKJA 1SNLA 3L4LA 2K61A 3SG4A 1JSAA 1UHNA 2LNKA 1ALVA 1RJVA 2WCHA 4DUQA 1NX0A 3I5HB 1TNXA 1EG3A 1GM0A 2K0JA 2L4IA 1NPQA 4NDCA 2M3WA 5TNCA 2PVBA 1IQ3A 2KI6C 2LV7A 1NUBA 1FI6A 1SL7A 4I5JA 5I2QA 5D69A 3TUYC 3NSKA 1BU3A
chains in the Genus database with same CATH topology
2PRUA 1BR4B 3K21A 1DVIA 1N65A 4U8DA 3SIBA 2EHBA 4A4CA 1M46A 3D10A 2BBNA 3BUNB 1A29A 2M7LA 3DVEA 3GOFA 4MRYA 5JJGA 1B1GA 4Q04A 5PALA 1A4PA 1DF0B 2MHHA 4OCIA 1QX5B 4YGCB 1NSHA 3IQQA 1YX8A 3OX5A 5BPJA 2KI4B 1KSMA 4ORBB 1EH2A 5KSZA 3EKHA 4XJKB 2COLB 2ZRTA 1YX7A 2M1KB 2GGZA 1SCMB 3BOWB 3PFVA 5CSNA 3WXAA 1AK8A 1KK7Y 2GGMA 1DF0A 4I5KA 4MVFA 2Y1MA 1RWYA 2WCBA 1QXPA 5AERA 1QV1A 2BCXA 1F4OA 2L51A 1H4BA 3VRRA 1Y1UA 4DCKA 1J7RA 3BUWB 1RECA 1CKKA 1PK0D 1QLKA 4YGAA 2LUXA 1UP5A 4TNCA 1LINA 4MBEA 4PHNA 1KFXS 1KFXL 3KEVA 1SPYA 1B4CA 3OB2B 2WORA 4CIDA 1RTP1 1S6JA 3LL8B 5AEQA 3SIAA 5HKZA 1CB1A 2LLSA 1OZSA 2V53A 2OTGC 3JTDC 1TN4A 3ZWHA 2MLFC 1IWQA 3EVUA 1SW8A 1W7JB 5G08A 1NCXA 1N2DA 4HRHA 2KGBC 1J55A 5DKQA 1XA5A 2F2PA 5GQQC 2AUCA 2HPSA 2LE9B 1QTXA 3WNXB 2MJWB 1OSAA 2M29A 2KAXA 1W7IB 4USLA 1QV0A 4C0LA 2MLEC 3A4UB 3ICBA 1J1EA 1DJIA 2K7BA 1KQVA 3QRXA 1LXFC 4YGBB 1FBVA 3I5IB 5HLOA 1XFVO 4A4BA 1XFWO 2R2IA 2BL0B 2MA2A 2NLNA 1XFXO 2WCEA 1DJZA 1B7TZ 2QPTA 1KWOB 2RGIA 2BCBA 4FQOA 4GFTA 3CTNA 3SG6A 2KFHA 1NWDA 1KQMB 3I5GB 1L2OB 2LVJA 3TDZA 3TS5B 2MAZA 2NZ0A 5CPVA 1BMOA 1CTRA 1M45A 5HLVA 2BECA 1JF2A 3O2PA 1E8AA 1OMDA 3TUYB 4NDBA 2AMIA 5CSJA 3D0YB 5IBWA 3AKAA 5B8IB 5K89A 2CCMA 2LHLA 2JNXA 2LC5A 4M2OA 2DOQA 2K7OA 1A03A 1R2UA 3CWGA 1V1FA 2LMTA 4CLNA 2F33A 3O6BA 3I5IC 3FWCA 2M7NA 3VGOA 2KI4C 1G33A 3BQ3A 1BODA 1Y6WA 3M0WA 2E30A 4ICBA 2CT9A 1J7PA 1TCOB 2OS8B 3VRPA 2LUCA 1K94A 2B1UA 2NCOA 1AJ5A 2NCPA 1BG1A 1BR1B 1NCYA 2LVVA 2BE6A 1ZACA 1DJHA 2K7DA 2I94A 1YRTB 1L2OC 2Q4UA 4P2YB 1NX1A 4PE0A 3EKJA 4N1GA 4OV2A 1TNPA 1B47A 1YVLA 5I2OA 1F8HA 3A8RA 2LMUA 4YGDB 3CS1A 1FPWA 2LP3A 1AVSA 2KHNA 1QIVA 4DIRA 1A75B 2KOTA 2FOTA 2K2AA 2LHIA 2ZRSA 4YGEB 1NX3A 2CBLA 1SKTA 2JULA 2Q91A 1BOCA 2BBMA 1BLQA 2JRFA 2K2FA 3IF7A 2M0RA 1IRJA 2I7AA 4QJ4B 1SY9A 1V1GA 1JC2A 1KK8B 3D0YA 3PLFB 3BUMB 4MSPA 5JOLA 1TCFA 1OZOA 2LVKA 4C0KA 3JVTC 3I5GC 1ZFSA 4JQ0D 4D1EA 2L5XB 1SL8A 3PATA 4GGFC 1SK6D 1GQMA 4NDDA 1JF0A 2OPOA 3JTDB 3PM8A 1KFUS 1SRAA 4GUKA 4NQGA 1S26D 1YUUA 3NSIA 2KGRA 3O4YA 2F3YA 5D7FA 1YR5A 2JOJA 2KAYA 1H8BA 1CFCA 5FYXA 3DVJA 2KQYA 3CR4X 2ISDA 1XFYO 1K95A 1B8LA 1U5IA 2KSPA 5HKYA 2KYCA 1UURA 5ER4X 5AANA 1GGWA 1JUOA 4AQIA 1KCYA 1K9KA 3GK2A 1TRFA 2KAVA 1QVIZ 2HETA 1TOPA 3NXAA 1AUIB 1YUSA 2KI6D 3BUXB 2WCFA 3GK1A 2L2EA 2KYFA 4YI8A 1MUXA 2LVIA 1SCVA 2BCAA 2TN4A 3BXKA 4JWQA 2JT0A 3DF0B 1F54A 2L50A 4DRWA 4PDZA 2JU0A 3OX6A 2NXQA 1YURA 3LCPC 3H4SE 1JBAA 1FF1A 1EJ3A 3WHUB 1XYDA 1TTXA 4GPLB 2Y4QA 2WNDA 1UUSA 1SBJA 2D8NA 3LLEA 3PN7C 2E6WA 2JXLA 5AXIA 1ODBA 2LLUA 1A75A 1WLMA 1WRLA 3BOWA 4PE1A 1CFFA 1AJ4A 1XK4A 2H61C 4PHKA 1S1EA 2WC8A 2IS9A 1DJYA 1IKUA 1B9AA 1BT6A 3EK8A 1PVBA 3EVVA 4M2QA 4MEWA 1DJXA 3PN7B 4GAOA 1OMVA 2CXJA 2KNEA 2Y5IA 4ZCVA 1Y0VH 2M9GA 1IG5A 1N0YA 1C07A 4OR9B 1NCZA 2L4HA 3DD4A 2F8PA 2JQ6A 2F3ZA 4MN0A 1K8UA 3SG2A 1XK4C 1CNPA 3F45A 1OOJA 2VRGA 2BKIB 4WQ2A 3FIAA 1J1DA 1EXRA 1NIWA 1KK7Z 1KSOA 4XJKA 2PMYA 1EG4A 2KFGA 2EGDA 3VRNA 1K9PA 1DJWA 1S6IA 2SCPA 4DS7A 3I5FB 4N1FA 2Y1NA 3CLNA 3RLZA 4C0JA 1D1OA 1QX2A 1Y1XA 3NSLA 1SR6C 1PRWA 1S36A 1DGUA 2KFFA 4N5XA 4F0ZB 1WLZA 1R6PA 1XFZO 2CTNA 2JT3A 2KDHA 4MLWA 5KTYA 2M49B 3WHTB 3EVRA 3DF0A 1PULA 1CM1A 1IGVA 2G2BA 2SASA 1QJTA 2I18A 2ZN8A 3PSRA 3AKBA 1K96A 1CFPA 2ZNEA 1MQ1A 1YUTA 2LAPA 1F4QA 2JZIA 4P5OE 1CDMA 1CDPA 5DKRA 1MHOA 4PE4A 4MZKA 4OKHA 3TDUA 1DMOA 1DJGA 1CMFA 3CGAA 3PALA 1CDLA 1S6CA 1KQMC 2ZFDA 2LMVA 1JFJA 1MF8B 2GV5A 1PVAA 3C1VA 4IL1A 5CSIA 4ETOA 4L9MA 1CDNA 2PASA 4R1EA 1FI5A 1QX7A 4YRUA 3BYAA 5I2LA 5DKNA 2LANA 2WOSA 2JT8A 3HCMA 1LA3A 4I5LB 1QVIY 3MSEB 1BF5A 2BL0C 4ORCB 4PALA 3FWBA 4PE7A 2BKHB 1F55A 1F70A 1JWDA 1CFDA 4AQJA 1PALA 1TIZA 4HSZA 1AHRA 1UHKA 4PCWA 1PSRA 1RK9A 4QJ3B 4CPVA 2JTTA 1EL4A 2ZKMX 3CR5X 1LA0A 1ALWA 3VROA 1SMGA 1SL9A 2KBIA 1DTLA 1CLBA 1L7ZA 4YBHB 3TS5C 1NP8A 1KK8C 3DVKA 3SG3A 3TDIA 4MZJA 3KF9A 1B7TY 1MR8A 1CLLA 1K93D 4ORAB 4JPZB 4XYNA 1JFKA 1G4YR 3DVMA 1YRUB 1YVHA 4GBAA 4BY5A 3OHMB 4OVNF 5J3XA 2JNFA 1PSBA 1K2HA 1QS7A 3OP0A 1DT7B 3KO0A 2F2OA 1IH0A 1WRKA 1NX2A 1ZUZA 1FW4A 1TNQA 4MRXA 4QJ5B 2LM5A 1UHJA 2I2RE 2L98A 1G8IA 3NSOA 1IQ5A 5ER5A 4WQ3A 2CNPA 2AAOA 3VRQA 2HF5A 3ZNIA 1B8CA 1CLMA 2PALA 1SCMC 1WY9A 3JVTB 3HX4A 1KWOC 1OMRA 1XO5A 2HQ8A 1UHIA 1WDCB 2JXCA 2ZN9A 2FJUB 1SR6B 3IQOA 1DGVA 4MZLA 5HYDA 2A4JA 2L0PA 2JC2A 3FS7A 1NYAA 2OS8C 1TNWA 1HQVA 1GJYA 2HQWA 2PSRA 1HT9A 1QATA 2LCPA 2M97A 1IJ5A 1X02A 2JPTA 5AFPA 1XFUO 2M8UA 4GGFA 1B8RA 1FI6A 1F71A 1IJ6A 2EC6C 3I5FC 3SJSA 4ZCUA 3SG7A 1RROA 3TZ1A 2KBMA 4BY4A 3AAJA 4PHMA 2K7CA 1ZMZA 2JWWA 3CZTX 4UPGA 1S3PA 1QLSA 2FCEA 4CFRA 1K9UA 5HKWA 3GK4X 4CFQA 4GGNA 4PHJA 1C7VA 2EC6B 1J7QA 1VRKA 4M2PA 2H2KA 1SYMA 1UWOA 3KHEA 4WRIA 4AOMA 1J7OA 2MBXA 2H61A 1C7WA 3CR2A 1CMGA 1OQPA 3EK4A 4HREE 1MXLC 1ZOTB 4GNKB 1UHHA 5KU1A 1Y1AA 1AP4A 1Q80A 2O60A 5I8NA 1KFUL 3BUOB 1K90D 1CM4A 1LVCD 2MRDA 1M63B 3AAKA 2O5GA 1U5IB 4HRGA 1XVJA 2FCDA 2QACA 4I5NB 3E3RA 3KPXA 2LLTA 2BE4A 2JTZA 3EK7A 1S5GZ 2LP2A 1GGZA 1A2XA 1BJFA 2ZNDA 1M39A 2KQ6A 1M31A 1WRZA 3O78A 1QASA 4E68A 4YI9A 4FTGA 3LK1A 5F6TA 1S5GY 1OE9B 1YTZC 2P6BB 1WDCC 3I5HC 1MWNA 2OTGB 3LK0A 5CSFA 1RFJA 1QIWA 2G9BA 3RM1A 3OB1B 1MXEA 2K8MB 2M1UA 3SG5A 1LKJA 1SNLA 2K61A 3SG4A 1JSAA 1UHNA 2LNKA 1ALVA 1RJVA 4DUQA 1NX0A 3I5HB 1TNXA 1EG3A 2K0JA 2L4IA 1NPQA 4NDCA 2M3WA 5TNCA 2PVBA 1IQ3A 2KI6C 2LV7A 1NUBA 1SL7A 4I5JA 5I2QA 5D69A 3TUYC 3NSKA 1BU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PRU A;  1BR4 B;  3K21 A;  1DVI A;  1N65 A;  4U8D A;  3SIB A;  2EHB A;  4A4C A;  1M46 A;  3D10 A;  2BBN A;  3BUN B;  1A29 A;  2M7L A;  3DVE A;  3GOF A;  4MRY A;  5JJG A;  1B1G A;  4Q04 A;  5PAL A;  1A4P A;  1DF0 B;  2MHH A;  4OCI A;  1QX5 B;  4YGC B;  1NSH A;  3IQQ A;  1YX8 A;  3OX5 A;  5BPJ A;  2KI4 B;  1KSM A;  4ORB B;  1EH2 A;  5KSZ A;  3EKH A;  4XJK B;  2COL B;  2ZRT A;  1YX7 A;  2M1K B;  2GGZ A;  1SCM B;  3BOW B;  3PFV A;  5CSN A;  3WXA A;  1AK8 A;  1KK7 Y;  2GGM A;  1DF0 A;  4I5K A;  4MVF A;  2Y1M A;  1RWY A;  2WCB A;  1QXP A;  5AER A;  1QV1 A;  2BCX A;  1F4O A;  2L51 A;  1H4B A;  3VRR A;  1Y1U A;  4DCK A;  1J7R A;  3BUW B;  1REC A;  1CKK A;  1PK0 D;  1QLK A;  4YGA A;  2LUX A;  1UP5 A;  4TNC A;  1LIN A;  4MBE A;  4PHN A;  1KFX S;  1KFX L;  3KEV A;  1SPY A;  1B4C A;  3OB2 B;  2WOR A;  4CID A;  1RTP 1;  1S6J A;  3LL8 B;  5AEQ A;  3SIA A;  5HKZ A;  1CB1 A;  2LLS A;  1OZS A;  2V53 A;  2OTG C;  3JTD C;  1TN4 A;  3ZWH A;  2MLF C;  1IWQ A;  3EVU A;  1SW8 A;  1W7J B;  5G08 A;  1NCX A;  1N2D A;  4HRH A;  2KGB C;  1J55 A;  5DKQ A;  1XA5 A;  2F2P A;  5GQQ C;  2AUC A;  2HPS A;  2LE9 B;  1QTX A;  3WNX B;  2MJW B;  1OSA A;  2M29 A;  2KAX A;  1W7I B;  4USL A;  1QV0 A;  4C0L A;  2MLE C;  3A4U B;  3ICB A;  1J1E A;  1DJI A;  2K7B A;  1KQV A;  3QRX A;  1LXF C;  4YGB B;  1FBV A;  3I5I B;  5HLO A;  1XFV O;  4A4B A;  1XFW O;  2R2I A;  2BL0 B;  2MA2 A;  2NLN A;  1XFX O;  2WCE A;  1DJZ A;  1B7T Z;  2QPT A;  1KWO B;  2RGI A;  2BCB A;  4FQO A;  4GFT A;  3CTN A;  3SG6 A;  2KFH A;  1NWD A;  1KQM B;  3I5G B;  1L2O B;  2LVJ A;  3TDZ A;  3TS5 B;  2MAZ A;  2NZ0 A;  5CPV A;  1BMO A;  1CTR A;  1M45 A;  5HLV A;  2BEC A;  1JF2 A;  3O2P A;  1E8A A;  1OMD A;  3TUY B;  4NDB A;  2AMI A;  5CSJ A;  3D0Y B;  5IBW A;  3AKA A;  5B8I B;  5K89 A;  2CCM A;  2LHL A;  2JNX A;  2LC5 A;  4M2O A;  2DOQ A;  2K7O A;  1A03 A;  1R2U A;  3CWG A;  1V1F A;  2LMT A;  4CLN A;  2F33 A;  3O6B A;  3I5I C;  3FWC A;  2M7N A;  3VGO A;  2KI4 C;  1G33 A;  3BQ3 A;  1BOD A;  1Y6W A;  3M0W A;  2E30 A;  4ICB A;  2CT9 A;  1J7P A;  1TCO B;  2OS8 B;  3VRP A;  2LUC A;  1K94 A;  2B1U A;  2NCO A;  1AJ5 A;  2NCP A;  1BG1 A;  1BR1 B;  1NCY A;  2LVV A;  2BE6 A;  1ZAC A;  1DJH A;  2K7D A;  2I94 A;  1YRT B;  1L2O C;  2Q4U A;  4P2Y B;  1NX1 A;  4PE0 A;  3EKJ A;  4N1G A;  4OV2 A;  1TNP A;  1B47 A;  1YVL A;  5I2O A;  1F8H A;  3A8R A;  2LMU A;  4YGD B;  3CS1 A;  1FPW A;  2LP3 A;  1AVS A;  2KHN A;  1QIV A;  4DIR A;  1A75 B;  2KOT A;  2FOT A;  2K2A A;  2LHI A;  2ZRS A;  4YGE B;  1NX3 A;  2CBL A;  1SKT A;  2JUL A;  2Q91 A;  1BOC A;  2BBM A;  1BLQ A;  2JRF A;  2K2F A;  3IF7 A;  2M0R A;  1IRJ A;  2I7A A;  4QJ4 B;  1SY9 A;  1V1G A;  1JC2 A;  1KK8 B;  3D0Y A;  3PLF B;  3BUM B;  4MSP A;  5JOL A;  1TCF A;  1OZO A;  2LVK A;  4C0K A;  3JVT C;  3I5G C;  1ZFS A;  4JQ0 D;  4D1E A;  2L5X B;  1SL8 A;  3PAT A;  4GGF C;  1SK6 D;  1GQM A;  4NDD A;  1JF0 A;  2OPO A;  3JTD B;  3PM8 A;  1KFU S;  1SRA A;  4GUK A;  4NQG A;  1S26 D;  1YUU A;  3NSI A;  2KGR A;  3O4Y A;  2F3Y A;  5D7F A;  1YR5 A;  2JOJ A;  2KAY A;  1H8B A;  1CFC A;  5FYX A;  3DVJ A;  2KQY A;  3CR4 X;  2ISD A;  1XFY O;  1K95 A;  1B8L A;  1U5I A;  2KSP A;  5HKY A;  2KYC A;  1UUR A;  5ER4 X;  5AAN A;  1GGW A;  1JUO A;  4AQI A;  1KCY A;  1K9K A;  3GK2 A;  1TRF A;  2KAV A;  1QVI Z;  2HET A;  1TOP A;  3NXA A;  1AUI B;  1YUS A;  2KI6 D;  3BUX B;  2WCF A;  3GK1 A;  2L2E A;  2KYF A;  4YI8 A;  1MUX A;  2LVI A;  1SCV A;  2BCA A;  2TN4 A;  3BXK A;  4JWQ A;  2JT0 A;  3DF0 B;  1F54 A;  2L50 A;  4DRW A;  4PDZ A;  2JU0 A;  3OX6 A;  2NXQ A;  1YUR A;  3LCP C;  3H4S E;  1JBA A;  1FF1 A;  1EJ3 A;  3WHU B;  1XYD A;  1TTX A;  4GPL B;  2Y4Q A;  2WND A;  1UUS A;  1SBJ A;  2D8N A;  3LLE A;  3PN7 C;  2E6W A;  2JXL A;  5AXI A;  1ODB A;  2LLU A;  1A75 A;  1WLM A;  1WRL A;  3BOW A;  4PE1 A;  1CFF A;  1AJ4 A;  1XK4 A;  2H61 C;  4PHK A;  1S1E A;  2WC8 A;  2IS9 A;  1DJY A;  1IKU A;  1B9A A;  1BT6 A;  3EK8 A;  1PVB A;  3EVV A;  4M2Q A;  4MEW A;  1DJX A;  3PN7 B;  4GAO A;  1OMV A;  2CXJ A;  2KNE A;  2Y5I A;  4ZCV A;  1Y0V H;  2M9G A;  1IG5 A;  1N0Y A;  1C07 A;  4OR9 B;  1NCZ A;  2L4H A;  3DD4 A;  2F8P A;  2JQ6 A;  2F3Z A;  4MN0 A;  1K8U A;  3SG2 A;  1XK4 C;  1CNP A;  3F45 A;  1OOJ A;  2VRG A;  2BKI B;  4WQ2 A;  3FIA A;  1J1D A;  1EXR A;  1NIW A;  1KK7 Z;  1KSO A;  4XJK A;  2PMY A;  1EG4 A;  2KFG A;  2EGD A;  3VRN A;  1K9P A;  1DJW A;  1S6I A;  2SCP A;  4DS7 A;  3I5F B;  4N1F A;  2Y1N A;  3CLN A;  3RLZ A;  4C0J A;  1D1O A;  1QX2 A;  1Y1X A;  3NSL A;  1SR6 C;  1PRW A;  1S36 A;  1DGU A;  2KFF A;  4N5X A;  4F0Z B;  1WLZ A;  1R6P A;  1XFZ O;  2CTN A;  2JT3 A;  2KDH A;  4MLW A;  5KTY A;  2M49 B;  3WHT B;  3EVR A;  3DF0 A;  1PUL A;  1CM1 A;  1IGV A;  2G2B A;  2SAS A;  1QJT A;  2I18 A;  2ZN8 A;  3PSR A;  3AKB A;  1K96 A;  1CFP A;  2ZNE A;  1MQ1 A;  1YUT A;  2LAP A;  1F4Q A;  2JZI A;  4P5O E;  1CDM A;  1CDP A;  5DKR A;  1MHO A;  4PE4 A;  4MZK A;  4OKH A;  3TDU A;  1DMO A;  1DJG A;  1CMF A;  3CGA A;  3PAL A;  1CDL A;  1S6C A;  1KQM C;  2ZFD A;  2LMV A;  1JFJ A;  1MF8 B;  2GV5 A;  1PVA A;  3C1V A;  4IL1 A;  5CSI A;  4ETO A;  4L9M A;  1CDN A;  2PAS A;  4R1E A;  1FI5 A;  1QX7 A;  4YRU A;  3BYA A;  5I2L A;  5DKN A;  2LAN A;  2WOS A;  2JT8 A;  3HCM A;  1LA3 A;  4I5L B;  1QVI Y;  3MSE B;  1BF5 A;  2BL0 C;  4ORC B;  4PAL A;  3FWB A;  4PE7 A;  2BKH B;  1F55 A;  1F70 A;  1JWD A;  1CFD A;  4AQJ A;  1PAL A;  1TIZ A;  4HSZ A;  1AHR A;  1UHK A;  4PCW A;  1PSR A;  1RK9 A;  4QJ3 B;  4CPV A;  2JTT A;  1EL4 A;  2ZKM X;  3CR5 X;  1LA0 A;  1ALW A;  3VRO A;  1SMG A;  1SL9 A;  2KBI A;  1DTL A;  1CLB A;  1L7Z A;  4YBH B;  3TS5 C;  1NP8 A;  1KK8 C;  3DVK A;  3SG3 A;  3TDI A;  4MZJ A;  3KF9 A;  1B7T Y;  1MR8 A;  1CLL A;  1K93 D;  4ORA B;  4JPZ B;  4XYN A;  1JFK A;  1G4Y R;  3DVM A;  1YRU B;  1YVH A;  4GBA A;  4BY5 A;  3OHM B;  4OVN F;  5J3X A;  2JNF A;  1PSB A;  1K2H A;  1QS7 A;  3OP0 A;  1DT7 B;  3KO0 A;  2F2O A;  1IH0 A;  1WRK A;  1NX2 A;  1ZUZ A;  1FW4 A;  1TNQ A;  4MRX A;  4QJ5 B;  2LM5 A;  1UHJ A;  2I2R E;  2L98 A;  1G8I A;  3NSO A;  1IQ5 A;  5ER5 A;  4WQ3 A;  2CNP A;  2AAO A;  3VRQ A;  2HF5 A;  3ZNI A;  1B8C A;  1CLM A;  2PAL A;  1SCM C;  1WY9 A;  3JVT B;  3HX4 A;  1KWO C;  1OMR A;  1XO5 A;  2HQ8 A;  1UHI A;  1WDC B;  2JXC A;  2ZN9 A;  2FJU B;  1SR6 B;  3IQO A;  1DGV A;  4MZL A;  5HYD A;  2A4J A;  2L0P A;  2JC2 A;  3FS7 A;  1NYA A;  2OS8 C;  1TNW A;  1HQV A;  1GJY A;  2HQW A;  2PSR A;  1HT9 A;  1QAT A;  2LCP A;  2M97 A;  1IJ5 A;  1X02 A;  2JPT A;  5AFP A;  1XFU O;  2M8U A;  4GGF A;  1B8R A;  1FI6 A;  1F71 A;  1IJ6 A;  2EC6 C;  3I5F C;  3SJS A;  4ZCU A;  3SG7 A;  1RRO A;  3TZ1 A;  2KBM A;  4BY4 A;  3AAJ A;  4PHM A;  2K7C A;  1ZMZ A;  2JWW A;  3CZT X;  4UPG A;  1S3P A;  1QLS A;  2FCE A;  4CFR A;  1K9U A;  5HKW A;  3GK4 X;  4CFQ A;  4GGN A;  4PHJ A;  1C7V A;  2EC6 B;  1J7Q A;  1VRK A;  4M2P A;  2H2K A;  1SYM A;  1UWO A;  3KHE A;  4WRI A;  4AOM A;  1J7O A;  2MBX A;  2H61 A;  1C7W A;  3CR2 A;  1CMG A;  1OQP A;  3EK4 A;  4HRE E;  1MXL C;  1ZOT B;  4GNK B;  1UHH A;  5KU1 A;  1Y1A A;  1AP4 A;  1Q80 A;  2O60 A;  5I8N A;  1KFU L;  3BUO B;  1K90 D;  1CM4 A;  1LVC D;  2MRD A;  1M63 B;  3AAK A;  2O5G A;  1U5I B;  4HRG A;  1XVJ A;  2FCD A;  2QAC A;  4I5N B;  3E3R A;  3KPX A;  2LLT A;  2BE4 A;  2JTZ A;  3EK7 A;  1S5G Z;  2LP2 A;  1GGZ A;  1A2X A;  1BJF A;  2ZND A;  1M39 A;  2KQ6 A;  1M31 A;  1WRZ A;  3O78 A;  1QAS A;  4E68 A;  4YI9 A;  4FTG A;  3LK1 A;  5F6T A;  1S5G Y;  1OE9 B;  1YTZ C;  2P6B B;  1WDC C;  3I5H C;  1MWN A;  2OTG B;  3LK0 A;  5CSF A;  1RFJ A;  1QIW A;  2G9B A;  3RM1 A;  3OB1 B;  1MXE A;  2K8M B;  2M1U A;  3SG5 A;  1LKJ A;  1SNL A;  2K61 A;  3SG4 A;  1JSA A;  1UHN A;  2LNK A;  1ALV A;  1RJV A;  4DUQ A;  1NX0 A;  3I5H B;  1TNX A;  1EG3 A;  2K0J A;  2L4I A;  1NPQ A;  4NDC A;  2M3W A;  5TNC A;  2PVB A;  1IQ3 A;  2KI6 C;  2LV7 A;  1NUB A;  1SL7 A;  4I5J A;  5I2Q A;  5D69 A;  3TUY C;  3NSK A;  1BU3 A; 
#chains in the Genus database with same CATH topology
 2PRU A;  1BR4 B;  3K21 A;  1DVI A;  1N65 A;  4U8D A;  3SIB A;  2EHB A;  4A4C A;  1M46 A;  3D10 A;  2BBN A;  3BUN B;  1A29 A;  2M7L A;  3DVE A;  3GOF A;  4MRY A;  5JJG A;  1B1G A;  4Q04 A;  5PAL A;  1A4P A;  1DF0 B;  2MHH A;  4OCI A;  1QX5 B;  4YGC B;  1NSH A;  3IQQ A;  1YX8 A;  3OX5 A;  5BPJ A;  2KI4 B;  1KSM A;  4ORB B;  3S0G A;  1EH2 A;  5KSZ A;  3EKH A;  4XJK B;  2COL B;  2ZRT A;  1YX7 A;  2M1K B;  2GGZ A;  1SCM B;  3BOW B;  3PFV A;  5CSN A;  3WXA A;  1AK8 A;  1KK7 Y;  2GGM A;  1DF0 A;  4I5K A;  4MVF A;  2Y1M A;  1RWY A;  3UNW A;  2WCB A;  1QXP A;  2PQL A;  5AER A;  1QV1 A;  2BCX A;  1F4O A;  2L51 A;  1H4B A;  3VRR A;  1Y1U A;  4DCK A;  1J7R A;  3BUW B;  1REC A;  1CKK A;  1PK0 D;  1QLK A;  4YGA A;  2LUX A;  1UP5 A;  4TNC A;  1LIN A;  1OW4 A;  4MBE A;  4PHN A;  1KFX S;  1KFX L;  3KEV A;  1SPY A;  1B4C A;  3OB2 B;  2WOR A;  4CID A;  1RTP 1;  1S6J A;  3LL8 B;  5AEQ A;  3SIA A;  5HKZ A;  1CB1 A;  2LLS A;  3DYE A;  1OZS A;  2V53 A;  2OTG C;  3B88 A;  3JTD C;  1TN4 A;  3R1V A;  3ZWH A;  2MLF C;  1IWQ A;  3PM2 A;  3EVU A;  1SW8 A;  1W7J B;  5G08 A;  2WCJ A;  1NCX A;  1N2D A;  4HRH A;  2KGB C;  1J55 A;  2JPO A;  5DKQ A;  1XA5 A;  2F2P A;  5GQQ C;  2AUC A;  2HPS A;  2LE9 B;  1QTX A;  3WNX B;  2MJW B;  1OSA A;  2M29 A;  2KAX A;  1W7I B;  4USL A;  1QV0 A;  4C0L A;  1DEL A;  2MLE C;  3A4U B;  3ICB A;  1J1E A;  1DJI A;  2K7B A;  1KQV A;  3QRX A;  3FE8 A;  3R72 A;  1LXF C;  4YGB B;  1FBV A;  3I5I B;  5HLO A;  1XFV O;  4A4B A;  1XFW O;  2R2I A;  2BL0 B;  2MA2 A;  2NLN A;  1XFX O;  2WCE A;  1DJZ A;  1B7T Z;  3FE9 A;  2QPT A;  1KWO B;  2RGI A;  2BCB A;  1IIO A;  3L47 A;  4FQO A;  3IVT A;  4GFT A;  3CTN A;  3SG6 A;  2KFH A;  1NWD A;  1KQM B;  3I5G B;  1L2O B;  2LVJ A;  3TDZ A;  3TS5 B;  2MAZ A;  2NZ0 A;  4FQT A;  1BMO A;  1CTR A;  3FE6 A;  5CPV A;  3S0F A;  1M45 A;  5HLV A;  2BEC A;  1JF2 A;  3O2P A;  1E8A A;  1OMD A;  3TUY B;  4NDB A;  2AMI A;  5CSJ A;  3D0Y B;  4JWQ A;  5IBW A;  3AKA A;  5B8I B;  5K89 A;  2CCM A;  2LHL A;  3SS4 A;  2JNX A;  2LC5 A;  3CZ1 A;  4M2O A;  2DOQ A;  2YGU A;  2K7O A;  1A03 A;  1R2U A;  3CAB A;  3CWG A;  3D78 A;  1V1F A;  2LMT A;  4CLN A;  2F33 A;  3O6B A;  3I5I C;  3FWC A;  2M7N A;  3VGO A;  2KI4 C;  1G33 A;  3D76 A;  3BQ3 A;  3D75 A;  1BOD A;  1Y6W A;  3M0W A;  1OOG A;  2E30 A;  4ICB A;  2CT9 A;  1J7P A;  1TCO B;  2OS8 B;  3VRP A;  2LUC A;  1K94 A;  2B1U A;  2L5Y A;  2NCO A;  1AJ5 A;  5D3O A;  2NCP A;  1BG1 A;  1TUJ A;  1BR1 B;  1NCY A;  2LVV A;  3NHT A;  2BE6 A;  1ZAC A;  3CZ2 A;  1DJH A;  2K7D A;  5FI6 A;  2I94 A;  1YRT B;  1L2O C;  2Q4U A;  4P2Y B;  1NX1 A;  3BFB A;  4PE0 A;  3EKJ A;  4N1G A;  4OV2 A;  3D77 A;  1TNP A;  1B47 A;  1YVL A;  5I2O A;  1F8H A;  3A8R A;  2LMU A;  3BFH A;  4YGD B;  3CS1 A;  1FPW A;  2LP3 A;  1AVS A;  2KHN A;  2QEB A;  1QIV A;  4DIR A;  1DQE A;  1A75 B;  2KOT A;  2FOT A;  2K2A A;  2LHI A;  2ZRS A;  4YGE B;  1NX3 A;  2CBL A;  2KLE A;  1SKT A;  2JUL A;  2Q91 A;  1BOC A;  2BBM A;  1BLQ A;  2JRF A;  2K2F A;  3IF7 A;  2M0R A;  1IRJ A;  2I7A A;  3D74 A;  1SY9 A;  1V1G A;  4QJ4 B;  1JC2 A;  1KK8 B;  3D0Y A;  3PLF B;  3BUM B;  4MSP A;  5JOL A;  1TCF A;  1OZO A;  2LVK A;  4C0K A;  3JVT C;  3I5G C;  1ZFS A;  4JQ0 D;  4D1E A;  3PJI A;  2L5X B;  1SL8 A;  4INX A;  3PAT A;  4GGF C;  1SK6 D;  1OOI X;  1GQM A;  4NDD A;  1JF0 A;  2OPO A;  3JTD B;  3PM8 A;  1KFU S;  1SRA A;  4GUK A;  4NQG A;  1S26 D;  1YUU A;  3NSI A;  2KGR A;  3O4Y A;  2F3Y A;  5D7F A;  1YR5 A;  1Z4H A;  2JOJ A;  2KAY A;  2P71 A;  1H8B A;  1CFC A;  5FYX A;  3DVJ A;  3D73 A;  2KQY A;  3CR4 X;  2ISD A;  1XFY O;  1K95 A;  1B8L A;  1U5I A;  2KSP A;  3SS5 A;  5HKY A;  3S0B A;  2KYC A;  1UUR A;  5ER4 X;  5AAN A;  1GGW A;  1JUO A;  4AQI A;  3R1O A;  1KCY A;  1K9K A;  1QWV A;  2ERB A;  3GK2 A;  1TRF A;  2KAV A;  1QVI Z;  2HET A;  1TOP A;  3NXA A;  1AUI B;  1YUS A;  2KI6 D;  3BUX B;  3CYZ A;  2WCF A;  3UO9 A;  3GK1 A;  3S0A A;  2L2E A;  2KYF A;  4YI8 A;  2QDI A;  1MUX A;  2LVI A;  1SCV A;  2BCA A;  2H8V A;  2TN4 A;  3BXK A;  2JT0 A;  3DF0 B;  4JD9 A;  2L50 A;  3VB1 A;  4DRW A;  4PDZ A;  2JU0 A;  3OX6 A;  2NXQ A;  1YUR A;  3LCP C;  3H4S E;  1JBA A;  1FF1 A;  2PYQ A;  1EJ3 A;  3WHU B;  1XYD A;  1TTX A;  4GPL B;  2Y4Q A;  2WND A;  1UUS A;  1SBJ A;  2D8N A;  3LLE A;  3PN7 C;  2E6W A;  2JXL A;  4PT1 A;  5AXI A;  1ODB A;  2LLU A;  1A75 A;  1WLM A;  3BFA A;  1WRL A;  3BOW A;  4PE1 A;  1CFF A;  1AJ4 A;  1XK4 A;  2H61 C;  4PHK A;  1S1E A;  2WC8 A;  2IS9 A;  1DJY A;  1IKU A;  1B9A A;  1BT6 A;  3EK8 A;  1PVB A;  3EVV A;  4M2Q A;  4MEW A;  1DJX A;  3PN7 B;  3R1P A;  4GAO A;  1OMV A;  2CXJ A;  2KNE A;  2Y5I A;  4INW A;  4ZCV A;  1Y0V H;  2M9G A;  1IG5 A;  1N0Y A;  1C07 A;  4OR9 B;  2KPH A;  1NCZ A;  2L4H A;  3DD4 A;  2F8P A;  2JQ6 A;  2F3Z A;  4MN0 A;  1K8U A;  3SG2 A;  1XK4 C;  1CNP A;  3F45 A;  5KTY A;  1OOJ A;  2VRG A;  2BKI B;  3OGN A;  4WQ2 A;  3FIA A;  1J1D A;  1EXR A;  1NIW A;  1KK7 Z;  1OOH A;  3B86 A;  1KSO A;  3S0E A;  4XJK A;  2PMY A;  1EG4 A;  2KFG A;  2EGD A;  3VRN A;  1K9P A;  1DJW A;  1S6I A;  2SCP A;  2P70 A;  4DS7 A;  2WC5 A;  3I5F B;  4N1F A;  2Y1N A;  3CLN A;  3RLZ A;  4C0J A;  1D1O A;  1QX2 A;  1Y1X A;  3NSL A;  1SR6 C;  1PRW A;  1S36 A;  1DGU A;  2KFF A;  4N5X A;  4F0Z B;  1WLZ A;  1R6P A;  1XFZ O;  2CTN A;  2JT3 A;  2KDH A;  3B7A A;  2QEO A;  2M49 B;  4MLW A;  3WHT B;  3EVR A;  3DF0 A;  1PUL A;  1CM1 A;  1IGV A;  2G2B A;  2SAS A;  1QJT A;  2I18 A;  2ZN8 A;  3PSR A;  3B6X A;  5I94 A;  3AKB A;  1K96 A;  1CFP A;  2ZNE A;  1MQ1 A;  1YUT A;  2LAP A;  1F4Q A;  2JZI A;  4P5O E;  1CDM A;  1CDP A;  5DKR A;  1MHO A;  4PE4 A;  4MZK A;  4OKH A;  3TDU A;  1DMO A;  1DJG A;  1CMF A;  3CGA A;  3NHI A;  1ORG A;  1CDL A;  1S6C A;  1KQM C;  3PAL A;  2ZFD A;  2LMV A;  1JFJ A;  1MF8 B;  2GV5 A;  1PVA A;  2BNX A;  3C1V A;  4IL1 A;  5CSI A;  4ETO A;  4L9M A;  1CDN A;  2PAS A;  4R1E A;  3RZS A;  1FI5 A;  1QX7 A;  4YRU A;  3BYA A;  2QEH A;  5I2L A;  5DKN A;  2LAN A;  1LS8 A;  2WOS A;  2JT8 A;  3HCM A;  1LA3 A;  4I5L B;  1QVI Y;  3MSE B;  1BF5 A;  2BL0 C;  4ORC B;  4PAL A;  3FWB A;  4PE7 A;  2BKH B;  1F55 A;  1F70 A;  1JWD A;  1CFD A;  4AQJ A;  1PAL A;  1TIZ A;  1C3Z A;  4HSZ A;  1AHR A;  1UHK A;  4PCW A;  4OZD A;  1PSR A;  1RK9 A;  4QJ3 B;  4CPV A;  2JTT A;  1EL4 A;  2ZKM X;  3CR5 X;  1LA0 A;  1ALW A;  3VRO A;  1SMG A;  1SL9 A;  2KBI A;  1DTL A;  1CLB A;  1L7Z A;  4YBH B;  3TS5 C;  2KLD A;  1NP8 A;  3SS3 A;  1KK8 C;  3DVK A;  3SG3 A;  3TDI A;  4MZJ A;  1P28 A;  4KYN A;  3KF9 A;  2GTE A;  1B7T Y;  1MR8 A;  1CLL A;  1K93 D;  4ORA B;  4JPZ B;  4XYN A;  1JFK A;  1G4Y R;  3DVM A;  1YRU B;  1YVH A;  4GBA A;  4BY5 A;  3OHM B;  4OVN F;  5J3X A;  2JNF A;  1PSB A;  1K2H A;  1QS7 A;  3OP0 A;  1DT7 B;  3KO0 A;  2F2O A;  1IH0 A;  1WRK A;  1NX2 A;  1ZUZ A;  3K1E A;  1FW4 A;  1TNQ A;  4MRX A;  4QJ5 B;  2LM5 A;  1UHJ A;  2I2R E;  2L98 A;  1G8I A;  3NSO A;  1IQ5 A;  3CZ0 A;  4F7F A;  5ER5 A;  2WC6 A;  4WQ3 A;  2CNP A;  2AAO A;  3VRQ A;  2HF5 A;  3ZNI A;  1DC1 A;  1B8C A;  3O4X A;  1CLM A;  2PAL A;  3CDN A;  3BJH A;  1SCM C;  1WY9 A;  3JVT B;  3HX4 A;  1KWO C;  1OMR A;  1XO5 A;  2HQ8 A;  1UHI A;  1WDC B;  1T14 A;  2JXC A;  2ZN9 A;  1SSE B;  2FJU B;  1SR6 B;  3DZT A;  1DGV A;  3IQO A;  4MZL A;  5HYD A;  2A4J A;  2L0P A;  2JC2 A;  3FS7 A;  5FI7 A;  1NYA A;  2OS8 C;  2WCM A;  1TNW A;  1HQV A;  1GJY A;  2HQW A;  2K60 A;  3DXL A;  3QME A;  5HL1 A;  2PSR A;  1HT9 A;  1QAT A;  2LCP A;  2M97 A;  1IJ5 A;  1X02 A;  2JPT A;  5AFP A;  1XFU O;  2M8U A;  1OOF A;  1XFR A;  4GGF A;  1B8R A;  4IJ7 A;  1C3Y A;  1F71 A;  1IJ6 A;  2EC6 C;  3I5F C;  3SJS A;  4ZCU A;  3SG7 A;  1RRO A;  3TZ1 A;  2KBM A;  4BY4 A;  1F54 A;  3AAJ A;  4PHM A;  2K7C A;  2WCL A;  1ZMZ A;  2JWW A;  3CZT X;  4UPG A;  1S3P A;  1QLS A;  2FCE A;  3S0D A;  4CFR A;  1K9U A;  5HKW A;  3GK4 X;  4CFQ A;  4GGN A;  4PHJ A;  3V2L A;  2EC6 B;  5DIC A;  1C7V A;  1J7Q A;  1VRK A;  2L2C A;  4M2P A;  2H2K A;  1SYM A;  1UWO A;  3EG5 B;  3KHE A;  3N7H A;  4WRI A;  4AOM A;  1J7O A;  2MBX A;  2H61 A;  1C7W A;  3CR2 A;  4JKT A;  1CMG A;  1OQP A;  3EK4 A;  3DY9 A;  3OBV A;  4HRE E;  1MXL C;  1ZOT B;  4GNK B;  1UHH A;  5KU1 A;  1Y1A A;  1AP4 A;  1Q80 A;  2WCK A;  3B87 A;  2O60 A;  5I8N A;  1KFU L;  3BUO B;  1K90 D;  1CM4 A;  1LVC D;  2MRD A;  1M63 B;  3AAK A;  2O5G A;  1U5I B;  4HRG A;  1W9Z A;  1XVJ A;  2FCD A;  2QAC A;  4I5N B;  3E3R A;  5FI2 A;  2BAP A;  2LLT A;  2BE4 A;  3KPX A;  1Z2C B;  3Q8I A;  2JTZ A;  3EK7 A;  1TUZ A;  1S5G Z;  3L4A A;  2FJY A;  2LP2 A;  1DEK A;  1GGZ A;  1A2X A;  1BJF A;  2ZND A;  1M39 A;  2KQ6 A;  1M31 A;  1WRZ A;  3O78 A;  1QAS A;  1TWO A;  4E68 A;  4YI9 A;  4FTG A;  3LK1 A;  5F6T A;  1S5G Y;  1OE9 B;  1YTZ C;  2P6B B;  3NGV A;  5EL2 A;  1WDC C;  3I5H C;  1MWN A;  2OTG B;  3LK0 A;  5CSF A;  1RFJ A;  1QIW A;  2G9B A;  3RM1 A;  2QEV A;  3OB1 B;  1MXE A;  2K8M B;  2M1U A;  3SG5 A;  1LKJ A;  1SNL A;  3L4L A;  2K61 A;  3SG4 A;  1JSA A;  1UHN A;  2LNK A;  1ALV A;  1RJV A;  2WCH A;  4DUQ A;  1NX0 A;  3I5H B;  1TNX A;  1EG3 A;  1GM0 A;  2K0J A;  2L4I A;  1NPQ A;  4NDC A;  2M3W A;  5TNC A;  2PVB A;  1IQ3 A;  2KI6 C;  2LV7 A;  1NUB A;  1FI6 A;  1SL7 A;  4I5J A;  5I2Q A;  5D69 A;  3TUY C;  3NSK A;  1BU3 A; 
#chains in the Genus database with same CATH homology
 2PRU A;  1BR4 B;  3K21 A;  1DVI A;  1N65 A;  4U8D A;  3SIB A;  2EHB A;  4A4C A;  1M46 A;  3D10 A;  2BBN A;  3BUN B;  1A29 A;  2M7L A;  3DVE A;  3GOF A;  4MRY A;  5JJG A;  1B1G A;  4Q04 A;  5PAL A;  1A4P A;  1DF0 B;  2MHH A;  4OCI A;  1QX5 B;  4YGC B;  1NSH A;  3IQQ A;  1YX8 A;  3OX5 A;  5BPJ A;  2KI4 B;  1KSM A;  4ORB B;  1EH2 A;  5KSZ A;  3EKH A;  4XJK B;  2COL B;  2ZRT A;  1YX7 A;  2M1K B;  2GGZ A;  1SCM B;  3BOW B;  3PFV A;  5CSN A;  3WXA A;  1AK8 A;  1KK7 Y;  2GGM A;  1DF0 A;  4I5K A;  4MVF A;  2Y1M A;  1RWY A;  2WCB A;  1QXP A;  5AER A;  1QV1 A;  2BCX A;  1F4O A;  2L51 A;  1H4B A;  3VRR A;  1Y1U A;  4DCK A;  1J7R A;  3BUW B;  1REC A;  1CKK A;  1PK0 D;  1QLK A;  4YGA A;  2LUX A;  1UP5 A;  4TNC A;  1LIN A;  4MBE A;  4PHN A;  1KFX S;  1KFX L;  3KEV A;  1SPY A;  1B4C A;  3OB2 B;  2WOR A;  4CID A;  1RTP 1;  1S6J A;  3LL8 B;  5AEQ A;  3SIA A;  5HKZ A;  1CB1 A;  2LLS A;  1OZS A;  2V53 A;  2OTG C;  3JTD C;  1TN4 A;  3ZWH A;  2MLF C;  1IWQ A;  3EVU A;  1SW8 A;  1W7J B;  5G08 A;  1NCX A;  1N2D A;  4HRH A;  2KGB C;  1J55 A;  5DKQ A;  1XA5 A;  2F2P A;  5GQQ C;  2AUC A;  2HPS A;  2LE9 B;  1QTX A;  3WNX B;  2MJW B;  1OSA A;  2M29 A;  2KAX A;  1W7I B;  4USL A;  1QV0 A;  4C0L A;  2MLE C;  3A4U B;  3ICB A;  1J1E A;  1DJI A;  2K7B A;  1KQV A;  3QRX A;  1LXF C;  4YGB B;  1FBV A;  3I5I B;  5HLO A;  1XFV O;  4A4B A;  1XFW O;  2R2I A;  2BL0 B;  2MA2 A;  2NLN A;  1XFX O;  2WCE A;  1DJZ A;  1B7T Z;  2QPT A;  1KWO B;  2RGI A;  2BCB A;  4FQO A;  4GFT A;  3CTN A;  3SG6 A;  2KFH A;  1NWD A;  1KQM B;  3I5G B;  1L2O B;  2LVJ A;  3TDZ A;  3TS5 B;  2MAZ A;  2NZ0 A;  5CPV A;  1BMO A;  1CTR A;  1M45 A;  5HLV A;  2BEC A;  1JF2 A;  3O2P A;  1E8A A;  1OMD A;  3TUY B;  4NDB A;  2AMI A;  5CSJ A;  3D0Y B;  5IBW A;  3AKA A;  5B8I B;  5K89 A;  2CCM A;  2LHL A;  2JNX A;  2LC5 A;  4M2O A;  2DOQ A;  2K7O A;  1A03 A;  1R2U A;  3CWG A;  1V1F A;  2LMT A;  4CLN A;  2F33 A;  3O6B A;  3I5I C;  3FWC A;  2M7N A;  3VGO A;  2KI4 C;  1G33 A;  3BQ3 A;  1BOD A;  1Y6W A;  3M0W A;  2E30 A;  4ICB A;  2CT9 A;  1J7P A;  1TCO B;  2OS8 B;  3VRP A;  2LUC A;  1K94 A;  2B1U A;  2NCO A;  1AJ5 A;  2NCP A;  1BG1 A;  1BR1 B;  1NCY A;  2LVV A;  2BE6 A;  1ZAC A;  1DJH A;  2K7D A;  2I94 A;  1YRT B;  1L2O C;  2Q4U A;  4P2Y B;  1NX1 A;  4PE0 A;  3EKJ A;  4N1G A;  4OV2 A;  1TNP A;  1B47 A;  1YVL A;  5I2O A;  1F8H A;  3A8R A;  2LMU A;  4YGD B;  3CS1 A;  1FPW A;  2LP3 A;  1AVS A;  2KHN A;  1QIV A;  4DIR A;  1A75 B;  2KOT A;  2FOT A;  2K2A A;  2LHI A;  2ZRS A;  4YGE B;  1NX3 A;  2CBL A;  1SKT A;  2JUL A;  2Q91 A;  1BOC A;  2BBM A;  1BLQ A;  2JRF A;  2K2F A;  3IF7 A;  2M0R A;  1IRJ A;  2I7A A;  4QJ4 B;  1SY9 A;  1V1G A;  1JC2 A;  1KK8 B;  3D0Y A;  3PLF B;  3BUM B;  4MSP A;  5JOL A;  1TCF A;  1OZO A;  2LVK A;  4C0K A;  3JVT C;  3I5G C;  1ZFS A;  4JQ0 D;  4D1E A;  2L5X B;  1SL8 A;  3PAT A;  4GGF C;  1SK6 D;  1GQM A;  4NDD A;  1JF0 A;  2OPO A;  3JTD B;  3PM8 A;  1KFU S;  1SRA A;  4GUK A;  4NQG A;  1S26 D;  1YUU A;  3NSI A;  2KGR A;  3O4Y A;  2F3Y A;  5D7F A;  1YR5 A;  2JOJ A;  2KAY A;  1H8B A;  1CFC A;  5FYX A;  3DVJ A;  2KQY A;  3CR4 X;  2ISD A;  1XFY O;  1K95 A;  1B8L A;  1U5I A;  2KSP A;  5HKY A;  2KYC A;  1UUR A;  5ER4 X;  5AAN A;  1GGW A;  1JUO A;  4AQI A;  1KCY A;  1K9K A;  3GK2 A;  1TRF A;  2KAV A;  1QVI Z;  2HET A;  1TOP A;  3NXA A;  1AUI B;  1YUS A;  2KI6 D;  3BUX B;  2WCF A;  3GK1 A;  2L2E A;  2KYF A;  4YI8 A;  1MUX A;  2LVI A;  1SCV A;  2BCA A;  2TN4 A;  3BXK A;  4JWQ A;  2JT0 A;  3DF0 B;  1F54 A;  2L50 A;  4DRW A;  4PDZ A;  2JU0 A;  3OX6 A;  2NXQ A;  1YUR A;  3LCP C;  3H4S E;  1JBA A;  1FF1 A;  1EJ3 A;  3WHU B;  1XYD A;  1TTX A;  4GPL B;  2Y4Q A;  2WND A;  1UUS A;  1SBJ A;  2D8N A;  3LLE A;  3PN7 C;  2E6W A;  2JXL A;  5AXI A;  1ODB A;  2LLU A;  1A75 A;  1WLM A;  1WRL A;  3BOW A;  4PE1 A;  1CFF A;  1AJ4 A;  1XK4 A;  2H61 C;  4PHK A;  1S1E A;  2WC8 A;  2IS9 A;  1DJY A;  1IKU A;  1B9A A;  1BT6 A;  3EK8 A;  1PVB A;  3EVV A;  4M2Q A;  4MEW A;  1DJX A;  3PN7 B;  4GAO A;  1OMV A;  2CXJ A;  2KNE A;  2Y5I A;  4ZCV A;  1Y0V H;  2M9G A;  1IG5 A;  1N0Y A;  1C07 A;  4OR9 B;  1NCZ A;  2L4H A;  3DD4 A;  2F8P A;  2JQ6 A;  2F3Z A;  4MN0 A;  1K8U A;  3SG2 A;  1XK4 C;  1CNP A;  3F45 A;  1OOJ A;  2VRG A;  2BKI B;  4WQ2 A;  3FIA A;  1J1D A;  1EXR A;  1NIW A;  1KK7 Z;  1KSO A;  4XJK A;  2PMY A;  1EG4 A;  2KFG A;  2EGD A;  3VRN A;  1K9P A;  1DJW A;  1S6I A;  2SCP A;  4DS7 A;  3I5F B;  4N1F A;  2Y1N A;  3CLN A;  3RLZ A;  4C0J A;  1D1O A;  1QX2 A;  1Y1X A;  3NSL A;  1SR6 C;  1PRW A;  1S36 A;  1DGU A;  2KFF A;  4N5X A;  4F0Z B;  1WLZ A;  1R6P A;  1XFZ O;  2CTN A;  2JT3 A;  2KDH A;  4MLW A;  5KTY A;  2M49 B;  3WHT B;  3EVR A;  3DF0 A;  1PUL A;  1CM1 A;  1IGV A;  2G2B A;  2SAS A;  1QJT A;  2I18 A;  2ZN8 A;  3PSR A;  3AKB A;  1K96 A;  1CFP A;  2ZNE A;  1MQ1 A;  1YUT A;  2LAP A;  1F4Q A;  2JZI A;  4P5O E;  1CDM A;  1CDP A;  5DKR A;  1MHO A;  4PE4 A;  4MZK A;  4OKH A;  3TDU A;  1DMO A;  1DJG A;  1CMF A;  3CGA A;  3PAL A;  1CDL A;  1S6C A;  1KQM C;  2ZFD A;  2LMV A;  1JFJ A;  1MF8 B;  2GV5 A;  1PVA A;  3C1V A;  4IL1 A;  5CSI A;  4ETO A;  4L9M A;  1CDN A;  2PAS A;  4R1E A;  1FI5 A;  1QX7 A;  4YRU A;  3BYA A;  5I2L A;  5DKN A;  2LAN A;  2WOS A;  2JT8 A;  3HCM A;  1LA3 A;  4I5L B;  1QVI Y;  3MSE B;  1BF5 A;  2BL0 C;  4ORC B;  4PAL A;  3FWB A;  4PE7 A;  2BKH B;  1F55 A;  1F70 A;  1JWD A;  1CFD A;  4AQJ A;  1PAL A;  1TIZ A;  4HSZ A;  1AHR A;  1UHK A;  4PCW A;  1PSR A;  1RK9 A;  4QJ3 B;  4CPV A;  2JTT A;  1EL4 A;  2ZKM X;  3CR5 X;  1LA0 A;  1ALW A;  3VRO A;  1SMG A;  1SL9 A;  2KBI A;  1DTL A;  1CLB A;  1L7Z A;  4YBH B;  3TS5 C;  1NP8 A;  1KK8 C;  3DVK A;  3SG3 A;  3TDI A;  4MZJ A;  3KF9 A;  1B7T Y;  1MR8 A;  1CLL A;  1K93 D;  4ORA B;  4JPZ B;  4XYN A;  1JFK A;  1G4Y R;  3DVM A;  1YRU B;  1YVH A;  4GBA A;  4BY5 A;  3OHM B;  4OVN F;  5J3X A;  2JNF A;  1PSB A;  1K2H A;  1QS7 A;  3OP0 A;  1DT7 B;  3KO0 A;  2F2O A;  1IH0 A;  1WRK A;  1NX2 A;  1ZUZ A;  1FW4 A;  1TNQ A;  4MRX A;  4QJ5 B;  2LM5 A;  1UHJ A;  2I2R E;  2L98 A;  1G8I A;  3NSO A;  1IQ5 A;  5ER5 A;  4WQ3 A;  2CNP A;  2AAO A;  3VRQ A;  2HF5 A;  3ZNI A;  1B8C A;  1CLM A;  2PAL A;  1SCM C;  1WY9 A;  3JVT B;  3HX4 A;  1KWO C;  1OMR A;  1XO5 A;  2HQ8 A;  1UHI A;  1WDC B;  2JXC A;  2ZN9 A;  2FJU B;  1SR6 B;  3IQO A;  1DGV A;  4MZL A;  5HYD A;  2A4J A;  2L0P A;  2JC2 A;  3FS7 A;  1NYA A;  2OS8 C;  1TNW A;  1HQV A;  1GJY A;  2HQW A;  2PSR A;  1HT9 A;  1QAT A;  2LCP A;  2M97 A;  1IJ5 A;  1X02 A;  2JPT A;  5AFP A;  1XFU O;  2M8U A;  4GGF A;  1B8R A;  1FI6 A;  1F71 A;  1IJ6 A;  2EC6 C;  3I5F C;  3SJS A;  4ZCU A;  3SG7 A;  1RRO A;  3TZ1 A;  2KBM A;  4BY4 A;  3AAJ A;  4PHM A;  2K7C A;  1ZMZ A;  2JWW A;  3CZT X;  4UPG A;  1S3P A;  1QLS A;  2FCE A;  4CFR A;  1K9U A;  5HKW A;  3GK4 X;  4CFQ A;  4GGN A;  4PHJ A;  1C7V A;  2EC6 B;  1J7Q A;  1VRK A;  4M2P A;  2H2K A;  1SYM A;  1UWO A;  3KHE A;  4WRI A;  4AOM A;  1J7O A;  2MBX A;  2H61 A;  1C7W A;  3CR2 A;  1CMG A;  1OQP A;  3EK4 A;  4HRE E;  1MXL C;  1ZOT B;  4GNK B;  1UHH A;  5KU1 A;  1Y1A A;  1AP4 A;  1Q80 A;  2O60 A;  5I8N A;  1KFU L;  3BUO B;  1K90 D;  1CM4 A;  1LVC D;  2MRD A;  1M63 B;  3AAK A;  2O5G A;  1U5I B;  4HRG A;  1XVJ A;  2FCD A;  2QAC A;  4I5N B;  3E3R A;  3KPX A;  2LLT A;  2BE4 A;  2JTZ A;  3EK7 A;  1S5G Z;  2LP2 A;  1GGZ A;  1A2X A;  1BJF A;  2ZND A;  1M39 A;  2KQ6 A;  1M31 A;  1WRZ A;  3O78 A;  1QAS A;  4E68 A;  4YI9 A;  4FTG A;  3LK1 A;  5F6T A;  1S5G Y;  1OE9 B;  1YTZ C;  2P6B B;  1WDC C;  3I5H C;  1MWN A;  2OTG B;  3LK0 A;  5CSF A;  1RFJ A;  1QIW A;  2G9B A;  3RM1 A;  3OB1 B;  1MXE A;  2K8M B;  2M1U A;  3SG5 A;  1LKJ A;  1SNL A;  2K61 A;  3SG4 A;  1JSA A;  1UHN A;  2LNK A;  1ALV A;  1RJV A;  4DUQ A;  1NX0 A;  3I5H B;  1TNX A;  1EG3 A;  2K0J A;  2L4I A;  1NPQ A;  4NDC A;  2M3W A;  5TNC A;  2PVB A;  1IQ3 A;  2KI6 C;  2LV7 A;  1NUB A;  1SL7 A;  4I5J A;  5I2Q A;  5D69 A;  3TUY C;  3NSK A;  1BU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...