2BBNA

Solution structure of a calmodulin-target peptide complex by multidimensional nmr
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
148
structure length
148
Chain Sequence
b'ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALMODULIN
molecule tags Calcium-binding protein
source organism Drosophila melanogaster
publication title Solution structure of a calmodulin-target peptide complex by multidimensional NMR.
pubmed rcsb
total genus 32
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 1992-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2bbnA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2bbnA02
2LAPA 1CDMA 1CDLA 2PRUA 2NZ0A 1N2DA 3SJSA 1DF0B 4C0LA 3EVVA 1PK0D 5JOLA 1QV1A 2GV5A 2WC8A 4YI9A 1SR6C 4CIDA 1FI6A 4HRGA 5AFPA 2CTNA 3EKHA 5HLVA 1RROA 2EC6B 4OR9B 1Y6WA 1L2OB 1DF0A 2F8PA 2WCBA 3EKJA 2M9GA 1QIWA 1KQMB 1B7TZ 2BE4A 3OX5A 4PALA 4YGDB 1BLQA 2LV7A 2KHNA 1A75B 5KU1A 2H61A 2LM5A 1N65A 1MF8B 2BCBA 1GJYA 2K2FA 3KEVA 1QX2A 4PHJA 3PN7B 3WNXB 1DT7B 2MA2A 5ER5A 3PLFB 2BE6A 1L7ZA 1NCZA 1BR4B 1G33A 1GGZA 1SL9A 3I5HC 1MXLC 1K9UA 1SKTA 5I2LA 4GGFC 4F0ZB 1UHHA 1NPQA 5G08A 4YGAA 1TNPA 1OZOA 2GGMA 3AKAA 5ER4X 2ZN9A 4DIRA 1M45A 2V53A 2Q4UA 1QXPA 2K7CA 1RK9A 1UHIA 5HKWA 1BOCA 1OMDA 3WHTB 1CMGA 1K90D 2K61A 3SG4A 2AMIA 1RJVA 1KWOB 2G9BA 1NYAA 2M29A 1IH0A 1SY9A 2CBLA 3CR2A 3DVEA 4XJKB 1GGWA 5AANA 2HQ8A 1DGUA 3D10A 2MJWB 5HKZA 2JC2A 3AAJA 1XFUO 3LCPC 4IL1A 2L50A 3TUYC 1FW4A 2COLB 1BJFA 4MRYA 1B1GA 4PHKA 3WHUB 1Y1XA 5HKYA 3ICBA 3E3RA 4NQGA 1K95A 1AHRA 1M46A 2KNEA 3VRPA 1TIZA 2I2RE 3BUXB 1YX7A 1B8RA 1K2HA 2P6BB 3SG5A 1QJTA 2BCAA 2KOTA 2JTZA 2CXJA 1C07A 1BG1A 3JTDB 1OSAA 1FBVA 5AEQA 3VROA 4WRIA 2JXLA 1AK8A 2HQWA 2KYFA 1NP8A 2ZNDA 1A29A 1DJHA 1XFZO 3PFVA 4MBEA 3SIAA 2Y5IA 2K8MB 1FI5A 2KDHA 2HETA 3ZNIA 3RM1A 1CDPA 2PVBA 2PMYA 3VGOA 4ETOA 2JU0A 4USLA 2I18A 4AOMA 5HYDA 1IJ6A 2Q91A 1IG5A 1YUUA 1XFVO 3C1VA 1MHOA 5FYXA 1K93D 3BQ3A 3FIAA 1SL7A 3WXAA 1S5GY 3O6BA 5CSFA 5I2OA 5PALA 1YTZC 4NDBA 2BKHB 2I94A 2E30A 3PSRA 3IQOA 2JT3A 2L98A 1KSOA 2LLTA 3NSOA 2M1KB 4N1GA 4DCKA 1TTXA 1YUSA 4OKHA 2QPTA 3OHMB 5CSJA 4YGCB 4PE1A 2F3ZA 1AJ4A 4Q04A 3JVTC 2O5GA 4PDZA 3TZ1A 1CM1A 2NLNA 3BUWB 3RLZA 2KFFA 2LVKA 3LK1A 1KQMC 3PATA 1PSRA 1R2UA 2KBIA 1JC2A 5DKRA 2DOQA 4C0JA 4ZCUA 2L51A 1OOJA 3TUYB 3I5FB 1LA3A 1UUSA 3QRXA 1RWYA 2LUCA 2KGBC 2SCPA 1UWOA 2VRGA 2L2EA 1MWNA 5D7FA 1NWDA 1NX3A 2EGDA 2F2OA 2HPSA 3OP0A 4MZLA 1EG4A 1UHNA 1JF0A 1IKUA 1C7WA 1SCMB 4BY4A 3GOFA 1UHKA 1L2OC 1CM4A 2MBXA 4WQ3A 4MSPA 1F4OA 4TNCA 1UP5A 3IF7A 1LKJA 2PALA 4PHNA 1PRWA 3EK7A 1OMVA 3OB2B 4MN0A 1KFXL 1J1DA 1BU3A 1MQ1A 1A2XA 4MRXA 2L0PA 1NCXA 1CFFA 2BL0B 5IBWA 2LVIA 1KWOC 1K9KA 4YI8A 4PE0A 1S6IA 2L5XB 2M7NA 1CLMA 1PALA 4P5OE 2KAXA 4DRWA 2EC6C 3CTNA 3K21A 2KBMA 1AVSA 4I5NB 2I7AA 2KI6D 2NCOA 1QS7A 4XJKA 1CB1A 1B47A 4ORAB 1OQPA 2M7LA 4C0KA 1CFCA 3NSKA 1K94A 1CMFA 1H8BA 2H2KA 4HREE 2LUXA 3SG7A 1ZOTB 2AUCA 2WORA 4CFQA 1CDNA 1S6CA 1SNLA 1E8AA 1MXEA 3EK4A 1ZMZA 3SIBA 1A03A 2KI6C 3DF0B 3I5IB 2ZKMX 4P2YB 1DJWA 4FTGA 3GK1A 1KK8C 3KF9A 3NXAA 5AERA 3EK8A 1TCOB 3VRQA 2JT8A 1DGVA 1SBJA 1QIVA 2F33A 1KFUS 1JFJA 1HQVA 1YVHA 1A75A 4I5JA 2LMUA 3I5IC 1M31A 2BECA 3I5GB 1OMRA 3BUMB 3O78A 4ORBB 5F6TA 1S6JA 5K89A 1EXRA 2LC5A 1NX1A 1UHJA 1CTRA 1QASA 1JBAA 4GBAA 1AP4A 1EJ3A 1YRUB 2WCEA 3EVUA 3NSIA 5KTYA 2JOJA 2K2AA 2D8NA 2LLSA 3F45A 1TNWA 1MUXA 2LHIA 1QVIY 1NX0A 1IJ5A 1TCFA 2OS8C 2PASA 3H4SE 5GQQC 1EH2A 3VRRA 1TNQA 1XFYO 4UPGA 1TRFA 2R2IA 4HRHA 5D69A 5I8NA 3BYAA 3CLNA 3CZTX 4N1FA 2NXQA 2H61C 3FWBA 1KK7Z 2LCPA 1SK6D 1M39A 1CLLA 1IQ5A 2HF5A 1B8CA 3KO0A 1KQVA 1LXFC 2OS8B 2QACA 2BL0C 2KAVA 1J7RA 1KK8B 1AUIB 4N5XA 3PM8A 4OCIA 2JZIA 4HSZA 2JTTA 1FPWA 4ORCB 2Y1NA 1S36A 1K96A 4JWQA 1PULA 2M97A 1WRLA 2MLEC 1RFJA 1B9AA 1WDCB 2JQ6A 4M2PA 5DKQA 1F8HA 1ODBA 1V1FA 1G8IA 2B1UA 2MAZA 5CPVA 1DJGA 1YUTA 4JQ0D 2JNFA 2M8UA 1S1EA 2KFHA 4E68A 1C7VA 2Y1MA 3CR5X 4QJ3B 2OPOA 1R6PA 2BBNA 3CR4X 1D1OA 3D0YA 1S3PA 4YGBB 1DJIA 1WLMA 4I5LB 2M0RA 3LL8B 3CGAA 5CSIA 1NIWA 1WY9A 1K9PA 1QTXA 4PE4A 3SG2A 5AXIA 1S5GZ 2GGZA 4CFRA 3TDUA 1BF5A 2PSRA 1J1EA 4M2OA 2K7DA 1BODA 3BUOB 1WLZA 1J7QA 3LK0A 2CNPA 2CT9A 2JPTA 2ZNEA 3CS1A 1F4QA 1U5IB 3GK2A 2JULA 3BUNB 1DVIA 2KI4B 3HX4A 3BOWB 3JVTB 3SG6A 4QJ4B 1LVCD 1SW8A 1NSHA 5KSZA 2E6WA 1JFKA 1HT9A 3OB1B 2L4IA 1ALWA 1JWDA 4CPVA 3ZWHA 5CSNA 3O4YA 1DJZA 1NX2A 2WOSA 4PHMA 3BXKA 2K7BA 1BT6A 1LA0A 1PVBA 3AKBA 3DVJA 1B8LA 1DJXA 1QX7A 2M1UA 2IS9A 4GGFA 2LNKA 4ICBA 3FWCA 1RECA 3CWGA 1V1GA 1ALVA 3PALA 3TS5B 5JJGA 1SRAA 1DTLA 1X02A 2LP3A 1CNPA 1KK7Y 1QLKA 1VRKA 2ZRSA 4YGEB 2LMVA 1UURA 3FS7A 2MLFC 1QX5B 1CFPA 2RGIA 1OE9B 4WQ2A 1EL4A 1QVIZ 2K7OA 4A4CA 2SASA 1XVJA 1H4BA 2OTGB 1KSMA 2KQ6A 3IQQA 1Y1UA 4OVNF 2WNDA 2LE9B 2BBMA 1ZACA 1QLSA 2JXCA 2KAYA 1JSAA 1S26D 1DJYA 2FOTA 2KI4C 4QJ5B 1WDCC 4YRUA 1TNXA 1WRZA 4PCWA 4PE7A 2BKIB 1G4YR 2CCMA 1Y1AA 4GNKB 5HLOA 3JTDC 1A4PA 4AQJA 3DF0A 1FF1A 1W7IB 2TN4A 2ZN8A 2EHBA 2FCDA 3HCMA 3LLEA 4GFTA 2Y4QA 1XO5A 1YX8A 1B4CA 2M3WA 3VRNA 2BCXA 4FQOA 1NUBA 2OTGC 4R1EA 4L9MA 3DVMA 1ZUZA 1J7PA 1DMOA 2LMTA 1JF2A 2NCPA 3TDIA 1CKKA 2F3YA 4MZJA 4NDCA 1OZSA 2LANA 2KGRA 1B7TY 2LVVA 1PSBA 1YVLA 2KYCA 1KCYA 5I2QA 1SMGA 1Y0VH 3O2PA 5TNCA 2JT0A 1YR5A 2ISDA 1Q80A 3TS5C 4I5KA 4AQIA 4OV2A 2LP2A 1M63B 3PN7C 1MR8A 1JUOA 1TN4A 2JWWA 1WRKA 2LVJA 1CFDA 4NDDA 2G2BA 1F54A 1CLBA 3DD4A 1BR1B 3AAKA 1XK4C 4YBHB 3TDZA 1KFUL 1BMOA 1RTP1 2JNXA 3GK4X 3A4UB 4U8DA 5B8IB 4XYNA 4D1EA 1F71A 4GGNA 2WCFA 1EG3A 1IQ3A 1XK4A 4GUKA 1IWQA 1XFWO 1TOPA 1U5IA 1AJ5A 2JRFA 5J3XA 3NSLA 1SYMA 4MEWA 4CLNA 1SR6B 2KSPA 1SL8A 2K0JA 4GAOA 4BY5A 1IRJA 1ZFSA 1IGVA 1QATA 1N0YA 1NCYA 1XA5A 2AAOA 2O60A 3A8RA 1SCVA 3KPXA 4GPLB 4M2QA 4DUQA 2FCEA 5DKNA 2KFGA 3D0YB 2LHLA 2L4HA 1SCMC 1W7JB 4MLWA 2A4JA 1PVAA 2MRDA 2KQYA 2ZRTA 4MVFA 3KHEA 3MSEB 1GQMA 1XYDA 2MHHA 2ZFDA 4MZKA 3M0WA 3SG3A 4A4BA 4ZCVA 4DS7A 1SPYA 1J7OA 4JPZB 3OX6A 1KFXS 3I5FC 3DVKA 3I5GC 5BPJA 3EVRA 3I5HB 2F2PA 1YRTB 2M49B 1J55A 1F55A 3BOWA 2FJUB 1K8UA 1F70A 2LLUA 1QV0A 1LINA 1XFXO 1YURA
chains in the Genus database with same CATH superfamily
2LAPA 1CDMA 1CDLA 2PRUA 2NZ0A 1N2DA 3SJSA 1DF0B 4C0LA 3EVVA 1PK0D 5JOLA 1QV1A 2GV5A 2WC8A 4YI9A 1SR6C 4CIDA 1FI6A 4HRGA 5AFPA 2CTNA 3EKHA 5HLVA 1RROA 2EC6B 4OR9B 1Y6WA 1L2OB 1DF0A 2F8PA 2WCBA 3EKJA 2M9GA 1QIWA 1KQMB 1B7TZ 2BE4A 3OX5A 3B86A 4PALA 4YGDB 2LV7A 1BLQA 2KHNA 1A75B 5KU1A 2H61A 2LM5A 1N65A 1MF8B 2BCBA 1GJYA 2K2FA 3KEVA 1QX2A 4PHJA 3PN7B 3WNXB 1DT7B 2MA2A 3R1PA 3PLFB 5ER5A 2BE6A 3B6XA 1L7ZA 1NCZA 1BR4B 1G33A 1GGZA 1SL9A 3I5HC 1MXLC 1K9UA 1SKTA 5I2LA 4GGFC 4F0ZB 5I94A 3S0FA 1UHHA 1NPQA 5G08A 4YGAA 1TNPA 2KLEA 1OZOA 2GGMA 3AKAA 5ER4X 2ZN9A 4DIRA 1M45A 2V53A 2Q4UA 3NHTA 1QXPA 3CZ0A 2K7CA 1RK9A 1UHIA 5HKWA 1BOCA 1OMDA 3WHTB 1CMGA 1K90D 2K61A 3SG4A 3CZ2A 2AMIA 3CYZA 5D3OA 1RJVA 1DQEA 1KWOB 2G9BA 1NYAA 2M29A 3R1OA 3SS3A 1IH0A 1SY9A 2CBLA 3CR2A 3DVEA 4XJKB 1GGWA 5AANA 2HQ8A 1DGUA 3D10A 3EG5B 2MJWB 5HKZA 2JC2A 3AAJA 1XFUO 3LCPC 4IL1A 2L50A 4PT1A 3TUYC 1QWVA 1FW4A 2COLB 1BJFA 4MRYA 1B1GA 4PHKA 3WHUB 1Y1XA 3S0DA 3ICBA 5HKYA 3E3RA 4NQGA 1K95A 1AHRA 1M46A 2KNEA 5FI2A 3VRPA 1TIZA 2I2RE 3CZ1A 3BUXB 1YX7A 1B8RA 1K2HA 1OOHA 2P6BB 3SG5A 1QJTA 2BCAA 2KOTA 2JTZA 2CXJA 1TUJA 2WCJA 1C07A 1BG1A 3JTDB 1OSAA 1FBVA 5AEQA 3VROA 5FI7A 4WRIA 2JXLA 1AK8A 2QEHA 2HQWA 2KYFA 1NP8A 2ZNDA 1A29A 1DJHA 1XFZO 3PFVA 4MBEA 3SIAA 2Y5IA 2K8MB 3FE8A 3PJIA 1FI5A 2KDHA 2QEOA 2HETA 3ZNIA 2PQLA 3R1VA 3RM1A 2WC5A 1CDPA 3NGVA 2PVBA 2PMYA 3VGOA 4ETOA 2JU0A 4USLA 2I18A 4AOMA 5HYDA 1IJ6A 2Q91A 1IG5A 3CABA 1YUUA 1XFVO 3C1VA 1MHOA 5FYXA 1K93D 3BQ3A 3CDNA 3FIAA 1SL7A 3WXAA 1S5GY 3O6BA 5CSFA 5I2OA 5PALA 1YTZC 4NDBA 2BKHB 2I94A 2E30A 3PSRA 3IQOA 1Z2CB 2JT3A 2L98A 1KSOA 2LLTA 3NSOA 2M1KB 3K1EA 4N1GA 4DCKA 1W9ZA 1TTXA 1YUSA 4OKHA 2QPTA 5FI6A 3OHMB 5CSJA 4YGCB 4PE1A 2F3ZA 1AJ4A 4Q04A 3JVTC 2O5GA 4PDZA 3TZ1A 1CM1A 4INXA 2NLNA 3BUWB 2L5YA 3RLZA 2KFFA 2LVKA 3LK1A 1KQMC 3PATA 1PSRA 1R2UA 2KBIA 1JC2A 3OGNA 5DKRA 2DOQA 4C0JA 4ZCUA 2L51A 1OOJA 3TUYB 3QMEA 3I5FB 2QEVA 1LA3A 1UUSA 3QRXA 1RWYA 2LUCA 2KGBC 2SCPA 1UWOA 2K60A 2VRGA 2L2EA 1MWNA 5D7FA 1NWDA 1NX3A 1OW4A 2EGDA 2F2OA 2HPSA 3OP0A 4MZLA 1EG4A 3RZSA 1UHNA 1C3ZA 1JF0A 1IKUA 1C7WA 1SCMB 2BAPA 4BY4A 3GOFA 1UHKA 1LS8A 1L2OC 1CM4A 2MBXA 4WQ3A 4MSPA 1F4OA 4TNCA 1TWOA 1UP5A 3IF7A 1LKJA 2PALA 4PHNA 1PRWA 3EK7A 1OMVA 3D74A 3OB2B 3S0AA 4JD9A 4MN0A 1KFXL 1J1DA 1BU3A 1MQ1A 1A2XA 3FE6A 2L0PA 1NCXA 4MRXA 1CFFA 2BL0B 3L4AA 5IBWA 2LVIA 1KWOC 1K9KA 4YI8A 1DEKA 4PE0A 1S6IA 2L5XB 2M7NA 1CLMA 1PALA 4P5OE 3SS5A 2KAXA 4DRWA 2EC6C 3CTNA 1OOIX 3K21A 2KBMA 1AVSA 4I5NB 2I7AA 2KI6D 2NCOA 2FJYA 1QS7A 4XJKA 4F7FA 1CB1A 1B47A 4ORAB 1OQPA 2M7LA 4C0KA 1CFCA 3NSKA 1K94A 1CMFA 1H8BA 2H2KA 4HREE 2LUXA 3SG7A 1ZOTB 2AUCA 2WORA 4CFQA 1CDNA 1OOGA 1S6CA 1SNLA 1E8AA 1MXEA 2P71A 3D78A 3EK4A 1ZMZA 3SIBA 1A03A 2KI6C 3DF0B 3I5IB 2ZKMX 3VB1A 4P2YB 1DJWA 4FTGA 3D75A 3GK1A 1KK8C 3KF9A 3NXAA 5AERA 3EK8A 1TCOB 3VRQA 4INWA 3O4XA 2JT8A 1DGVA 1SBJA 1QIVA 2F33A 1KFUS 1JFJA 1HQVA 1YVHA 1A75A 4I5JA 2LMUA 3I5IC 1M31A 2BECA 3I5GB 1OMRA 3BUMB 3O78A 4ORBB 5F6TA 1S6JA 2QEBA 5K89A 1EXRA 2LC5A 1NX1A 1UHJA 1CTRA 1QASA 2PYQA 4GBAA 1JBAA 1AP4A 1EJ3A 1YRUB 2WCEA 3EVUA 3NSIA 5KTYA 2JOJA 2K2AA 2WCHA 2D8NA 2LLSA 3F45A 1TNWA 1MUXA 2LHIA 1QVIY 1NX0A 1IJ5A 1TCFA 2OS8C 2PASA 3H4SE 5GQQC 1EH2A 3VRRA 1TNQA 1XFYO 4UPGA 1TRFA 2R2IA 4HRHA 5D69A 5I8NA 3BYAA 3CLNA 3CZTX 4N1FA 2NXQA 2H61C 3FWBA 1KK7Z 2LCPA 1SK6D 3B88A 1M39A 1CLLA 1IQ5A 2HF5A 1B8CA 3KO0A 1KQVA 1LXFC 2OS8B 2QACA 2BL0C 2KAVA 1J7RA 1KK8B 1AUIB 4N5XA 3S0EA 3DYEA 3PM8A 4OCIA 2JZIA 4HSZA 3UO9A 2JTTA 1FPWA 4ORCB 3N7HA 2Y1NA 1S36A 1K96A 4JWQA 3BFAA 1PULA 2M97A 1WRLA 2MLEC 1RFJA 1B9AA 1WDCB 2JQ6A 4M2PA 5DKQA 1F8HA 1ODBA 1V1FA 1G8IA 2B1UA 2MAZA 5CPVA 1DJGA 2QDIA 1YUTA 4JQ0D 2WCKA 2JNFA 2M8UA 1S1EA 2KFHA 4E68A 5HL1A 1ORGA 1C7VA 2Y1MA 3CR5X 4QJ3B 2OPOA 1R6PA 2P70A 2BBNA 3CR4X 1D1OA 3D0YA 1S3PA 4YGBB 1DJIA 1WLMA 4I5LB 3S0GA 2M0RA 3LL8B 3CGAA 5CSIA 1NIWA 1WY9A 1K9PA 1QTXA 3BFHA 4PE4A 3SG2A 5AXIA 1S5GZ 2GGZA 4CFRA 3TDUA 1BF5A 2PSRA 1J1EA 4M2OA 2K7DA 3R72A 1BODA 3NHIA 3BUOB 1GM0A 1WLZA 1J7QA 3LK0A 2CNPA 2CT9A 2JPTA 2ZNEA 3CS1A 4IJ7A 1F4QA 1U5IB 3GK2A 2JULA 3OBVA 3BUNB 1DVIA 2KI4B 3HX4A 3BOWB 3JVTB 3SG6A 2KPHA 3L47A 4QJ4B 1LVCD 1SW8A 1NSHA 5KSZA 2E6WA 1JFKA 1HT9A 3OB1B 2L4IA 1ALWA 3DY9A 1JWDA 4CPVA 3ZWHA 5CSNA 3O4YA 1C3YA 1DJZA 1NX2A 2WOSA 3D77A 4PHMA 3BXKA 2K7BA 1BT6A 1LA0A 1PVBA 3AKBA 3DVJA 1B8LA 1DJXA 1QX7A 2M1UA 2IS9A 4GGFA 4JKTA 3S0BA 2LNKA 4ICBA 3FWCA 1RECA 3CWGA 1V1GA 1ALVA 3BFBA 3PALA 2YGUA 3TS5B 5JJGA 1SRAA 1DTLA 1X02A 2LP3A 1CNPA 1KK7Y 1QLKA 1VRKA 2ZRSA 1IIOA 4YGEB 2LMVA 3DXLA 3BJHA 1UURA 3FS7A 2MLFC 1QX5B 1SSEB 3D76A 3FE9A 1OOFA 1CFPA 2RGIA 3Q8IA 1OE9B 4WQ2A 1EL4A 1QVIZ 2WCMA 2K7OA 4A4CA 2SASA 1XVJA 1H4BA 2OTGB 2KLDA 1KSMA 2KQ6A 3IQQA 1Y1UA 4OVNF 2WNDA 2LE9B 2BBMA 1ZACA 1QLSA 2JXCA 2KAYA 1JSAA 1S26D 3V2LA 1DJYA 2FOTA 2KI4C 3PM2A 1WDCC 4QJ5B 4YRUA 1TNXA 1WRZA 4PCWA 4PE7A 2BKIB 1G4YR 3IVTA 2CCMA 1Y1AA 4GNKB 5HLOA 3JTDC 1XFRA 1A4PA 4AQJA 3DF0A 1FF1A 1W7IB 2TN4A 2ZN8A 2GTEA 2EHBA 2FCDA 3HCMA 3LLEA 4GFTA 1T14A 2Y4QA 1XO5A 1YX8A 1B4CA 2M3WA 3VRNA 2BCXA 4FQOA 1NUBA 2OTGC 2JPOA 4R1EA 1P28A 4L9MA 3DVMA 1ZUZA 1J7PA 1DMOA 2LMTA 1JF2A 2NCPA 3D73A 3TDIA 1CKKA 2F3YA 4FQTA 4MZJA 4NDCA 1Z4HA 1OZSA 2LANA 2KGRA 1B7TY 2LVVA 1PSBA 1YVLA 2KYCA 1KCYA 5I2QA 1SMGA 1Y0VH 3O2PA 5TNCA 1DELA 2JT0A 1YR5A 2ISDA 1Q80A 2BNXA 3TS5C 4I5KA 4AQIA 4OV2A 2LP2A 1M63B 3PN7C 1MR8A 1JUOA 1TN4A 2JWWA 1WRKA 2LVJA 4OZDA 1CFDA 4NDDA 2G2BA 1F54A 1CLBA 3DD4A 1BR1B 2ERBA 1XK4C 3AAKA 4YBHB 3TDZA 1KFUL 1BMOA 1RTP1 2JNXA 3GK4X 3A4UB 2WC6A 4U8DA 2H8VA 5B8IB 4XYNA 3SS4A 3B87A 4D1EA 1F71A 4GGNA 2WCFA 1EG3A 1IQ3A 1XK4A 4KYNA 4GUKA 1IWQA 1XFWO 1TOPA 1U5IA 1AJ5A 2JRFA 2L2CA 5J3XA 3NSLA 3UNWA 2WCLA 1SYMA 4MEWA 4CLNA 1SR6B 5DICA 2KSPA 1SL8A 2K0JA 4GAOA 4BY5A 1IRJA 1ZFSA 1IGVA 1QATA 1N0YA 1NCYA 1XA5A 2AAOA 3L4LA 2O60A 3A8RA 1SCVA 3KPXA 4GPLB 4M2QA 4DUQA 1DC1A 2FCEA 5DKNA 2KFGA 3DZTA 3D0YB 2LHLA 2L4HA 1SCMC 1W7JB 4MLWA 2A4JA 1PVAA 2MRDA 2KQYA 2ZRTA 4MVFA 3KHEA 3B7AA 3MSEB 1GQMA 1XYDA 2MHHA 2ZFDA 1TUZA 3M0WA 4MZKA 5EL2A 4ZCVA 3SG3A 1SPYA 4A4BA 4JPZB 1J7OA 3OX6A 1KFXS 3I5FC 3DVKA 3I5GC 5BPJA 3EVRA 3I5HB 2F2PA 1YRTB 2M49B 1J55A 1F55A 3BOWA 1K8UA 2FJUB 1F70A 2LLUA 1QV0A 1LINA 4DS7A 1XFXO 1YURA
chains in the Genus database with same CATH topology
2LAPA 1CDMA 1CDLA 2PRUA 2NZ0A 1N2DA 3SJSA 1DF0B 4C0LA 3EVVA 1PK0D 5JOLA 1QV1A 2GV5A 2WC8A 4YI9A 1SR6C 4CIDA 1FI6A 4HRGA 5AFPA 2CTNA 3EKHA 5HLVA 1RROA 2EC6B 4OR9B 1Y6WA 1L2OB 1DF0A 2F8PA 2WCBA 3EKJA 2M9GA 1QIWA 1KQMB 1B7TZ 2BE4A 3OX5A 4PALA 4YGDB 1BLQA 2LV7A 2KHNA 1A75B 5KU1A 2H61A 2LM5A 1N65A 1MF8B 2BCBA 1GJYA 2K2FA 3KEVA 1QX2A 4PHJA 3PN7B 3WNXB 1DT7B 2MA2A 5ER5A 3PLFB 2BE6A 1L7ZA 1NCZA 1BR4B 1G33A 1GGZA 1SL9A 3I5HC 1MXLC 1K9UA 1SKTA 5I2LA 4GGFC 4F0ZB 1UHHA 1NPQA 5G08A 4YGAA 1TNPA 1OZOA 2GGMA 3AKAA 5ER4X 2ZN9A 4DIRA 1M45A 2V53A 2Q4UA 1QXPA 2K7CA 1RK9A 1UHIA 5HKWA 1BOCA 1OMDA 3WHTB 1CMGA 1K90D 2K61A 3SG4A 2AMIA 1RJVA 1KWOB 2G9BA 1NYAA 2M29A 1IH0A 1SY9A 2CBLA 3CR2A 3DVEA 4XJKB 1GGWA 5AANA 2HQ8A 1DGUA 3D10A 2MJWB 5HKZA 2JC2A 3AAJA 1XFUO 3LCPC 4IL1A 2L50A 3TUYC 1FW4A 2COLB 1BJFA 4MRYA 1B1GA 4PHKA 3WHUB 1Y1XA 5HKYA 3ICBA 3E3RA 4NQGA 1K95A 1AHRA 1M46A 2KNEA 3VRPA 1TIZA 2I2RE 3BUXB 1YX7A 1B8RA 1K2HA 2P6BB 3SG5A 1QJTA 2BCAA 2KOTA 2JTZA 2CXJA 1C07A 1BG1A 3JTDB 1OSAA 1FBVA 5AEQA 3VROA 4WRIA 2JXLA 1AK8A 2HQWA 2KYFA 1NP8A 2ZNDA 1A29A 1DJHA 1XFZO 3PFVA 4MBEA 3SIAA 2Y5IA 2K8MB 1FI5A 2KDHA 2HETA 3ZNIA 3RM1A 1CDPA 2PVBA 2PMYA 3VGOA 4ETOA 2JU0A 4USLA 2I18A 4AOMA 5HYDA 1IJ6A 2Q91A 1IG5A 1YUUA 1XFVO 3C1VA 1MHOA 5FYXA 1K93D 3BQ3A 3FIAA 1SL7A 3WXAA 1S5GY 3O6BA 5CSFA 5I2OA 5PALA 1YTZC 4NDBA 2BKHB 2I94A 2E30A 3PSRA 3IQOA 2JT3A 2L98A 1KSOA 2LLTA 3NSOA 2M1KB 4N1GA 4DCKA 1TTXA 1YUSA 4OKHA 2QPTA 3OHMB 5CSJA 4YGCB 4PE1A 2F3ZA 1AJ4A 4Q04A 3JVTC 2O5GA 4PDZA 3TZ1A 1CM1A 2NLNA 3BUWB 3RLZA 2KFFA 2LVKA 3LK1A 1KQMC 3PATA 1PSRA 1R2UA 2KBIA 1JC2A 5DKRA 2DOQA 4C0JA 4ZCUA 2L51A 1OOJA 3TUYB 3I5FB 1LA3A 1UUSA 3QRXA 1RWYA 2LUCA 2KGBC 2SCPA 1UWOA 2VRGA 2L2EA 1MWNA 5D7FA 1NWDA 1NX3A 2EGDA 2F2OA 2HPSA 3OP0A 4MZLA 1EG4A 1UHNA 1JF0A 1IKUA 1C7WA 1SCMB 4BY4A 3GOFA 1UHKA 1L2OC 1CM4A 2MBXA 4WQ3A 4MSPA 1F4OA 4TNCA 1UP5A 3IF7A 1LKJA 2PALA 4PHNA 1PRWA 3EK7A 1OMVA 3OB2B 4MN0A 1KFXL 1J1DA 1BU3A 1MQ1A 1A2XA 4MRXA 2L0PA 1NCXA 1CFFA 2BL0B 5IBWA 2LVIA 1KWOC 1K9KA 4YI8A 4PE0A 1S6IA 2L5XB 2M7NA 1CLMA 1PALA 4P5OE 2KAXA 4DRWA 2EC6C 3CTNA 3K21A 2KBMA 1AVSA 4I5NB 2I7AA 2KI6D 2NCOA 1QS7A 4XJKA 1CB1A 1B47A 4ORAB 1OQPA 2M7LA 4C0KA 1CFCA 3NSKA 1K94A 1CMFA 1H8BA 2H2KA 4HREE 2LUXA 3SG7A 1ZOTB 2AUCA 2WORA 4CFQA 1CDNA 1S6CA 1SNLA 1E8AA 1MXEA 3EK4A 1ZMZA 3SIBA 1A03A 2KI6C 3DF0B 3I5IB 2ZKMX 4P2YB 1DJWA 4FTGA 3GK1A 1KK8C 3KF9A 3NXAA 5AERA 3EK8A 1TCOB 3VRQA 2JT8A 1DGVA 1SBJA 1QIVA 2F33A 1KFUS 1JFJA 1HQVA 1YVHA 1A75A 4I5JA 2LMUA 3I5IC 1M31A 2BECA 3I5GB 1OMRA 3BUMB 3O78A 4ORBB 5F6TA 1S6JA 5K89A 1EXRA 2LC5A 1NX1A 1UHJA 1CTRA 1QASA 1JBAA 4GBAA 1AP4A 1EJ3A 1YRUB 2WCEA 3EVUA 3NSIA 5KTYA 2JOJA 2K2AA 2D8NA 2LLSA 3F45A 1TNWA 1MUXA 2LHIA 1QVIY 1NX0A 1IJ5A 1TCFA 2OS8C 2PASA 3H4SE 5GQQC 1EH2A 3VRRA 1TNQA 1XFYO 4UPGA 1TRFA 2R2IA 4HRHA 5D69A 5I8NA 3BYAA 3CLNA 3CZTX 4N1FA 2NXQA 2H61C 3FWBA 1KK7Z 2LCPA 1SK6D 1M39A 1CLLA 1IQ5A 2HF5A 1B8CA 3KO0A 1KQVA 1LXFC 2OS8B 2QACA 2BL0C 2KAVA 1J7RA 1KK8B 1AUIB 4N5XA 3PM8A 4OCIA 2JZIA 4HSZA 2JTTA 1FPWA 4ORCB 2Y1NA 1S36A 1K96A 4JWQA 1PULA 2M97A 1WRLA 2MLEC 1RFJA 1B9AA 1WDCB 2JQ6A 4M2PA 5DKQA 1F8HA 1ODBA 1V1FA 1G8IA 2B1UA 2MAZA 5CPVA 1DJGA 1YUTA 4JQ0D 2JNFA 2M8UA 1S1EA 2KFHA 4E68A 1C7VA 2Y1MA 3CR5X 4QJ3B 2OPOA 1R6PA 2BBNA 3CR4X 1D1OA 3D0YA 1S3PA 4YGBB 1DJIA 1WLMA 4I5LB 2M0RA 3LL8B 3CGAA 5CSIA 1NIWA 1WY9A 1K9PA 1QTXA 4PE4A 3SG2A 5AXIA 1S5GZ 2GGZA 4CFRA 3TDUA 1BF5A 2PSRA 1J1EA 4M2OA 2K7DA 1BODA 3BUOB 1WLZA 1J7QA 3LK0A 2CNPA 2CT9A 2JPTA 2ZNEA 3CS1A 1F4QA 1U5IB 3GK2A 2JULA 3BUNB 1DVIA 2KI4B 3HX4A 3BOWB 3JVTB 3SG6A 4QJ4B 1LVCD 1SW8A 1NSHA 5KSZA 2E6WA 1JFKA 1HT9A 3OB1B 2L4IA 1ALWA 1JWDA 4CPVA 3ZWHA 5CSNA 3O4YA 1DJZA 1NX2A 2WOSA 4PHMA 3BXKA 2K7BA 1BT6A 1LA0A 1PVBA 3AKBA 3DVJA 1B8LA 1DJXA 1QX7A 2M1UA 2IS9A 4GGFA 2LNKA 4ICBA 3FWCA 1RECA 3CWGA 1V1GA 1ALVA 3PALA 3TS5B 5JJGA 1SRAA 1DTLA 1X02A 2LP3A 1CNPA 1KK7Y 1QLKA 1VRKA 2ZRSA 4YGEB 2LMVA 1UURA 3FS7A 2MLFC 1QX5B 1CFPA 2RGIA 1OE9B 4WQ2A 1EL4A 1QVIZ 2K7OA 4A4CA 2SASA 1XVJA 1H4BA 2OTGB 1KSMA 2KQ6A 3IQQA 1Y1UA 4OVNF 2WNDA 2LE9B 2BBMA 1ZACA 1QLSA 2JXCA 2KAYA 1JSAA 1S26D 1DJYA 2FOTA 2KI4C 4QJ5B 1WDCC 4YRUA 1TNXA 1WRZA 4PCWA 4PE7A 2BKIB 1G4YR 2CCMA 1Y1AA 4GNKB 5HLOA 3JTDC 1A4PA 4AQJA 3DF0A 1FF1A 1W7IB 2TN4A 2ZN8A 2EHBA 2FCDA 3HCMA 3LLEA 4GFTA 2Y4QA 1XO5A 1YX8A 1B4CA 2M3WA 3VRNA 2BCXA 4FQOA 1NUBA 2OTGC 4R1EA 4L9MA 3DVMA 1ZUZA 1J7PA 1DMOA 2LMTA 1JF2A 2NCPA 3TDIA 1CKKA 2F3YA 4MZJA 4NDCA 1OZSA 2LANA 2KGRA 1B7TY 2LVVA 1PSBA 1YVLA 2KYCA 1KCYA 5I2QA 1SMGA 1Y0VH 3O2PA 5TNCA 2JT0A 1YR5A 2ISDA 1Q80A 3TS5C 4I5KA 4AQIA 4OV2A 2LP2A 1M63B 3PN7C 1MR8A 1JUOA 1TN4A 2JWWA 1WRKA 2LVJA 1CFDA 4NDDA 2G2BA 1F54A 1CLBA 3DD4A 1BR1B 3AAKA 1XK4C 4YBHB 3TDZA 1KFUL 1BMOA 1RTP1 2JNXA 3GK4X 3A4UB 4U8DA 5B8IB 4XYNA 4D1EA 1F71A 4GGNA 2WCFA 1EG3A 1IQ3A 1XK4A 4GUKA 1IWQA 1XFWO 1TOPA 1U5IA 1AJ5A 2JRFA 5J3XA 3NSLA 1SYMA 4MEWA 4CLNA 1SR6B 2KSPA 1SL8A 2K0JA 4GAOA 4BY5A 1IRJA 1ZFSA 1IGVA 1QATA 1N0YA 1NCYA 1XA5A 2AAOA 2O60A 3A8RA 1SCVA 3KPXA 4GPLB 4M2QA 4DUQA 2FCEA 5DKNA 2KFGA 3D0YB 2LHLA 2L4HA 1SCMC 1W7JB 4MLWA 2A4JA 1PVAA 2MRDA 2KQYA 2ZRTA 4MVFA 3KHEA 3MSEB 1GQMA 1XYDA 2MHHA 2ZFDA 4MZKA 3M0WA 3SG3A 4A4BA 4ZCVA 4DS7A 1SPYA 1J7OA 4JPZB 3OX6A 1KFXS 3I5FC 3DVKA 3I5GC 5BPJA 3EVRA 3I5HB 2F2PA 1YRTB 2M49B 1J55A 1F55A 3BOWA 2FJUB 1K8UA 1F70A 2LLUA 1QV0A 1LINA 1XFXO 1YURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LAP A;  1CDM A;  1CDL A;  2PRU A;  2NZ0 A;  1N2D A;  3SJS A;  1DF0 B;  4C0L A;  3EVV A;  1PK0 D;  5JOL A;  1QV1 A;  2GV5 A;  2WC8 A;  4YI9 A;  1SR6 C;  4CID A;  1FI6 A;  4HRG A;  5AFP A;  2CTN A;  3EKH A;  5HLV A;  1RRO A;  2EC6 B;  4OR9 B;  1Y6W A;  1L2O B;  1DF0 A;  2F8P A;  2WCB A;  3EKJ A;  2M9G A;  1QIW A;  1KQM B;  1B7T Z;  2BE4 A;  3OX5 A;  4PAL A;  4YGD B;  1BLQ A;  2LV7 A;  2KHN A;  1A75 B;  5KU1 A;  2H61 A;  2LM5 A;  1N65 A;  1MF8 B;  2BCB A;  1GJY A;  2K2F A;  3KEV A;  1QX2 A;  4PHJ A;  3PN7 B;  3WNX B;  1DT7 B;  2MA2 A;  5ER5 A;  3PLF B;  2BE6 A;  1L7Z A;  1NCZ A;  1BR4 B;  1G33 A;  1GGZ A;  1SL9 A;  3I5H C;  1MXL C;  1K9U A;  1SKT A;  5I2L A;  4GGF C;  4F0Z B;  1UHH A;  1NPQ A;  5G08 A;  4YGA A;  1TNP A;  1OZO A;  2GGM A;  3AKA A;  5ER4 X;  2ZN9 A;  4DIR A;  1M45 A;  2V53 A;  2Q4U A;  1QXP A;  2K7C A;  1RK9 A;  1UHI A;  5HKW A;  1BOC A;  1OMD A;  3WHT B;  1CMG A;  1K90 D;  2K61 A;  3SG4 A;  2AMI A;  1RJV A;  1KWO B;  2G9B A;  1NYA A;  2M29 A;  1IH0 A;  1SY9 A;  2CBL A;  3CR2 A;  3DVE A;  4XJK B;  1GGW A;  5AAN A;  2HQ8 A;  1DGU A;  3D10 A;  2MJW B;  5HKZ A;  2JC2 A;  3AAJ A;  1XFU O;  3LCP C;  4IL1 A;  2L50 A;  3TUY C;  1FW4 A;  2COL B;  1BJF A;  4MRY A;  1B1G A;  4PHK A;  3WHU B;  1Y1X A;  5HKY A;  3ICB A;  3E3R A;  4NQG A;  1K95 A;  1AHR A;  1M46 A;  2KNE A;  3VRP A;  1TIZ A;  2I2R E;  3BUX B;  1YX7 A;  1B8R A;  1K2H A;  2P6B B;  3SG5 A;  1QJT A;  2BCA A;  2KOT A;  2JTZ A;  2CXJ A;  1C07 A;  1BG1 A;  3JTD B;  1OSA A;  1FBV A;  5AEQ A;  3VRO A;  4WRI A;  2JXL A;  1AK8 A;  2HQW A;  2KYF A;  1NP8 A;  2ZND A;  1A29 A;  1DJH A;  1XFZ O;  3PFV A;  4MBE A;  3SIA A;  2Y5I A;  2K8M B;  1FI5 A;  2KDH A;  2HET A;  3ZNI A;  3RM1 A;  1CDP A;  2PVB A;  2PMY A;  3VGO A;  4ETO A;  2JU0 A;  4USL A;  2I18 A;  4AOM A;  5HYD A;  1IJ6 A;  2Q91 A;  1IG5 A;  1YUU A;  1XFV O;  3C1V A;  1MHO A;  5FYX A;  1K93 D;  3BQ3 A;  3FIA A;  1SL7 A;  3WXA A;  1S5G Y;  3O6B A;  5CSF A;  5I2O A;  5PAL A;  1YTZ C;  4NDB A;  2BKH B;  2I94 A;  2E30 A;  3PSR A;  3IQO A;  2JT3 A;  2L98 A;  1KSO A;  2LLT A;  3NSO A;  2M1K B;  4N1G A;  4DCK A;  1TTX A;  1YUS A;  4OKH A;  2QPT A;  3OHM B;  5CSJ A;  4YGC B;  4PE1 A;  2F3Z A;  1AJ4 A;  4Q04 A;  3JVT C;  2O5G A;  4PDZ A;  3TZ1 A;  1CM1 A;  2NLN A;  3BUW B;  3RLZ A;  2KFF A;  2LVK A;  3LK1 A;  1KQM C;  3PAT A;  1PSR A;  1R2U A;  2KBI A;  1JC2 A;  5DKR A;  2DOQ A;  4C0J A;  4ZCU A;  2L51 A;  1OOJ A;  3TUY B;  3I5F B;  1LA3 A;  1UUS A;  3QRX A;  1RWY A;  2LUC A;  2KGB C;  2SCP A;  1UWO A;  2VRG A;  2L2E A;  1MWN A;  5D7F A;  1NWD A;  1NX3 A;  2EGD A;  2F2O A;  2HPS A;  3OP0 A;  4MZL A;  1EG4 A;  1UHN A;  1JF0 A;  1IKU A;  1C7W A;  1SCM B;  4BY4 A;  3GOF A;  1UHK A;  1L2O C;  1CM4 A;  2MBX A;  4WQ3 A;  4MSP A;  1F4O A;  4TNC A;  1UP5 A;  3IF7 A;  1LKJ A;  2PAL A;  4PHN A;  1PRW A;  3EK7 A;  1OMV A;  3OB2 B;  4MN0 A;  1KFX L;  1J1D A;  1BU3 A;  1MQ1 A;  1A2X A;  4MRX A;  2L0P A;  1NCX A;  1CFF A;  2BL0 B;  5IBW A;  2LVI A;  1KWO C;  1K9K A;  4YI8 A;  4PE0 A;  1S6I A;  2L5X B;  2M7N A;  1CLM A;  1PAL A;  4P5O E;  2KAX A;  4DRW A;  2EC6 C;  3CTN A;  3K21 A;  2KBM A;  1AVS A;  4I5N B;  2I7A A;  2KI6 D;  2NCO A;  1QS7 A;  4XJK A;  1CB1 A;  1B47 A;  4ORA B;  1OQP A;  2M7L A;  4C0K A;  1CFC A;  3NSK A;  1K94 A;  1CMF A;  1H8B A;  2H2K A;  4HRE E;  2LUX A;  3SG7 A;  1ZOT B;  2AUC A;  2WOR A;  4CFQ A;  1CDN A;  1S6C A;  1SNL A;  1E8A A;  1MXE A;  3EK4 A;  1ZMZ A;  3SIB A;  1A03 A;  2KI6 C;  3DF0 B;  3I5I B;  2ZKM X;  4P2Y B;  1DJW A;  4FTG A;  3GK1 A;  1KK8 C;  3KF9 A;  3NXA A;  5AER A;  3EK8 A;  1TCO B;  3VRQ A;  2JT8 A;  1DGV A;  1SBJ A;  1QIV A;  2F33 A;  1KFU S;  1JFJ A;  1HQV A;  1YVH A;  1A75 A;  4I5J A;  2LMU A;  3I5I C;  1M31 A;  2BEC A;  3I5G B;  1OMR A;  3BUM B;  3O78 A;  4ORB B;  5F6T A;  1S6J A;  5K89 A;  1EXR A;  2LC5 A;  1NX1 A;  1UHJ A;  1CTR A;  1QAS A;  1JBA A;  4GBA A;  1AP4 A;  1EJ3 A;  1YRU B;  2WCE A;  3EVU A;  3NSI A;  5KTY A;  2JOJ A;  2K2A A;  2D8N A;  2LLS A;  3F45 A;  1TNW A;  1MUX A;  2LHI A;  1QVI Y;  1NX0 A;  1IJ5 A;  1TCF A;  2OS8 C;  2PAS A;  3H4S E;  5GQQ C;  1EH2 A;  3VRR A;  1TNQ A;  1XFY O;  4UPG A;  1TRF A;  2R2I A;  4HRH A;  5D69 A;  5I8N A;  3BYA A;  3CLN A;  3CZT X;  4N1F A;  2NXQ A;  2H61 C;  3FWB A;  1KK7 Z;  2LCP A;  1SK6 D;  1M39 A;  1CLL A;  1IQ5 A;  2HF5 A;  1B8C A;  3KO0 A;  1KQV A;  1LXF C;  2OS8 B;  2QAC A;  2BL0 C;  2KAV A;  1J7R A;  1KK8 B;  1AUI B;  4N5X A;  3PM8 A;  4OCI A;  2JZI A;  4HSZ A;  2JTT A;  1FPW A;  4ORC B;  2Y1N A;  1S36 A;  1K96 A;  4JWQ A;  1PUL A;  2M97 A;  1WRL A;  2MLE C;  1RFJ A;  1B9A A;  1WDC B;  2JQ6 A;  4M2P A;  5DKQ A;  1F8H A;  1ODB A;  1V1F A;  1G8I A;  2B1U A;  2MAZ A;  5CPV A;  1DJG A;  1YUT A;  4JQ0 D;  2JNF A;  2M8U A;  1S1E A;  2KFH A;  4E68 A;  1C7V A;  2Y1M A;  3CR5 X;  4QJ3 B;  2OPO A;  1R6P A;  2BBN A;  3CR4 X;  1D1O A;  3D0Y A;  1S3P A;  4YGB B;  1DJI A;  1WLM A;  4I5L B;  2M0R A;  3LL8 B;  3CGA A;  5CSI A;  1NIW A;  1WY9 A;  1K9P A;  1QTX A;  4PE4 A;  3SG2 A;  5AXI A;  1S5G Z;  2GGZ A;  4CFR A;  3TDU A;  1BF5 A;  2PSR A;  1J1E A;  4M2O A;  2K7D A;  1BOD A;  3BUO B;  1WLZ A;  1J7Q A;  3LK0 A;  2CNP A;  2CT9 A;  2JPT A;  2ZNE A;  3CS1 A;  1F4Q A;  1U5I B;  3GK2 A;  2JUL A;  3BUN B;  1DVI A;  2KI4 B;  3HX4 A;  3BOW B;  3JVT B;  3SG6 A;  4QJ4 B;  1LVC D;  1SW8 A;  1NSH A;  5KSZ A;  2E6W A;  1JFK A;  1HT9 A;  3OB1 B;  2L4I A;  1ALW A;  1JWD A;  4CPV A;  3ZWH A;  5CSN A;  3O4Y A;  1DJZ A;  1NX2 A;  2WOS A;  4PHM A;  3BXK A;  2K7B A;  1BT6 A;  1LA0 A;  1PVB A;  3AKB A;  3DVJ A;  1B8L A;  1DJX A;  1QX7 A;  2M1U A;  2IS9 A;  4GGF A;  2LNK A;  4ICB A;  3FWC A;  1REC A;  3CWG A;  1V1G A;  1ALV A;  3PAL A;  3TS5 B;  5JJG A;  1SRA A;  1DTL A;  1X02 A;  2LP3 A;  1CNP A;  1KK7 Y;  1QLK A;  1VRK A;  2ZRS A;  4YGE B;  2LMV A;  1UUR A;  3FS7 A;  2MLF C;  1QX5 B;  1CFP A;  2RGI A;  1OE9 B;  4WQ2 A;  1EL4 A;  1QVI Z;  2K7O A;  4A4C A;  2SAS A;  1XVJ A;  1H4B A;  2OTG B;  1KSM A;  2KQ6 A;  3IQQ A;  1Y1U A;  4OVN F;  2WND A;  2LE9 B;  2BBM A;  1ZAC A;  1QLS A;  2JXC A;  2KAY A;  1JSA A;  1S26 D;  1DJY A;  2FOT A;  2KI4 C;  4QJ5 B;  1WDC C;  4YRU A;  1TNX A;  1WRZ A;  4PCW A;  4PE7 A;  2BKI B;  1G4Y R;  2CCM A;  1Y1A A;  4GNK B;  5HLO A;  3JTD C;  1A4P A;  4AQJ A;  3DF0 A;  1FF1 A;  1W7I B;  2TN4 A;  2ZN8 A;  2EHB A;  2FCD A;  3HCM A;  3LLE A;  4GFT A;  2Y4Q A;  1XO5 A;  1YX8 A;  1B4C A;  2M3W A;  3VRN A;  2BCX A;  4FQO A;  1NUB A;  2OTG C;  4R1E A;  4L9M A;  3DVM A;  1ZUZ A;  1J7P A;  1DMO A;  2LMT A;  1JF2 A;  2NCP A;  3TDI A;  1CKK A;  2F3Y A;  4MZJ A;  4NDC A;  1OZS A;  2LAN A;  2KGR A;  1B7T Y;  2LVV A;  1PSB A;  1YVL A;  2KYC A;  1KCY A;  5I2Q A;  1SMG A;  1Y0V H;  3O2P A;  5TNC A;  2JT0 A;  1YR5 A;  2ISD A;  1Q80 A;  3TS5 C;  4I5K A;  4AQI A;  4OV2 A;  2LP2 A;  1M63 B;  3PN7 C;  1MR8 A;  1JUO A;  1TN4 A;  2JWW A;  1WRK A;  2LVJ A;  1CFD A;  4NDD A;  2G2B A;  1F54 A;  1CLB A;  3DD4 A;  1BR1 B;  3AAK A;  1XK4 C;  4YBH B;  3TDZ A;  1KFU L;  1BMO A;  1RTP 1;  2JNX A;  3GK4 X;  3A4U B;  4U8D A;  5B8I B;  4XYN A;  4D1E A;  1F71 A;  4GGN A;  2WCF A;  1EG3 A;  1IQ3 A;  1XK4 A;  4GUK A;  1IWQ A;  1XFW O;  1TOP A;  1U5I A;  1AJ5 A;  2JRF A;  5J3X A;  3NSL A;  1SYM A;  4MEW A;  4CLN A;  1SR6 B;  2KSP A;  1SL8 A;  2K0J A;  4GAO A;  4BY5 A;  1IRJ A;  1ZFS A;  1IGV A;  1QAT A;  1N0Y A;  1NCY A;  1XA5 A;  2AAO A;  2O60 A;  3A8R A;  1SCV A;  3KPX A;  4GPL B;  4M2Q A;  4DUQ A;  2FCE A;  5DKN A;  2KFG A;  3D0Y B;  2LHL A;  2L4H A;  1SCM C;  1W7J B;  4MLW A;  2A4J A;  1PVA A;  2MRD A;  2KQY A;  2ZRT A;  4MVF A;  3KHE A;  3MSE B;  1GQM A;  1XYD A;  2MHH A;  2ZFD A;  4MZK A;  3M0W A;  3SG3 A;  4A4B A;  4ZCV A;  4DS7 A;  1SPY A;  1J7O A;  4JPZ B;  3OX6 A;  1KFX S;  3I5F C;  3DVK A;  3I5G C;  5BPJ A;  3EVR A;  3I5H B;  2F2P A;  1YRT B;  2M49 B;  1J55 A;  1F55 A;  3BOW A;  2FJU B;  1K8U A;  1F70 A;  2LLU A;  1QV0 A;  1LIN A;  1XFX O;  1YUR A; 
#chains in the Genus database with same CATH topology
 2LAP A;  1CDM A;  1CDL A;  2PRU A;  2NZ0 A;  1N2D A;  3SJS A;  1DF0 B;  4C0L A;  3EVV A;  1PK0 D;  5JOL A;  1QV1 A;  2GV5 A;  2WC8 A;  4YI9 A;  1SR6 C;  4CID A;  1FI6 A;  4HRG A;  5AFP A;  2CTN A;  3EKH A;  5HLV A;  1RRO A;  2EC6 B;  4OR9 B;  1Y6W A;  1L2O B;  1DF0 A;  2F8P A;  2WCB A;  3EKJ A;  2M9G A;  1QIW A;  1KQM B;  1B7T Z;  2BE4 A;  3OX5 A;  3B86 A;  4PAL A;  4YGD B;  2LV7 A;  1BLQ A;  2KHN A;  1A75 B;  5KU1 A;  2H61 A;  2LM5 A;  1N65 A;  1MF8 B;  2BCB A;  1GJY A;  2K2F A;  3KEV A;  1QX2 A;  4PHJ A;  3PN7 B;  3WNX B;  1DT7 B;  2MA2 A;  3R1P A;  3PLF B;  5ER5 A;  2BE6 A;  3B6X A;  1L7Z A;  1NCZ A;  1BR4 B;  1G33 A;  1GGZ A;  1SL9 A;  3I5H C;  1MXL C;  1K9U A;  1SKT A;  5I2L A;  4GGF C;  4F0Z B;  5I94 A;  3S0F A;  1UHH A;  1NPQ A;  5G08 A;  4YGA A;  1TNP A;  2KLE A;  1OZO A;  2GGM A;  3AKA A;  5ER4 X;  2ZN9 A;  4DIR A;  1M45 A;  2V53 A;  2Q4U A;  3NHT A;  1QXP A;  3CZ0 A;  2K7C A;  1RK9 A;  1UHI A;  5HKW A;  1BOC A;  1OMD A;  3WHT B;  1CMG A;  1K90 D;  2K61 A;  3SG4 A;  3CZ2 A;  2AMI A;  3CYZ A;  5D3O A;  1RJV A;  1DQE A;  1KWO B;  2G9B A;  1NYA A;  2M29 A;  3R1O A;  3SS3 A;  1IH0 A;  1SY9 A;  2CBL A;  3CR2 A;  3DVE A;  4XJK B;  1GGW A;  5AAN A;  2HQ8 A;  1DGU A;  3D10 A;  3EG5 B;  2MJW B;  5HKZ A;  2JC2 A;  3AAJ A;  1XFU O;  3LCP C;  4IL1 A;  2L50 A;  4PT1 A;  3TUY C;  1QWV A;  1FW4 A;  2COL B;  1BJF A;  4MRY A;  1B1G A;  4PHK A;  3WHU B;  1Y1X A;  3S0D A;  3ICB A;  5HKY A;  3E3R A;  4NQG A;  1K95 A;  1AHR A;  1M46 A;  2KNE A;  5FI2 A;  3VRP A;  1TIZ A;  2I2R E;  3CZ1 A;  3BUX B;  1YX7 A;  1B8R A;  1K2H A;  1OOH A;  2P6B B;  3SG5 A;  1QJT A;  2BCA A;  2KOT A;  2JTZ A;  2CXJ A;  1TUJ A;  2WCJ A;  1C07 A;  1BG1 A;  3JTD B;  1OSA A;  1FBV A;  5AEQ A;  3VRO A;  5FI7 A;  4WRI A;  2JXL A;  1AK8 A;  2QEH A;  2HQW A;  2KYF A;  1NP8 A;  2ZND A;  1A29 A;  1DJH A;  1XFZ O;  3PFV A;  4MBE A;  3SIA A;  2Y5I A;  2K8M B;  3FE8 A;  3PJI A;  1FI5 A;  2KDH A;  2QEO A;  2HET A;  3ZNI A;  2PQL A;  3R1V A;  3RM1 A;  2WC5 A;  1CDP A;  3NGV A;  2PVB A;  2PMY A;  3VGO A;  4ETO A;  2JU0 A;  4USL A;  2I18 A;  4AOM A;  5HYD A;  1IJ6 A;  2Q91 A;  1IG5 A;  3CAB A;  1YUU A;  1XFV O;  3C1V A;  1MHO A;  5FYX A;  1K93 D;  3BQ3 A;  3CDN A;  3FIA A;  1SL7 A;  3WXA A;  1S5G Y;  3O6B A;  5CSF A;  5I2O A;  5PAL A;  1YTZ C;  4NDB A;  2BKH B;  2I94 A;  2E30 A;  3PSR A;  3IQO A;  1Z2C B;  2JT3 A;  2L98 A;  1KSO A;  2LLT A;  3NSO A;  2M1K B;  3K1E A;  4N1G A;  4DCK A;  1W9Z A;  1TTX A;  1YUS A;  4OKH A;  2QPT A;  5FI6 A;  3OHM B;  5CSJ A;  4YGC B;  4PE1 A;  2F3Z A;  1AJ4 A;  4Q04 A;  3JVT C;  2O5G A;  4PDZ A;  3TZ1 A;  1CM1 A;  4INX A;  2NLN A;  3BUW B;  2L5Y A;  3RLZ A;  2KFF A;  2LVK A;  3LK1 A;  1KQM C;  3PAT A;  1PSR A;  1R2U A;  2KBI A;  1JC2 A;  3OGN A;  5DKR A;  2DOQ A;  4C0J A;  4ZCU A;  2L51 A;  1OOJ A;  3TUY B;  3QME A;  3I5F B;  2QEV A;  1LA3 A;  1UUS A;  3QRX A;  1RWY A;  2LUC A;  2KGB C;  2SCP A;  1UWO A;  2K60 A;  2VRG A;  2L2E A;  1MWN A;  5D7F A;  1NWD A;  1NX3 A;  1OW4 A;  2EGD A;  2F2O A;  2HPS A;  3OP0 A;  4MZL A;  1EG4 A;  3RZS A;  1UHN A;  1C3Z A;  1JF0 A;  1IKU A;  1C7W A;  1SCM B;  2BAP A;  4BY4 A;  3GOF A;  1UHK A;  1LS8 A;  1L2O C;  1CM4 A;  2MBX A;  4WQ3 A;  4MSP A;  1F4O A;  4TNC A;  1TWO A;  1UP5 A;  3IF7 A;  1LKJ A;  2PAL A;  4PHN A;  1PRW A;  3EK7 A;  1OMV A;  3D74 A;  3OB2 B;  3S0A A;  4JD9 A;  4MN0 A;  1KFX L;  1J1D A;  1BU3 A;  1MQ1 A;  1A2X A;  3FE6 A;  2L0P A;  1NCX A;  4MRX A;  1CFF A;  2BL0 B;  3L4A A;  5IBW A;  2LVI A;  1KWO C;  1K9K A;  4YI8 A;  1DEK A;  4PE0 A;  1S6I A;  2L5X B;  2M7N A;  1CLM A;  1PAL A;  4P5O E;  3SS5 A;  2KAX A;  4DRW A;  2EC6 C;  3CTN A;  1OOI X;  3K21 A;  2KBM A;  1AVS A;  4I5N B;  2I7A A;  2KI6 D;  2NCO A;  2FJY A;  1QS7 A;  4XJK A;  4F7F A;  1CB1 A;  1B47 A;  4ORA B;  1OQP A;  2M7L A;  4C0K A;  1CFC A;  3NSK A;  1K94 A;  1CMF A;  1H8B A;  2H2K A;  4HRE E;  2LUX A;  3SG7 A;  1ZOT B;  2AUC A;  2WOR A;  4CFQ A;  1CDN A;  1OOG A;  1S6C A;  1SNL A;  1E8A A;  1MXE A;  2P71 A;  3D78 A;  3EK4 A;  1ZMZ A;  3SIB A;  1A03 A;  2KI6 C;  3DF0 B;  3I5I B;  2ZKM X;  3VB1 A;  4P2Y B;  1DJW A;  4FTG A;  3D75 A;  3GK1 A;  1KK8 C;  3KF9 A;  3NXA A;  5AER A;  3EK8 A;  1TCO B;  3VRQ A;  4INW A;  3O4X A;  2JT8 A;  1DGV A;  1SBJ A;  1QIV A;  2F33 A;  1KFU S;  1JFJ A;  1HQV A;  1YVH A;  1A75 A;  4I5J A;  2LMU A;  3I5I C;  1M31 A;  2BEC A;  3I5G B;  1OMR A;  3BUM B;  3O78 A;  4ORB B;  5F6T A;  1S6J A;  2QEB A;  5K89 A;  1EXR A;  2LC5 A;  1NX1 A;  1UHJ A;  1CTR A;  1QAS A;  2PYQ A;  4GBA A;  1JBA A;  1AP4 A;  1EJ3 A;  1YRU B;  2WCE A;  3EVU A;  3NSI A;  5KTY A;  2JOJ A;  2K2A A;  2WCH A;  2D8N A;  2LLS A;  3F45 A;  1TNW A;  1MUX A;  2LHI A;  1QVI Y;  1NX0 A;  1IJ5 A;  1TCF A;  2OS8 C;  2PAS A;  3H4S E;  5GQQ C;  1EH2 A;  3VRR A;  1TNQ A;  1XFY O;  4UPG A;  1TRF A;  2R2I A;  4HRH A;  5D69 A;  5I8N A;  3BYA A;  3CLN A;  3CZT X;  4N1F A;  2NXQ A;  2H61 C;  3FWB A;  1KK7 Z;  2LCP A;  1SK6 D;  3B88 A;  1M39 A;  1CLL A;  1IQ5 A;  2HF5 A;  1B8C A;  3KO0 A;  1KQV A;  1LXF C;  2OS8 B;  2QAC A;  2BL0 C;  2KAV A;  1J7R A;  1KK8 B;  1AUI B;  4N5X A;  3S0E A;  3DYE A;  3PM8 A;  4OCI A;  2JZI A;  4HSZ A;  3UO9 A;  2JTT A;  1FPW A;  4ORC B;  3N7H A;  2Y1N A;  1S36 A;  1K96 A;  4JWQ A;  3BFA A;  1PUL A;  2M97 A;  1WRL A;  2MLE C;  1RFJ A;  1B9A A;  1WDC B;  2JQ6 A;  4M2P A;  5DKQ A;  1F8H A;  1ODB A;  1V1F A;  1G8I A;  2B1U A;  2MAZ A;  5CPV A;  1DJG A;  2QDI A;  1YUT A;  4JQ0 D;  2WCK A;  2JNF A;  2M8U A;  1S1E A;  2KFH A;  4E68 A;  5HL1 A;  1ORG A;  1C7V A;  2Y1M A;  3CR5 X;  4QJ3 B;  2OPO A;  1R6P A;  2P70 A;  2BBN A;  3CR4 X;  1D1O A;  3D0Y A;  1S3P A;  4YGB B;  1DJI A;  1WLM A;  4I5L B;  3S0G A;  2M0R A;  3LL8 B;  3CGA A;  5CSI A;  1NIW A;  1WY9 A;  1K9P A;  1QTX A;  3BFH A;  4PE4 A;  3SG2 A;  5AXI A;  1S5G Z;  2GGZ A;  4CFR A;  3TDU A;  1BF5 A;  2PSR A;  1J1E A;  4M2O A;  2K7D A;  3R72 A;  1BOD A;  3NHI A;  3BUO B;  1GM0 A;  1WLZ A;  1J7Q A;  3LK0 A;  2CNP A;  2CT9 A;  2JPT A;  2ZNE A;  3CS1 A;  4IJ7 A;  1F4Q A;  1U5I B;  3GK2 A;  2JUL A;  3OBV A;  3BUN B;  1DVI A;  2KI4 B;  3HX4 A;  3BOW B;  3JVT B;  3SG6 A;  2KPH A;  3L47 A;  4QJ4 B;  1LVC D;  1SW8 A;  1NSH A;  5KSZ A;  2E6W A;  1JFK A;  1HT9 A;  3OB1 B;  2L4I A;  1ALW A;  3DY9 A;  1JWD A;  4CPV A;  3ZWH A;  5CSN A;  3O4Y A;  1C3Y A;  1DJZ A;  1NX2 A;  2WOS A;  3D77 A;  4PHM A;  3BXK A;  2K7B A;  1BT6 A;  1LA0 A;  1PVB A;  3AKB A;  3DVJ A;  1B8L A;  1DJX A;  1QX7 A;  2M1U A;  2IS9 A;  4GGF A;  4JKT A;  3S0B A;  2LNK A;  4ICB A;  3FWC A;  1REC A;  3CWG A;  1V1G A;  1ALV A;  3BFB A;  3PAL A;  2YGU A;  3TS5 B;  5JJG A;  1SRA A;  1DTL A;  1X02 A;  2LP3 A;  1CNP A;  1KK7 Y;  1QLK A;  1VRK A;  2ZRS A;  1IIO A;  4YGE B;  2LMV A;  3DXL A;  3BJH A;  1UUR A;  3FS7 A;  2MLF C;  1QX5 B;  1SSE B;  3D76 A;  3FE9 A;  1OOF A;  1CFP A;  2RGI A;  3Q8I A;  1OE9 B;  4WQ2 A;  1EL4 A;  1QVI Z;  2WCM A;  2K7O A;  4A4C A;  2SAS A;  1XVJ A;  1H4B A;  2OTG B;  2KLD A;  1KSM A;  2KQ6 A;  3IQQ A;  1Y1U A;  4OVN F;  2WND A;  2LE9 B;  2BBM A;  1ZAC A;  1QLS A;  2JXC A;  2KAY A;  1JSA A;  1S26 D;  3V2L A;  1DJY A;  2FOT A;  2KI4 C;  3PM2 A;  1WDC C;  4QJ5 B;  4YRU A;  1TNX A;  1WRZ A;  4PCW A;  4PE7 A;  2BKI B;  1G4Y R;  3IVT A;  2CCM A;  1Y1A A;  4GNK B;  5HLO A;  3JTD C;  1XFR A;  1A4P A;  4AQJ A;  3DF0 A;  1FF1 A;  1W7I B;  2TN4 A;  2ZN8 A;  2GTE A;  2EHB A;  2FCD A;  3HCM A;  3LLE A;  4GFT A;  1T14 A;  2Y4Q A;  1XO5 A;  1YX8 A;  1B4C A;  2M3W A;  3VRN A;  2BCX A;  4FQO A;  1NUB A;  2OTG C;  2JPO A;  4R1E A;  1P28 A;  4L9M A;  3DVM A;  1ZUZ A;  1J7P A;  1DMO A;  2LMT A;  1JF2 A;  2NCP A;  3D73 A;  3TDI A;  1CKK A;  2F3Y A;  4FQT A;  4MZJ A;  4NDC A;  1Z4H A;  1OZS A;  2LAN A;  2KGR A;  1B7T Y;  2LVV A;  1PSB A;  1YVL A;  2KYC A;  1KCY A;  5I2Q A;  1SMG A;  1Y0V H;  3O2P A;  5TNC A;  1DEL A;  2JT0 A;  1YR5 A;  2ISD A;  1Q80 A;  2BNX A;  3TS5 C;  4I5K A;  4AQI A;  4OV2 A;  2LP2 A;  1M63 B;  3PN7 C;  1MR8 A;  1JUO A;  1TN4 A;  2JWW A;  1WRK A;  2LVJ A;  4OZD A;  1CFD A;  4NDD A;  2G2B A;  1F54 A;  1CLB A;  3DD4 A;  1BR1 B;  2ERB A;  1XK4 C;  3AAK A;  4YBH B;  3TDZ A;  1KFU L;  1BMO A;  1RTP 1;  2JNX A;  3GK4 X;  3A4U B;  2WC6 A;  4U8D A;  2H8V A;  5B8I B;  4XYN A;  3SS4 A;  3B87 A;  4D1E A;  1F71 A;  4GGN A;  2WCF A;  1EG3 A;  1IQ3 A;  1XK4 A;  4KYN A;  4GUK A;  1IWQ A;  1XFW O;  1TOP A;  1U5I A;  1AJ5 A;  2JRF A;  2L2C A;  5J3X A;  3NSL A;  3UNW A;  2WCL A;  1SYM A;  4MEW A;  4CLN A;  1SR6 B;  5DIC A;  2KSP A;  1SL8 A;  2K0J A;  4GAO A;  4BY5 A;  1IRJ A;  1ZFS A;  1IGV A;  1QAT A;  1N0Y A;  1NCY A;  1XA5 A;  2AAO A;  3L4L A;  2O60 A;  3A8R A;  1SCV A;  3KPX A;  4GPL B;  4M2Q A;  4DUQ A;  1DC1 A;  2FCE A;  5DKN A;  2KFG A;  3DZT A;  3D0Y B;  2LHL A;  2L4H A;  1SCM C;  1W7J B;  4MLW A;  2A4J A;  1PVA A;  2MRD A;  2KQY A;  2ZRT A;  4MVF A;  3KHE A;  3B7A A;  3MSE B;  1GQM A;  1XYD A;  2MHH A;  2ZFD A;  1TUZ A;  3M0W A;  4MZK A;  5EL2 A;  4ZCV A;  3SG3 A;  1SPY A;  4A4B A;  4JPZ B;  1J7O A;  3OX6 A;  1KFX S;  3I5F C;  3DVK A;  3I5G C;  5BPJ A;  3EVR A;  3I5H B;  2F2P A;  1YRT B;  2M49 B;  1J55 A;  1F55 A;  3BOW A;  1K8U A;  2FJU B;  1F70 A;  2LLU A;  1QV0 A;  1LIN A;  4DS7 A;  1XFX O;  1YUR A; 
#chains in the Genus database with same CATH homology
 2LAP A;  1CDM A;  1CDL A;  2PRU A;  2NZ0 A;  1N2D A;  3SJS A;  1DF0 B;  4C0L A;  3EVV A;  1PK0 D;  5JOL A;  1QV1 A;  2GV5 A;  2WC8 A;  4YI9 A;  1SR6 C;  4CID A;  1FI6 A;  4HRG A;  5AFP A;  2CTN A;  3EKH A;  5HLV A;  1RRO A;  2EC6 B;  4OR9 B;  1Y6W A;  1L2O B;  1DF0 A;  2F8P A;  2WCB A;  3EKJ A;  2M9G A;  1QIW A;  1KQM B;  1B7T Z;  2BE4 A;  3OX5 A;  4PAL A;  4YGD B;  1BLQ A;  2LV7 A;  2KHN A;  1A75 B;  5KU1 A;  2H61 A;  2LM5 A;  1N65 A;  1MF8 B;  2BCB A;  1GJY A;  2K2F A;  3KEV A;  1QX2 A;  4PHJ A;  3PN7 B;  3WNX B;  1DT7 B;  2MA2 A;  5ER5 A;  3PLF B;  2BE6 A;  1L7Z A;  1NCZ A;  1BR4 B;  1G33 A;  1GGZ A;  1SL9 A;  3I5H C;  1MXL C;  1K9U A;  1SKT A;  5I2L A;  4GGF C;  4F0Z B;  1UHH A;  1NPQ A;  5G08 A;  4YGA A;  1TNP A;  1OZO A;  2GGM A;  3AKA A;  5ER4 X;  2ZN9 A;  4DIR A;  1M45 A;  2V53 A;  2Q4U A;  1QXP A;  2K7C A;  1RK9 A;  1UHI A;  5HKW A;  1BOC A;  1OMD A;  3WHT B;  1CMG A;  1K90 D;  2K61 A;  3SG4 A;  2AMI A;  1RJV A;  1KWO B;  2G9B A;  1NYA A;  2M29 A;  1IH0 A;  1SY9 A;  2CBL A;  3CR2 A;  3DVE A;  4XJK B;  1GGW A;  5AAN A;  2HQ8 A;  1DGU A;  3D10 A;  2MJW B;  5HKZ A;  2JC2 A;  3AAJ A;  1XFU O;  3LCP C;  4IL1 A;  2L50 A;  3TUY C;  1FW4 A;  2COL B;  1BJF A;  4MRY A;  1B1G A;  4PHK A;  3WHU B;  1Y1X A;  5HKY A;  3ICB A;  3E3R A;  4NQG A;  1K95 A;  1AHR A;  1M46 A;  2KNE A;  3VRP A;  1TIZ A;  2I2R E;  3BUX B;  1YX7 A;  1B8R A;  1K2H A;  2P6B B;  3SG5 A;  1QJT A;  2BCA A;  2KOT A;  2JTZ A;  2CXJ A;  1C07 A;  1BG1 A;  3JTD B;  1OSA A;  1FBV A;  5AEQ A;  3VRO A;  4WRI A;  2JXL A;  1AK8 A;  2HQW A;  2KYF A;  1NP8 A;  2ZND A;  1A29 A;  1DJH A;  1XFZ O;  3PFV A;  4MBE A;  3SIA A;  2Y5I A;  2K8M B;  1FI5 A;  2KDH A;  2HET A;  3ZNI A;  3RM1 A;  1CDP A;  2PVB A;  2PMY A;  3VGO A;  4ETO A;  2JU0 A;  4USL A;  2I18 A;  4AOM A;  5HYD A;  1IJ6 A;  2Q91 A;  1IG5 A;  1YUU A;  1XFV O;  3C1V A;  1MHO A;  5FYX A;  1K93 D;  3BQ3 A;  3FIA A;  1SL7 A;  3WXA A;  1S5G Y;  3O6B A;  5CSF A;  5I2O A;  5PAL A;  1YTZ C;  4NDB A;  2BKH B;  2I94 A;  2E30 A;  3PSR A;  3IQO A;  2JT3 A;  2L98 A;  1KSO A;  2LLT A;  3NSO A;  2M1K B;  4N1G A;  4DCK A;  1TTX A;  1YUS A;  4OKH A;  2QPT A;  3OHM B;  5CSJ A;  4YGC B;  4PE1 A;  2F3Z A;  1AJ4 A;  4Q04 A;  3JVT C;  2O5G A;  4PDZ A;  3TZ1 A;  1CM1 A;  2NLN A;  3BUW B;  3RLZ A;  2KFF A;  2LVK A;  3LK1 A;  1KQM C;  3PAT A;  1PSR A;  1R2U A;  2KBI A;  1JC2 A;  5DKR A;  2DOQ A;  4C0J A;  4ZCU A;  2L51 A;  1OOJ A;  3TUY B;  3I5F B;  1LA3 A;  1UUS A;  3QRX A;  1RWY A;  2LUC A;  2KGB C;  2SCP A;  1UWO A;  2VRG A;  2L2E A;  1MWN A;  5D7F A;  1NWD A;  1NX3 A;  2EGD A;  2F2O A;  2HPS A;  3OP0 A;  4MZL A;  1EG4 A;  1UHN A;  1JF0 A;  1IKU A;  1C7W A;  1SCM B;  4BY4 A;  3GOF A;  1UHK A;  1L2O C;  1CM4 A;  2MBX A;  4WQ3 A;  4MSP A;  1F4O A;  4TNC A;  1UP5 A;  3IF7 A;  1LKJ A;  2PAL A;  4PHN A;  1PRW A;  3EK7 A;  1OMV A;  3OB2 B;  4MN0 A;  1KFX L;  1J1D A;  1BU3 A;  1MQ1 A;  1A2X A;  4MRX A;  2L0P A;  1NCX A;  1CFF A;  2BL0 B;  5IBW A;  2LVI A;  1KWO C;  1K9K A;  4YI8 A;  4PE0 A;  1S6I A;  2L5X B;  2M7N A;  1CLM A;  1PAL A;  4P5O E;  2KAX A;  4DRW A;  2EC6 C;  3CTN A;  3K21 A;  2KBM A;  1AVS A;  4I5N B;  2I7A A;  2KI6 D;  2NCO A;  1QS7 A;  4XJK A;  1CB1 A;  1B47 A;  4ORA B;  1OQP A;  2M7L A;  4C0K A;  1CFC A;  3NSK A;  1K94 A;  1CMF A;  1H8B A;  2H2K A;  4HRE E;  2LUX A;  3SG7 A;  1ZOT B;  2AUC A;  2WOR A;  4CFQ A;  1CDN A;  1S6C A;  1SNL A;  1E8A A;  1MXE A;  3EK4 A;  1ZMZ A;  3SIB A;  1A03 A;  2KI6 C;  3DF0 B;  3I5I B;  2ZKM X;  4P2Y B;  1DJW A;  4FTG A;  3GK1 A;  1KK8 C;  3KF9 A;  3NXA A;  5AER A;  3EK8 A;  1TCO B;  3VRQ A;  2JT8 A;  1DGV A;  1SBJ A;  1QIV A;  2F33 A;  1KFU S;  1JFJ A;  1HQV A;  1YVH A;  1A75 A;  4I5J A;  2LMU A;  3I5I C;  1M31 A;  2BEC A;  3I5G B;  1OMR A;  3BUM B;  3O78 A;  4ORB B;  5F6T A;  1S6J A;  5K89 A;  1EXR A;  2LC5 A;  1NX1 A;  1UHJ A;  1CTR A;  1QAS A;  1JBA A;  4GBA A;  1AP4 A;  1EJ3 A;  1YRU B;  2WCE A;  3EVU A;  3NSI A;  5KTY A;  2JOJ A;  2K2A A;  2D8N A;  2LLS A;  3F45 A;  1TNW A;  1MUX A;  2LHI A;  1QVI Y;  1NX0 A;  1IJ5 A;  1TCF A;  2OS8 C;  2PAS A;  3H4S E;  5GQQ C;  1EH2 A;  3VRR A;  1TNQ A;  1XFY O;  4UPG A;  1TRF A;  2R2I A;  4HRH A;  5D69 A;  5I8N A;  3BYA A;  3CLN A;  3CZT X;  4N1F A;  2NXQ A;  2H61 C;  3FWB A;  1KK7 Z;  2LCP A;  1SK6 D;  1M39 A;  1CLL A;  1IQ5 A;  2HF5 A;  1B8C A;  3KO0 A;  1KQV A;  1LXF C;  2OS8 B;  2QAC A;  2BL0 C;  2KAV A;  1J7R A;  1KK8 B;  1AUI B;  4N5X A;  3PM8 A;  4OCI A;  2JZI A;  4HSZ A;  2JTT A;  1FPW A;  4ORC B;  2Y1N A;  1S36 A;  1K96 A;  4JWQ A;  1PUL A;  2M97 A;  1WRL A;  2MLE C;  1RFJ A;  1B9A A;  1WDC B;  2JQ6 A;  4M2P A;  5DKQ A;  1F8H A;  1ODB A;  1V1F A;  1G8I A;  2B1U A;  2MAZ A;  5CPV A;  1DJG A;  1YUT A;  4JQ0 D;  2JNF A;  2M8U A;  1S1E A;  2KFH A;  4E68 A;  1C7V A;  2Y1M A;  3CR5 X;  4QJ3 B;  2OPO A;  1R6P A;  2BBN A;  3CR4 X;  1D1O A;  3D0Y A;  1S3P A;  4YGB B;  1DJI A;  1WLM A;  4I5L B;  2M0R A;  3LL8 B;  3CGA A;  5CSI A;  1NIW A;  1WY9 A;  1K9P A;  1QTX A;  4PE4 A;  3SG2 A;  5AXI A;  1S5G Z;  2GGZ A;  4CFR A;  3TDU A;  1BF5 A;  2PSR A;  1J1E A;  4M2O A;  2K7D A;  1BOD A;  3BUO B;  1WLZ A;  1J7Q A;  3LK0 A;  2CNP A;  2CT9 A;  2JPT A;  2ZNE A;  3CS1 A;  1F4Q A;  1U5I B;  3GK2 A;  2JUL A;  3BUN B;  1DVI A;  2KI4 B;  3HX4 A;  3BOW B;  3JVT B;  3SG6 A;  4QJ4 B;  1LVC D;  1SW8 A;  1NSH A;  5KSZ A;  2E6W A;  1JFK A;  1HT9 A;  3OB1 B;  2L4I A;  1ALW A;  1JWD A;  4CPV A;  3ZWH A;  5CSN A;  3O4Y A;  1DJZ A;  1NX2 A;  2WOS A;  4PHM A;  3BXK A;  2K7B A;  1BT6 A;  1LA0 A;  1PVB A;  3AKB A;  3DVJ A;  1B8L A;  1DJX A;  1QX7 A;  2M1U A;  2IS9 A;  4GGF A;  2LNK A;  4ICB A;  3FWC A;  1REC A;  3CWG A;  1V1G A;  1ALV A;  3PAL A;  3TS5 B;  5JJG A;  1SRA A;  1DTL A;  1X02 A;  2LP3 A;  1CNP A;  1KK7 Y;  1QLK A;  1VRK A;  2ZRS A;  4YGE B;  2LMV A;  1UUR A;  3FS7 A;  2MLF C;  1QX5 B;  1CFP A;  2RGI A;  1OE9 B;  4WQ2 A;  1EL4 A;  1QVI Z;  2K7O A;  4A4C A;  2SAS A;  1XVJ A;  1H4B A;  2OTG B;  1KSM A;  2KQ6 A;  3IQQ A;  1Y1U A;  4OVN F;  2WND A;  2LE9 B;  2BBM A;  1ZAC A;  1QLS A;  2JXC A;  2KAY A;  1JSA A;  1S26 D;  1DJY A;  2FOT A;  2KI4 C;  4QJ5 B;  1WDC C;  4YRU A;  1TNX A;  1WRZ A;  4PCW A;  4PE7 A;  2BKI B;  1G4Y R;  2CCM A;  1Y1A A;  4GNK B;  5HLO A;  3JTD C;  1A4P A;  4AQJ A;  3DF0 A;  1FF1 A;  1W7I B;  2TN4 A;  2ZN8 A;  2EHB A;  2FCD A;  3HCM A;  3LLE A;  4GFT A;  2Y4Q A;  1XO5 A;  1YX8 A;  1B4C A;  2M3W A;  3VRN A;  2BCX A;  4FQO A;  1NUB A;  2OTG C;  4R1E A;  4L9M A;  3DVM A;  1ZUZ A;  1J7P A;  1DMO A;  2LMT A;  1JF2 A;  2NCP A;  3TDI A;  1CKK A;  2F3Y A;  4MZJ A;  4NDC A;  1OZS A;  2LAN A;  2KGR A;  1B7T Y;  2LVV A;  1PSB A;  1YVL A;  2KYC A;  1KCY A;  5I2Q A;  1SMG A;  1Y0V H;  3O2P A;  5TNC A;  2JT0 A;  1YR5 A;  2ISD A;  1Q80 A;  3TS5 C;  4I5K A;  4AQI A;  4OV2 A;  2LP2 A;  1M63 B;  3PN7 C;  1MR8 A;  1JUO A;  1TN4 A;  2JWW A;  1WRK A;  2LVJ A;  1CFD A;  4NDD A;  2G2B A;  1F54 A;  1CLB A;  3DD4 A;  1BR1 B;  3AAK A;  1XK4 C;  4YBH B;  3TDZ A;  1KFU L;  1BMO A;  1RTP 1;  2JNX A;  3GK4 X;  3A4U B;  4U8D A;  5B8I B;  4XYN A;  4D1E A;  1F71 A;  4GGN A;  2WCF A;  1EG3 A;  1IQ3 A;  1XK4 A;  4GUK A;  1IWQ A;  1XFW O;  1TOP A;  1U5I A;  1AJ5 A;  2JRF A;  5J3X A;  3NSL A;  1SYM A;  4MEW A;  4CLN A;  1SR6 B;  2KSP A;  1SL8 A;  2K0J A;  4GAO A;  4BY5 A;  1IRJ A;  1ZFS A;  1IGV A;  1QAT A;  1N0Y A;  1NCY A;  1XA5 A;  2AAO A;  2O60 A;  3A8R A;  1SCV A;  3KPX A;  4GPL B;  4M2Q A;  4DUQ A;  2FCE A;  5DKN A;  2KFG A;  3D0Y B;  2LHL A;  2L4H A;  1SCM C;  1W7J B;  4MLW A;  2A4J A;  1PVA A;  2MRD A;  2KQY A;  2ZRT A;  4MVF A;  3KHE A;  3MSE B;  1GQM A;  1XYD A;  2MHH A;  2ZFD A;  4MZK A;  3M0W A;  3SG3 A;  4A4B A;  4ZCV A;  4DS7 A;  1SPY A;  1J7O A;  4JPZ B;  3OX6 A;  1KFX S;  3I5F C;  3DVK A;  3I5G C;  5BPJ A;  3EVR A;  3I5H B;  2F2P A;  1YRT B;  2M49 B;  1J55 A;  1F55 A;  3BOW A;  2FJU B;  1K8U A;  1F70 A;  2LLU A;  1QV0 A;  1LIN A;  1XFX O;  1YUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...