2BBNA

Solution structure of a calmodulin-target peptide complex by multidimensional nmr
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
148
structure length
148
Chain Sequence
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of a calmodulin-target peptide complex by multidimensional NMR.
pubmed rcsb
source organism Drosophila melanogaster
molecule tags Calcium-binding protein
molecule keywords CALMODULIN
total genus 32
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 1992-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2bbnA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2bbnA02
1B47A 1XVJA 3LK0A 2MAZA 3CWGA 3EKJA 3PATA 1GGWA 1PALA 3I5GB 3BYAA 4GNKB 3DVMA 1JUOA 1UHKA 1YRTB 4ETOA 2BBNA 1F8HA 2LLSA 1SYMA 1DF0A 1TNXA 3IQOA 2LHIA 3TZ1A 2ZN9A 3GK1A 1QXPA 2WNDA 1DJZA 4WQ3A 2ISDA 1WRKA 1S6CA 3NSOA 5J3XA 5DKNA 1M45A 1OMVA 4MRXA 5F6TA 3DVKA 2KI6D 3OHMB 1BR4B 1TCOB 4MSPA 4QJ3B 5DKRA 2JTZA 4IL1A 5IBWA 1IGVA 1K2HA 1SMGA 2KGBC 2JT3A 1YURA 4QJ5B 2R2IA 2JOJA 2LP3A 3K21A 4MLWA 4CLNA 1OMDA 2PALA 2JWWA 2CNPA 3GK2A 1FPWA 3JTDC 3NSKA 2FOTA 4PDZA 5CSNA 1S3PA 2HF5A 1K90D 4M2QA 1QVIZ 3VGOA 1KK8B 1JFJA 4GBAA 1F55A 1XK4A 1V1FA 2F8PA 1A03A 2L0PA 3O78A 1DF0B 1L2OB 1UHHA 3WXAA 2HPSA 4I5JA 2NZ0A 2OS8B 1YX7A 1KFUL 1OQPA 1OSAA 1CDMA 3I5FC 1NP8A 1PK0D 3CS1A 1KK7Z 2FJUB 2MRDA 1S6IA 3LLEA 1NIWA 1YUTA 2SCPA 1TNPA 4F0ZB 4JPZB 4U8DA 2LP2A 5HYDA 3SG6A 1CM4A 1LXFC 3I5HC 3KHEA 4MRYA 3TUYB 1SL7A 2AAOA 3VRPA 1FW4A 2PRUA 1CNPA 2LMVA 4C0LA 2O60A 1B7TY 4I5KA 2KI6C 2AMIA 1AK8A 1R2UA 1KSMA 1S26D 1ALWA 2SASA 3H4SE 3OX6A 3WHTB 2Q4UA 2GGMA 1DJYA 5KTYA 3PALA 4C0KA 1KQMB 1OOJA 3D0YB 1DJWA 1MHOA 3SG2A 4PE0A 1IG5A 2ZRSA 1QLKA 2M8UA 5JOLA 1MXLC 2ZRTA 1DJXA 1SRAA 2E6WA 3CR5X 1XFVO 1QLSA 3TS5C 1LVCD 4GAOA 5PALA 3CR2A 1CFPA 2K0JA 1L2OC 1MWNA 2EC6B 3WNXB 5AERA 2M7NA 1U5IA 1W7IB 1BOCA 2LC5A 1BMOA 3O6BA 4N1GA 4NQGA 1LINA 1CTRA 2LHLA 1YX8A 2MLFC 1J7PA 1HQVA 1UP5A 1SKTA 1ZFSA 2WCBA 1LA0A 1KQVA 2ZN8A 1EXRA 1NPQA 2KHNA 2LLTA 5DKQA 2LAPA 2OTGB 3AAKA 5KU1A 1JC2A 1NX2A 5AANA 1PSBA 2F3YA 3FWCA 1J7RA 3I5HB 5B8IB 1WDCB 3BUOB 3D0YA 2H61C 4M2OA 1TNQA 4P2YB 2KBMA 5D7FA 4ORBB 5AFPA 2LUCA 3KPXA 3SG7A 2RGIA 3F45A 2JXLA 2WORA 3QRXA 4PE1A 1NUBA 4N5XA 1CFDA 5I2LA 4PHMA 3SG4A 3JVTB 2M1UA 1TOPA 5K89A 1MF8B 2B1UA 1N2DA 4HRGA 4TNCA 2LM5A 1SL8A 1YVLA 2M29A 2BCBA 2M97A 2MHHA 2K2FA 2H2KA 2LVKA 1SBJA 1LKJA 2HQWA 1EH2A 3SG3A 1B8RA 3AKBA 3CR4X 1J1DA 1JBAA 1F4QA 1ZACA 4P5OE 2MJWB 2LVVA 2K7BA 3VRRA 3A8RA 1KFXS 4AQJA 1B7TZ 4HSZA 4BY4A 5D69A 2FCDA 1XYDA 2WCFA 1OE9B 1M39A 4ORCB 3PM8A 5I2QA 2ZFDA 4CFRA 1NCZA 1YR5A 2Y4QA 1WLMA 1Y1UA 2LLUA 2TN4A 5HLOA 2KYFA 3KEVA 3PLFB 2KI4C 1RWYA 2M0RA 1RJVA 2BL0C 2WC8A 4DRWA 4I5LB 1F71A 1WRLA 1SW8A 1TIZA 3EK7A 1AVSA 1GJYA 3BQ3A 1UHJA 2BE4A 4NDBA 2ZNEA 1XFZO 1J7OA 1EL4A 1X02A 4ORAB 2JQ6A 1OMRA 1RFJA 1TRFA 2ZKMX 2KAXA 2KGRA 3AAJA 1J1EA 1K93D 1CMGA 1XFUO 4FTGA 1G33A 4OV2A 3BOWA 3EK4A 4MVFA 3MSEB 2BKHB 3NXAA 4WRIA 3GK4X 4YGCB 3SIAA 1SY9A 3DF0B 1NCYA 1EJ3A 1EG3A 4XYNA 1G4YR 1B8CA 2F3ZA 4MZJA 2LVJA 1ODBA 3DVEA 3HX4A 2KQ6A 4ZCUA 1KWOC 5HKYA 1OZSA 3BUNB 1ALVA 1YRUB 1PRWA 1SCMC 1OZOA 1CMFA 1UURA 5CPVA 4MZLA 2AUCA 4YI9A 2JNXA 2KFHA 1E8AA 2L98A 2CTNA 5GQQC 1ZOTB 1QX2A 1K96A 3BUWB 2JNFA 1K9KA 4NDCA 3ZNIA 1GGZA 1EG4A 2KDHA 2F2PA 1KK7Y 1RK9A 4PHNA 1BT6A 4JQ0D 1NSHA 1QS7A 1K9UA 1CLBA 3I5IC 1WLZA 3D10A 1JF0A 2LMUA 2Y5IA 4GFTA 4YGBB 4MEWA 2KNEA 3TDZA 3BOWB 5BPJA 1S1EA 1F4OA 2PVBA 1IWQA 2KAVA 2LE9B 1JWDA 3ZWHA 3O4YA 1R6PA 2O5GA 4YBHB 2WCEA 1BLQA 3SIBA 5KSZA 4CPVA 4C0JA 1DMOA 2BBMA 2A4JA 4GGFA 1Y1XA 1QTXA 2FCEA 1BJFA 3I5FB 2K2AA 1JFKA 4ICBA 3I5GC 1TN4A 1J55A 4DUQA 1K95A 4AOMA 1NX3A 1KCYA 3EK8A 1CDPA 3DVJA 1KFXL 4GGNA 3OB1B 1IRJA 1K9PA 1XK4C 1A75B 4OKHA 1XA5A 1CFCA 2M7LA 4PE4A 1NX1A 2L51A 1SPYA 1QATA 2H61A 1CKKA 1CDLA 2KFFA 2K8MB 4YRUA 2JULA 3ICBA 3GOFA 5TNCA 1VRKA 3PN7B 1MQ1A 2M49B 2JXCA 1RECA 4DS7A 1N0YA 2Y1MA 4Q04A 1SK6D 3WHUB 3PSRA 2QPTA 1UHIA 2MLEC 2QACA 1M63B 3LK1A 2EHBA 1DT7B 1CLLA 2NLNA 1BU3A 3CLNA 1UHNA 3O2PA 2M3WA 2DOQA 2OS8C 3CTNA 2JRFA 2G9BA 4OVNF 1DVIA 1SR6C 1KK8C 3BXKA 4L9MA 1TCFA 2JZIA 1BG1A 2OTGC 2OPOA 4DCKA 2MA2A 2JT8A 3BUMB 2Y1NA 1FI6A 2NXQA 4PE7A 1DJGA 1IJ5A 4I5NB 1WDCC 1M31A 4YGDB 2K61A 1S36A 2I94A 1AJ4A 3KF9A 4PHJA 1GQMA 1HT9A 4ZCVA 3VRNA 2LUXA 4DIRA 1AP4A 2ZNDA 3LCPC 3NSLA 3VRQA 2PASA 2GGZA 3HCMA 1QV0A 1RROA 2BCXA 1JSAA 5I2OA 4USLA 1PVBA 1S6JA 1DJIA 2NCPA 4HREE 2KYCA 2WOSA 1XO5A 1SCVA 1IQ3A 1QVIY 1NWDA 1H8BA 1C7WA 4XJKB 1SNLA 2E30A 1NX0A 3LL8B 4NDDA 2MBXA 2COLB 3SJSA 1B9AA 4QJ4B 4CFQA 1QIVA 3NSIA 3RM1A 5AXIA 2LNKA 4D1EA 3TUYC 2F2OA 1MUXA 3PFVA 2M1KB 3A4UB 3DF0A 2K7DA 2P6BB 1CDNA 2K7OA 1BF5A 1YUSA 1FF1A 3TS5B 3EKHA 1F70A 4BY5A 1KWOB 4OCIA 2D8NA 1A4PA 2PMYA 3KO0A 2BE6A 4GGFC 1WY9A 1L7ZA 1A29A 1B8LA 1NCXA 2F33A 4GUKA 1BR1B 2L2EA 1KQMC 4OR9B 3C1VA 4CIDA 2JT0A 2KOTA 1C7VA 1TNWA 4XJKA 1KFUS 2BKIB 2KQYA 3IF7A 2KFGA 1W7JB 2KAYA 3CGAA 2CXJA 2LVIA 2PSRA 1FI5A 2CBLA 2L4HA 3I5IB 1YVHA 1PULA 3EVVA 2EC6C 3E3RA 3EVRA 5AEQA 1WRZA 5FYXA 1D1OA 4UPGA 1IH0A 1AHRA 1JF2A 1SL9A 1ZUZA 2KI4B 3FS7A 2NCOA 2M9GA 5HKWA 4AQIA 3FIAA 5G08A 1QV1A 4GPLB 2BCAA 4HRHA 2IS9A 1S5GZ 1PVAA 4PCWA 1QX7A 3JTDB 4M2PA 2CT9A 5CSFA 1SR6B 1A2XA 2KBIA 4N1FA 5JJGA 1BODA 1XFYO 4A4CA 4MN0A 3M0WA 4JWQA 1B1GA 4YGAA 2LANA 1Q80A 2I18A 1AJ5A 2I2RE 4MBEA 1XFXO 1XFWO 1A75A 1IQ5A 3OB2B 1YUUA 1V1GA 4R1EA 1YTZC 1CLMA 2L4IA 1DTLA 2G2BA 3OP0A 2EGDA 1N65A 5HLVA 1FBVA 1ZMZA 3RLZA 1K8UA 1F54A 2LV7A 1LA3A 1J7QA 1PSRA 1QIWA 1QASA 2HQ8A 3AKAA 1B4CA 2JPTA 2CCMA 3BUXB 4FQOA 1KSOA 5ER4X 1CFFA 5CSIA 1U5IB 2V53A 3IQQA 1RTP1 5ER5A 1MR8A 1TTXA 4PALA 2L50A 3EVUA 1QX5B 2BECA 1SCMB 2JC2A 3DD4A 1NYAA 1DGUA 2VRGA 1UUSA 4YGEB 2BL0B 2GV5A 2JTTA 4MZKA 4WQ2A 3TDIA 1DGVA 2KSPA 1IJ6A 5CSJA 3TDUA 3CZTX 1S5GY 3SG5A 1Y6WA 4YI8A 2LCPA 1AUIB 4E68A 3OX5A 1UWOA 2K7CA 2LMTA 2Q91A 1Y1AA 3VROA 1M46A 3PN7C 1H4BA 2L5XB 2HETA 5I8NA 1IKUA 1DJHA 5HKZA 1MXEA 1Y0VH 4A4BA 4PHKA 2JU0A 1G8IA 1K94A 1CB1A 1QJTA 2I7AA 1C07A 1CM1A 3JVTC 3FWBA
chains in the Genus database with same CATH superfamily
1B47A 1XVJA 3LK0A 2MAZA 3CWGA 3EKJA 3PATA 1GGWA 1PALA 3I5GB 1DQEA 1LS8A 3BYAA 3BFBA 4GNKB 3DVMA 1JUOA 1UHKA 1YRTB 5I94A 4ETOA 2BBNA 1F8HA 2LLSA 1SYMA 3B7AA 1DF0A 1TNXA 3IQOA 2LHIA 3TZ1A 2ZN9A 3GK1A 1GM0A 1QXPA 3UNWA 2WNDA 1DJZA 4WQ3A 2ISDA 1WRKA 1S6CA 2L2CA 3NSOA 3NHIA 3FE8A 5J3XA 5DKNA 1TUJA 1M45A 1OMVA 4MRXA 5F6TA 3DVKA 2KI6D 3OHMB 1BR4B 1TCOB 4MSPA 4QJ3B 5DKRA 2QEHA 2JTZA 4IL1A 5IBWA 1IGVA 1K2HA 1SMGA 2KGBC 2JT3A 1YURA 4QJ5B 2R2IA 2JOJA 2LP3A 3K21A 4MLWA 4CLNA 1OMDA 2PALA 2JWWA 3D73A 2CNPA 3GK2A 3RZSA 3B86A 3JTDC 3NSKA 3S0EA 2FOTA 1FPWA 4PDZA 5CSNA 1S3PA 2HF5A 1K90D 4M2QA 1QVIZ 3VGOA 1KK8B 1JFJA 4GBAA 1F55A 1XK4A 1V1FA 2BNXA 2F8PA 1A03A 2L0PA 3O78A 1DF0B 1L2OB 1UHHA 3SS5A 3WXAA 2HPSA 3FE6A 2NZ0A 4I5JA 2OS8B 1DEKA 1YX7A 1KFUL 1OQPA 1OSAA 1CDMA 3I5FC 1NP8A 1PK0D 3CS1A 1KK7Z 2FJUB 2MRDA 1S6IA 3LLEA 1NIWA 3R1PA 1YUTA 2SCPA 5D3OA 4PT1A 1TNPA 4F0ZB 2QDIA 4JPZB 4U8DA 2LP2A 5HYDA 3SG6A 1CM4A 1LXFC 3I5HC 3KHEA 4MRYA 3TUYB 1SL7A 2AAOA 3VRPA 1FW4A 2PRUA 3CDNA 1CNPA 2LMVA 2PYQA 4C0LA 2O60A 1B7TY 4I5KA 3K1EA 2KI6C 2AMIA 1AK8A 1R2UA 1KSMA 1S26D 1ALWA 2SASA 3H4SE 3OX6A 3WHTB 2Q4UA 2GGMA 3L4LA 1OW4A 3NHTA 2P70A 5FI6A 2H8VA 1DJYA 3Q8IA 5KTYA 3PALA 4C0KA 1KQMB 1OOJA 3D0YB 1DJWA 1MHOA 3SG2A 4PE0A 1IG5A 2ZRSA 1QLKA 2M8UA 5JOLA 1MXLC 2ZRTA 1DJXA 1SRAA 2E6WA 3CR5X 2K60A 1XFVO 1QLSA 3TS5C 3D74A 1LVCD 4GAOA 5PALA 3CR2A 1CFPA 2K0JA 1L2OC 2EC6B 1MWNA 3WNXB 5AERA 2M7NA 1U5IA 1W7IB 1BOCA 2LC5A 1BMOA 3DY9A 3O6BA 4OZDA 4N1GA 4NQGA 1LINA 1CTRA 2LHLA 1YX8A 2MLFC 1J7PA 1HQVA 1UP5A 1SKTA 2WCJA 1ZFSA 2WCBA 1LA0A 1KQVA 2ZN8A 3UO9A 1EXRA 1NPQA 2KHNA 2LLTA 5DKQA 2LAPA 2OTGB 3AAKA 5KU1A 1JC2A 1NX2A 5AANA 1PSBA 2F3YA 3FWCA 1J7RA 3I5HB 5B8IB 1WDCB 2WCLA 3BUOB 3D0YA 2H61C 4M2OA 1TNQA 4P2YB 2KBMA 5D7FA 4ORBB 5AFPA 2LUCA 3KPXA 3SG7A 2RGIA 3F45A 2JXLA 2WORA 3L47A 3QRXA 4PE1A 1NUBA 4N5XA 1CFDA 5I2LA 4PHMA 3SG4A 3JVTB 2M1UA 1TOPA 5K89A 1MF8B 2B1UA 1N2DA 4HRGA 4TNCA 2LM5A 1SL8A 1YVLA 2M29A 2BCBA 2M97A 2MHHA 2K2FA 1C3YA 2H2KA 2LVKA 1SBJA 1LKJA 2HQWA 1EH2A 3SG3A 1B8RA 3AKBA 3CR4X 1J1DA 1JBAA 1F4QA 1ZACA 4P5OE 2MJWB 2LVVA 2K7BA 3VRRA 3A8RA 1KFXS 4AQJA 3SS3A 3PM2A 1B7TZ 2PQLA 2JPOA 3PJIA 4HSZA 4BY4A 5D69A 3S0BA 2FCDA 1XYDA 2WCFA 1OE9B 1M39A 4ORCB 3PM8A 5I2QA 2ZFDA 4CFRA 1NCZA 1YR5A 2Y4QA 1WLMA 1Y1UA 2LLUA 2TN4A 5HLOA 2KYFA 3KEVA 3PLFB 2KI4C 1RWYA 2M0RA 2BAPA 2BL0C 1OOFA 1RJVA 2WC8A 1W9ZA 4DRWA 4I5LB 1F71A 1WRLA 1SW8A 1TIZA 3EK7A 1AVSA 1GJYA 3BQ3A 1UHJA 2BE4A 4NDBA 2ZNEA 1XFZO 5FI2A 1J7OA 1EL4A 1X02A 3CZ1A 3DZTA 4ORAB 2JQ6A 1OMRA 1OOHA 1RFJA 1TRFA 2ZKMX 2KAXA 2KGRA 3AAJA 1J1EA 1K93D 1CMGA 1XFUO 2WCMA 1Z4HA 4FTGA 1G33A 1DC1A 4OV2A 3BOWA 3EK4A 4MVFA 3MSEB 2BKHB 3NXAA 3BJHA 4WRIA 3GK4X 4YGCB 3SIAA 1SY9A 3DF0B 1NCYA 1EJ3A 1EG3A 4XYNA 1G4YR 1B8CA 2F3ZA 4MZJA 2LVJA 1ODBA 3DVEA 3HX4A 2KQ6A 4ZCUA 1KWOC 5HKYA 1OZSA 3BUNB 1ALVA 1YRUB 1PRWA 1SCMC 1OZOA 1CMFA 1UURA 5CPVA 4MZLA 2AUCA 4YI9A 2JNXA 2KFHA 1E8AA 2L98A 2CTNA 1XFRA 3R1OA 5GQQC 1ZOTB 1QX2A 1K96A 3BUWB 3FE9A 2JNFA 1K9KA 4NDCA 3ZNIA 1GGZA 1EG4A 2KDHA 3B6XA 2F2PA 1KK7Y 1RK9A 4PHNA 1BT6A 4JQ0D 1NSHA 1QS7A 1K9UA 1CLBA 3I5IC 1WLZA 3D10A 1JF0A 2LMUA 2Y5IA 4GFTA 4YGBB 4MEWA 2KNEA 3TDZA 3BOWB 5BPJA 1S1EA 2ERBA 1F4OA 2PVBA 1IWQA 2KAVA 4IJ7A 2LE9B 1JWDA 3ZWHA 3O4YA 1R6PA 2O5GA 4YBHB 2WCEA 1BLQA 3SIBA 5KSZA 4CPVA 4INWA 4C0JA 1DMOA 2BBMA 2A4JA 4GGFA 3S0DA 1Y1XA 1QTXA 2FCEA 3D78A 1BJFA 1SSEB 3I5FB 2K2AA 1JFKA 1C3ZA 4ICBA 3I5GC 1TN4A 1J55A 4DUQA 1K95A 4AOMA 1NX3A 1KCYA 3EK8A 1CDPA 3DVJA 1KFXL 4GGNA 3OB1B 1IRJA 1K9PA 1XK4C 1A75B 4OKHA 1XA5A 1CFCA 2YGUA 2M7LA 4PE4A 1NX1A 2L51A 1SPYA 1QATA 1DELA 3S0FA 2H61A 1CKKA 1CDLA 2KFFA 2K8MB 3OGNA 4YRUA 1TWOA 4KYNA 3R1VA 2JULA 2KPHA 3ICBA 3EG5B 3GOFA 3S0AA 3CABA 5TNCA 3O4XA 2P71A 3CZ0A 1VRKA 3PN7B 1MQ1A 2M49B 2JXCA 1RECA 4DS7A 1N0YA 2Y1MA 4Q04A 1SK6D 3WHUB 3PSRA 2QPTA 1UHIA 2MLEC 2QACA 1M63B 3LK1A 2EHBA 1DT7B 1CLLA 2NLNA 3VB1A 1BU3A 3CLNA 1UHNA 3O2PA 3B88A 2M3WA 2DOQA 2OS8C 3CTNA 2JRFA 2G9BA 4OVNF 1DVIA 1SR6C 1KK8C 3BXKA 4L9MA 1TCFA 2JZIA 1BG1A 2OTGC 2OPOA 4DCKA 2MA2A 2JT8A 3BUMB 2Y1NA 1FI6A 2NXQA 4PE7A 1DJGA 1IJ5A 4I5NB 1WDCC 1M31A 2KLEA 2K61A 4YGDB 1S36A 2I94A 1AJ4A 3KF9A 4PHJA 1GQMA 1HT9A 4ZCVA 3VRNA 2LUXA 4DIRA 1AP4A 2ZNDA 3LCPC 3NSLA 3VRQA 2PASA 2GGZA 3D75A 3HCMA 1QV0A 1RROA 2BCXA 1JSAA 5I2OA 4USLA 1PVBA 3NGVA 1S6JA 1DJIA 2NCPA 4HREE 4JD9A 5FI7A 2KYCA 2WOSA 1XO5A 1SCVA 1IQ3A 1QVIY 1NWDA 2KLDA 1H8BA 1C7WA 4XJKB 1SNLA 2E30A 1NX0A 3LL8B 4NDDA 2MBXA 2COLB 3SJSA 1B9AA 4QJ4B 4CFQA 1QIVA 3NSIA 3RM1A 5AXIA 2LNKA 3DYEA 4D1EA 3TUYC 2F2OA 1MUXA 3PFVA 3D77A 2M1KB 3A4UB 3DF0A 2K7DA 2P6BB 1IIOA 1CDNA 2K7OA 1BF5A 1YUSA 3B87A 1FF1A 5DICA 3TS5B 2QEVA 3EKHA 2QEBA 4JKTA 1F70A 4BY5A 1KWOB 1TUZA 4OCIA 4F7FA 2D8NA 1A4PA 2PMYA 3KO0A 2BE6A 4GGFC 1WY9A 1L7ZA 1A29A 1B8LA 1NCXA 2F33A 4GUKA 1BR1B 1OOGA 2L2EA 1KQMC 4OR9B 3C1VA 4CIDA 2JT0A 2KOTA 1C7VA 1ORGA 1TNWA 4XJKA 1KFUS 2BKIB 2KQYA 3IF7A 2KFGA 1P28A 1W7JB 2KAYA 3CGAA 1Z2CB 2CXJA 3L4AA 2LVIA 2PSRA 1FI5A 2CBLA 2L4HA 3I5IB 5HL1A 3OBVA 1YVHA 1PULA 2QEOA 3BFHA 3EVVA 2EC6C 3E3RA 3EVRA 5AEQA 3SS4A 1WRZA 3CYZA 5FYXA 1D1OA 4UPGA 1IH0A 1AHRA 1JF2A 3BFAA 1SL9A 1ZUZA 2KI4B 3FS7A 2NCOA 2M9GA 5HKWA 4AQIA 3FIAA 3S0GA 5G08A 1QV1A 4GPLB 3V2LA 2BCAA 4HRHA 4FQTA 2IS9A 1S5GZ 1PVAA 4PCWA 2WCKA 1QX7A 3JTDB 4M2PA 2CT9A 5CSFA 1SR6B 1A2XA 2KBIA 4N1FA 5JJGA 1BODA 1XFYO 4A4CA 4MN0A 3M0WA 1QWVA 2FJYA 4JWQA 4YGAA 1B1GA 2LANA 1Q80A 2I18A 1AJ5A 2I2RE 3IVTA 1XFXO 4MBEA 1XFWO 1A75A 1IQ5A 3OB2B 1YUUA 1OOIX 1V1GA 4R1EA 1YTZC 5EL2A 1CLMA 2L5YA 2WC5A 2L4IA 2GTEA 1DTLA 2G2BA 3CZ2A 3OP0A 2EGDA 1N65A 5HLVA 1FBVA 1ZMZA 3RLZA 1K8UA 1F54A 2LV7A 1LA3A 1J7QA 1T14A 1PSRA 1QIWA 1QASA 2HQ8A 2WCHA 3AKAA 1B4CA 2JPTA 2CCMA 3BUXB 3N7HA 4FQOA 1KSOA 5ER4X 1CFFA 5CSIA 1U5IB 2V53A 3IQQA 1RTP1 5ER5A 1MR8A 1TTXA 4PALA 3R72A 2L50A 3EVUA 1QX5B 2BECA 1SCMB 2JC2A 3DD4A 1NYAA 1DGUA 2VRGA 1UUSA 4INXA 4YGEB 2BL0B 2GV5A 2JTTA 4MZKA 4WQ2A 3TDIA 1DGVA 2KSPA 1IJ6A 5CSJA 3TDUA 3CZTX 1S5GY 3QMEA 3SG5A 1Y6WA 4YI8A 2LCPA 1AUIB 4E68A 3OX5A 1UWOA 2K7CA 2LMTA 2Q91A 1Y1AA 3VROA 1M46A 3PN7C 1H4BA 2L5XB 2HETA 5I8NA 1IKUA 1DJHA 5HKZA 1MXEA 1Y0VH 3DXLA 4PHKA 4A4BA 2JU0A 3D76A 1G8IA 1K94A 2WC6A 1CB1A 1QJTA 2I7AA 1C07A 1CM1A 3JVTC 3FWBA
chains in the Genus database with same CATH topology
1B47A 1XVJA 3LK0A 2MAZA 3CWGA 3EKJA 3PATA 1GGWA 1PALA 3I5GB 3BYAA 4GNKB 3DVMA 1JUOA 1UHKA 1YRTB 4ETOA 2BBNA 1F8HA 2LLSA 1SYMA 1DF0A 1TNXA 3IQOA 2LHIA 3TZ1A 2ZN9A 3GK1A 1QXPA 2WNDA 1DJZA 4WQ3A 2ISDA 1WRKA 1S6CA 3NSOA 5J3XA 5DKNA 1M45A 1OMVA 4MRXA 5F6TA 3DVKA 2KI6D 3OHMB 1BR4B 1TCOB 4MSPA 4QJ3B 5DKRA 2JTZA 4IL1A 5IBWA 1IGVA 1K2HA 1SMGA 2KGBC 2JT3A 1YURA 4QJ5B 2R2IA 2JOJA 2LP3A 3K21A 4MLWA 4CLNA 1OMDA 2PALA 2JWWA 2CNPA 3GK2A 1FPWA 3JTDC 3NSKA 2FOTA 4PDZA 5CSNA 1S3PA 2HF5A 1K90D 4M2QA 1QVIZ 3VGOA 1KK8B 1JFJA 4GBAA 1F55A 1XK4A 1V1FA 2F8PA 1A03A 2L0PA 3O78A 1DF0B 1L2OB 1UHHA 3WXAA 2HPSA 4I5JA 2NZ0A 2OS8B 1YX7A 1KFUL 1OQPA 1OSAA 1CDMA 3I5FC 1NP8A 1PK0D 3CS1A 1KK7Z 2FJUB 2MRDA 1S6IA 3LLEA 1NIWA 1YUTA 2SCPA 1TNPA 4F0ZB 4JPZB 4U8DA 2LP2A 5HYDA 3SG6A 1CM4A 1LXFC 3I5HC 3KHEA 4MRYA 3TUYB 1SL7A 2AAOA 3VRPA 1FW4A 2PRUA 1CNPA 2LMVA 4C0LA 2O60A 1B7TY 4I5KA 2KI6C 2AMIA 1AK8A 1R2UA 1KSMA 1S26D 1ALWA 2SASA 3H4SE 3OX6A 3WHTB 2Q4UA 2GGMA 1DJYA 5KTYA 3PALA 4C0KA 1KQMB 1OOJA 3D0YB 1DJWA 1MHOA 3SG2A 4PE0A 1IG5A 2ZRSA 1QLKA 2M8UA 5JOLA 1MXLC 2ZRTA 1DJXA 1SRAA 2E6WA 3CR5X 1XFVO 1QLSA 3TS5C 1LVCD 4GAOA 5PALA 3CR2A 1CFPA 2K0JA 1L2OC 1MWNA 2EC6B 3WNXB 5AERA 2M7NA 1U5IA 1W7IB 1BOCA 2LC5A 1BMOA 3O6BA 4N1GA 4NQGA 1LINA 1CTRA 2LHLA 1YX8A 2MLFC 1J7PA 1HQVA 1UP5A 1SKTA 1ZFSA 2WCBA 1LA0A 1KQVA 2ZN8A 1EXRA 1NPQA 2KHNA 2LLTA 5DKQA 2LAPA 2OTGB 3AAKA 5KU1A 1JC2A 1NX2A 5AANA 1PSBA 2F3YA 3FWCA 1J7RA 3I5HB 5B8IB 1WDCB 3BUOB 3D0YA 2H61C 4M2OA 1TNQA 4P2YB 2KBMA 5D7FA 4ORBB 5AFPA 2LUCA 3KPXA 3SG7A 2RGIA 3F45A 2JXLA 2WORA 3QRXA 4PE1A 1NUBA 4N5XA 1CFDA 5I2LA 4PHMA 3SG4A 3JVTB 2M1UA 1TOPA 5K89A 1MF8B 2B1UA 1N2DA 4HRGA 4TNCA 2LM5A 1SL8A 1YVLA 2M29A 2BCBA 2M97A 2MHHA 2K2FA 2H2KA 2LVKA 1SBJA 1LKJA 2HQWA 1EH2A 3SG3A 1B8RA 3AKBA 3CR4X 1J1DA 1JBAA 1F4QA 1ZACA 4P5OE 2MJWB 2LVVA 2K7BA 3VRRA 3A8RA 1KFXS 4AQJA 1B7TZ 4HSZA 4BY4A 5D69A 2FCDA 1XYDA 2WCFA 1OE9B 1M39A 4ORCB 3PM8A 5I2QA 2ZFDA 4CFRA 1NCZA 1YR5A 2Y4QA 1WLMA 1Y1UA 2LLUA 2TN4A 5HLOA 2KYFA 3KEVA 3PLFB 2KI4C 1RWYA 2M0RA 1RJVA 2BL0C 2WC8A 4DRWA 4I5LB 1F71A 1WRLA 1SW8A 1TIZA 3EK7A 1AVSA 1GJYA 3BQ3A 1UHJA 2BE4A 4NDBA 2ZNEA 1XFZO 1J7OA 1EL4A 1X02A 4ORAB 2JQ6A 1OMRA 1RFJA 1TRFA 2ZKMX 2KAXA 2KGRA 3AAJA 1J1EA 1K93D 1CMGA 1XFUO 4FTGA 1G33A 4OV2A 3BOWA 3EK4A 4MVFA 3MSEB 2BKHB 3NXAA 4WRIA 3GK4X 4YGCB 3SIAA 1SY9A 3DF0B 1NCYA 1EJ3A 1EG3A 4XYNA 1G4YR 1B8CA 2F3ZA 4MZJA 2LVJA 1ODBA 3DVEA 3HX4A 2KQ6A 4ZCUA 1KWOC 5HKYA 1OZSA 3BUNB 1ALVA 1YRUB 1PRWA 1SCMC 1OZOA 1CMFA 1UURA 5CPVA 4MZLA 2AUCA 4YI9A 2JNXA 2KFHA 1E8AA 2L98A 2CTNA 5GQQC 1ZOTB 1QX2A 1K96A 3BUWB 2JNFA 1K9KA 4NDCA 3ZNIA 1GGZA 1EG4A 2KDHA 2F2PA 1KK7Y 1RK9A 4PHNA 1BT6A 4JQ0D 1NSHA 1QS7A 1K9UA 1CLBA 3I5IC 1WLZA 3D10A 1JF0A 2LMUA 2Y5IA 4GFTA 4YGBB 4MEWA 2KNEA 3TDZA 3BOWB 5BPJA 1S1EA 1F4OA 2PVBA 1IWQA 2KAVA 2LE9B 1JWDA 3ZWHA 3O4YA 1R6PA 2O5GA 4YBHB 2WCEA 1BLQA 3SIBA 5KSZA 4CPVA 4C0JA 1DMOA 2BBMA 2A4JA 4GGFA 1Y1XA 1QTXA 2FCEA 1BJFA 3I5FB 2K2AA 1JFKA 4ICBA 3I5GC 1TN4A 1J55A 4DUQA 1K95A 4AOMA 1NX3A 1KCYA 3EK8A 1CDPA 3DVJA 1KFXL 4GGNA 3OB1B 1IRJA 1K9PA 1XK4C 1A75B 4OKHA 1XA5A 1CFCA 2M7LA 4PE4A 1NX1A 2L51A 1SPYA 1QATA 2H61A 1CKKA 1CDLA 2KFFA 2K8MB 4YRUA 2JULA 3ICBA 3GOFA 5TNCA 1VRKA 3PN7B 1MQ1A 2M49B 2JXCA 1RECA 4DS7A 1N0YA 2Y1MA 4Q04A 1SK6D 3WHUB 3PSRA 2QPTA 1UHIA 2MLEC 2QACA 1M63B 3LK1A 2EHBA 1DT7B 1CLLA 2NLNA 1BU3A 3CLNA 1UHNA 3O2PA 2M3WA 2DOQA 2OS8C 3CTNA 2JRFA 2G9BA 4OVNF 1DVIA 1SR6C 1KK8C 3BXKA 4L9MA 1TCFA 2JZIA 1BG1A 2OTGC 2OPOA 4DCKA 2MA2A 2JT8A 3BUMB 2Y1NA 1FI6A 2NXQA 4PE7A 1DJGA 1IJ5A 4I5NB 1WDCC 1M31A 4YGDB 2K61A 1S36A 2I94A 1AJ4A 3KF9A 4PHJA 1GQMA 1HT9A 4ZCVA 3VRNA 2LUXA 4DIRA 1AP4A 2ZNDA 3LCPC 3NSLA 3VRQA 2PASA 2GGZA 3HCMA 1QV0A 1RROA 2BCXA 1JSAA 5I2OA 4USLA 1PVBA 1S6JA 1DJIA 2NCPA 4HREE 2KYCA 2WOSA 1XO5A 1SCVA 1IQ3A 1QVIY 1NWDA 1H8BA 1C7WA 4XJKB 1SNLA 2E30A 1NX0A 3LL8B 4NDDA 2MBXA 2COLB 3SJSA 1B9AA 4QJ4B 4CFQA 1QIVA 3NSIA 3RM1A 5AXIA 2LNKA 4D1EA 3TUYC 2F2OA 1MUXA 3PFVA 2M1KB 3A4UB 3DF0A 2K7DA 2P6BB 1CDNA 2K7OA 1BF5A 1YUSA 1FF1A 3TS5B 3EKHA 1F70A 4BY5A 1KWOB 4OCIA 2D8NA 1A4PA 2PMYA 3KO0A 2BE6A 4GGFC 1WY9A 1L7ZA 1A29A 1B8LA 1NCXA 2F33A 4GUKA 1BR1B 2L2EA 1KQMC 4OR9B 3C1VA 4CIDA 2JT0A 2KOTA 1C7VA 1TNWA 4XJKA 1KFUS 2BKIB 2KQYA 3IF7A 2KFGA 1W7JB 2KAYA 3CGAA 2CXJA 2LVIA 2PSRA 1FI5A 2CBLA 2L4HA 3I5IB 1YVHA 1PULA 3EVVA 2EC6C 3E3RA 3EVRA 5AEQA 1WRZA 5FYXA 1D1OA 4UPGA 1IH0A 1AHRA 1JF2A 1SL9A 1ZUZA 2KI4B 3FS7A 2NCOA 2M9GA 5HKWA 4AQIA 3FIAA 5G08A 1QV1A 4GPLB 2BCAA 4HRHA 2IS9A 1S5GZ 1PVAA 4PCWA 1QX7A 3JTDB 4M2PA 2CT9A 5CSFA 1SR6B 1A2XA 2KBIA 4N1FA 5JJGA 1BODA 1XFYO 4A4CA 4MN0A 3M0WA 4JWQA 1B1GA 4YGAA 2LANA 1Q80A 2I18A 1AJ5A 2I2RE 4MBEA 1XFXO 1XFWO 1A75A 1IQ5A 3OB2B 1YUUA 1V1GA 4R1EA 1YTZC 1CLMA 2L4IA 1DTLA 2G2BA 3OP0A 2EGDA 1N65A 5HLVA 1FBVA 1ZMZA 3RLZA 1K8UA 1F54A 2LV7A 1LA3A 1J7QA 1PSRA 1QIWA 1QASA 2HQ8A 3AKAA 1B4CA 2JPTA 2CCMA 3BUXB 4FQOA 1KSOA 5ER4X 1CFFA 5CSIA 1U5IB 2V53A 3IQQA 1RTP1 5ER5A 1MR8A 1TTXA 4PALA 2L50A 3EVUA 1QX5B 2BECA 1SCMB 2JC2A 3DD4A 1NYAA 1DGUA 2VRGA 1UUSA 4YGEB 2BL0B 2GV5A 2JTTA 4MZKA 4WQ2A 3TDIA 1DGVA 2KSPA 1IJ6A 5CSJA 3TDUA 3CZTX 1S5GY 3SG5A 1Y6WA 4YI8A 2LCPA 1AUIB 4E68A 3OX5A 1UWOA 2K7CA 2LMTA 2Q91A 1Y1AA 3VROA 1M46A 3PN7C 1H4BA 2L5XB 2HETA 5I8NA 1IKUA 1DJHA 5HKZA 1MXEA 1Y0VH 4A4BA 4PHKA 2JU0A 1G8IA 1K94A 1CB1A 1QJTA 2I7AA 1C07A 1CM1A 3JVTC 3FWBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B47 A;  1XVJ A;  3LK0 A;  2MAZ A;  3CWG A;  3EKJ A;  3PAT A;  1GGW A;  1PAL A;  3I5G B;  3BYA A;  4GNK B;  3DVM A;  1JUO A;  1UHK A;  1YRT B;  4ETO A;  2BBN A;  1F8H A;  2LLS A;  1SYM A;  1DF0 A;  1TNX A;  3IQO A;  2LHI A;  3TZ1 A;  2ZN9 A;  3GK1 A;  1QXP A;  2WND A;  1DJZ A;  4WQ3 A;  2ISD A;  1WRK A;  1S6C A;  3NSO A;  5J3X A;  5DKN A;  1M45 A;  1OMV A;  4MRX A;  5F6T A;  3DVK A;  2KI6 D;  3OHM B;  1BR4 B;  1TCO B;  4MSP A;  4QJ3 B;  5DKR A;  2JTZ A;  4IL1 A;  5IBW A;  1IGV A;  1K2H A;  1SMG A;  2KGB C;  2JT3 A;  1YUR A;  4QJ5 B;  2R2I A;  2JOJ A;  2LP3 A;  3K21 A;  4MLW A;  4CLN A;  1OMD A;  2PAL A;  2JWW A;  2CNP A;  3GK2 A;  1FPW A;  3JTD C;  3NSK A;  2FOT A;  4PDZ A;  5CSN A;  1S3P A;  2HF5 A;  1K90 D;  4M2Q A;  1QVI Z;  3VGO A;  1KK8 B;  1JFJ A;  4GBA A;  1F55 A;  1XK4 A;  1V1F A;  2F8P A;  1A03 A;  2L0P A;  3O78 A;  1DF0 B;  1L2O B;  1UHH A;  3WXA A;  2HPS A;  4I5J A;  2NZ0 A;  2OS8 B;  1YX7 A;  1KFU L;  1OQP A;  1OSA A;  1CDM A;  3I5F C;  1NP8 A;  1PK0 D;  3CS1 A;  1KK7 Z;  2FJU B;  2MRD A;  1S6I A;  3LLE A;  1NIW A;  1YUT A;  2SCP A;  1TNP A;  4F0Z B;  4JPZ B;  4U8D A;  2LP2 A;  5HYD A;  3SG6 A;  1CM4 A;  1LXF C;  3I5H C;  3KHE A;  4MRY A;  3TUY B;  1SL7 A;  2AAO A;  3VRP A;  1FW4 A;  2PRU A;  1CNP A;  2LMV A;  4C0L A;  2O60 A;  1B7T Y;  4I5K A;  2KI6 C;  2AMI A;  1AK8 A;  1R2U A;  1KSM A;  1S26 D;  1ALW A;  2SAS A;  3H4S E;  3OX6 A;  3WHT B;  2Q4U A;  2GGM A;  1DJY A;  5KTY A;  3PAL A;  4C0K A;  1KQM B;  1OOJ A;  3D0Y B;  1DJW A;  1MHO A;  3SG2 A;  4PE0 A;  1IG5 A;  2ZRS A;  1QLK A;  2M8U A;  5JOL A;  1MXL C;  2ZRT A;  1DJX A;  1SRA A;  2E6W A;  3CR5 X;  1XFV O;  1QLS A;  3TS5 C;  1LVC D;  4GAO A;  5PAL A;  3CR2 A;  1CFP A;  2K0J A;  1L2O C;  1MWN A;  2EC6 B;  3WNX B;  5AER A;  2M7N A;  1U5I A;  1W7I B;  1BOC A;  2LC5 A;  1BMO A;  3O6B A;  4N1G A;  4NQG A;  1LIN A;  1CTR A;  2LHL A;  1YX8 A;  2MLF C;  1J7P A;  1HQV A;  1UP5 A;  1SKT A;  1ZFS A;  2WCB A;  1LA0 A;  1KQV A;  2ZN8 A;  1EXR A;  1NPQ A;  2KHN A;  2LLT A;  5DKQ A;  2LAP A;  2OTG B;  3AAK A;  5KU1 A;  1JC2 A;  1NX2 A;  5AAN A;  1PSB A;  2F3Y A;  3FWC A;  1J7R A;  3I5H B;  5B8I B;  1WDC B;  3BUO B;  3D0Y A;  2H61 C;  4M2O A;  1TNQ A;  4P2Y B;  2KBM A;  5D7F A;  4ORB B;  5AFP A;  2LUC A;  3KPX A;  3SG7 A;  2RGI A;  3F45 A;  2JXL A;  2WOR A;  3QRX A;  4PE1 A;  1NUB A;  4N5X A;  1CFD A;  5I2L A;  4PHM A;  3SG4 A;  3JVT B;  2M1U A;  1TOP A;  5K89 A;  1MF8 B;  2B1U A;  1N2D A;  4HRG A;  4TNC A;  2LM5 A;  1SL8 A;  1YVL A;  2M29 A;  2BCB A;  2M97 A;  2MHH A;  2K2F A;  2H2K A;  2LVK A;  1SBJ A;  1LKJ A;  2HQW A;  1EH2 A;  3SG3 A;  1B8R A;  3AKB A;  3CR4 X;  1J1D A;  1JBA A;  1F4Q A;  1ZAC A;  4P5O E;  2MJW B;  2LVV A;  2K7B A;  3VRR A;  3A8R A;  1KFX S;  4AQJ A;  1B7T Z;  4HSZ A;  4BY4 A;  5D69 A;  2FCD A;  1XYD A;  2WCF A;  1OE9 B;  1M39 A;  4ORC B;  3PM8 A;  5I2Q A;  2ZFD A;  4CFR A;  1NCZ A;  1YR5 A;  2Y4Q A;  1WLM A;  1Y1U A;  2LLU A;  2TN4 A;  5HLO A;  2KYF A;  3KEV A;  3PLF B;  2KI4 C;  1RWY A;  2M0R A;  1RJV A;  2BL0 C;  2WC8 A;  4DRW A;  4I5L B;  1F71 A;  1WRL A;  1SW8 A;  1TIZ A;  3EK7 A;  1AVS A;  1GJY A;  3BQ3 A;  1UHJ A;  2BE4 A;  4NDB A;  2ZNE A;  1XFZ O;  1J7O A;  1EL4 A;  1X02 A;  4ORA B;  2JQ6 A;  1OMR A;  1RFJ A;  1TRF A;  2ZKM X;  2KAX A;  2KGR A;  3AAJ A;  1J1E A;  1K93 D;  1CMG A;  1XFU O;  4FTG A;  1G33 A;  4OV2 A;  3BOW A;  3EK4 A;  4MVF A;  3MSE B;  2BKH B;  3NXA A;  4WRI A;  3GK4 X;  4YGC B;  3SIA A;  1SY9 A;  3DF0 B;  1NCY A;  1EJ3 A;  1EG3 A;  4XYN A;  1G4Y R;  1B8C A;  2F3Z A;  4MZJ A;  2LVJ A;  1ODB A;  3DVE A;  3HX4 A;  2KQ6 A;  4ZCU A;  1KWO C;  5HKY A;  1OZS A;  3BUN B;  1ALV A;  1YRU B;  1PRW A;  1SCM C;  1OZO A;  1CMF A;  1UUR A;  5CPV A;  4MZL A;  2AUC A;  4YI9 A;  2JNX A;  2KFH A;  1E8A A;  2L98 A;  2CTN A;  5GQQ C;  1ZOT B;  1QX2 A;  1K96 A;  3BUW B;  2JNF A;  1K9K A;  4NDC A;  3ZNI A;  1GGZ A;  1EG4 A;  2KDH A;  2F2P A;  1KK7 Y;  1RK9 A;  4PHN A;  1BT6 A;  4JQ0 D;  1NSH A;  1QS7 A;  1K9U A;  1CLB A;  3I5I C;  1WLZ A;  3D10 A;  1JF0 A;  2LMU A;  2Y5I A;  4GFT A;  4YGB B;  4MEW A;  2KNE A;  3TDZ A;  3BOW B;  5BPJ A;  1S1E A;  1F4O A;  2PVB A;  1IWQ A;  2KAV A;  2LE9 B;  1JWD A;  3ZWH A;  3O4Y A;  1R6P A;  2O5G A;  4YBH B;  2WCE A;  1BLQ A;  3SIB A;  5KSZ A;  4CPV A;  4C0J A;  1DMO A;  2BBM A;  2A4J A;  4GGF A;  1Y1X A;  1QTX A;  2FCE A;  1BJF A;  3I5F B;  2K2A A;  1JFK A;  4ICB A;  3I5G C;  1TN4 A;  1J55 A;  4DUQ A;  1K95 A;  4AOM A;  1NX3 A;  1KCY A;  3EK8 A;  1CDP A;  3DVJ A;  1KFX L;  4GGN A;  3OB1 B;  1IRJ A;  1K9P A;  1XK4 C;  1A75 B;  4OKH A;  1XA5 A;  1CFC A;  2M7L A;  4PE4 A;  1NX1 A;  2L51 A;  1SPY A;  1QAT A;  2H61 A;  1CKK A;  1CDL A;  2KFF A;  2K8M B;  4YRU A;  2JUL A;  3ICB A;  3GOF A;  5TNC A;  1VRK A;  3PN7 B;  1MQ1 A;  2M49 B;  2JXC A;  1REC A;  4DS7 A;  1N0Y A;  2Y1M A;  4Q04 A;  1SK6 D;  3WHU B;  3PSR A;  2QPT A;  1UHI A;  2MLE C;  2QAC A;  1M63 B;  3LK1 A;  2EHB A;  1DT7 B;  1CLL A;  2NLN A;  1BU3 A;  3CLN A;  1UHN A;  3O2P A;  2M3W A;  2DOQ A;  2OS8 C;  3CTN A;  2JRF A;  2G9B A;  4OVN F;  1DVI A;  1SR6 C;  1KK8 C;  3BXK A;  4L9M A;  1TCF A;  2JZI A;  1BG1 A;  2OTG C;  2OPO A;  4DCK A;  2MA2 A;  2JT8 A;  3BUM B;  2Y1N A;  1FI6 A;  2NXQ A;  4PE7 A;  1DJG A;  1IJ5 A;  4I5N B;  1WDC C;  1M31 A;  4YGD B;  2K61 A;  1S36 A;  2I94 A;  1AJ4 A;  3KF9 A;  4PHJ A;  1GQM A;  1HT9 A;  4ZCV A;  3VRN A;  2LUX A;  4DIR A;  1AP4 A;  2ZND A;  3LCP C;  3NSL A;  3VRQ A;  2PAS A;  2GGZ A;  3HCM A;  1QV0 A;  1RRO A;  2BCX A;  1JSA A;  5I2O A;  4USL A;  1PVB A;  1S6J A;  1DJI A;  2NCP A;  4HRE E;  2KYC A;  2WOS A;  1XO5 A;  1SCV A;  1IQ3 A;  1QVI Y;  1NWD A;  1H8B A;  1C7W A;  4XJK B;  1SNL A;  2E30 A;  1NX0 A;  3LL8 B;  4NDD A;  2MBX A;  2COL B;  3SJS A;  1B9A A;  4QJ4 B;  4CFQ A;  1QIV A;  3NSI A;  3RM1 A;  5AXI A;  2LNK A;  4D1E A;  3TUY C;  2F2O A;  1MUX A;  3PFV A;  2M1K B;  3A4U B;  3DF0 A;  2K7D A;  2P6B B;  1CDN A;  2K7O A;  1BF5 A;  1YUS A;  1FF1 A;  3TS5 B;  3EKH A;  1F70 A;  4BY5 A;  1KWO B;  4OCI A;  2D8N A;  1A4P A;  2PMY A;  3KO0 A;  2BE6 A;  4GGF C;  1WY9 A;  1L7Z A;  1A29 A;  1B8L A;  1NCX A;  2F33 A;  4GUK A;  1BR1 B;  2L2E A;  1KQM C;  4OR9 B;  3C1V A;  4CID A;  2JT0 A;  2KOT A;  1C7V A;  1TNW A;  4XJK A;  1KFU S;  2BKI B;  2KQY A;  3IF7 A;  2KFG A;  1W7J B;  2KAY A;  3CGA A;  2CXJ A;  2LVI A;  2PSR A;  1FI5 A;  2CBL A;  2L4H A;  3I5I B;  1YVH A;  1PUL A;  3EVV A;  2EC6 C;  3E3R A;  3EVR A;  5AEQ A;  1WRZ A;  5FYX A;  1D1O A;  4UPG A;  1IH0 A;  1AHR A;  1JF2 A;  1SL9 A;  1ZUZ A;  2KI4 B;  3FS7 A;  2NCO A;  2M9G A;  5HKW A;  4AQI A;  3FIA A;  5G08 A;  1QV1 A;  4GPL B;  2BCA A;  4HRH A;  2IS9 A;  1S5G Z;  1PVA A;  4PCW A;  1QX7 A;  3JTD B;  4M2P A;  2CT9 A;  5CSF A;  1SR6 B;  1A2X A;  2KBI A;  4N1F A;  5JJG A;  1BOD A;  1XFY O;  4A4C A;  4MN0 A;  3M0W A;  4JWQ A;  1B1G A;  4YGA A;  2LAN A;  1Q80 A;  2I18 A;  1AJ5 A;  2I2R E;  4MBE A;  1XFX O;  1XFW O;  1A75 A;  1IQ5 A;  3OB2 B;  1YUU A;  1V1G A;  4R1E A;  1YTZ C;  1CLM A;  2L4I A;  1DTL A;  2G2B A;  3OP0 A;  2EGD A;  1N65 A;  5HLV A;  1FBV A;  1ZMZ A;  3RLZ A;  1K8U A;  1F54 A;  2LV7 A;  1LA3 A;  1J7Q A;  1PSR A;  1QIW A;  1QAS A;  2HQ8 A;  3AKA A;  1B4C A;  2JPT A;  2CCM A;  3BUX B;  4FQO A;  1KSO A;  5ER4 X;  1CFF A;  5CSI A;  1U5I B;  2V53 A;  3IQQ A;  1RTP 1;  5ER5 A;  1MR8 A;  1TTX A;  4PAL A;  2L50 A;  3EVU A;  1QX5 B;  2BEC A;  1SCM B;  2JC2 A;  3DD4 A;  1NYA A;  1DGU A;  2VRG A;  1UUS A;  4YGE B;  2BL0 B;  2GV5 A;  2JTT A;  4MZK A;  4WQ2 A;  3TDI A;  1DGV A;  2KSP A;  1IJ6 A;  5CSJ A;  3TDU A;  3CZT X;  1S5G Y;  3SG5 A;  1Y6W A;  4YI8 A;  2LCP A;  1AUI B;  4E68 A;  3OX5 A;  1UWO A;  2K7C A;  2LMT A;  2Q91 A;  1Y1A A;  3VRO A;  1M46 A;  3PN7 C;  1H4B A;  2L5X B;  2HET A;  5I8N A;  1IKU A;  1DJH A;  5HKZ A;  1MXE A;  1Y0V H;  4A4B A;  4PHK A;  2JU0 A;  1G8I A;  1K94 A;  1CB1 A;  1QJT A;  2I7A A;  1C07 A;  1CM1 A;  3JVT C;  3FWB A; 
#chains in the Genus database with same CATH topology
 1B47 A;  1XVJ A;  3LK0 A;  2MAZ A;  3CWG A;  3EKJ A;  3PAT A;  1GGW A;  1PAL A;  3I5G B;  1DQE A;  1LS8 A;  3BYA A;  3BFB A;  4GNK B;  3DVM A;  1JUO A;  1UHK A;  1YRT B;  5I94 A;  4ETO A;  2BBN A;  1F8H A;  2LLS A;  1SYM A;  3B7A A;  1DF0 A;  1TNX A;  3IQO A;  2LHI A;  3TZ1 A;  2ZN9 A;  3GK1 A;  1GM0 A;  1QXP A;  3UNW A;  2WND A;  1DJZ A;  4WQ3 A;  2ISD A;  1WRK A;  1S6C A;  2L2C A;  3NSO A;  3NHI A;  3FE8 A;  5J3X A;  5DKN A;  1TUJ A;  1M45 A;  1OMV A;  4MRX A;  5F6T A;  3DVK A;  2KI6 D;  3OHM B;  1BR4 B;  1TCO B;  4MSP A;  4QJ3 B;  5DKR A;  2QEH A;  2JTZ A;  4IL1 A;  5IBW A;  1IGV A;  1K2H A;  1SMG A;  2KGB C;  2JT3 A;  1YUR A;  4QJ5 B;  2R2I A;  2JOJ A;  2LP3 A;  3K21 A;  4MLW A;  4CLN A;  1OMD A;  2PAL A;  2JWW A;  3D73 A;  2CNP A;  3GK2 A;  3RZS A;  3B86 A;  3JTD C;  3NSK A;  3S0E A;  2FOT A;  1FPW A;  4PDZ A;  5CSN A;  1S3P A;  2HF5 A;  1K90 D;  4M2Q A;  1QVI Z;  3VGO A;  1KK8 B;  1JFJ A;  4GBA A;  1F55 A;  1XK4 A;  1V1F A;  2BNX A;  2F8P A;  1A03 A;  2L0P A;  3O78 A;  1DF0 B;  1L2O B;  1UHH A;  3SS5 A;  3WXA A;  2HPS A;  3FE6 A;  2NZ0 A;  4I5J A;  2OS8 B;  1DEK A;  1YX7 A;  1KFU L;  1OQP A;  1OSA A;  1CDM A;  3I5F C;  1NP8 A;  1PK0 D;  3CS1 A;  1KK7 Z;  2FJU B;  2MRD A;  1S6I A;  3LLE A;  1NIW A;  3R1P A;  1YUT A;  2SCP A;  5D3O A;  4PT1 A;  1TNP A;  4F0Z B;  2QDI A;  4JPZ B;  4U8D A;  2LP2 A;  5HYD A;  3SG6 A;  1CM4 A;  1LXF C;  3I5H C;  3KHE A;  4MRY A;  3TUY B;  1SL7 A;  2AAO A;  3VRP A;  1FW4 A;  2PRU A;  3CDN A;  1CNP A;  2LMV A;  2PYQ A;  4C0L A;  2O60 A;  1B7T Y;  4I5K A;  3K1E A;  2KI6 C;  2AMI A;  1AK8 A;  1R2U A;  1KSM A;  1S26 D;  1ALW A;  2SAS A;  3H4S E;  3OX6 A;  3WHT B;  2Q4U A;  2GGM A;  3L4L A;  1OW4 A;  3NHT A;  2P70 A;  5FI6 A;  2H8V A;  1DJY A;  3Q8I A;  5KTY A;  3PAL A;  4C0K A;  1KQM B;  1OOJ A;  3D0Y B;  1DJW A;  1MHO A;  3SG2 A;  4PE0 A;  1IG5 A;  2ZRS A;  1QLK A;  2M8U A;  5JOL A;  1MXL C;  2ZRT A;  1DJX A;  1SRA A;  2E6W A;  3CR5 X;  2K60 A;  1XFV O;  1QLS A;  3TS5 C;  3D74 A;  1LVC D;  4GAO A;  5PAL A;  3CR2 A;  1CFP A;  2K0J A;  1L2O C;  2EC6 B;  1MWN A;  3WNX B;  5AER A;  2M7N A;  1U5I A;  1W7I B;  1BOC A;  2LC5 A;  1BMO A;  3DY9 A;  3O6B A;  4OZD A;  4N1G A;  4NQG A;  1LIN A;  1CTR A;  2LHL A;  1YX8 A;  2MLF C;  1J7P A;  1HQV A;  1UP5 A;  1SKT A;  2WCJ A;  1ZFS A;  2WCB A;  1LA0 A;  1KQV A;  2ZN8 A;  3UO9 A;  1EXR A;  1NPQ A;  2KHN A;  2LLT A;  5DKQ A;  2LAP A;  2OTG B;  3AAK A;  5KU1 A;  1JC2 A;  1NX2 A;  5AAN A;  1PSB A;  2F3Y A;  3FWC A;  1J7R A;  3I5H B;  5B8I B;  1WDC B;  2WCL A;  3BUO B;  3D0Y A;  2H61 C;  4M2O A;  1TNQ A;  4P2Y B;  2KBM A;  5D7F A;  4ORB B;  5AFP A;  2LUC A;  3KPX A;  3SG7 A;  2RGI A;  3F45 A;  2JXL A;  2WOR A;  3L47 A;  3QRX A;  4PE1 A;  1NUB A;  4N5X A;  1CFD A;  5I2L A;  4PHM A;  3SG4 A;  3JVT B;  2M1U A;  1TOP A;  5K89 A;  1MF8 B;  2B1U A;  1N2D A;  4HRG A;  4TNC A;  2LM5 A;  1SL8 A;  1YVL A;  2M29 A;  2BCB A;  2M97 A;  2MHH A;  2K2F A;  1C3Y A;  2H2K A;  2LVK A;  1SBJ A;  1LKJ A;  2HQW A;  1EH2 A;  3SG3 A;  1B8R A;  3AKB A;  3CR4 X;  1J1D A;  1JBA A;  1F4Q A;  1ZAC A;  4P5O E;  2MJW B;  2LVV A;  2K7B A;  3VRR A;  3A8R A;  1KFX S;  4AQJ A;  3SS3 A;  3PM2 A;  1B7T Z;  2PQL A;  2JPO A;  3PJI A;  4HSZ A;  4BY4 A;  5D69 A;  3S0B A;  2FCD A;  1XYD A;  2WCF A;  1OE9 B;  1M39 A;  4ORC B;  3PM8 A;  5I2Q A;  2ZFD A;  4CFR A;  1NCZ A;  1YR5 A;  2Y4Q A;  1WLM A;  1Y1U A;  2LLU A;  2TN4 A;  5HLO A;  2KYF A;  3KEV A;  3PLF B;  2KI4 C;  1RWY A;  2M0R A;  2BAP A;  2BL0 C;  1OOF A;  1RJV A;  2WC8 A;  1W9Z A;  4DRW A;  4I5L B;  1F71 A;  1WRL A;  1SW8 A;  1TIZ A;  3EK7 A;  1AVS A;  1GJY A;  3BQ3 A;  1UHJ A;  2BE4 A;  4NDB A;  2ZNE A;  1XFZ O;  5FI2 A;  1J7O A;  1EL4 A;  1X02 A;  3CZ1 A;  3DZT A;  4ORA B;  2JQ6 A;  1OMR A;  1OOH A;  1RFJ A;  1TRF A;  2ZKM X;  2KAX A;  2KGR A;  3AAJ A;  1J1E A;  1K93 D;  1CMG A;  1XFU O;  2WCM A;  1Z4H A;  4FTG A;  1G33 A;  1DC1 A;  4OV2 A;  3BOW A;  3EK4 A;  4MVF A;  3MSE B;  2BKH B;  3NXA A;  3BJH A;  4WRI A;  3GK4 X;  4YGC B;  3SIA A;  1SY9 A;  3DF0 B;  1NCY A;  1EJ3 A;  1EG3 A;  4XYN A;  1G4Y R;  1B8C A;  2F3Z A;  4MZJ A;  2LVJ A;  1ODB A;  3DVE A;  3HX4 A;  2KQ6 A;  4ZCU A;  1KWO C;  5HKY A;  1OZS A;  3BUN B;  1ALV A;  1YRU B;  1PRW A;  1SCM C;  1OZO A;  1CMF A;  1UUR A;  5CPV A;  4MZL A;  2AUC A;  4YI9 A;  2JNX A;  2KFH A;  1E8A A;  2L98 A;  2CTN A;  1XFR A;  3R1O A;  5GQQ C;  1ZOT B;  1QX2 A;  1K96 A;  3BUW B;  3FE9 A;  2JNF A;  1K9K A;  4NDC A;  3ZNI A;  1GGZ A;  1EG4 A;  2KDH A;  3B6X A;  2F2P A;  1KK7 Y;  1RK9 A;  4PHN A;  1BT6 A;  4JQ0 D;  1NSH A;  1QS7 A;  1K9U A;  1CLB A;  3I5I C;  1WLZ A;  3D10 A;  1JF0 A;  2LMU A;  2Y5I A;  4GFT A;  4YGB B;  4MEW A;  2KNE A;  3TDZ A;  3BOW B;  5BPJ A;  1S1E A;  2ERB A;  1F4O A;  2PVB A;  1IWQ A;  2KAV A;  4IJ7 A;  2LE9 B;  1JWD A;  3ZWH A;  3O4Y A;  1R6P A;  2O5G A;  4YBH B;  2WCE A;  1BLQ A;  3SIB A;  5KSZ A;  4CPV A;  4INW A;  4C0J A;  1DMO A;  2BBM A;  2A4J A;  4GGF A;  3S0D A;  1Y1X A;  1QTX A;  2FCE A;  3D78 A;  1BJF A;  1SSE B;  3I5F B;  2K2A A;  1JFK A;  1C3Z A;  4ICB A;  3I5G C;  1TN4 A;  1J55 A;  4DUQ A;  1K95 A;  4AOM A;  1NX3 A;  1KCY A;  3EK8 A;  1CDP A;  3DVJ A;  1KFX L;  4GGN A;  3OB1 B;  1IRJ A;  1K9P A;  1XK4 C;  1A75 B;  4OKH A;  1XA5 A;  1CFC A;  2YGU A;  2M7L A;  4PE4 A;  1NX1 A;  2L51 A;  1SPY A;  1QAT A;  1DEL A;  3S0F A;  2H61 A;  1CKK A;  1CDL A;  2KFF A;  2K8M B;  3OGN A;  4YRU A;  1TWO A;  4KYN A;  3R1V A;  2JUL A;  2KPH A;  3ICB A;  3EG5 B;  3GOF A;  3S0A A;  3CAB A;  5TNC A;  3O4X A;  2P71 A;  3CZ0 A;  1VRK A;  3PN7 B;  1MQ1 A;  2M49 B;  2JXC A;  1REC A;  4DS7 A;  1N0Y A;  2Y1M A;  4Q04 A;  1SK6 D;  3WHU B;  3PSR A;  2QPT A;  1UHI A;  2MLE C;  2QAC A;  1M63 B;  3LK1 A;  2EHB A;  1DT7 B;  1CLL A;  2NLN A;  3VB1 A;  1BU3 A;  3CLN A;  1UHN A;  3O2P A;  3B88 A;  2M3W A;  2DOQ A;  2OS8 C;  3CTN A;  2JRF A;  2G9B A;  4OVN F;  1DVI A;  1SR6 C;  1KK8 C;  3BXK A;  4L9M A;  1TCF A;  2JZI A;  1BG1 A;  2OTG C;  2OPO A;  4DCK A;  2MA2 A;  2JT8 A;  3BUM B;  2Y1N A;  1FI6 A;  2NXQ A;  4PE7 A;  1DJG A;  1IJ5 A;  4I5N B;  1WDC C;  1M31 A;  2KLE A;  2K61 A;  4YGD B;  1S36 A;  2I94 A;  1AJ4 A;  3KF9 A;  4PHJ A;  1GQM A;  1HT9 A;  4ZCV A;  3VRN A;  2LUX A;  4DIR A;  1AP4 A;  2ZND A;  3LCP C;  3NSL A;  3VRQ A;  2PAS A;  2GGZ A;  3D75 A;  3HCM A;  1QV0 A;  1RRO A;  2BCX A;  1JSA A;  5I2O A;  4USL A;  1PVB A;  3NGV A;  1S6J A;  1DJI A;  2NCP A;  4HRE E;  4JD9 A;  5FI7 A;  2KYC A;  2WOS A;  1XO5 A;  1SCV A;  1IQ3 A;  1QVI Y;  1NWD A;  2KLD A;  1H8B A;  1C7W A;  4XJK B;  1SNL A;  2E30 A;  1NX0 A;  3LL8 B;  4NDD A;  2MBX A;  2COL B;  3SJS A;  1B9A A;  4QJ4 B;  4CFQ A;  1QIV A;  3NSI A;  3RM1 A;  5AXI A;  2LNK A;  3DYE A;  4D1E A;  3TUY C;  2F2O A;  1MUX A;  3PFV A;  3D77 A;  2M1K B;  3A4U B;  3DF0 A;  2K7D A;  2P6B B;  1IIO A;  1CDN A;  2K7O A;  1BF5 A;  1YUS A;  3B87 A;  1FF1 A;  5DIC A;  3TS5 B;  2QEV A;  3EKH A;  2QEB A;  4JKT A;  1F70 A;  4BY5 A;  1KWO B;  1TUZ A;  4OCI A;  4F7F A;  2D8N A;  1A4P A;  2PMY A;  3KO0 A;  2BE6 A;  4GGF C;  1WY9 A;  1L7Z A;  1A29 A;  1B8L A;  1NCX A;  2F33 A;  4GUK A;  1BR1 B;  1OOG A;  2L2E A;  1KQM C;  4OR9 B;  3C1V A;  4CID A;  2JT0 A;  2KOT A;  1C7V A;  1ORG A;  1TNW A;  4XJK A;  1KFU S;  2BKI B;  2KQY A;  3IF7 A;  2KFG A;  1P28 A;  1W7J B;  2KAY A;  3CGA A;  1Z2C B;  2CXJ A;  3L4A A;  2LVI A;  2PSR A;  1FI5 A;  2CBL A;  2L4H A;  3I5I B;  5HL1 A;  3OBV A;  1YVH A;  1PUL A;  2QEO A;  3BFH A;  3EVV A;  2EC6 C;  3E3R A;  3EVR A;  5AEQ A;  3SS4 A;  1WRZ A;  3CYZ A;  5FYX A;  1D1O A;  4UPG A;  1IH0 A;  1AHR A;  1JF2 A;  3BFA A;  1SL9 A;  1ZUZ A;  2KI4 B;  3FS7 A;  2NCO A;  2M9G A;  5HKW A;  4AQI A;  3FIA A;  3S0G A;  5G08 A;  1QV1 A;  4GPL B;  3V2L A;  2BCA A;  4HRH A;  4FQT A;  2IS9 A;  1S5G Z;  1PVA A;  4PCW A;  2WCK A;  1QX7 A;  3JTD B;  4M2P A;  2CT9 A;  5CSF A;  1SR6 B;  1A2X A;  2KBI A;  4N1F A;  5JJG A;  1BOD A;  1XFY O;  4A4C A;  4MN0 A;  3M0W A;  1QWV A;  2FJY A;  4JWQ A;  4YGA A;  1B1G A;  2LAN A;  1Q80 A;  2I18 A;  1AJ5 A;  2I2R E;  3IVT A;  1XFX O;  4MBE A;  1XFW O;  1A75 A;  1IQ5 A;  3OB2 B;  1YUU A;  1OOI X;  1V1G A;  4R1E A;  1YTZ C;  5EL2 A;  1CLM A;  2L5Y A;  2WC5 A;  2L4I A;  2GTE A;  1DTL A;  2G2B A;  3CZ2 A;  3OP0 A;  2EGD A;  1N65 A;  5HLV A;  1FBV A;  1ZMZ A;  3RLZ A;  1K8U A;  1F54 A;  2LV7 A;  1LA3 A;  1J7Q A;  1T14 A;  1PSR A;  1QIW A;  1QAS A;  2HQ8 A;  2WCH A;  3AKA A;  1B4C A;  2JPT A;  2CCM A;  3BUX B;  3N7H A;  4FQO A;  1KSO A;  5ER4 X;  1CFF A;  5CSI A;  1U5I B;  2V53 A;  3IQQ A;  1RTP 1;  5ER5 A;  1MR8 A;  1TTX A;  4PAL A;  3R72 A;  2L50 A;  3EVU A;  1QX5 B;  2BEC A;  1SCM B;  2JC2 A;  3DD4 A;  1NYA A;  1DGU A;  2VRG A;  1UUS A;  4INX A;  4YGE B;  2BL0 B;  2GV5 A;  2JTT A;  4MZK A;  4WQ2 A;  3TDI A;  1DGV A;  2KSP A;  1IJ6 A;  5CSJ A;  3TDU A;  3CZT X;  1S5G Y;  3QME A;  3SG5 A;  1Y6W A;  4YI8 A;  2LCP A;  1AUI B;  4E68 A;  3OX5 A;  1UWO A;  2K7C A;  2LMT A;  2Q91 A;  1Y1A A;  3VRO A;  1M46 A;  3PN7 C;  1H4B A;  2L5X B;  2HET A;  5I8N A;  1IKU A;  1DJH A;  5HKZ A;  1MXE A;  1Y0V H;  3DXL A;  4PHK A;  4A4B A;  2JU0 A;  3D76 A;  1G8I A;  1K94 A;  2WC6 A;  1CB1 A;  1QJT A;  2I7A A;  1C07 A;  1CM1 A;  3JVT C;  3FWB A; 
#chains in the Genus database with same CATH homology
 1B47 A;  1XVJ A;  3LK0 A;  2MAZ A;  3CWG A;  3EKJ A;  3PAT A;  1GGW A;  1PAL A;  3I5G B;  3BYA A;  4GNK B;  3DVM A;  1JUO A;  1UHK A;  1YRT B;  4ETO A;  2BBN A;  1F8H A;  2LLS A;  1SYM A;  1DF0 A;  1TNX A;  3IQO A;  2LHI A;  3TZ1 A;  2ZN9 A;  3GK1 A;  1QXP A;  2WND A;  1DJZ A;  4WQ3 A;  2ISD A;  1WRK A;  1S6C A;  3NSO A;  5J3X A;  5DKN A;  1M45 A;  1OMV A;  4MRX A;  5F6T A;  3DVK A;  2KI6 D;  3OHM B;  1BR4 B;  1TCO B;  4MSP A;  4QJ3 B;  5DKR A;  2JTZ A;  4IL1 A;  5IBW A;  1IGV A;  1K2H A;  1SMG A;  2KGB C;  2JT3 A;  1YUR A;  4QJ5 B;  2R2I A;  2JOJ A;  2LP3 A;  3K21 A;  4MLW A;  4CLN A;  1OMD A;  2PAL A;  2JWW A;  2CNP A;  3GK2 A;  1FPW A;  3JTD C;  3NSK A;  2FOT A;  4PDZ A;  5CSN A;  1S3P A;  2HF5 A;  1K90 D;  4M2Q A;  1QVI Z;  3VGO A;  1KK8 B;  1JFJ A;  4GBA A;  1F55 A;  1XK4 A;  1V1F A;  2F8P A;  1A03 A;  2L0P A;  3O78 A;  1DF0 B;  1L2O B;  1UHH A;  3WXA A;  2HPS A;  4I5J A;  2NZ0 A;  2OS8 B;  1YX7 A;  1KFU L;  1OQP A;  1OSA A;  1CDM A;  3I5F C;  1NP8 A;  1PK0 D;  3CS1 A;  1KK7 Z;  2FJU B;  2MRD A;  1S6I A;  3LLE A;  1NIW A;  1YUT A;  2SCP A;  1TNP A;  4F0Z B;  4JPZ B;  4U8D A;  2LP2 A;  5HYD A;  3SG6 A;  1CM4 A;  1LXF C;  3I5H C;  3KHE A;  4MRY A;  3TUY B;  1SL7 A;  2AAO A;  3VRP A;  1FW4 A;  2PRU A;  1CNP A;  2LMV A;  4C0L A;  2O60 A;  1B7T Y;  4I5K A;  2KI6 C;  2AMI A;  1AK8 A;  1R2U A;  1KSM A;  1S26 D;  1ALW A;  2SAS A;  3H4S E;  3OX6 A;  3WHT B;  2Q4U A;  2GGM A;  1DJY A;  5KTY A;  3PAL A;  4C0K A;  1KQM B;  1OOJ A;  3D0Y B;  1DJW A;  1MHO A;  3SG2 A;  4PE0 A;  1IG5 A;  2ZRS A;  1QLK A;  2M8U A;  5JOL A;  1MXL C;  2ZRT A;  1DJX A;  1SRA A;  2E6W A;  3CR5 X;  1XFV O;  1QLS A;  3TS5 C;  1LVC D;  4GAO A;  5PAL A;  3CR2 A;  1CFP A;  2K0J A;  1L2O C;  1MWN A;  2EC6 B;  3WNX B;  5AER A;  2M7N A;  1U5I A;  1W7I B;  1BOC A;  2LC5 A;  1BMO A;  3O6B A;  4N1G A;  4NQG A;  1LIN A;  1CTR A;  2LHL A;  1YX8 A;  2MLF C;  1J7P A;  1HQV A;  1UP5 A;  1SKT A;  1ZFS A;  2WCB A;  1LA0 A;  1KQV A;  2ZN8 A;  1EXR A;  1NPQ A;  2KHN A;  2LLT A;  5DKQ A;  2LAP A;  2OTG B;  3AAK A;  5KU1 A;  1JC2 A;  1NX2 A;  5AAN A;  1PSB A;  2F3Y A;  3FWC A;  1J7R A;  3I5H B;  5B8I B;  1WDC B;  3BUO B;  3D0Y A;  2H61 C;  4M2O A;  1TNQ A;  4P2Y B;  2KBM A;  5D7F A;  4ORB B;  5AFP A;  2LUC A;  3KPX A;  3SG7 A;  2RGI A;  3F45 A;  2JXL A;  2WOR A;  3QRX A;  4PE1 A;  1NUB A;  4N5X A;  1CFD A;  5I2L A;  4PHM A;  3SG4 A;  3JVT B;  2M1U A;  1TOP A;  5K89 A;  1MF8 B;  2B1U A;  1N2D A;  4HRG A;  4TNC A;  2LM5 A;  1SL8 A;  1YVL A;  2M29 A;  2BCB A;  2M97 A;  2MHH A;  2K2F A;  2H2K A;  2LVK A;  1SBJ A;  1LKJ A;  2HQW A;  1EH2 A;  3SG3 A;  1B8R A;  3AKB A;  3CR4 X;  1J1D A;  1JBA A;  1F4Q A;  1ZAC A;  4P5O E;  2MJW B;  2LVV A;  2K7B A;  3VRR A;  3A8R A;  1KFX S;  4AQJ A;  1B7T Z;  4HSZ A;  4BY4 A;  5D69 A;  2FCD A;  1XYD A;  2WCF A;  1OE9 B;  1M39 A;  4ORC B;  3PM8 A;  5I2Q A;  2ZFD A;  4CFR A;  1NCZ A;  1YR5 A;  2Y4Q A;  1WLM A;  1Y1U A;  2LLU A;  2TN4 A;  5HLO A;  2KYF A;  3KEV A;  3PLF B;  2KI4 C;  1RWY A;  2M0R A;  1RJV A;  2BL0 C;  2WC8 A;  4DRW A;  4I5L B;  1F71 A;  1WRL A;  1SW8 A;  1TIZ A;  3EK7 A;  1AVS A;  1GJY A;  3BQ3 A;  1UHJ A;  2BE4 A;  4NDB A;  2ZNE A;  1XFZ O;  1J7O A;  1EL4 A;  1X02 A;  4ORA B;  2JQ6 A;  1OMR A;  1RFJ A;  1TRF A;  2ZKM X;  2KAX A;  2KGR A;  3AAJ A;  1J1E A;  1K93 D;  1CMG A;  1XFU O;  4FTG A;  1G33 A;  4OV2 A;  3BOW A;  3EK4 A;  4MVF A;  3MSE B;  2BKH B;  3NXA A;  4WRI A;  3GK4 X;  4YGC B;  3SIA A;  1SY9 A;  3DF0 B;  1NCY A;  1EJ3 A;  1EG3 A;  4XYN A;  1G4Y R;  1B8C A;  2F3Z A;  4MZJ A;  2LVJ A;  1ODB A;  3DVE A;  3HX4 A;  2KQ6 A;  4ZCU A;  1KWO C;  5HKY A;  1OZS A;  3BUN B;  1ALV A;  1YRU B;  1PRW A;  1SCM C;  1OZO A;  1CMF A;  1UUR A;  5CPV A;  4MZL A;  2AUC A;  4YI9 A;  2JNX A;  2KFH A;  1E8A A;  2L98 A;  2CTN A;  5GQQ C;  1ZOT B;  1QX2 A;  1K96 A;  3BUW B;  2JNF A;  1K9K A;  4NDC A;  3ZNI A;  1GGZ A;  1EG4 A;  2KDH A;  2F2P A;  1KK7 Y;  1RK9 A;  4PHN A;  1BT6 A;  4JQ0 D;  1NSH A;  1QS7 A;  1K9U A;  1CLB A;  3I5I C;  1WLZ A;  3D10 A;  1JF0 A;  2LMU A;  2Y5I A;  4GFT A;  4YGB B;  4MEW A;  2KNE A;  3TDZ A;  3BOW B;  5BPJ A;  1S1E A;  1F4O A;  2PVB A;  1IWQ A;  2KAV A;  2LE9 B;  1JWD A;  3ZWH A;  3O4Y A;  1R6P A;  2O5G A;  4YBH B;  2WCE A;  1BLQ A;  3SIB A;  5KSZ A;  4CPV A;  4C0J A;  1DMO A;  2BBM A;  2A4J A;  4GGF A;  1Y1X A;  1QTX A;  2FCE A;  1BJF A;  3I5F B;  2K2A A;  1JFK A;  4ICB A;  3I5G C;  1TN4 A;  1J55 A;  4DUQ A;  1K95 A;  4AOM A;  1NX3 A;  1KCY A;  3EK8 A;  1CDP A;  3DVJ A;  1KFX L;  4GGN A;  3OB1 B;  1IRJ A;  1K9P A;  1XK4 C;  1A75 B;  4OKH A;  1XA5 A;  1CFC A;  2M7L A;  4PE4 A;  1NX1 A;  2L51 A;  1SPY A;  1QAT A;  2H61 A;  1CKK A;  1CDL A;  2KFF A;  2K8M B;  4YRU A;  2JUL A;  3ICB A;  3GOF A;  5TNC A;  1VRK A;  3PN7 B;  1MQ1 A;  2M49 B;  2JXC A;  1REC A;  4DS7 A;  1N0Y A;  2Y1M A;  4Q04 A;  1SK6 D;  3WHU B;  3PSR A;  2QPT A;  1UHI A;  2MLE C;  2QAC A;  1M63 B;  3LK1 A;  2EHB A;  1DT7 B;  1CLL A;  2NLN A;  1BU3 A;  3CLN A;  1UHN A;  3O2P A;  2M3W A;  2DOQ A;  2OS8 C;  3CTN A;  2JRF A;  2G9B A;  4OVN F;  1DVI A;  1SR6 C;  1KK8 C;  3BXK A;  4L9M A;  1TCF A;  2JZI A;  1BG1 A;  2OTG C;  2OPO A;  4DCK A;  2MA2 A;  2JT8 A;  3BUM B;  2Y1N A;  1FI6 A;  2NXQ A;  4PE7 A;  1DJG A;  1IJ5 A;  4I5N B;  1WDC C;  1M31 A;  4YGD B;  2K61 A;  1S36 A;  2I94 A;  1AJ4 A;  3KF9 A;  4PHJ A;  1GQM A;  1HT9 A;  4ZCV A;  3VRN A;  2LUX A;  4DIR A;  1AP4 A;  2ZND A;  3LCP C;  3NSL A;  3VRQ A;  2PAS A;  2GGZ A;  3HCM A;  1QV0 A;  1RRO A;  2BCX A;  1JSA A;  5I2O A;  4USL A;  1PVB A;  1S6J A;  1DJI A;  2NCP A;  4HRE E;  2KYC A;  2WOS A;  1XO5 A;  1SCV A;  1IQ3 A;  1QVI Y;  1NWD A;  1H8B A;  1C7W A;  4XJK B;  1SNL A;  2E30 A;  1NX0 A;  3LL8 B;  4NDD A;  2MBX A;  2COL B;  3SJS A;  1B9A A;  4QJ4 B;  4CFQ A;  1QIV A;  3NSI A;  3RM1 A;  5AXI A;  2LNK A;  4D1E A;  3TUY C;  2F2O A;  1MUX A;  3PFV A;  2M1K B;  3A4U B;  3DF0 A;  2K7D A;  2P6B B;  1CDN A;  2K7O A;  1BF5 A;  1YUS A;  1FF1 A;  3TS5 B;  3EKH A;  1F70 A;  4BY5 A;  1KWO B;  4OCI A;  2D8N A;  1A4P A;  2PMY A;  3KO0 A;  2BE6 A;  4GGF C;  1WY9 A;  1L7Z A;  1A29 A;  1B8L A;  1NCX A;  2F33 A;  4GUK A;  1BR1 B;  2L2E A;  1KQM C;  4OR9 B;  3C1V A;  4CID A;  2JT0 A;  2KOT A;  1C7V A;  1TNW A;  4XJK A;  1KFU S;  2BKI B;  2KQY A;  3IF7 A;  2KFG A;  1W7J B;  2KAY A;  3CGA A;  2CXJ A;  2LVI A;  2PSR A;  1FI5 A;  2CBL A;  2L4H A;  3I5I B;  1YVH A;  1PUL A;  3EVV A;  2EC6 C;  3E3R A;  3EVR A;  5AEQ A;  1WRZ A;  5FYX A;  1D1O A;  4UPG A;  1IH0 A;  1AHR A;  1JF2 A;  1SL9 A;  1ZUZ A;  2KI4 B;  3FS7 A;  2NCO A;  2M9G A;  5HKW A;  4AQI A;  3FIA A;  5G08 A;  1QV1 A;  4GPL B;  2BCA A;  4HRH A;  2IS9 A;  1S5G Z;  1PVA A;  4PCW A;  1QX7 A;  3JTD B;  4M2P A;  2CT9 A;  5CSF A;  1SR6 B;  1A2X A;  2KBI A;  4N1F A;  5JJG A;  1BOD A;  1XFY O;  4A4C A;  4MN0 A;  3M0W A;  4JWQ A;  1B1G A;  4YGA A;  2LAN A;  1Q80 A;  2I18 A;  1AJ5 A;  2I2R E;  4MBE A;  1XFX O;  1XFW O;  1A75 A;  1IQ5 A;  3OB2 B;  1YUU A;  1V1G A;  4R1E A;  1YTZ C;  1CLM A;  2L4I A;  1DTL A;  2G2B A;  3OP0 A;  2EGD A;  1N65 A;  5HLV A;  1FBV A;  1ZMZ A;  3RLZ A;  1K8U A;  1F54 A;  2LV7 A;  1LA3 A;  1J7Q A;  1PSR A;  1QIW A;  1QAS A;  2HQ8 A;  3AKA A;  1B4C A;  2JPT A;  2CCM A;  3BUX B;  4FQO A;  1KSO A;  5ER4 X;  1CFF A;  5CSI A;  1U5I B;  2V53 A;  3IQQ A;  1RTP 1;  5ER5 A;  1MR8 A;  1TTX A;  4PAL A;  2L50 A;  3EVU A;  1QX5 B;  2BEC A;  1SCM B;  2JC2 A;  3DD4 A;  1NYA A;  1DGU A;  2VRG A;  1UUS A;  4YGE B;  2BL0 B;  2GV5 A;  2JTT A;  4MZK A;  4WQ2 A;  3TDI A;  1DGV A;  2KSP A;  1IJ6 A;  5CSJ A;  3TDU A;  3CZT X;  1S5G Y;  3SG5 A;  1Y6W A;  4YI8 A;  2LCP A;  1AUI B;  4E68 A;  3OX5 A;  1UWO A;  2K7C A;  2LMT A;  2Q91 A;  1Y1A A;  3VRO A;  1M46 A;  3PN7 C;  1H4B A;  2L5X B;  2HET A;  5I8N A;  1IKU A;  1DJH A;  5HKZ A;  1MXE A;  1Y0V H;  4A4B A;  4PHK A;  2JU0 A;  1G8I A;  1K94 A;  1CB1 A;  1QJT A;  2I7A A;  1C07 A;  1CM1 A;  3JVT C;  3FWB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...