4PDZA

Crystal structure of calcium-loaded s100b bound to sbi4172
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
90
structure length
90
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Covalent Small Molecule Inhibitors of Ca(2+)-Bound S100B.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein/inhibitor
molecule keywords Protein S100-B
total genus 34
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4pdzA00
4JWQA 1RTP1 1JBAA 5PALA 1ZOTB 2BE6A 1CB1A 2LAPA 2H61C 1SL7A 2LANA 2V53A 2K7CA 3PLFB 2CXJA 4JPZB 3NSKA 4WQ2A 2IS9A 1CM1A 1XO5A 2KDHA 4A4CA 3SG7A 1K95A 2JU0A 2M97A 2GGMA 4ORAB 1MXEA 2CBLA 2LUXA 1Q80A 2E30A 5J3XA 1K9PA 4IL1A 4YI9A 1IKUA 1F4OA 1J7OA 5HLVA 4MRYA 5HLOA 2NCPA 3PFVA 1F71A 1V1GA 3GOFA 1NSHA 4QJ3B 5I2QA 3TUYC 1A03A 1ODBA 4QJ5B 2KI6C 2KNEA 2Q91A 3SIBA 2LM5A 2VRGA 1SK6D 2BKIB 4GFTA 2JNFA 5DKNA 1H4BA 2M8UA 1J55A 1M45A 3AAKA 4GGFA 4NDDA 4QJ4B 5TNCA 2E6WA 1PVBA 1CNPA 1OSAA 1OZOA 4E68A 1IH0A 1AP4A 1DJGA 1SBJA 5KU1A 1R6PA 3VRQA 1UWOA 2JT0A 1PSBA 1L7ZA 1FF1A 5I2LA 2BKHB 4YGBB 4WRIA 4DIRA 2JC2A 2JXLA 2H61A 2K7DA 1BR4B 3H4SE 1NWDA 1PSRA 3FS7A 3EVVA 1CLMA 1E8AA 4OKHA 1A75A 4USLA 1B1GA 1WDCC 1WRKA 2WNDA 1N2DA 2KHNA 2LNKA 2MLEC 1JUOA 2BL0B 2NLNA 3ICBA 5IBWA 1C7VA 5AXIA 1D1OA 1L2OB 3I5FC 2NCOA 1SYMA 1DMOA 3O78A 1RROA 3QRXA 2B1UA 4HSZA 2P6BB 3GK1A 1NUBA 3I5GC 4PCWA 1KQMB 1MXLC 3GK2A 2K7BA 1S6JA 1UHJA 1BT6A 3O6BA 5AANA 2L51A 1AJ4A 3DF0B 1SL9A 4GUKA 5I8NA 1LVCD 1EL4A 2LVJA 1DF0B 4DS7A 2JULA 3CLNA 1YR5A 1CKKA 3IQQA 1YRTB 4YGCB 5CPVA 2MA2A 2CCMA 1DJXA 3HX4A 3IQOA 1KFXL 1XFUO 2LVKA 1SPYA 4L9MA 1JF0A 5K89A 4P2YB 1KWOB 2PVBA 3SG5A 2TN4A 3MSEB 1B7TY 1J1EA 2KBMA 3KO0A 3FWCA 4CFQA 2KYFA 4YGAA 3BUWB 2L0PA 2AAOA 1UHHA 3KHEA 1YUSA 4XYNA 1DJHA 2CNPA 3OX5A 5CSNA 5HKZA 2PALA 2M1KB 4NQGA 3KPXA 2KBIA 4NDCA 2BBNA 1NX1A 1S1EA 1H8BA 4MN0A 4PHKA 4U8DA 1IG5A 2M29A 1NX3A 3PALA 3DF0A 1VRKA 1TCOB 4M2QA 3NSOA 1G33A 1TIZA 1C07A 1QVIY 2HPSA 5CSFA 4CPVA 3DVMA 1CM4A 2Q4UA 1NCYA 3OP0A 4ORBB 3BOWB 2BCAA 1OQPA 1DGUA 3SG3A 1F54A 1UP5A 1NCXA 3A8RA 3LCPC 2I94A 4PE0A 4PHNA 1TRFA 1QV1A 2F2PA 3ZWHA 1OMVA 4C0JA 3JTDC 1F8HA 1GGWA 4C0KA 2G9BA 2JNXA 1RFJA 1S6CA 4ETOA 1XK4C 2LMTA 1K90D 1K8UA 3ZNIA 4MSPA 1B8LA 1TCFA 4M2PA 1HQVA 1FPWA 1SW8A 1AUIB 1LA3A 4YGDB 3TS5B 3OHMB 5DKQA 3E3RA 4I5NB 1XFZO 1LXFC 1SRAA 1SKTA 1Y1UA 2K8MB 2FJUB 4OCIA 1YX8A 1A75B 1A29A 2LLTA 3CZTX 1IJ6A 1BR1B 4CLNA 2HQWA 1AVSA 2JRFA 1JF2A 1ZUZA 1LA0A 3M0WA 5D7FA 4Q04A 1U5IA 4F0ZB 1BF5A 1WDCB 3PN7C 3O4YA 2O5GA 1KK8B 1YTZC 2JQ6A 2LV7A 2WOSA 1Y1AA 1Y0VH 2L50A 2I2RE 3WNXB 1JWDA 1L2OC 2OTGB 4WQ3A 2FCDA 2M9GA 1DJWA 3RM1A 4ORCB 4MZJA 1XK4A 5CSIA 3EVUA 4N1FA 1TOPA 1Y6WA 2LP3A 2L98A 3JVTB 2LC5A 1M63B 2EHBA 1DJIA 1S6IA 1R2UA 3AAJA 1SCMC 4GAOA 1DF0A 3SG4A 1J7QA 2I7AA 4OVNF 1XYDA 2JTTA 5I2OA 1UHNA 3BUOB 2WCBA 1IJ5A 4MLWA 2LVIA 1W7IB 1DGVA 1TNPA 1JC2A 4PE1A 2R2IA 1CDLA 3CR5X 1YVHA 4GNKB 1U5IB 1QLSA 1QLKA 1K94A 5CSJA 1F55A 2DOQA 1FBVA 2ZFDA 1DJYA 2WCFA 4YI8A 3SJSA 1KFXS 1CFPA 1XFWO 4PDZA 3EK8A 5AERA 1K96A 3LL8B 2PSRA 1SMGA 1CFFA 4A4BA 2COLB 3OB1B 1NIWA 1WLMA 1YUTA 1RECA 3VRNA 1UHIA 4BY5A 2EC6B 1A4PA 2L5XB 5FYXA 3TS5C 1SCVA 4PHMA 5ER4X 2BCBA 4AQIA 1K9KA 2KQ6A 3K21A 1ZACA 3I5HC 1GQMA 2G2BA 2M1UA 3CGAA 2WORA 1RWYA 1ZMZA 2FOTA 2HETA 3WHTB 4HRGA 1XFVO 2M0RA 2GGZA 1B9AA 1NP8A 1SNLA 1DVIA 1CFCA 2Y1NA 1M46A 1YVLA 3BOWA 3FIAA 1G8IA 1YUUA 3DD4A 1K9UA 1KSOA 2LLUA 1KFUL 3TZ1A 2QACA 4PALA 1S26D 2KI4B 1CDNA 1WY9A 1DT7B 2RGIA 1UURA 5AEQA 2LHIA 4I5LB 1KQMC 1G4YR 2ZRSA 2QPTA 4UPGA 1B8CA 2LHLA 2BL0C 1QX7A 2KAVA 3F45A 1MF8B 2OS8C 3LLEA 1KQVA 3TDIA 1OE9B 2LLSA 3JVTC 4MZLA 4GPLB 1KCYA 4ZCUA 2F2OA 2M7NA 3PATA 2KI6D 1PALA 1KK7Y 1B4CA 1GJYA 2SASA 5KTYA 1W7JB 1TN4A 4TNCA 5HKWA 2SCPA 1OMDA 3NSIA 3KEVA 2BECA 1QS7A 3VGOA 1QJTA 2MLFC 4YRUA 2H2KA 1OOJA 2CTNA 2OPOA 1ALWA 1EJ3A 3EK4A 2ZKMX 4I5KA 2KGRA 3IF7A 3PN7B 4MBEA 2F8PA 1B7TZ 2EGDA 1HT9A 2WCEA 3AKAA 5HYDA 2BCXA 3LK1A 2FCEA 3OX6A 5AFPA 1N65A 2K2FA 2L4IA 1CLBA 3D10A 1MUXA 1YX7A 1BJFA 2L2EA 4CIDA 3O2PA 5G08A 3RLZA 2Y5IA 2LCPA 5HKYA 1QTXA 4R1EA 4YGEB 1KK7Z 2MAZA 5B8IB 1CMFA 4N1GA 1LINA 2EC6C 1M39A 5DKRA 3KF9A 4BY4A 1SR6C 2MRDA 2JXCA 3LK0A 1KSMA 4DUQA 2AUCA 3BUNB 3EVRA 3VROA 2LUCA 2NZ0A 1JFKA 1RK9A 1EH2A 3WHUB 1QIVA 1B47A 3PSRA 1MWNA 1QVIZ 4YBHB 1MR8A 1S5GZ 4XJKB 4NDBA 3TDZA 1XFYO 2AMIA 3D0YB 2WC8A 2Y4QA 2BBMA 3BXKA 3I5GB 1K2HA 2ZRTA 5JJGA 1NYAA 2KAYA 1BLQA 3CR4X 2HF5A 2HQ8A 1V1FA 4MRXA 2I18A 1CLLA 2JWWA 3SG6A 3I5FB 3I5IB 3JTDB 1CFDA 2LMVA 4ZCVA 2JZIA 1XFXO 1QX5B 2KFHA 4P5OE 2PMYA 1BG1A 3BYAA 2PRUA 1PULA 1N0YA 1CMGA 1JSAA 2OS8B 3DVKA 1FW4A 3EKHA 4HREE 3I5IC 4FQOA 3FWBA 4PE4A 1CTRA 1AK8A 1AJ5A 1XVJA 2KI4C 3CTNA 4HRHA 1IGVA 1F70A 2M49B 3DVEA 1S5GY 4GGFC 1A2XA 5KSZA 3EK7A 3OB2B 4DCKA 4DRWA 1BOCA 2KYCA 2JOJA 1IQ3A 2K7OA 1ALVA 4M2OA 3BUXB 3D0YA 2KGBC 2ZNDA 3CWGA 2F3YA 1GGZA 1NX2A 2NXQA 1EXRA 4AQJA 2K2AA 1FI5A 1QATA 3NXAA 1Y1XA 5D69A 1KWOC 1WLZA 1S3PA 1BU3A 1KK8C 2L4HA 4CFRA 1CDMA 4MZKA 1WRZA 5GQQC 1FI6A 1BMOA 1DTLA 1AHRA 1QX2A 1SCMB 1X02A 2A4JA 3A4UB 1TNXA 4MEWA 4ICBA 3TUYB 1QIWA 2PASA 1TTXA 4PHJA 2JT3A 1J7RA 1MHOA 2LVVA 1DJZA 2M7LA 3GK4X 1UUSA 1JFJA 2D8NA 4C0LA 1SR6B 1TNWA 1XA5A 4D1EA 1QASA 2KSPA 1IQ5A 1SY9A 2JPTA 1K93D 1EG4A 1UHKA 4JQ0D 3PM8A 1IWQA 3HCMA 2KFFA 1NCZA 3BUMB 3CS1A 4FTGA 2ZN8A 1YURA 3WXAA 3SIAA 1OMRA 5BPJA 1NX0A 5ER5A 2GV5A 2KQYA 1S36A 1LKJA 4GBAA 2LMUA 1YRUB 3TDUA 2ZNEA 4PE7A 3CR2A 1NPQA 1PK0D 1TNQA 2KFGA 2ZN9A 1WRLA 3C1VA 2ISDA 2JT8A 3VRPA 3NSLA 1B8RA 2M3WA 4I5JA 1PRWA 1KFUS 1IRJA 2Y1MA 3BQ3A 1ZFSA 1SL8A 5JOLA 1OZSA 3EKJA 2KAXA 1C7WA 4MVFA 4N5XA 2F33A 2LE9B 1F4QA 2LP2A 4OR9B 1EG3A 1QXPA 2O60A 2K61A 3I5HB 2JTZA 3SG2A 1PVAA 5F6TA 2F3ZA 2K0JA 2KOTA 3AKBA 2BE4A 1J7PA 2CT9A 1J1DA 4AOMA 1RJVA 1CDPA 3VRRA 4GGNA 1M31A 2MHHA 1QV0A 1MQ1A 2MBXA 3DVJA 4XJKA 1BODA 2MJWB 2OTGC 4OV2A
chains in the Genus database with same CATH superfamily
4JWQA 1RTP1 1JBAA 5PALA 1ZOTB 2BE6A 3B7AA 3VB1A 1CB1A 2LAPA 2H61C 1SL7A 2LANA 2V53A 2K7CA 3PLFB 2CXJA 4JPZB 3NSKA 4WQ2A 2IS9A 4INXA 1CM1A 1XO5A 2H8VA 2KDHA 3SG7A 4A4CA 2BAPA 1K95A 3O4XA 2JU0A 2M97A 2GGMA 4ORAB 1MXEA 2CBLA 2LUXA 1Q80A 2E30A 5J3XA 1K9PA 4IL1A 4YI9A 1IKUA 1F4OA 1J7OA 5HLVA 4MRYA 5HLOA 2NCPA 3PFVA 1F71A 1V1GA 3GOFA 1NSHA 4QJ3B 5I2QA 3TUYC 1A03A 1ODBA 3BFBA 2KI6C 3BJHA 4QJ5B 2KNEA 2Q91A 3SIBA 2QDIA 3D76A 2LM5A 2VRGA 1SK6D 2BKIB 4GFTA 2JNFA 5DKNA 1H4BA 2M8UA 1J55A 1M45A 3AAKA 4GGFA 4NDDA 4QJ4B 4PT1A 2E6WA 1PVBA 5TNCA 1CNPA 1OSAA 1OZOA 4E68A 1IH0A 1AP4A 1DJGA 1SBJA 2L2CA 3NHTA 5KU1A 3CYZA 1R6PA 3VRQA 1UWOA 2JT0A 2P71A 1PSBA 1L7ZA 1FF1A 5I2LA 2BKHB 3D75A 4YGBB 4WRIA 4DIRA 2JC2A 2JXLA 2H61A 2K7DA 2WCHA 1BR4B 3DY9A 3H4SE 3SS3A 1NWDA 1PSRA 3FS7A 3EVVA 1CLMA 1E8AA 4OKHA 2BNXA 1DELA 1A75A 4USLA 1B1GA 3IVTA 1WDCC 1WRKA 2WNDA 1N2DA 2KHNA 2LNKA 4FQTA 2MLEC 1JUOA 2BL0B 2NLNA 3B86A 4OZDA 3ICBA 5IBWA 1C7VA 5AXIA 1D1OA 5DICA 1L2OB 2KPHA 3I5FC 2NCOA 1SYMA 1DMOA 3UO9A 3O78A 1RROA 3QRXA 2B1UA 2QEVA 4HSZA 2P6BB 2KLEA 3GK1A 1NUBA 3I5GC 4PCWA 4INWA 1KQMB 1MXLC 3RZSA 3GK2A 1OOGA 2K7BA 1S6JA 1UHJA 1BT6A 3O6BA 5AANA 2L51A 1AJ4A 3DF0B 1SL9A 4GUKA 5I8NA 1LVCD 1EL4A 2LVJA 1DF0B 4DS7A 2JULA 3CLNA 1YR5A 1CKKA 3IQQA 1YRTB 4YGCB 5CPVA 2MA2A 2CCMA 1DJXA 3HX4A 3IQOA 1KFXL 1XFUO 2LVKA 1SPYA 4L9MA 1JF0A 3CDNA 5K89A 1W9ZA 4P2YB 1KWOB 3CZ2A 2PVBA 3SG5A 2TN4A 3R72A 3K1EA 3MSEB 1B7TY 1J1EA 2KBMA 3KO0A 3FWCA 4CFQA 2KYFA 4YGAA 3BUWB 2L0PA 2AAOA 1UHHA 2WCJA 3KHEA 1YUSA 4XYNA 1DJHA 2CNPA 3OX5A 5CSNA 5HKZA 2PALA 2M1KB 4NQGA 3KPXA 2KBIA 4NDCA 2BBNA 1NX1A 1S1EA 1H8BA 4MN0A 4PHKA 2QEHA 4U8DA 1IG5A 2M29A 1NX3A 3PALA 3DF0A 1VRKA 3BFAA 1TCOB 4M2QA 3NSOA 1G33A 1TIZA 1C07A 1QVIY 2HPSA 5CSFA 4CPVA 3DVMA 1CM4A 2Q4UA 1NCYA 3OP0A 4ORBB 3BOWB 5EL2A 2BCAA 1OQPA 1DGUA 3SG3A 1F54A 1UP5A 1NCXA 3A8RA 3LCPC 2I94A 4PE0A 4PHNA 1TRFA 1QV1A 2F2PA 3ZWHA 2P70A 1OMVA 4C0JA 3JTDC 1F8HA 1GGWA 2QEBA 2G9BA 2JNXA 1RFJA 1S6CA 4C0KA 4ETOA 1XK4C 2LMTA 1K90D 2WCLA 1K8UA 3ZNIA 4MSPA 1B8LA 1TCFA 4M2PA 1HQVA 2PQLA 1FPWA 1SW8A 1AUIB 1LA3A 4YGDB 3TS5B 3OHMB 5DKQA 3E3RA 4I5NB 1XFZO 1LXFC 1SRAA 1SKTA 1Y1UA 2K8MB 2FJUB 4OCIA 1YX8A 1A75B 1A29A 2LLTA 3CZTX 1IJ6A 1BR1B 2WC6A 4CLNA 2HQWA 1AVSA 2JRFA 1JF2A 1ZUZA 3OGNA 1LA0A 3CABA 3M0WA 4Q04A 5D7FA 1U5IA 2WCKA 3V2LA 4F0ZB 1BF5A 1WDCB 3PN7C 3O4YA 2O5GA 1KK8B 1YTZC 2JQ6A 2LV7A 2WOSA 1Y1AA 1C3ZA 1Y0VH 3S0EA 2L50A 2I2RE 3WNXB 1JWDA 1L2OC 2OTGB 4WQ3A 2FCDA 2M9GA 1DJWA 3RM1A 4ORCB 4MZJA 1XK4A 5CSIA 3EVUA 4N1FA 1TOPA 1Y6WA 2LP3A 2L98A 3JVTB 2WCMA 3QMEA 2LC5A 1M63B 2EHBA 1DJIA 1S6IA 1R2UA 3AAJA 1SCMC 4GAOA 2KLDA 1DF0A 3SG4A 1J7QA 2I7AA 4OVNF 1XYDA 1TUZA 2JTTA 5I2OA 3S0GA 1UHNA 3BFHA 3BUOB 1SSEB 2WCBA 1IJ5A 4MLWA 2LVIA 1P28A 1W7IB 1DGVA 1TNPA 1JC2A 4PE1A 2R2IA 1CDLA 3CR5X 1YVHA 3DYEA 4GNKB 1U5IB 1QLSA 1QLKA 1K94A 5CSJA 1F55A 2DOQA 1FBVA 2ZFDA 1DJYA 2WCFA 4YI8A 3SJSA 1KFXS 1CFPA 1XFWO 4PDZA 3EK8A 5AERA 1K96A 3LL8B 2PSRA 1SMGA 1CFFA 4A4BA 2COLB 3OB1B 1NIWA 1WLMA 1YUTA 1RECA 3VRNA 1UHIA 3FE8A 4BY5A 2EC6B 1A4PA 2L5XB 5FYXA 3TS5C 1SCVA 3D77A 4PHMA 5ER4X 1LS8A 2BCBA 4AQIA 1K9KA 2KQ6A 2YGUA 1ZACA 3I5HC 3K21A 1GQMA 2G2BA 2M1UA 4JKTA 3CGAA 2WORA 3D73A 3PM2A 1DQEA 1RWYA 1ZMZA 2FOTA 2HETA 3WHTB 4HRGA 1XFVO 2M0RA 2GGZA 3FE9A 1B9AA 3NHIA 1GM0A 1NP8A 1SNLA 1DVIA 3L4AA 1CFCA 2Y1NA 1M46A 1YVLA 3BOWA 3FIAA 1G8IA 1YUUA 3DD4A 1K9UA 1KSOA 2LLUA 1KFUL 3TZ1A 2QACA 3R1PA 1S26D 2KI4B 4PALA 1Z4HA 1WY9A 1DT7B 1CDNA 2RGIA 1UURA 5AEQA 2LHIA 4I5LB 1KQMC 1G4YR 2ZRSA 2QPTA 4UPGA 1B8CA 3R1VA 2LHLA 2BL0C 1QX7A 2KAVA 3F45A 1MF8B 2OS8C 3D74A 3LLEA 1KQVA 3TDIA 1OE9B 2LLSA 3JVTC 4MZLA 4GPLB 1DEKA 2GTEA 4ZCUA 2F2OA 2M7NA 3PATA 1KCYA 2KI6D 1PALA 3B88A 1KK7Y 1OOHA 1GJYA 1OW4A 2SASA 5KTYA 1W7JB 3S0FA 1B4CA 1TN4A 4TNCA 5HKWA 2SCPA 1OMDA 3NSIA 3KEVA 5D3OA 2BECA 1DC1A 1QS7A 3VGOA 1QJTA 2MLFC 4YRUA 2H2KA 1OOJA 2CTNA 2OPOA 1ALWA 1EJ3A 3EK4A 2ZKMX 4I5KA 2KGRA 3IF7A 3PN7B 1QWVA 4MBEA 2WC5A 2F8PA 3OBVA 1B7TZ 3S0AA 2EGDA 1HT9A 2WCEA 1TUJA 3AKAA 5HYDA 2BCXA 3LK1A 2FCEA 3OX6A 1ORGA 1N65A 2K2FA 2L4IA 5AFPA 1CLBA 3D10A 1MUXA 1OOIX 3CZ1A 1YX7A 1BJFA 2L2EA 3FE6A 3O2PA 4CIDA 5G08A 3RLZA 3DXLA 2Y5IA 2LCPA 5HKYA 1QTXA 1Z2CB 4R1EA 4YGEB 1KK7Z 3N7HA 2MAZA 5B8IB 1CMFA 4N1GA 1LINA 2EC6C 1M39A 5DKRA 3KF9A 1OOFA 4BY4A 1SR6C 2MRDA 2JXCA 3LK0A 1KSMA 3NGVA 4DUQA 2AUCA 3BUNB 3EVRA 3VROA 2LUCA 1XFRA 1JFKA 2NZ0A 1RK9A 1EH2A 3WHUB 1QIVA 1B47A 3R1OA 3PSRA 1MWNA 1QVIZ 4YBHB 1MR8A 1S5GZ 4XJKB 4NDBA 3TDZA 1XFYO 2AMIA 3D0YB 1IIOA 2WC8A 2Y4QA 2BBMA 3BXKA 2FJYA 3I5GB 1K2HA 2ZRTA 5JJGA 1NYAA 5FI6A 1TWOA 2KAYA 1BLQA 3CR4X 2HF5A 2HQ8A 1V1FA 4MRXA 2I18A 1CLLA 2JWWA 3SG6A 3I5FB 3I5IB 3JTDB 1CFDA 2LMVA 4ZCVA 2JZIA 3S0BA 1XFXO 1QX5B 2KFHA 4P5OE 2PMYA 1BG1A 3BYAA 2PRUA 1PULA 1N0YA 4KYNA 1CMGA 3Q8IA 2OS8B 3DVKA 1JSAA 1FW4A 3EKHA 4HREE 3I5IC 3S0DA 4FQOA 3FWBA 4PE4A 1CTRA 1AK8A 1AJ5A 1XVJA 2KI4C 3CTNA 4HRHA 1IGVA 1F70A 2M49B 3DVEA 1S5GY 4GGFC 1A2XA 5KSZA 2PYQA 3EK7A 3OB2B 4DCKA 4DRWA 1BOCA 2KYCA 2JOJA 1IQ3A 2K7OA 1ALVA 4M2OA 3BUXB 3D0YA 2KGBC 2ZNDA 3CWGA 2F3YA 1GGZA 1NX2A 2NXQA 1EXRA 4AQJA 2K2AA 1FI5A 4IJ7A 1QATA 3NXAA 1Y1XA 5D69A 1KWOC 3UNWA 1WLZA 1S3PA 1BU3A 1KK8C 2L4HA 4CFRA 1CDMA 3D78A 4MZKA 3SS4A 1WRZA 5GQQC 1FI6A 1BMOA 1DTLA 1AHRA 1QX2A 1SCMB 1X02A 2A4JA 3A4UB 1TNXA 4MEWA 4ICBA 3TUYB 1QIWA 2PASA 3PJIA 1TTXA 3CZ0A 4PHJA 2JT3A 1J7RA 1MHOA 2LVVA 1DJZA 5FI7A 2M7LA 3GK4X 1UUSA 1JFJA 2D8NA 3DZTA 4C0LA 1SR6B 1TNWA 1XA5A 4D1EA 1QASA 2KSPA 1IQ5A 1SY9A 2JPTA 1K93D 1EG4A 1UHKA 4JQ0D 3PM8A 1IWQA 3HCMA 2KFFA 1NCZA 3BUMB 3CS1A 4FTGA 2ZN8A 1YURA 4JD9A 3WXAA 3SIAA 1OMRA 5BPJA 2K60A 1NX0A 5ER5A 2GV5A 2KQYA 1S36A 1LKJA 4GBAA 3B87A 2LMUA 1YRUB 3TDUA 2ZNEA 3L4LA 3CR2A 4PE7A 1NPQA 1PK0D 1TNQA 2KFGA 2ZN9A 1WRLA 3C1VA 5HL1A 5I94A 2ISDA 3L47A 2JT8A 3VRPA 3NSLA 1B8RA 2M3WA 4I5JA 1PRWA 1KFUS 3EG5B 4F7FA 1IRJA 2ERBA 2Y1MA 3BQ3A 1ZFSA 1SL8A 5JOLA 1OZSA 3EKJA 2KAXA 1C7WA 4MVFA 4N5XA 2F33A 2LE9B 1F4QA 2LP2A 4OR9B 2L5YA 1EG3A 1QXPA 2O60A 2K61A 3I5HB 2JTZA 2JPOA 3SG2A 1PVAA 5F6TA 2F3ZA 2K0JA 2KOTA 2QEOA 3AKBA 2BE4A 1J7PA 2CT9A 1J1DA 4AOMA 1RJVA 1CDPA 3SS5A 4GGNA 3VRRA 1M31A 2MHHA 1QV0A 1T14A 1C3YA 1MQ1A 5FI2A 3DVJA 4XJKA 2MBXA 2MJWB 1BODA 3B6XA 2OTGC 4OV2A
chains in the Genus database with same CATH topology
4JWQA 1RTP1 1JBAA 5PALA 1ZOTB 2BE6A 1CB1A 2LAPA 2H61C 1SL7A 2LANA 2V53A 2K7CA 3PLFB 2CXJA 4JPZB 3NSKA 4WQ2A 2IS9A 1CM1A 1XO5A 2KDHA 4A4CA 3SG7A 1K95A 2JU0A 2M97A 2GGMA 4ORAB 1MXEA 2CBLA 2LUXA 1Q80A 2E30A 5J3XA 1K9PA 4IL1A 4YI9A 1IKUA 1F4OA 1J7OA 5HLVA 4MRYA 5HLOA 2NCPA 3PFVA 1F71A 1V1GA 3GOFA 1NSHA 4QJ3B 5I2QA 3TUYC 1A03A 1ODBA 4QJ5B 2KI6C 2KNEA 2Q91A 3SIBA 2LM5A 2VRGA 1SK6D 2BKIB 4GFTA 2JNFA 5DKNA 1H4BA 2M8UA 1J55A 1M45A 3AAKA 4GGFA 4NDDA 4QJ4B 5TNCA 2E6WA 1PVBA 1CNPA 1OSAA 1OZOA 4E68A 1IH0A 1AP4A 1DJGA 1SBJA 5KU1A 1R6PA 3VRQA 1UWOA 2JT0A 1PSBA 1L7ZA 1FF1A 5I2LA 2BKHB 4YGBB 4WRIA 4DIRA 2JC2A 2JXLA 2H61A 2K7DA 1BR4B 3H4SE 1NWDA 1PSRA 3FS7A 3EVVA 1CLMA 1E8AA 4OKHA 1A75A 4USLA 1B1GA 1WDCC 1WRKA 2WNDA 1N2DA 2KHNA 2LNKA 2MLEC 1JUOA 2BL0B 2NLNA 3ICBA 5IBWA 1C7VA 5AXIA 1D1OA 1L2OB 3I5FC 2NCOA 1SYMA 1DMOA 3O78A 1RROA 3QRXA 2B1UA 4HSZA 2P6BB 3GK1A 1NUBA 3I5GC 4PCWA 1KQMB 1MXLC 3GK2A 2K7BA 1S6JA 1UHJA 1BT6A 3O6BA 5AANA 2L51A 1AJ4A 3DF0B 1SL9A 4GUKA 5I8NA 1LVCD 1EL4A 2LVJA 1DF0B 4DS7A 2JULA 3CLNA 1YR5A 1CKKA 3IQQA 1YRTB 4YGCB 5CPVA 2MA2A 2CCMA 1DJXA 3HX4A 3IQOA 1KFXL 1XFUO 2LVKA 1SPYA 4L9MA 1JF0A 5K89A 4P2YB 1KWOB 2PVBA 3SG5A 2TN4A 3MSEB 1B7TY 1J1EA 2KBMA 3KO0A 3FWCA 4CFQA 2KYFA 4YGAA 3BUWB 2L0PA 2AAOA 1UHHA 3KHEA 1YUSA 4XYNA 1DJHA 2CNPA 3OX5A 5CSNA 5HKZA 2PALA 2M1KB 4NQGA 3KPXA 2KBIA 4NDCA 2BBNA 1NX1A 1S1EA 1H8BA 4MN0A 4PHKA 4U8DA 1IG5A 2M29A 1NX3A 3PALA 3DF0A 1VRKA 1TCOB 4M2QA 3NSOA 1G33A 1TIZA 1C07A 1QVIY 2HPSA 5CSFA 4CPVA 3DVMA 1CM4A 2Q4UA 1NCYA 3OP0A 4ORBB 3BOWB 2BCAA 1OQPA 1DGUA 3SG3A 1F54A 1UP5A 1NCXA 3A8RA 3LCPC 2I94A 4PE0A 4PHNA 1TRFA 1QV1A 2F2PA 3ZWHA 1OMVA 4C0JA 3JTDC 1F8HA 1GGWA 4C0KA 2G9BA 2JNXA 1RFJA 1S6CA 4ETOA 1XK4C 2LMTA 1K90D 1K8UA 3ZNIA 4MSPA 1B8LA 1TCFA 4M2PA 1HQVA 1FPWA 1SW8A 1AUIB 1LA3A 4YGDB 3TS5B 3OHMB 5DKQA 3E3RA 4I5NB 1XFZO 1LXFC 1SRAA 1SKTA 1Y1UA 2K8MB 2FJUB 4OCIA 1YX8A 1A75B 1A29A 2LLTA 3CZTX 1IJ6A 1BR1B 4CLNA 2HQWA 1AVSA 2JRFA 1JF2A 1ZUZA 1LA0A 3M0WA 5D7FA 4Q04A 1U5IA 4F0ZB 1BF5A 1WDCB 3PN7C 3O4YA 2O5GA 1KK8B 1YTZC 2JQ6A 2LV7A 2WOSA 1Y1AA 1Y0VH 2L50A 2I2RE 3WNXB 1JWDA 1L2OC 2OTGB 4WQ3A 2FCDA 2M9GA 1DJWA 3RM1A 4ORCB 4MZJA 1XK4A 5CSIA 3EVUA 4N1FA 1TOPA 1Y6WA 2LP3A 2L98A 3JVTB 2LC5A 1M63B 2EHBA 1DJIA 1S6IA 1R2UA 3AAJA 1SCMC 4GAOA 1DF0A 3SG4A 1J7QA 2I7AA 4OVNF 1XYDA 2JTTA 5I2OA 1UHNA 3BUOB 2WCBA 1IJ5A 4MLWA 2LVIA 1W7IB 1DGVA 1TNPA 1JC2A 4PE1A 2R2IA 1CDLA 3CR5X 1YVHA 4GNKB 1U5IB 1QLSA 1QLKA 1K94A 5CSJA 1F55A 2DOQA 1FBVA 2ZFDA 1DJYA 2WCFA 4YI8A 3SJSA 1KFXS 1CFPA 1XFWO 4PDZA 3EK8A 5AERA 1K96A 3LL8B 2PSRA 1SMGA 1CFFA 4A4BA 2COLB 3OB1B 1NIWA 1WLMA 1YUTA 1RECA 3VRNA 1UHIA 4BY5A 2EC6B 1A4PA 2L5XB 5FYXA 3TS5C 1SCVA 4PHMA 5ER4X 2BCBA 4AQIA 1K9KA 2KQ6A 3K21A 1ZACA 3I5HC 1GQMA 2G2BA 2M1UA 3CGAA 2WORA 1RWYA 1ZMZA 2FOTA 2HETA 3WHTB 4HRGA 1XFVO 2M0RA 2GGZA 1B9AA 1NP8A 1SNLA 1DVIA 1CFCA 2Y1NA 1M46A 1YVLA 3BOWA 3FIAA 1G8IA 1YUUA 3DD4A 1K9UA 1KSOA 2LLUA 1KFUL 3TZ1A 2QACA 4PALA 1S26D 2KI4B 1CDNA 1WY9A 1DT7B 2RGIA 1UURA 5AEQA 2LHIA 4I5LB 1KQMC 1G4YR 2ZRSA 2QPTA 4UPGA 1B8CA 2LHLA 2BL0C 1QX7A 2KAVA 3F45A 1MF8B 2OS8C 3LLEA 1KQVA 3TDIA 1OE9B 2LLSA 3JVTC 4MZLA 4GPLB 1KCYA 4ZCUA 2F2OA 2M7NA 3PATA 2KI6D 1PALA 1KK7Y 1B4CA 1GJYA 2SASA 5KTYA 1W7JB 1TN4A 4TNCA 5HKWA 2SCPA 1OMDA 3NSIA 3KEVA 2BECA 1QS7A 3VGOA 1QJTA 2MLFC 4YRUA 2H2KA 1OOJA 2CTNA 2OPOA 1ALWA 1EJ3A 3EK4A 2ZKMX 4I5KA 2KGRA 3IF7A 3PN7B 4MBEA 2F8PA 1B7TZ 2EGDA 1HT9A 2WCEA 3AKAA 5HYDA 2BCXA 3LK1A 2FCEA 3OX6A 5AFPA 1N65A 2K2FA 2L4IA 1CLBA 3D10A 1MUXA 1YX7A 1BJFA 2L2EA 4CIDA 3O2PA 5G08A 3RLZA 2Y5IA 2LCPA 5HKYA 1QTXA 4R1EA 4YGEB 1KK7Z 2MAZA 5B8IB 1CMFA 4N1GA 1LINA 2EC6C 1M39A 5DKRA 3KF9A 4BY4A 1SR6C 2MRDA 2JXCA 3LK0A 1KSMA 4DUQA 2AUCA 3BUNB 3EVRA 3VROA 2LUCA 2NZ0A 1JFKA 1RK9A 1EH2A 3WHUB 1QIVA 1B47A 3PSRA 1MWNA 1QVIZ 4YBHB 1MR8A 1S5GZ 4XJKB 4NDBA 3TDZA 1XFYO 2AMIA 3D0YB 2WC8A 2Y4QA 2BBMA 3BXKA 3I5GB 1K2HA 2ZRTA 5JJGA 1NYAA 2KAYA 1BLQA 3CR4X 2HF5A 2HQ8A 1V1FA 4MRXA 2I18A 1CLLA 2JWWA 3SG6A 3I5FB 3I5IB 3JTDB 1CFDA 2LMVA 4ZCVA 2JZIA 1XFXO 1QX5B 2KFHA 4P5OE 2PMYA 1BG1A 3BYAA 2PRUA 1PULA 1N0YA 1CMGA 1JSAA 2OS8B 3DVKA 1FW4A 3EKHA 4HREE 3I5IC 4FQOA 3FWBA 4PE4A 1CTRA 1AK8A 1AJ5A 1XVJA 2KI4C 3CTNA 4HRHA 1IGVA 1F70A 2M49B 3DVEA 1S5GY 4GGFC 1A2XA 5KSZA 3EK7A 3OB2B 4DCKA 4DRWA 1BOCA 2KYCA 2JOJA 1IQ3A 2K7OA 1ALVA 4M2OA 3BUXB 3D0YA 2KGBC 2ZNDA 3CWGA 2F3YA 1GGZA 1NX2A 2NXQA 1EXRA 4AQJA 2K2AA 1FI5A 1QATA 3NXAA 1Y1XA 5D69A 1KWOC 1WLZA 1S3PA 1BU3A 1KK8C 2L4HA 4CFRA 1CDMA 4MZKA 1WRZA 5GQQC 1FI6A 1BMOA 1DTLA 1AHRA 1QX2A 1SCMB 1X02A 2A4JA 3A4UB 1TNXA 4MEWA 4ICBA 3TUYB 1QIWA 2PASA 1TTXA 4PHJA 2JT3A 1J7RA 1MHOA 2LVVA 1DJZA 2M7LA 3GK4X 1UUSA 1JFJA 2D8NA 4C0LA 1SR6B 1TNWA 1XA5A 4D1EA 1QASA 2KSPA 1IQ5A 1SY9A 2JPTA 1K93D 1EG4A 1UHKA 4JQ0D 3PM8A 1IWQA 3HCMA 2KFFA 1NCZA 3BUMB 3CS1A 4FTGA 2ZN8A 1YURA 3WXAA 3SIAA 1OMRA 5BPJA 1NX0A 5ER5A 2GV5A 2KQYA 1S36A 1LKJA 4GBAA 2LMUA 1YRUB 3TDUA 2ZNEA 4PE7A 3CR2A 1NPQA 1PK0D 1TNQA 2KFGA 2ZN9A 1WRLA 3C1VA 2ISDA 2JT8A 3VRPA 3NSLA 1B8RA 2M3WA 4I5JA 1PRWA 1KFUS 1IRJA 2Y1MA 3BQ3A 1ZFSA 1SL8A 5JOLA 1OZSA 3EKJA 2KAXA 1C7WA 4MVFA 4N5XA 2F33A 2LE9B 1F4QA 2LP2A 4OR9B 1EG3A 1QXPA 2O60A 2K61A 3I5HB 2JTZA 3SG2A 1PVAA 5F6TA 2F3ZA 2K0JA 2KOTA 3AKBA 2BE4A 1J7PA 2CT9A 1J1DA 4AOMA 1RJVA 1CDPA 3VRRA 4GGNA 1M31A 2MHHA 1QV0A 1MQ1A 2MBXA 3DVJA 4XJKA 1BODA 2MJWB 2OTGC 4OV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JWQ A;  1RTP 1;  1JBA A;  5PAL A;  1ZOT B;  2BE6 A;  1CB1 A;  2LAP A;  2H61 C;  1SL7 A;  2LAN A;  2V53 A;  2K7C A;  3PLF B;  2CXJ A;  4JPZ B;  3NSK A;  4WQ2 A;  2IS9 A;  1CM1 A;  1XO5 A;  2KDH A;  4A4C A;  3SG7 A;  1K95 A;  2JU0 A;  2M97 A;  2GGM A;  4ORA B;  1MXE A;  2CBL A;  2LUX A;  1Q80 A;  2E30 A;  5J3X A;  1K9P A;  4IL1 A;  4YI9 A;  1IKU A;  1F4O A;  1J7O A;  5HLV A;  4MRY A;  5HLO A;  2NCP A;  3PFV A;  1F71 A;  1V1G A;  3GOF A;  1NSH A;  4QJ3 B;  5I2Q A;  3TUY C;  1A03 A;  1ODB A;  4QJ5 B;  2KI6 C;  2KNE A;  2Q91 A;  3SIB A;  2LM5 A;  2VRG A;  1SK6 D;  2BKI B;  4GFT A;  2JNF A;  5DKN A;  1H4B A;  2M8U A;  1J55 A;  1M45 A;  3AAK A;  4GGF A;  4NDD A;  4QJ4 B;  5TNC A;  2E6W A;  1PVB A;  1CNP A;  1OSA A;  1OZO A;  4E68 A;  1IH0 A;  1AP4 A;  1DJG A;  1SBJ A;  5KU1 A;  1R6P A;  3VRQ A;  1UWO A;  2JT0 A;  1PSB A;  1L7Z A;  1FF1 A;  5I2L A;  2BKH B;  4YGB B;  4WRI A;  4DIR A;  2JC2 A;  2JXL A;  2H61 A;  2K7D A;  1BR4 B;  3H4S E;  1NWD A;  1PSR A;  3FS7 A;  3EVV A;  1CLM A;  1E8A A;  4OKH A;  1A75 A;  4USL A;  1B1G A;  1WDC C;  1WRK A;  2WND A;  1N2D A;  2KHN A;  2LNK A;  2MLE C;  1JUO A;  2BL0 B;  2NLN A;  3ICB A;  5IBW A;  1C7V A;  5AXI A;  1D1O A;  1L2O B;  3I5F C;  2NCO A;  1SYM A;  1DMO A;  3O78 A;  1RRO A;  3QRX A;  2B1U A;  4HSZ A;  2P6B B;  3GK1 A;  1NUB A;  3I5G C;  4PCW A;  1KQM B;  1MXL C;  3GK2 A;  2K7B A;  1S6J A;  1UHJ A;  1BT6 A;  3O6B A;  5AAN A;  2L51 A;  1AJ4 A;  3DF0 B;  1SL9 A;  4GUK A;  5I8N A;  1LVC D;  1EL4 A;  2LVJ A;  1DF0 B;  4DS7 A;  2JUL A;  3CLN A;  1YR5 A;  1CKK A;  3IQQ A;  1YRT B;  4YGC B;  5CPV A;  2MA2 A;  2CCM A;  1DJX A;  3HX4 A;  3IQO A;  1KFX L;  1XFU O;  2LVK A;  1SPY A;  4L9M A;  1JF0 A;  5K89 A;  4P2Y B;  1KWO B;  2PVB A;  3SG5 A;  2TN4 A;  3MSE B;  1B7T Y;  1J1E A;  2KBM A;  3KO0 A;  3FWC A;  4CFQ A;  2KYF A;  4YGA A;  3BUW B;  2L0P A;  2AAO A;  1UHH A;  3KHE A;  1YUS A;  4XYN A;  1DJH A;  2CNP A;  3OX5 A;  5CSN A;  5HKZ A;  2PAL A;  2M1K B;  4NQG A;  3KPX A;  2KBI A;  4NDC A;  2BBN A;  1NX1 A;  1S1E A;  1H8B A;  4MN0 A;  4PHK A;  4U8D A;  1IG5 A;  2M29 A;  1NX3 A;  3PAL A;  3DF0 A;  1VRK A;  1TCO B;  4M2Q A;  3NSO A;  1G33 A;  1TIZ A;  1C07 A;  1QVI Y;  2HPS A;  5CSF A;  4CPV A;  3DVM A;  1CM4 A;  2Q4U A;  1NCY A;  3OP0 A;  4ORB B;  3BOW B;  2BCA A;  1OQP A;  1DGU A;  3SG3 A;  1F54 A;  1UP5 A;  1NCX A;  3A8R A;  3LCP C;  2I94 A;  4PE0 A;  4PHN A;  1TRF A;  1QV1 A;  2F2P A;  3ZWH A;  1OMV A;  4C0J A;  3JTD C;  1F8H A;  1GGW A;  4C0K A;  2G9B A;  2JNX A;  1RFJ A;  1S6C A;  4ETO A;  1XK4 C;  2LMT A;  1K90 D;  1K8U A;  3ZNI A;  4MSP A;  1B8L A;  1TCF A;  4M2P A;  1HQV A;  1FPW A;  1SW8 A;  1AUI B;  1LA3 A;  4YGD B;  3TS5 B;  3OHM B;  5DKQ A;  3E3R A;  4I5N B;  1XFZ O;  1LXF C;  1SRA A;  1SKT A;  1Y1U A;  2K8M B;  2FJU B;  4OCI A;  1YX8 A;  1A75 B;  1A29 A;  2LLT A;  3CZT X;  1IJ6 A;  1BR1 B;  4CLN A;  2HQW A;  1AVS A;  2JRF A;  1JF2 A;  1ZUZ A;  1LA0 A;  3M0W A;  5D7F A;  4Q04 A;  1U5I A;  4F0Z B;  1BF5 A;  1WDC B;  3PN7 C;  3O4Y A;  2O5G A;  1KK8 B;  1YTZ C;  2JQ6 A;  2LV7 A;  2WOS A;  1Y1A A;  1Y0V H;  2L50 A;  2I2R E;  3WNX B;  1JWD A;  1L2O C;  2OTG B;  4WQ3 A;  2FCD A;  2M9G A;  1DJW A;  3RM1 A;  4ORC B;  4MZJ A;  1XK4 A;  5CSI A;  3EVU A;  4N1F A;  1TOP A;  1Y6W A;  2LP3 A;  2L98 A;  3JVT B;  2LC5 A;  1M63 B;  2EHB A;  1DJI A;  1S6I A;  1R2U A;  3AAJ A;  1SCM C;  4GAO A;  1DF0 A;  3SG4 A;  1J7Q A;  2I7A A;  4OVN F;  1XYD A;  2JTT A;  5I2O A;  1UHN A;  3BUO B;  2WCB A;  1IJ5 A;  4MLW A;  2LVI A;  1W7I B;  1DGV A;  1TNP A;  1JC2 A;  4PE1 A;  2R2I A;  1CDL A;  3CR5 X;  1YVH A;  4GNK B;  1U5I B;  1QLS A;  1QLK A;  1K94 A;  5CSJ A;  1F55 A;  2DOQ A;  1FBV A;  2ZFD A;  1DJY A;  2WCF A;  4YI8 A;  3SJS A;  1KFX S;  1CFP A;  1XFW O;  4PDZ A;  3EK8 A;  5AER A;  1K96 A;  3LL8 B;  2PSR A;  1SMG A;  1CFF A;  4A4B A;  2COL B;  3OB1 B;  1NIW A;  1WLM A;  1YUT A;  1REC A;  3VRN A;  1UHI A;  4BY5 A;  2EC6 B;  1A4P A;  2L5X B;  5FYX A;  3TS5 C;  1SCV A;  4PHM A;  5ER4 X;  2BCB A;  4AQI A;  1K9K A;  2KQ6 A;  3K21 A;  1ZAC A;  3I5H C;  1GQM A;  2G2B A;  2M1U A;  3CGA A;  2WOR A;  1RWY A;  1ZMZ A;  2FOT A;  2HET A;  3WHT B;  4HRG A;  1XFV O;  2M0R A;  2GGZ A;  1B9A A;  1NP8 A;  1SNL A;  1DVI A;  1CFC A;  2Y1N A;  1M46 A;  1YVL A;  3BOW A;  3FIA A;  1G8I A;  1YUU A;  3DD4 A;  1K9U A;  1KSO A;  2LLU A;  1KFU L;  3TZ1 A;  2QAC A;  4PAL A;  1S26 D;  2KI4 B;  1CDN A;  1WY9 A;  1DT7 B;  2RGI A;  1UUR A;  5AEQ A;  2LHI A;  4I5L B;  1KQM C;  1G4Y R;  2ZRS A;  2QPT A;  4UPG A;  1B8C A;  2LHL A;  2BL0 C;  1QX7 A;  2KAV A;  3F45 A;  1MF8 B;  2OS8 C;  3LLE A;  1KQV A;  3TDI A;  1OE9 B;  2LLS A;  3JVT C;  4MZL A;  4GPL B;  1KCY A;  4ZCU A;  2F2O A;  2M7N A;  3PAT A;  2KI6 D;  1PAL A;  1KK7 Y;  1B4C A;  1GJY A;  2SAS A;  5KTY A;  1W7J B;  1TN4 A;  4TNC A;  5HKW A;  2SCP A;  1OMD A;  3NSI A;  3KEV A;  2BEC A;  1QS7 A;  3VGO A;  1QJT A;  2MLF C;  4YRU A;  2H2K A;  1OOJ A;  2CTN A;  2OPO A;  1ALW A;  1EJ3 A;  3EK4 A;  2ZKM X;  4I5K A;  2KGR A;  3IF7 A;  3PN7 B;  4MBE A;  2F8P A;  1B7T Z;  2EGD A;  1HT9 A;  2WCE A;  3AKA A;  5HYD A;  2BCX A;  3LK1 A;  2FCE A;  3OX6 A;  5AFP A;  1N65 A;  2K2F A;  2L4I A;  1CLB A;  3D10 A;  1MUX A;  1YX7 A;  1BJF A;  2L2E A;  4CID A;  3O2P A;  5G08 A;  3RLZ A;  2Y5I A;  2LCP A;  5HKY A;  1QTX A;  4R1E A;  4YGE B;  1KK7 Z;  2MAZ A;  5B8I B;  1CMF A;  4N1G A;  1LIN A;  2EC6 C;  1M39 A;  5DKR A;  3KF9 A;  4BY4 A;  1SR6 C;  2MRD A;  2JXC A;  3LK0 A;  1KSM A;  4DUQ A;  2AUC A;  3BUN B;  3EVR A;  3VRO A;  2LUC A;  2NZ0 A;  1JFK A;  1RK9 A;  1EH2 A;  3WHU B;  1QIV A;  1B47 A;  3PSR A;  1MWN A;  1QVI Z;  4YBH B;  1MR8 A;  1S5G Z;  4XJK B;  4NDB A;  3TDZ A;  1XFY O;  2AMI A;  3D0Y B;  2WC8 A;  2Y4Q A;  2BBM A;  3BXK A;  3I5G B;  1K2H A;  2ZRT A;  5JJG A;  1NYA A;  2KAY A;  1BLQ A;  3CR4 X;  2HF5 A;  2HQ8 A;  1V1F A;  4MRX A;  2I18 A;  1CLL A;  2JWW A;  3SG6 A;  3I5F B;  3I5I B;  3JTD B;  1CFD A;  2LMV A;  4ZCV A;  2JZI A;  1XFX O;  1QX5 B;  2KFH A;  4P5O E;  2PMY A;  1BG1 A;  3BYA A;  2PRU A;  1PUL A;  1N0Y A;  1CMG A;  1JSA A;  2OS8 B;  3DVK A;  1FW4 A;  3EKH A;  4HRE E;  3I5I C;  4FQO A;  3FWB A;  4PE4 A;  1CTR A;  1AK8 A;  1AJ5 A;  1XVJ A;  2KI4 C;  3CTN A;  4HRH A;  1IGV A;  1F70 A;  2M49 B;  3DVE A;  1S5G Y;  4GGF C;  1A2X A;  5KSZ A;  3EK7 A;  3OB2 B;  4DCK A;  4DRW A;  1BOC A;  2KYC A;  2JOJ A;  1IQ3 A;  2K7O A;  1ALV A;  4M2O A;  3BUX B;  3D0Y A;  2KGB C;  2ZND A;  3CWG A;  2F3Y A;  1GGZ A;  1NX2 A;  2NXQ A;  1EXR A;  4AQJ A;  2K2A A;  1FI5 A;  1QAT A;  3NXA A;  1Y1X A;  5D69 A;  1KWO C;  1WLZ A;  1S3P A;  1BU3 A;  1KK8 C;  2L4H A;  4CFR A;  1CDM A;  4MZK A;  1WRZ A;  5GQQ C;  1FI6 A;  1BMO A;  1DTL A;  1AHR A;  1QX2 A;  1SCM B;  1X02 A;  2A4J A;  3A4U B;  1TNX A;  4MEW A;  4ICB A;  3TUY B;  1QIW A;  2PAS A;  1TTX A;  4PHJ A;  2JT3 A;  1J7R A;  1MHO A;  2LVV A;  1DJZ A;  2M7L A;  3GK4 X;  1UUS A;  1JFJ A;  2D8N A;  4C0L A;  1SR6 B;  1TNW A;  1XA5 A;  4D1E A;  1QAS A;  2KSP A;  1IQ5 A;  1SY9 A;  2JPT A;  1K93 D;  1EG4 A;  1UHK A;  4JQ0 D;  3PM8 A;  1IWQ A;  3HCM A;  2KFF A;  1NCZ A;  3BUM B;  3CS1 A;  4FTG A;  2ZN8 A;  1YUR A;  3WXA A;  3SIA A;  1OMR A;  5BPJ A;  1NX0 A;  5ER5 A;  2GV5 A;  2KQY A;  1S36 A;  1LKJ A;  4GBA A;  2LMU A;  1YRU B;  3TDU A;  2ZNE A;  4PE7 A;  3CR2 A;  1NPQ A;  1PK0 D;  1TNQ A;  2KFG A;  2ZN9 A;  1WRL A;  3C1V A;  2ISD A;  2JT8 A;  3VRP A;  3NSL A;  1B8R A;  2M3W A;  4I5J A;  1PRW A;  1KFU S;  1IRJ A;  2Y1M A;  3BQ3 A;  1ZFS A;  1SL8 A;  5JOL A;  1OZS A;  3EKJ A;  2KAX A;  1C7W A;  4MVF A;  4N5X A;  2F33 A;  2LE9 B;  1F4Q A;  2LP2 A;  4OR9 B;  1EG3 A;  1QXP A;  2O60 A;  2K61 A;  3I5H B;  2JTZ A;  3SG2 A;  1PVA A;  5F6T A;  2F3Z A;  2K0J A;  2KOT A;  3AKB A;  2BE4 A;  1J7P A;  2CT9 A;  1J1D A;  4AOM A;  1RJV A;  1CDP A;  3VRR A;  4GGN A;  1M31 A;  2MHH A;  1QV0 A;  1MQ1 A;  2MBX A;  3DVJ A;  4XJK A;  1BOD A;  2MJW B;  2OTG C;  4OV2 A; 
#chains in the Genus database with same CATH topology
 4JWQ A;  1RTP 1;  1JBA A;  5PAL A;  1ZOT B;  2BE6 A;  3B7A A;  3VB1 A;  1CB1 A;  2LAP A;  2H61 C;  1SL7 A;  2LAN A;  2V53 A;  2K7C A;  3PLF B;  2CXJ A;  4JPZ B;  3NSK A;  4WQ2 A;  2IS9 A;  4INX A;  1CM1 A;  1XO5 A;  2H8V A;  2KDH A;  3SG7 A;  4A4C A;  2BAP A;  1K95 A;  3O4X A;  2JU0 A;  2M97 A;  2GGM A;  4ORA B;  1MXE A;  2CBL A;  2LUX A;  1Q80 A;  2E30 A;  5J3X A;  1K9P A;  4IL1 A;  4YI9 A;  1IKU A;  1F4O A;  1J7O A;  5HLV A;  4MRY A;  5HLO A;  2NCP A;  3PFV A;  1F71 A;  1V1G A;  3GOF A;  1NSH A;  4QJ3 B;  5I2Q A;  3TUY C;  1A03 A;  1ODB A;  3BFB A;  2KI6 C;  3BJH A;  4QJ5 B;  2KNE A;  2Q91 A;  3SIB A;  2QDI A;  3D76 A;  2LM5 A;  2VRG A;  1SK6 D;  2BKI B;  4GFT A;  2JNF A;  5DKN A;  1H4B A;  2M8U A;  1J55 A;  1M45 A;  3AAK A;  4GGF A;  4NDD A;  4QJ4 B;  4PT1 A;  2E6W A;  1PVB A;  5TNC A;  1CNP A;  1OSA A;  1OZO A;  4E68 A;  1IH0 A;  1AP4 A;  1DJG A;  1SBJ A;  2L2C A;  3NHT A;  5KU1 A;  3CYZ A;  1R6P A;  3VRQ A;  1UWO A;  2JT0 A;  2P71 A;  1PSB A;  1L7Z A;  1FF1 A;  5I2L A;  2BKH B;  3D75 A;  4YGB B;  4WRI A;  4DIR A;  2JC2 A;  2JXL A;  2H61 A;  2K7D A;  2WCH A;  1BR4 B;  3DY9 A;  3H4S E;  3SS3 A;  1NWD A;  1PSR A;  3FS7 A;  3EVV A;  1CLM A;  1E8A A;  4OKH A;  2BNX A;  1DEL A;  1A75 A;  4USL A;  1B1G A;  3IVT A;  1WDC C;  1WRK A;  2WND A;  1N2D A;  2KHN A;  2LNK A;  4FQT A;  2MLE C;  1JUO A;  2BL0 B;  2NLN A;  3B86 A;  4OZD A;  3ICB A;  5IBW A;  1C7V A;  5AXI A;  1D1O A;  5DIC A;  1L2O B;  2KPH A;  3I5F C;  2NCO A;  1SYM A;  1DMO A;  3UO9 A;  3O78 A;  1RRO A;  3QRX A;  2B1U A;  2QEV A;  4HSZ A;  2P6B B;  2KLE A;  3GK1 A;  1NUB A;  3I5G C;  4PCW A;  4INW A;  1KQM B;  1MXL C;  3RZS A;  3GK2 A;  1OOG A;  2K7B A;  1S6J A;  1UHJ A;  1BT6 A;  3O6B A;  5AAN A;  2L51 A;  1AJ4 A;  3DF0 B;  1SL9 A;  4GUK A;  5I8N A;  1LVC D;  1EL4 A;  2LVJ A;  1DF0 B;  4DS7 A;  2JUL A;  3CLN A;  1YR5 A;  1CKK A;  3IQQ A;  1YRT B;  4YGC B;  5CPV A;  2MA2 A;  2CCM A;  1DJX A;  3HX4 A;  3IQO A;  1KFX L;  1XFU O;  2LVK A;  1SPY A;  4L9M A;  1JF0 A;  3CDN A;  5K89 A;  1W9Z A;  4P2Y B;  1KWO B;  3CZ2 A;  2PVB A;  3SG5 A;  2TN4 A;  3R72 A;  3K1E A;  3MSE B;  1B7T Y;  1J1E A;  2KBM A;  3KO0 A;  3FWC A;  4CFQ A;  2KYF A;  4YGA A;  3BUW B;  2L0P A;  2AAO A;  1UHH A;  2WCJ A;  3KHE A;  1YUS A;  4XYN A;  1DJH A;  2CNP A;  3OX5 A;  5CSN A;  5HKZ A;  2PAL A;  2M1K B;  4NQG A;  3KPX A;  2KBI A;  4NDC A;  2BBN A;  1NX1 A;  1S1E A;  1H8B A;  4MN0 A;  4PHK A;  2QEH A;  4U8D A;  1IG5 A;  2M29 A;  1NX3 A;  3PAL A;  3DF0 A;  1VRK A;  3BFA A;  1TCO B;  4M2Q A;  3NSO A;  1G33 A;  1TIZ A;  1C07 A;  1QVI Y;  2HPS A;  5CSF A;  4CPV A;  3DVM A;  1CM4 A;  2Q4U A;  1NCY A;  3OP0 A;  4ORB B;  3BOW B;  5EL2 A;  2BCA A;  1OQP A;  1DGU A;  3SG3 A;  1F54 A;  1UP5 A;  1NCX A;  3A8R A;  3LCP C;  2I94 A;  4PE0 A;  4PHN A;  1TRF A;  1QV1 A;  2F2P A;  3ZWH A;  2P70 A;  1OMV A;  4C0J A;  3JTD C;  1F8H A;  1GGW A;  2QEB A;  2G9B A;  2JNX A;  1RFJ A;  1S6C A;  4C0K A;  4ETO A;  1XK4 C;  2LMT A;  1K90 D;  2WCL A;  1K8U A;  3ZNI A;  4MSP A;  1B8L A;  1TCF A;  4M2P A;  1HQV A;  2PQL A;  1FPW A;  1SW8 A;  1AUI B;  1LA3 A;  4YGD B;  3TS5 B;  3OHM B;  5DKQ A;  3E3R A;  4I5N B;  1XFZ O;  1LXF C;  1SRA A;  1SKT A;  1Y1U A;  2K8M B;  2FJU B;  4OCI A;  1YX8 A;  1A75 B;  1A29 A;  2LLT A;  3CZT X;  1IJ6 A;  1BR1 B;  2WC6 A;  4CLN A;  2HQW A;  1AVS A;  2JRF A;  1JF2 A;  1ZUZ A;  3OGN A;  1LA0 A;  3CAB A;  3M0W A;  4Q04 A;  5D7F A;  1U5I A;  2WCK A;  3V2L A;  4F0Z B;  1BF5 A;  1WDC B;  3PN7 C;  3O4Y A;  2O5G A;  1KK8 B;  1YTZ C;  2JQ6 A;  2LV7 A;  2WOS A;  1Y1A A;  1C3Z A;  1Y0V H;  3S0E A;  2L50 A;  2I2R E;  3WNX B;  1JWD A;  1L2O C;  2OTG B;  4WQ3 A;  2FCD A;  2M9G A;  1DJW A;  3RM1 A;  4ORC B;  4MZJ A;  1XK4 A;  5CSI A;  3EVU A;  4N1F A;  1TOP A;  1Y6W A;  2LP3 A;  2L98 A;  3JVT B;  2WCM A;  3QME A;  2LC5 A;  1M63 B;  2EHB A;  1DJI A;  1S6I A;  1R2U A;  3AAJ A;  1SCM C;  4GAO A;  2KLD A;  1DF0 A;  3SG4 A;  1J7Q A;  2I7A A;  4OVN F;  1XYD A;  1TUZ A;  2JTT A;  5I2O A;  3S0G A;  1UHN A;  3BFH A;  3BUO B;  1SSE B;  2WCB A;  1IJ5 A;  4MLW A;  2LVI A;  1P28 A;  1W7I B;  1DGV A;  1TNP A;  1JC2 A;  4PE1 A;  2R2I A;  1CDL A;  3CR5 X;  1YVH A;  3DYE A;  4GNK B;  1U5I B;  1QLS A;  1QLK A;  1K94 A;  5CSJ A;  1F55 A;  2DOQ A;  1FBV A;  2ZFD A;  1DJY A;  2WCF A;  4YI8 A;  3SJS A;  1KFX S;  1CFP A;  1XFW O;  4PDZ A;  3EK8 A;  5AER A;  1K96 A;  3LL8 B;  2PSR A;  1SMG A;  1CFF A;  4A4B A;  2COL B;  3OB1 B;  1NIW A;  1WLM A;  1YUT A;  1REC A;  3VRN A;  1UHI A;  3FE8 A;  4BY5 A;  2EC6 B;  1A4P A;  2L5X B;  5FYX A;  3TS5 C;  1SCV A;  3D77 A;  4PHM A;  5ER4 X;  1LS8 A;  2BCB A;  4AQI A;  1K9K A;  2KQ6 A;  2YGU A;  1ZAC A;  3I5H C;  3K21 A;  1GQM A;  2G2B A;  2M1U A;  4JKT A;  3CGA A;  2WOR A;  3D73 A;  3PM2 A;  1DQE A;  1RWY A;  1ZMZ A;  2FOT A;  2HET A;  3WHT B;  4HRG A;  1XFV O;  2M0R A;  2GGZ A;  3FE9 A;  1B9A A;  3NHI A;  1GM0 A;  1NP8 A;  1SNL A;  1DVI A;  3L4A A;  1CFC A;  2Y1N A;  1M46 A;  1YVL A;  3BOW A;  3FIA A;  1G8I A;  1YUU A;  3DD4 A;  1K9U A;  1KSO A;  2LLU A;  1KFU L;  3TZ1 A;  2QAC A;  3R1P A;  1S26 D;  2KI4 B;  4PAL A;  1Z4H A;  1WY9 A;  1DT7 B;  1CDN A;  2RGI A;  1UUR A;  5AEQ A;  2LHI A;  4I5L B;  1KQM C;  1G4Y R;  2ZRS A;  2QPT A;  4UPG A;  1B8C A;  3R1V A;  2LHL A;  2BL0 C;  1QX7 A;  2KAV A;  3F45 A;  1MF8 B;  2OS8 C;  3D74 A;  3LLE A;  1KQV A;  3TDI A;  1OE9 B;  2LLS A;  3JVT C;  4MZL A;  4GPL B;  1DEK A;  2GTE A;  4ZCU A;  2F2O A;  2M7N A;  3PAT A;  1KCY A;  2KI6 D;  1PAL A;  3B88 A;  1KK7 Y;  1OOH A;  1GJY A;  1OW4 A;  2SAS A;  5KTY A;  1W7J B;  3S0F A;  1B4C A;  1TN4 A;  4TNC A;  5HKW A;  2SCP A;  1OMD A;  3NSI A;  3KEV A;  5D3O A;  2BEC A;  1DC1 A;  1QS7 A;  3VGO A;  1QJT A;  2MLF C;  4YRU A;  2H2K A;  1OOJ A;  2CTN A;  2OPO A;  1ALW A;  1EJ3 A;  3EK4 A;  2ZKM X;  4I5K A;  2KGR A;  3IF7 A;  3PN7 B;  1QWV A;  4MBE A;  2WC5 A;  2F8P A;  3OBV A;  1B7T Z;  3S0A A;  2EGD A;  1HT9 A;  2WCE A;  1TUJ A;  3AKA A;  5HYD A;  2BCX A;  3LK1 A;  2FCE A;  3OX6 A;  1ORG A;  1N65 A;  2K2F A;  2L4I A;  5AFP A;  1CLB A;  3D10 A;  1MUX A;  1OOI X;  3CZ1 A;  1YX7 A;  1BJF A;  2L2E A;  3FE6 A;  3O2P A;  4CID A;  5G08 A;  3RLZ A;  3DXL A;  2Y5I A;  2LCP A;  5HKY A;  1QTX A;  1Z2C B;  4R1E A;  4YGE B;  1KK7 Z;  3N7H A;  2MAZ A;  5B8I B;  1CMF A;  4N1G A;  1LIN A;  2EC6 C;  1M39 A;  5DKR A;  3KF9 A;  1OOF A;  4BY4 A;  1SR6 C;  2MRD A;  2JXC A;  3LK0 A;  1KSM A;  3NGV A;  4DUQ A;  2AUC A;  3BUN B;  3EVR A;  3VRO A;  2LUC A;  1XFR A;  1JFK A;  2NZ0 A;  1RK9 A;  1EH2 A;  3WHU B;  1QIV A;  1B47 A;  3R1O A;  3PSR A;  1MWN A;  1QVI Z;  4YBH B;  1MR8 A;  1S5G Z;  4XJK B;  4NDB A;  3TDZ A;  1XFY O;  2AMI A;  3D0Y B;  1IIO A;  2WC8 A;  2Y4Q A;  2BBM A;  3BXK A;  2FJY A;  3I5G B;  1K2H A;  2ZRT A;  5JJG A;  1NYA A;  5FI6 A;  1TWO A;  2KAY A;  1BLQ A;  3CR4 X;  2HF5 A;  2HQ8 A;  1V1F A;  4MRX A;  2I18 A;  1CLL A;  2JWW A;  3SG6 A;  3I5F B;  3I5I B;  3JTD B;  1CFD A;  2LMV A;  4ZCV A;  2JZI A;  3S0B A;  1XFX O;  1QX5 B;  2KFH A;  4P5O E;  2PMY A;  1BG1 A;  3BYA A;  2PRU A;  1PUL A;  1N0Y A;  4KYN A;  1CMG A;  3Q8I A;  2OS8 B;  3DVK A;  1JSA A;  1FW4 A;  3EKH A;  4HRE E;  3I5I C;  3S0D A;  4FQO A;  3FWB A;  4PE4 A;  1CTR A;  1AK8 A;  1AJ5 A;  1XVJ A;  2KI4 C;  3CTN A;  4HRH A;  1IGV A;  1F70 A;  2M49 B;  3DVE A;  1S5G Y;  4GGF C;  1A2X A;  5KSZ A;  2PYQ A;  3EK7 A;  3OB2 B;  4DCK A;  4DRW A;  1BOC A;  2KYC A;  2JOJ A;  1IQ3 A;  2K7O A;  1ALV A;  4M2O A;  3BUX B;  3D0Y A;  2KGB C;  2ZND A;  3CWG A;  2F3Y A;  1GGZ A;  1NX2 A;  2NXQ A;  1EXR A;  4AQJ A;  2K2A A;  1FI5 A;  4IJ7 A;  1QAT A;  3NXA A;  1Y1X A;  5D69 A;  1KWO C;  3UNW A;  1WLZ A;  1S3P A;  1BU3 A;  1KK8 C;  2L4H A;  4CFR A;  1CDM A;  3D78 A;  4MZK A;  3SS4 A;  1WRZ A;  5GQQ C;  1FI6 A;  1BMO A;  1DTL A;  1AHR A;  1QX2 A;  1SCM B;  1X02 A;  2A4J A;  3A4U B;  1TNX A;  4MEW A;  4ICB A;  3TUY B;  1QIW A;  2PAS A;  3PJI A;  1TTX A;  3CZ0 A;  4PHJ A;  2JT3 A;  1J7R A;  1MHO A;  2LVV A;  1DJZ A;  5FI7 A;  2M7L A;  3GK4 X;  1UUS A;  1JFJ A;  2D8N A;  3DZT A;  4C0L A;  1SR6 B;  1TNW A;  1XA5 A;  4D1E A;  1QAS A;  2KSP A;  1IQ5 A;  1SY9 A;  2JPT A;  1K93 D;  1EG4 A;  1UHK A;  4JQ0 D;  3PM8 A;  1IWQ A;  3HCM A;  2KFF A;  1NCZ A;  3BUM B;  3CS1 A;  4FTG A;  2ZN8 A;  1YUR A;  4JD9 A;  3WXA A;  3SIA A;  1OMR A;  5BPJ A;  2K60 A;  1NX0 A;  5ER5 A;  2GV5 A;  2KQY A;  1S36 A;  1LKJ A;  4GBA A;  3B87 A;  2LMU A;  1YRU B;  3TDU A;  2ZNE A;  3L4L A;  3CR2 A;  4PE7 A;  1NPQ A;  1PK0 D;  1TNQ A;  2KFG A;  2ZN9 A;  1WRL A;  3C1V A;  5HL1 A;  5I94 A;  2ISD A;  3L47 A;  2JT8 A;  3VRP A;  3NSL A;  1B8R A;  2M3W A;  4I5J A;  1PRW A;  1KFU S;  3EG5 B;  4F7F A;  1IRJ A;  2ERB A;  2Y1M A;  3BQ3 A;  1ZFS A;  1SL8 A;  5JOL A;  1OZS A;  3EKJ A;  2KAX A;  1C7W A;  4MVF A;  4N5X A;  2F33 A;  2LE9 B;  1F4Q A;  2LP2 A;  4OR9 B;  2L5Y A;  1EG3 A;  1QXP A;  2O60 A;  2K61 A;  3I5H B;  2JTZ A;  2JPO A;  3SG2 A;  1PVA A;  5F6T A;  2F3Z A;  2K0J A;  2KOT A;  2QEO A;  3AKB A;  2BE4 A;  1J7P A;  2CT9 A;  1J1D A;  4AOM A;  1RJV A;  1CDP A;  3SS5 A;  4GGN A;  3VRR A;  1M31 A;  2MHH A;  1QV0 A;  1T14 A;  1C3Y A;  1MQ1 A;  5FI2 A;  3DVJ A;  4XJK A;  2MBX A;  2MJW B;  1BOD A;  3B6X A;  2OTG C;  4OV2 A; 
#chains in the Genus database with same CATH homology
 4JWQ A;  1RTP 1;  1JBA A;  5PAL A;  1ZOT B;  2BE6 A;  1CB1 A;  2LAP A;  2H61 C;  1SL7 A;  2LAN A;  2V53 A;  2K7C A;  3PLF B;  2CXJ A;  4JPZ B;  3NSK A;  4WQ2 A;  2IS9 A;  1CM1 A;  1XO5 A;  2KDH A;  4A4C A;  3SG7 A;  1K95 A;  2JU0 A;  2M97 A;  2GGM A;  4ORA B;  1MXE A;  2CBL A;  2LUX A;  1Q80 A;  2E30 A;  5J3X A;  1K9P A;  4IL1 A;  4YI9 A;  1IKU A;  1F4O A;  1J7O A;  5HLV A;  4MRY A;  5HLO A;  2NCP A;  3PFV A;  1F71 A;  1V1G A;  3GOF A;  1NSH A;  4QJ3 B;  5I2Q A;  3TUY C;  1A03 A;  1ODB A;  4QJ5 B;  2KI6 C;  2KNE A;  2Q91 A;  3SIB A;  2LM5 A;  2VRG A;  1SK6 D;  2BKI B;  4GFT A;  2JNF A;  5DKN A;  1H4B A;  2M8U A;  1J55 A;  1M45 A;  3AAK A;  4GGF A;  4NDD A;  4QJ4 B;  5TNC A;  2E6W A;  1PVB A;  1CNP A;  1OSA A;  1OZO A;  4E68 A;  1IH0 A;  1AP4 A;  1DJG A;  1SBJ A;  5KU1 A;  1R6P A;  3VRQ A;  1UWO A;  2JT0 A;  1PSB A;  1L7Z A;  1FF1 A;  5I2L A;  2BKH B;  4YGB B;  4WRI A;  4DIR A;  2JC2 A;  2JXL A;  2H61 A;  2K7D A;  1BR4 B;  3H4S E;  1NWD A;  1PSR A;  3FS7 A;  3EVV A;  1CLM A;  1E8A A;  4OKH A;  1A75 A;  4USL A;  1B1G A;  1WDC C;  1WRK A;  2WND A;  1N2D A;  2KHN A;  2LNK A;  2MLE C;  1JUO A;  2BL0 B;  2NLN A;  3ICB A;  5IBW A;  1C7V A;  5AXI A;  1D1O A;  1L2O B;  3I5F C;  2NCO A;  1SYM A;  1DMO A;  3O78 A;  1RRO A;  3QRX A;  2B1U A;  4HSZ A;  2P6B B;  3GK1 A;  1NUB A;  3I5G C;  4PCW A;  1KQM B;  1MXL C;  3GK2 A;  2K7B A;  1S6J A;  1UHJ A;  1BT6 A;  3O6B A;  5AAN A;  2L51 A;  1AJ4 A;  3DF0 B;  1SL9 A;  4GUK A;  5I8N A;  1LVC D;  1EL4 A;  2LVJ A;  1DF0 B;  4DS7 A;  2JUL A;  3CLN A;  1YR5 A;  1CKK A;  3IQQ A;  1YRT B;  4YGC B;  5CPV A;  2MA2 A;  2CCM A;  1DJX A;  3HX4 A;  3IQO A;  1KFX L;  1XFU O;  2LVK A;  1SPY A;  4L9M A;  1JF0 A;  5K89 A;  4P2Y B;  1KWO B;  2PVB A;  3SG5 A;  2TN4 A;  3MSE B;  1B7T Y;  1J1E A;  2KBM A;  3KO0 A;  3FWC A;  4CFQ A;  2KYF A;  4YGA A;  3BUW B;  2L0P A;  2AAO A;  1UHH A;  3KHE A;  1YUS A;  4XYN A;  1DJH A;  2CNP A;  3OX5 A;  5CSN A;  5HKZ A;  2PAL A;  2M1K B;  4NQG A;  3KPX A;  2KBI A;  4NDC A;  2BBN A;  1NX1 A;  1S1E A;  1H8B A;  4MN0 A;  4PHK A;  4U8D A;  1IG5 A;  2M29 A;  1NX3 A;  3PAL A;  3DF0 A;  1VRK A;  1TCO B;  4M2Q A;  3NSO A;  1G33 A;  1TIZ A;  1C07 A;  1QVI Y;  2HPS A;  5CSF A;  4CPV A;  3DVM A;  1CM4 A;  2Q4U A;  1NCY A;  3OP0 A;  4ORB B;  3BOW B;  2BCA A;  1OQP A;  1DGU A;  3SG3 A;  1F54 A;  1UP5 A;  1NCX A;  3A8R A;  3LCP C;  2I94 A;  4PE0 A;  4PHN A;  1TRF A;  1QV1 A;  2F2P A;  3ZWH A;  1OMV A;  4C0J A;  3JTD C;  1F8H A;  1GGW A;  4C0K A;  2G9B A;  2JNX A;  1RFJ A;  1S6C A;  4ETO A;  1XK4 C;  2LMT A;  1K90 D;  1K8U A;  3ZNI A;  4MSP A;  1B8L A;  1TCF A;  4M2P A;  1HQV A;  1FPW A;  1SW8 A;  1AUI B;  1LA3 A;  4YGD B;  3TS5 B;  3OHM B;  5DKQ A;  3E3R A;  4I5N B;  1XFZ O;  1LXF C;  1SRA A;  1SKT A;  1Y1U A;  2K8M B;  2FJU B;  4OCI A;  1YX8 A;  1A75 B;  1A29 A;  2LLT A;  3CZT X;  1IJ6 A;  1BR1 B;  4CLN A;  2HQW A;  1AVS A;  2JRF A;  1JF2 A;  1ZUZ A;  1LA0 A;  3M0W A;  5D7F A;  4Q04 A;  1U5I A;  4F0Z B;  1BF5 A;  1WDC B;  3PN7 C;  3O4Y A;  2O5G A;  1KK8 B;  1YTZ C;  2JQ6 A;  2LV7 A;  2WOS A;  1Y1A A;  1Y0V H;  2L50 A;  2I2R E;  3WNX B;  1JWD A;  1L2O C;  2OTG B;  4WQ3 A;  2FCD A;  2M9G A;  1DJW A;  3RM1 A;  4ORC B;  4MZJ A;  1XK4 A;  5CSI A;  3EVU A;  4N1F A;  1TOP A;  1Y6W A;  2LP3 A;  2L98 A;  3JVT B;  2LC5 A;  1M63 B;  2EHB A;  1DJI A;  1S6I A;  1R2U A;  3AAJ A;  1SCM C;  4GAO A;  1DF0 A;  3SG4 A;  1J7Q A;  2I7A A;  4OVN F;  1XYD A;  2JTT A;  5I2O A;  1UHN A;  3BUO B;  2WCB A;  1IJ5 A;  4MLW A;  2LVI A;  1W7I B;  1DGV A;  1TNP A;  1JC2 A;  4PE1 A;  2R2I A;  1CDL A;  3CR5 X;  1YVH A;  4GNK B;  1U5I B;  1QLS A;  1QLK A;  1K94 A;  5CSJ A;  1F55 A;  2DOQ A;  1FBV A;  2ZFD A;  1DJY A;  2WCF A;  4YI8 A;  3SJS A;  1KFX S;  1CFP A;  1XFW O;  4PDZ A;  3EK8 A;  5AER A;  1K96 A;  3LL8 B;  2PSR A;  1SMG A;  1CFF A;  4A4B A;  2COL B;  3OB1 B;  1NIW A;  1WLM A;  1YUT A;  1REC A;  3VRN A;  1UHI A;  4BY5 A;  2EC6 B;  1A4P A;  2L5X B;  5FYX A;  3TS5 C;  1SCV A;  4PHM A;  5ER4 X;  2BCB A;  4AQI A;  1K9K A;  2KQ6 A;  3K21 A;  1ZAC A;  3I5H C;  1GQM A;  2G2B A;  2M1U A;  3CGA A;  2WOR A;  1RWY A;  1ZMZ A;  2FOT A;  2HET A;  3WHT B;  4HRG A;  1XFV O;  2M0R A;  2GGZ A;  1B9A A;  1NP8 A;  1SNL A;  1DVI A;  1CFC A;  2Y1N A;  1M46 A;  1YVL A;  3BOW A;  3FIA A;  1G8I A;  1YUU A;  3DD4 A;  1K9U A;  1KSO A;  2LLU A;  1KFU L;  3TZ1 A;  2QAC A;  4PAL A;  1S26 D;  2KI4 B;  1CDN A;  1WY9 A;  1DT7 B;  2RGI A;  1UUR A;  5AEQ A;  2LHI A;  4I5L B;  1KQM C;  1G4Y R;  2ZRS A;  2QPT A;  4UPG A;  1B8C A;  2LHL A;  2BL0 C;  1QX7 A;  2KAV A;  3F45 A;  1MF8 B;  2OS8 C;  3LLE A;  1KQV A;  3TDI A;  1OE9 B;  2LLS A;  3JVT C;  4MZL A;  4GPL B;  1KCY A;  4ZCU A;  2F2O A;  2M7N A;  3PAT A;  2KI6 D;  1PAL A;  1KK7 Y;  1B4C A;  1GJY A;  2SAS A;  5KTY A;  1W7J B;  1TN4 A;  4TNC A;  5HKW A;  2SCP A;  1OMD A;  3NSI A;  3KEV A;  2BEC A;  1QS7 A;  3VGO A;  1QJT A;  2MLF C;  4YRU A;  2H2K A;  1OOJ A;  2CTN A;  2OPO A;  1ALW A;  1EJ3 A;  3EK4 A;  2ZKM X;  4I5K A;  2KGR A;  3IF7 A;  3PN7 B;  4MBE A;  2F8P A;  1B7T Z;  2EGD A;  1HT9 A;  2WCE A;  3AKA A;  5HYD A;  2BCX A;  3LK1 A;  2FCE A;  3OX6 A;  5AFP A;  1N65 A;  2K2F A;  2L4I A;  1CLB A;  3D10 A;  1MUX A;  1YX7 A;  1BJF A;  2L2E A;  4CID A;  3O2P A;  5G08 A;  3RLZ A;  2Y5I A;  2LCP A;  5HKY A;  1QTX A;  4R1E A;  4YGE B;  1KK7 Z;  2MAZ A;  5B8I B;  1CMF A;  4N1G A;  1LIN A;  2EC6 C;  1M39 A;  5DKR A;  3KF9 A;  4BY4 A;  1SR6 C;  2MRD A;  2JXC A;  3LK0 A;  1KSM A;  4DUQ A;  2AUC A;  3BUN B;  3EVR A;  3VRO A;  2LUC A;  2NZ0 A;  1JFK A;  1RK9 A;  1EH2 A;  3WHU B;  1QIV A;  1B47 A;  3PSR A;  1MWN A;  1QVI Z;  4YBH B;  1MR8 A;  1S5G Z;  4XJK B;  4NDB A;  3TDZ A;  1XFY O;  2AMI A;  3D0Y B;  2WC8 A;  2Y4Q A;  2BBM A;  3BXK A;  3I5G B;  1K2H A;  2ZRT A;  5JJG A;  1NYA A;  2KAY A;  1BLQ A;  3CR4 X;  2HF5 A;  2HQ8 A;  1V1F A;  4MRX A;  2I18 A;  1CLL A;  2JWW A;  3SG6 A;  3I5F B;  3I5I B;  3JTD B;  1CFD A;  2LMV A;  4ZCV A;  2JZI A;  1XFX O;  1QX5 B;  2KFH A;  4P5O E;  2PMY A;  1BG1 A;  3BYA A;  2PRU A;  1PUL A;  1N0Y A;  1CMG A;  1JSA A;  2OS8 B;  3DVK A;  1FW4 A;  3EKH A;  4HRE E;  3I5I C;  4FQO A;  3FWB A;  4PE4 A;  1CTR A;  1AK8 A;  1AJ5 A;  1XVJ A;  2KI4 C;  3CTN A;  4HRH A;  1IGV A;  1F70 A;  2M49 B;  3DVE A;  1S5G Y;  4GGF C;  1A2X A;  5KSZ A;  3EK7 A;  3OB2 B;  4DCK A;  4DRW A;  1BOC A;  2KYC A;  2JOJ A;  1IQ3 A;  2K7O A;  1ALV A;  4M2O A;  3BUX B;  3D0Y A;  2KGB C;  2ZND A;  3CWG A;  2F3Y A;  1GGZ A;  1NX2 A;  2NXQ A;  1EXR A;  4AQJ A;  2K2A A;  1FI5 A;  1QAT A;  3NXA A;  1Y1X A;  5D69 A;  1KWO C;  1WLZ A;  1S3P A;  1BU3 A;  1KK8 C;  2L4H A;  4CFR A;  1CDM A;  4MZK A;  1WRZ A;  5GQQ C;  1FI6 A;  1BMO A;  1DTL A;  1AHR A;  1QX2 A;  1SCM B;  1X02 A;  2A4J A;  3A4U B;  1TNX A;  4MEW A;  4ICB A;  3TUY B;  1QIW A;  2PAS A;  1TTX A;  4PHJ A;  2JT3 A;  1J7R A;  1MHO A;  2LVV A;  1DJZ A;  2M7L A;  3GK4 X;  1UUS A;  1JFJ A;  2D8N A;  4C0L A;  1SR6 B;  1TNW A;  1XA5 A;  4D1E A;  1QAS A;  2KSP A;  1IQ5 A;  1SY9 A;  2JPT A;  1K93 D;  1EG4 A;  1UHK A;  4JQ0 D;  3PM8 A;  1IWQ A;  3HCM A;  2KFF A;  1NCZ A;  3BUM B;  3CS1 A;  4FTG A;  2ZN8 A;  1YUR A;  3WXA A;  3SIA A;  1OMR A;  5BPJ A;  1NX0 A;  5ER5 A;  2GV5 A;  2KQY A;  1S36 A;  1LKJ A;  4GBA A;  2LMU A;  1YRU B;  3TDU A;  2ZNE A;  4PE7 A;  3CR2 A;  1NPQ A;  1PK0 D;  1TNQ A;  2KFG A;  2ZN9 A;  1WRL A;  3C1V A;  2ISD A;  2JT8 A;  3VRP A;  3NSL A;  1B8R A;  2M3W A;  4I5J A;  1PRW A;  1KFU S;  1IRJ A;  2Y1M A;  3BQ3 A;  1ZFS A;  1SL8 A;  5JOL A;  1OZS A;  3EKJ A;  2KAX A;  1C7W A;  4MVF A;  4N5X A;  2F33 A;  2LE9 B;  1F4Q A;  2LP2 A;  4OR9 B;  1EG3 A;  1QXP A;  2O60 A;  2K61 A;  3I5H B;  2JTZ A;  3SG2 A;  1PVA A;  5F6T A;  2F3Z A;  2K0J A;  2KOT A;  3AKB A;  2BE4 A;  1J7P A;  2CT9 A;  1J1D A;  4AOM A;  1RJV A;  1CDP A;  3VRR A;  4GGN A;  1M31 A;  2MHH A;  1QV0 A;  1MQ1 A;  2MBX A;  3DVJ A;  4XJK A;  1BOD A;  2MJW B;  2OTG C;  4OV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...