4PDZA

Crystal structure of calcium-loaded s100b bound to sbi4172
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
90
structure length
90
Chain Sequence
b'MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title Covalent Small Molecule Inhibitors of Ca(2+)-Bound S100B.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein/inhibitor
total genus 34
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4pdzA00
4WQ3A 1XYDA 2K7BA 1SL9A 1B8RA 1H8BA 3BUNB 2L2EA 5PALA 2MLFC 4GGFA 2KHNA 4MRXA 1W7IB 1FPWA 4C0KA 1J1DA 1SCVA 3FWBA 1A75B 2BL0B 3VRQA 2I7AA 1CMGA 3NSIA 4DRWA 5KSZA 1JUOA 3JVTC 1CDMA 4NDCA 2JNFA 4MVFA 2K2AA 1NX1A 1LVCD 1TOPA 4IL1A 2JTTA 1J7PA 1IJ5A 2F2PA 3CGAA 1GGWA 2H61A 4M2OA 1JBAA 4YRUA 2K7CA 3BUOB 3VRNA 1JF0A 5AANA 1UHJA 1AJ4A 4YGEB 2OS8C 1MR8A 1F4OA 4MSPA 5JOLA 2JWWA 3HX4A 4PHJA 2AAOA 5KTYA 1CFCA 1KWOC 1QS7A 4UPGA 1QX5B 1YRTB 2A4JA 1KFXL 1ZMZA 3VRRA 1BMOA 3VRPA 3EKHA 4PE4A 1V1GA 4YI9A 1SR6B 2E30A 2QACA 2DOQA 2EGDA 2HQWA 4ORCB 3VGOA 4OVNF 4QJ5B 2G9BA 3BXKA 3PALA 2H2KA 1J7RA 2LAPA 2GGZA 4PHNA 1BT6A 3EVVA 1K2HA 3SG2A 4JPZB 1TIZA 1F4QA 1XFVO 2KGRA 1G8IA 1S6IA 3SG6A 5TNCA 2WCFA 3JTDB 3NSKA 1QIWA 1QASA 1WLZA 1TCOB 2NLNA 2M9GA 4GUKA 4C0JA 1XFXO 3GK4X 2QPTA 1W7JB 1OMVA 3IQOA 1YUSA 2BL0C 1TNWA 1AUIB 4P2YB 2ZNEA 2NCOA 4F0ZB 1CLLA 2O5GA 1UHIA 5HLOA 4CFQA 2LLTA 1M45A 3QRXA 2KOTA 1AP4A 1SL8A 3EVRA 2K8MB 5DKNA 2EC6B 3WHUB 1MXEA 4AQJA 1XFUO 4DUQA 1OSAA 2V53A 5IBWA 1KCYA 2FCEA 1VRKA 1KK7Z 2ZN9A 1HQVA 3BYAA 5CPVA 3MSEB 4N1FA 4PALA 1KFXS 3DF0B 1TNPA 1XFZO 2RGIA 4FTGA 1F54A 2LC5A 4A4CA 3CWGA 1LA3A 3LK0A 2MA2A 1ZOTB 2F8PA 3FIAA 1SR6C 1SYMA 1J55A 4GBAA 2LM5A 2WC8A 1NP8A 4I5KA 1PVAA 1QX7A 2R2IA 2LMTA 4XYNA 1K9UA 3CR4X 4PE7A 2LANA 1DJXA 4ETOA 1CTRA 1EXRA 2PMYA 5AERA 2JU0A 1EH2A 2JOJA 1PSRA 1SCMB 3LL8B 4CPVA 2LLUA 3GOFA 3M0WA 1RECA 4DIRA 3RM1A 2FJUB 1QVIY 1S5GZ 1XVJA 2SCPA 1B7TZ 1K9KA 1DJYA 2BBMA 2ZKMX 2I18A 3JTDC 1CNPA 2LV7A 4N5XA 1BOCA 1JC2A 2CXJA 2WORA 3CLNA 3PN7B 3OX6A 1GQMA 1M63B 2WOSA 3TUYB 1J1EA 3LK1A 2KAVA 1Y0VH 4CFRA 1AVSA 4ZCUA 1IG5A 1LXFC 2Q4UA 3ZWHA 1DVIA 2E6WA 1B9AA 1AJ5A 1ODBA 2KQYA 1OMRA 2EC6C 1Y1XA 3ZNIA 2Q91A 1BR1B 4GPLB 2KI4B 2LLSA 2KGBC 2KI6C 1GGZA 1YVLA 2FCDA 2B1UA 5JJGA 3GK1A 4PDZA 2BE6A 1EG3A 3I5HB 4OR9B 1PVBA 1CLMA 1F70A 1BU3A 5GQQC 5HKZA 1DGVA 1H4BA 2KYFA 2MRDA 1MUXA 1KQVA 4I5NB 3IF7A 1B8LA 3SIBA 3DD4A 2M29A 5CSFA 3CS1A 4D1EA 1SKTA 2L98A 4OV2A 3I5FB 3AKAA 1AK8A 3NSOA 1N0YA 3LLEA 2ZRTA 1DF0B 1CDLA 2M7LA 2M49B 3DVJA 1TN4A 2F2OA 1PULA 3SJSA 3I5GB 4MZLA 1UUSA 5D69A 2H61C 3I5IB 2VRGA 1SCMC 1IRJA 2HF5A 2KAXA 3A8RA 1CM1A 1FW4A 2MBXA 3C1VA 1S6JA 2CT9A 2AMIA 1TRFA 1QJTA 4OKHA 2LMUA 4CIDA 2LHLA 2BCXA 1L7ZA 3D0YB 3PN7C 3TUYC 1CFFA 2KFFA 1CDPA 2NCPA 1CB1A 4C0LA 2JZIA 1MHOA 3D10A 1V1FA 5F6TA 4MN0A 2AUCA 4YBHB 1BJFA 1DGUA 1N2DA 1ALVA 1F55A 4YGAA 1QIVA 5CSIA 4M2QA 3VROA 2M1KB 2CCMA 2I2RE 4NDDA 4R1EA 1EL4A 2KBIA 4M2PA 1JF2A 1B1GA 1KK8B 3KPXA 4OCIA 1NPQA 1UWOA 2ZFDA 3EKJA 3PM8A 1NUBA 1B4CA 2KI4C 5ER4X 1U5IB 5CSNA 1D1OA 3BOWB 3SG4A 2LVVA 2LUXA 3A4UB 1UHHA 3I5HC 2ZRSA 1DMOA 1E8AA 1OZOA 4U8DA 1DTLA 4HSZA 1S36A 3SG3A 1IKUA 1NSHA 1K94A 1A75A 2M0RA 3BUXB 4XJKA 3BUWB 1R2UA 4USLA 1JWDA 1YRUB 4NDBA 1S3PA 2I94A 1UP5A 3I5FC 1K90D 3OB2B 2ISDA 1AHRA 3CR2A 1IWQA 2COLB 2CNPA 5G08A 4AQIA 3E3RA 1SW8A 1K8UA 4GNKB 1RJVA 3I5GC 4FQOA 3GK2A 1K9PA 1Y6WA 1WRKA 2LP3A 3I5IC 1MF8B 1CMFA 1SPYA 1M46A 1KFUL 2WCBA 1BLQA 2LE9B 5J3XA 1IQ5A 1X02A 2K0JA 5HKYA 3H4SE 2MHHA 3NSLA 5HLVA 1DJWA 1S5GY 2SASA 1CDNA 3LCPC 1ZACA 3CZTX 1B7TY 2HPSA 5D7FA 2M7NA 1F8HA 1GJYA 2JNXA 1B8CA 3EK8A 3HCMA 1RROA 3FS7A 2BCBA 4P5OE 1S26D 1G4YR 5AEQA 1SBJA 1IJ6A 1ZUZA 4ORBB 1OQPA 1PK0D 2KFHA 2PASA 1MQ1A 1XK4A 2L5XB 3TZ1A 1TTXA 2JXLA 1KK8C 3CTNA 1C7VA 2WNDA 1M39A 4CLNA 1FI6A 2JXCA 1PALA 1L2OB 1ZFSA 4PHMA 2LCPA 1WY9A 1TNXA 2KI6D 2JQ6A 3ICBA 1DJIA 4MZJA 1CLBA 3PFVA 3OHMB 4MZKA 1WLMA 2KBMA 2LVIA 3PATA 1NCYA 1KQMB 4GFTA 4NQGA 1A4PA 5HYDA 1NYAA 3O4YA 3FWCA 2BKIB 1NCZA 5K89A 3PLFB 4MBEA 2GV5A 3F45A 2P6BB 2HQ8A 1S6CA 1EG4A 4AOMA 2LNKA 1XFYO 2PVBA 2L50A 4ZCVA 1ALWA 4YGBB 2JPTA 2KDHA 1QXPA 2JC2A 5I2LA 1KFUS 4GGFC 3RLZA 2K61A 3CR5X 2PALA 2ZNDA 1NWDA 2LVKA 5KU1A 1A29A 3DF0A 1OMDA 2FOTA 2KAYA 1KSMA 1B47A 1IQ3A 4QJ3B 5B8IB 2O60A 1Q80A 1MWNA 2JT0A 2EHBA 1SMGA 1YVHA 2Y1MA 1K93D 4XJKB 1QLSA 3DVMA 4DS7A 4JQ0D 1QV1A 3O2PA 4A4BA 1Y1UA 1K96A 2BE4A 3BQ3A 3OX5A 1WDCB 1WRLA 2KNEA 2JTZA 2L0PA 2CTNA 5I2QA 4HREE 1CKKA 3O78A 4Q04A 5CSJA 4E68A 2K7DA 1LA0A 4WQ2A 1L2OC 2F33A 3TS5B 1DJZA 2LMVA 2LUCA 1QV0A 1OOJA 3NXAA 4ORAB 5AXIA 2K7OA 3IQQA 1BODA 2BECA 1HT9A 2L51A 4WRIA 1UHNA 1BG1A 1YUUA 5FYXA 2MLEC 2L4HA 3OP0A 1KQMC 2KQ6A 1NCXA 1NX3A 3AAKA 2M97A 2IS9A 3DVEA 2KSPA 3SIAA 1NX2A 3EK7A 1G33A 5HKWA 1RK9A 3AAJA 3AKBA 3O6BA 1UURA 1KK7Y 4QJ4B 1A03A 3PSRA 2TN4A 1XA5A 2M8UA 1FI5A 1NIWA 1J7QA 2JULA 1N65A 4PE1A 5I2OA 4DCKA 2OTGB 1IGVA 2KYCA 1CFPA 2L4IA 3TDZA 1C7WA 1QX2A 1QLKA 1NX0A 2ZN8A 3EVUA 1RFJA 4MRYA 4ICBA 1YX7A 2LP2A 3KHEA 1KSOA 2WCEA 1RTP1 3SG5A 2KFGA 1LINA 4TNCA 2F3YA 2CBLA 1CFDA 1JFKA 1YR5A 2D8NA 2PSRA 1DF0A 1QATA 3TDUA 1Y1AA 1YUTA 4YGCB 1WDCC 4HRHA 5AFPA 1YX8A 3WHTB 1YTZC 2JRFA 2MJWB 5ER5A 1R6PA 2JT8A 3TDIA 3TS5C 3JVTB 2LVJA 4N1GA 1IH0A 4L9MA 2NXQA 2LHIA 3DVKA 4YI8A 4MLWA 3KO0A 1EJ3A 2G2BA 4PE0A 2Y5IA 1SK6D 1DJHA 3D0YA 4JWQA 2OPOA 1OZSA 5BPJA 1LKJA 1BF5A 1XFWO 3EK4A 4MEWA 1TCFA 1WRZA 2BBNA 1QTXA 4BY5A 1K95A 3K21A 2OS8B 2GGMA 1SL7A 2F3ZA 4GAOA 3WNXB 1BR4B 2BKHB 3SG7A 1KWOB 2M1UA 4PHKA 1XK4C 1C07A 1U5IA 4I5LB 1RWYA 1S1EA 4YGDB 1DJGA 1PRWA 3BOWA 1SNLA 1SY9A 2PRUA 1CM4A 2OTGC 3OB1B 4GGNA 1OE9B 1XO5A 1JFJA 1M31A 2Y1NA 2JT3A 1FBVA 2BCAA 1TNQA 4BY4A 1A2XA 1F71A 1JSAA 5I8NA 1FF1A 1QVIZ 1YURA 1MXLC 4I5JA 1DT7B 2M3WA 1UHKA 3KF9A 2HETA 4HRGA 1J7OA 2K2FA 1PSBA 1SRAA 5DKRA 5DKQA 2NZ0A 2MAZA 3BUMB 3WXAA 4PCWA 3KEVA 2Y4QA
chains in the Genus database with same CATH superfamily
4WQ3A 1XYDA 2K7BA 1SL9A 3S0FA 1B8RA 1H8BA 3BUNB 2L2EA 5PALA 2MLFC 4GGFA 2KHNA 4MRXA 1W7IB 1FPWA 4C0KA 1J1DA 1SCVA 3FWBA 1A75B 2WCMA 2BL0B 3VRQA 2I7AA 1CMGA 3NSIA 4DRWA 5KSZA 1JUOA 3JVTC 1CDMA 4NDCA 2JNFA 4MVFA 1QWVA 4KYNA 2K2AA 3UNWA 1NX1A 1LVCD 1TOPA 4IL1A 2JTTA 3S0BA 1J7PA 1IJ5A 2F2PA 3CGAA 1TWOA 3DY9A 1GGWA 2H61A 4M2OA 1JBAA 5I94A 4YRUA 2K7CA 3BUOB 3VRNA 1JF0A 5AANA 1UHJA 1AJ4A 3FE9A 2OS8C 3O4XA 4YGEB 1MR8A 1F4OA 1OOHA 4MSPA 2JWWA 3HX4A 4PHJA 2GTEA 5JOLA 3SS3A 2AAOA 5KTYA 1CFCA 1KWOC 1QS7A 4UPGA 1QX5B 1YRTB 1ZMZA 1KFXL 2A4JA 3VRRA 3DZTA 3CZ0A 1BMOA 3VRPA 3EKHA 4PE4A 1V1GA 1W9ZA 4YI9A 1SR6B 2E30A 2QACA 2DOQA 2EGDA 2HQWA 3D74A 4ORCB 2KLDA 4OVNF 3VGOA 4QJ5B 2G9BA 3BXKA 3PALA 1Z2CB 2H2KA 1J7RA 2LAPA 2GGZA 4PHNA 1BT6A 3EVVA 1K2HA 3SG2A 1B1GA 3UO9A 4JPZB 2JPOA 1TIZA 1F4QA 3OGNA 3B86A 1XFVO 2KGRA 1G8IA 1S6IA 3SG6A 5TNCA 2WCFA 3JTDB 3NSKA 1QIWA 1QASA 1WLZA 1TCOB 2NLNA 3D78A 2M9GA 4GUKA 4C0JA 1XFXO 3GK4X 2QPTA 1W7JB 1OMVA 3IQOA 1YUSA 2BL0C 1TNWA 1AUIB 4P2YB 2ZNEA 3PJIA 2NCOA 4F0ZB 1CLLA 2O5GA 1UHIA 5HLOA 4CFQA 2LLTA 1M45A 3QRXA 2KOTA 1AP4A 1SL8A 3EVRA 2K8MB 5DKNA 2EC6B 3WHUB 1MXEA 4AQJA 4OZDA 3CABA 1XFUO 3BFHA 1OSAA 4JKTA 4DUQA 3SS5A 2V53A 5IBWA 1KCYA 2FCEA 1VRKA 1KK7Z 2ZN9A 1HQVA 3BYAA 2L5YA 3PM2A 5CPVA 3MSEB 2QEVA 4N1FA 1KFXS 3DF0B 1TNPA 1XFZO 2RGIA 4FTGA 4PALA 1C3YA 1F54A 2LC5A 4A4CA 3CWGA 1LA3A 3LK0A 2MA2A 5HL1A 1ZOTB 2F8PA 3FIAA 1SR6C 1SYMA 1J55A 4GBAA 2LM5A 2WC8A 1NP8A 4I5KA 1PVAA 1QX7A 2R2IA 3K1EA 2LMTA 4XYNA 1K9UA 3CR4X 4PE7A 2LANA 1DJXA 4ETOA 1CTRA 1EXRA 2PMYA 5AERA 2JU0A 1EH2A 2JOJA 1PSRA 1SCMB 3LL8B 4CPVA 2LLUA 3GOFA 3M0WA 4FQTA 1RECA 4DIRA 3RM1A 2FJUB 1QVIY 1S5GZ 1XVJA 2SCPA 1B7TZ 1K9KA 1DJYA 2BBMA 2ZKMX 2I18A 3JTDC 1CNPA 2LV7A 4IJ7A 4N5XA 1BOCA 1JC2A 1ORGA 2CXJA 2WORA 3CLNA 3PN7B 3OX6A 1GQMA 1M63B 2WOSA 3TUYB 1J1EA 3LK1A 2KAVA 1Y0VH 2BNXA 4CFRA 1AVSA 4ZCUA 1IG5A 1LXFC 1P28A 2Q4UA 3ZWHA 1DVIA 2E6WA 3QMEA 1B9AA 1AJ5A 1ODBA 2KQYA 1OMRA 2EC6C 1Y1XA 3ZNIA 2Q91A 1BR1B 4GPLB 2KI4B 2LLSA 2KGBC 2KI6C 1GGZA 1YVLA 2FCDA 2B1UA 1TUZA 3CZ2A 3GK1A 5JJGA 2FJYA 4PDZA 2BE6A 1EG3A 3I5HB 4OR9B 1PVBA 1CLMA 1F70A 1BU3A 5GQQC 5HKZA 1DGVA 1H4BA 2KYFA 2MRDA 1MUXA 1KQVA 4I5NB 3IF7A 1B8LA 3SIBA 3DD4A 2M29A 5CSFA 3CS1A 4D1EA 1SKTA 2L98A 4OV2A 3I5FB 3AKAA 1AK8A 3NSOA 1N0YA 3LLEA 2ZRTA 1DF0B 1CDLA 5FI2A 2M49B 2M7LA 4INXA 3DVJA 1TN4A 2F2OA 1PULA 3SJSA 3I5GB 4MZLA 1UUSA 3L4LA 5D69A 2H61C 3I5IB 2VRGA 1SCMC 1IRJA 2HF5A 2KAXA 3A8RA 1CM1A 1FW4A 2BAPA 2MBXA 3BJHA 1S6JA 3C1VA 2CT9A 2AMIA 1TRFA 1QJTA 4OKHA 2LMUA 4CIDA 2LHLA 2BCXA 1L7ZA 2KLEA 3CYZA 3D0YB 3PN7C 3TUYC 3RZSA 1CFFA 2KFFA 1CDPA 2NCPA 3S0DA 1CB1A 4C0LA 2JZIA 1MHOA 3D10A 1V1FA 3NHIA 2L2CA 4MN0A 5F6TA 2AUCA 4YBHB 1BJFA 1DGUA 1N2DA 1ALVA 1F55A 4YGAA 1QIVA 5CSIA 2P71A 4M2QA 2M1KB 2CCMA 3VROA 2I2RE 4NDDA 4R1EA 1EL4A 1Z4HA 2KBIA 1JF2A 4M2PA 1KK8B 3KPXA 4OCIA 1NPQA 1UWOA 2ZFDA 3EKJA 3PM8A 1NUBA 1B4CA 2KI4C 5ER4X 1U5IB 2QEHA 5CSNA 1D1OA 3BOWB 3N7HA 3SG4A 2LVVA 2LUXA 3A4UB 1UHHA 2KPHA 3I5HC 2ZRSA 1DMOA 1E8AA 1OZOA 4U8DA 1DTLA 4HSZA 1S36A 3SG3A 1IKUA 1NSHA 5D3OA 1K94A 1A75A 2M0RA 3BUXB 4XJKA 2QDIA 3BUWB 3B88A 3Q8IA 1R2UA 4USLA 1JWDA 1DELA 1YRUB 4NDBA 1S3PA 2I94A 1UP5A 3I5FC 1K90D 2QEOA 3OB2B 1AHRA 3CR2A 2ISDA 1IWQA 2COLB 2CNPA 5G08A 4AQIA 3E3RA 3VB1A 1SW8A 1K8UA 4GNKB 1RJVA 3I5GC 4FQOA 3GK2A 1K9PA 1Y6WA 1WRKA 2LP3A 3I5IC 1MF8B 1CMFA 1SPYA 1M46A 1KFUL 2WCBA 1BLQA 2LE9B 5J3XA 1IQ5A 1X02A 2K0JA 5HKYA 3H4SE 2MHHA 3NSLA 5HLVA 1DJWA 1S5GY 2SASA 1CDNA 3LCPC 1ZACA 3CZTX 1B7TY 3V2LA 5FI7A 2HPSA 5D7FA 2M7NA 1F8HA 1GJYA 2JNXA 1B8CA 3EK8A 3HCMA 1RROA 3FS7A 2BCBA 4P5OE 1S26D 1G4YR 5AEQA 1SBJA 1IJ6A 1ZUZA 3EG5B 4ORBB 1OQPA 1PK0D 2KFHA 2PASA 1MQ1A 1XK4A 2L5XB 3D77A 3TZ1A 1TTXA 2JXLA 1KK8C 3CTNA 1C7VA 2WCKA 2WNDA 1M39A 4CLNA 1FI6A 2JXCA 1PALA 1L2OB 1DEKA 1ZFSA 4PHMA 2LCPA 1WY9A 1TNXA 2KI6D 2JQ6A 3ICBA 1DJIA 4MZJA 1OOGA 1CLBA 3PFVA 3OHMB 4MZKA 1WLMA 2KBMA 2LVIA 3PATA 1NCYA 1KQMB 4GFTA 4NQGA 1A4PA 5HYDA 1NYAA 3O4YA 3FWCA 2BKIB 1NCZA 5K89A 3PLFB 4MBEA 2GV5A 3F45A 2P6BB 3SS4A 2HQ8A 1S6CA 1EG4A 1OOFA 3S0GA 2LNKA 4AOMA 1XFYO 2PVBA 2L50A 2WCHA 4ZCVA 2PQLA 1ALWA 4YGBB 2JPTA 2KDHA 2P70A 1QXPA 2JC2A 5I2LA 1T14A 1TUJA 1KFUS 4GGFC 3RLZA 1GM0A 3B7AA 2K61A 3CR5X 2PALA 2ZNDA 3OBVA 1NWDA 3R1OA 2LVKA 3B6XA 5KU1A 1A29A 3DF0A 2WC5A 1DC1A 1OMDA 2FOTA 2KAYA 1KSMA 1B47A 1IQ3A 4QJ3B 5B8IB 2O60A 4INWA 1Q80A 1MWNA 2JT0A 2EHBA 1SMGA 1YVHA 2Y1MA 1K93D 4XJKB 1QLSA 3DVMA 4DS7A 4JQ0D 3NHTA 1QV1A 2WC6A 3O2PA 4A4BA 1Y1UA 1K96A 2BE4A 3BQ3A 3OX5A 1WDCB 1WRLA 2KNEA 2JTZA 2L0PA 2CTNA 5I2QA 4HREE 1CKKA 3R1PA 3O78A 4Q04A 5CSJA 4E68A 2K7DA 1LA0A 4WQ2A 1L2OC 2F33A 3TS5B 1DJZA 2LMVA 2LUCA 1QV0A 1OOJA 3D76A 3NXAA 4ORAB 5AXIA 3NGVA 3D75A 2K7OA 3IQQA 1BODA 2BECA 1HT9A 2L51A 4WRIA 1UHNA 1BG1A 1YUUA 5FYXA 1DQEA 2MLEC 2L4HA 3OP0A 1KQMC 2KQ6A 1NCXA 1NX3A 3AAKA 2M97A 3DXLA 3CZ1A 2IS9A 3DVEA 2WCLA 3FE6A 1OOIX 2KSPA 3SIAA 1NX2A 3EK7A 1G33A 5HKWA 1RK9A 3AAJA 3AKBA 4F7FA 3O6BA 1UURA 1KK7Y 3FE8A 3IVTA 4QJ4B 1A03A 3PSRA 2TN4A 1XA5A 2M8UA 1FI5A 1NIWA 1J7QA 2H8VA 2JULA 1N65A 4PE1A 5I2OA 1JFJA 4DCKA 2OTGB 1IGVA 2KYCA 1CFPA 2L4IA 3TDZA 3CDNA 1C7WA 1QX2A 1QLKA 1NX0A 2ZN8A 3DYEA 3EVUA 1RFJA 2WCJA 4MRYA 4ICBA 1YX7A 2LP2A 3KHEA 1KSOA 2WCEA 1RTP1 3SG5A 2KFGA 1LINA 4TNCA 3BFAA 2F3YA 2CBLA 5DICA 1CFDA 1JFKA 3S0AA 1YR5A 2D8NA 2PSRA 1DF0A 1QATA 3TDUA 1Y1AA 3BFBA 1YUTA 4YGCB 1WDCC 4HRHA 5AFPA 1LS8A 1YX8A 3WHTB 1YTZC 2JRFA 2MJWB 5ER5A 3B87A 1R6PA 2JT8A 3TDIA 3TS5C 3JVTB 2LVJA 4N1GA 1IH0A 4L9MA 2PYQA 2NXQA 2LHIA 3DVKA 4YI8A 4MLWA 1XFRA 3KO0A 1EJ3A 2G2BA 4PE0A 2Y5IA 1SK6D 1DJHA 3D0YA 4JWQA 2OPOA 1OZSA 2ERBA 1IIOA 2QEBA 5BPJA 1LKJA 1BF5A 1XFWO 3EK4A 2YGUA 4MEWA 1TCFA 1SSEB 1WRZA 2BBNA 1QTXA 3L47A 4BY5A 4PT1A 1K95A 3K21A 2OS8B 2GGMA 1SL7A 2F3ZA 4GAOA 3WNXB 1BR4B 3R72A 5EL2A 2BKHB 3SG7A 1KWOB 2M1UA 4PHKA 4JD9A 1XK4C 1C07A 1U5IA 4I5LB 1RWYA 1S1EA 4YGDB 1DJGA 1PRWA 5FI6A 3BOWA 1SNLA 1SY9A 2PRUA 3D73A 1CM4A 2OTGC 1OW4A 3OB1B 1OE9B 1XO5A 4GGNA 1M31A 2Y1NA 2JT3A 1FBVA 2BCAA 1TNQA 3S0EA 4BY4A 1A2XA 1F71A 1JSAA 5I8NA 1FF1A 1QVIZ 1YURA 1MXLC 4I5JA 1DT7B 3R1VA 2M3WA 2K60A 1UHKA 3KF9A 2HETA 4HRGA 3L4AA 1J7OA 2K2FA 1PSBA 1SRAA 5DKRA 5DKQA 2NZ0A 2MAZA 1C3ZA 3BUMB 3WXAA 4PCWA 3KEVA 2Y4QA
chains in the Genus database with same CATH topology
4WQ3A 1XYDA 2K7BA 1SL9A 1B8RA 1H8BA 3BUNB 2L2EA 5PALA 2MLFC 4GGFA 2KHNA 4MRXA 1W7IB 1FPWA 4C0KA 1J1DA 1SCVA 3FWBA 1A75B 2BL0B 3VRQA 2I7AA 1CMGA 3NSIA 4DRWA 5KSZA 1JUOA 3JVTC 1CDMA 4NDCA 2JNFA 4MVFA 2K2AA 1NX1A 1LVCD 1TOPA 4IL1A 2JTTA 1J7PA 1IJ5A 2F2PA 3CGAA 1GGWA 2H61A 4M2OA 1JBAA 4YRUA 2K7CA 3BUOB 3VRNA 1JF0A 5AANA 1UHJA 1AJ4A 4YGEB 2OS8C 1MR8A 1F4OA 4MSPA 5JOLA 2JWWA 3HX4A 4PHJA 2AAOA 5KTYA 1CFCA 1KWOC 1QS7A 4UPGA 1QX5B 1YRTB 2A4JA 1KFXL 1ZMZA 3VRRA 1BMOA 3VRPA 3EKHA 4PE4A 1V1GA 4YI9A 1SR6B 2E30A 2QACA 2DOQA 2EGDA 2HQWA 4ORCB 3VGOA 4OVNF 4QJ5B 2G9BA 3BXKA 3PALA 2H2KA 1J7RA 2LAPA 2GGZA 4PHNA 1BT6A 3EVVA 1K2HA 3SG2A 4JPZB 1TIZA 1F4QA 1XFVO 2KGRA 1G8IA 1S6IA 3SG6A 5TNCA 2WCFA 3JTDB 3NSKA 1QIWA 1QASA 1WLZA 1TCOB 2NLNA 2M9GA 4GUKA 4C0JA 1XFXO 3GK4X 2QPTA 1W7JB 1OMVA 3IQOA 1YUSA 2BL0C 1TNWA 1AUIB 4P2YB 2ZNEA 2NCOA 4F0ZB 1CLLA 2O5GA 1UHIA 5HLOA 4CFQA 2LLTA 1M45A 3QRXA 2KOTA 1AP4A 1SL8A 3EVRA 2K8MB 5DKNA 2EC6B 3WHUB 1MXEA 4AQJA 1XFUO 4DUQA 1OSAA 2V53A 5IBWA 1KCYA 2FCEA 1VRKA 1KK7Z 2ZN9A 1HQVA 3BYAA 5CPVA 3MSEB 4N1FA 4PALA 1KFXS 3DF0B 1TNPA 1XFZO 2RGIA 4FTGA 1F54A 2LC5A 4A4CA 3CWGA 1LA3A 3LK0A 2MA2A 1ZOTB 2F8PA 3FIAA 1SR6C 1SYMA 1J55A 4GBAA 2LM5A 2WC8A 1NP8A 4I5KA 1PVAA 1QX7A 2R2IA 2LMTA 4XYNA 1K9UA 3CR4X 4PE7A 2LANA 1DJXA 4ETOA 1CTRA 1EXRA 2PMYA 5AERA 2JU0A 1EH2A 2JOJA 1PSRA 1SCMB 3LL8B 4CPVA 2LLUA 3GOFA 3M0WA 1RECA 4DIRA 3RM1A 2FJUB 1QVIY 1S5GZ 1XVJA 2SCPA 1B7TZ 1K9KA 1DJYA 2BBMA 2ZKMX 2I18A 3JTDC 1CNPA 2LV7A 4N5XA 1BOCA 1JC2A 2CXJA 2WORA 3CLNA 3PN7B 3OX6A 1GQMA 1M63B 2WOSA 3TUYB 1J1EA 3LK1A 2KAVA 1Y0VH 4CFRA 1AVSA 4ZCUA 1IG5A 1LXFC 2Q4UA 3ZWHA 1DVIA 2E6WA 1B9AA 1AJ5A 1ODBA 2KQYA 1OMRA 2EC6C 1Y1XA 3ZNIA 2Q91A 1BR1B 4GPLB 2KI4B 2LLSA 2KGBC 2KI6C 1GGZA 1YVLA 2FCDA 2B1UA 5JJGA 3GK1A 4PDZA 2BE6A 1EG3A 3I5HB 4OR9B 1PVBA 1CLMA 1F70A 1BU3A 5GQQC 5HKZA 1DGVA 1H4BA 2KYFA 2MRDA 1MUXA 1KQVA 4I5NB 3IF7A 1B8LA 3SIBA 3DD4A 2M29A 5CSFA 3CS1A 4D1EA 1SKTA 2L98A 4OV2A 3I5FB 3AKAA 1AK8A 3NSOA 1N0YA 3LLEA 2ZRTA 1DF0B 1CDLA 2M7LA 2M49B 3DVJA 1TN4A 2F2OA 1PULA 3SJSA 3I5GB 4MZLA 1UUSA 5D69A 2H61C 3I5IB 2VRGA 1SCMC 1IRJA 2HF5A 2KAXA 3A8RA 1CM1A 1FW4A 2MBXA 3C1VA 1S6JA 2CT9A 2AMIA 1TRFA 1QJTA 4OKHA 2LMUA 4CIDA 2LHLA 2BCXA 1L7ZA 3D0YB 3PN7C 3TUYC 1CFFA 2KFFA 1CDPA 2NCPA 1CB1A 4C0LA 2JZIA 1MHOA 3D10A 1V1FA 5F6TA 4MN0A 2AUCA 4YBHB 1BJFA 1DGUA 1N2DA 1ALVA 1F55A 4YGAA 1QIVA 5CSIA 4M2QA 3VROA 2M1KB 2CCMA 2I2RE 4NDDA 4R1EA 1EL4A 2KBIA 4M2PA 1JF2A 1B1GA 1KK8B 3KPXA 4OCIA 1NPQA 1UWOA 2ZFDA 3EKJA 3PM8A 1NUBA 1B4CA 2KI4C 5ER4X 1U5IB 5CSNA 1D1OA 3BOWB 3SG4A 2LVVA 2LUXA 3A4UB 1UHHA 3I5HC 2ZRSA 1DMOA 1E8AA 1OZOA 4U8DA 1DTLA 4HSZA 1S36A 3SG3A 1IKUA 1NSHA 1K94A 1A75A 2M0RA 3BUXB 4XJKA 3BUWB 1R2UA 4USLA 1JWDA 1YRUB 4NDBA 1S3PA 2I94A 1UP5A 3I5FC 1K90D 3OB2B 2ISDA 1AHRA 3CR2A 1IWQA 2COLB 2CNPA 5G08A 4AQIA 3E3RA 1SW8A 1K8UA 4GNKB 1RJVA 3I5GC 4FQOA 3GK2A 1K9PA 1Y6WA 1WRKA 2LP3A 3I5IC 1MF8B 1CMFA 1SPYA 1M46A 1KFUL 2WCBA 1BLQA 2LE9B 5J3XA 1IQ5A 1X02A 2K0JA 5HKYA 3H4SE 2MHHA 3NSLA 5HLVA 1DJWA 1S5GY 2SASA 1CDNA 3LCPC 1ZACA 3CZTX 1B7TY 2HPSA 5D7FA 2M7NA 1F8HA 1GJYA 2JNXA 1B8CA 3EK8A 3HCMA 1RROA 3FS7A 2BCBA 4P5OE 1S26D 1G4YR 5AEQA 1SBJA 1IJ6A 1ZUZA 4ORBB 1OQPA 1PK0D 2KFHA 2PASA 1MQ1A 1XK4A 2L5XB 3TZ1A 1TTXA 2JXLA 1KK8C 3CTNA 1C7VA 2WNDA 1M39A 4CLNA 1FI6A 2JXCA 1PALA 1L2OB 1ZFSA 4PHMA 2LCPA 1WY9A 1TNXA 2KI6D 2JQ6A 3ICBA 1DJIA 4MZJA 1CLBA 3PFVA 3OHMB 4MZKA 1WLMA 2KBMA 2LVIA 3PATA 1NCYA 1KQMB 4GFTA 4NQGA 1A4PA 5HYDA 1NYAA 3O4YA 3FWCA 2BKIB 1NCZA 5K89A 3PLFB 4MBEA 2GV5A 3F45A 2P6BB 2HQ8A 1S6CA 1EG4A 4AOMA 2LNKA 1XFYO 2PVBA 2L50A 4ZCVA 1ALWA 4YGBB 2JPTA 2KDHA 1QXPA 2JC2A 5I2LA 1KFUS 4GGFC 3RLZA 2K61A 3CR5X 2PALA 2ZNDA 1NWDA 2LVKA 5KU1A 1A29A 3DF0A 1OMDA 2FOTA 2KAYA 1KSMA 1B47A 1IQ3A 4QJ3B 5B8IB 2O60A 1Q80A 1MWNA 2JT0A 2EHBA 1SMGA 1YVHA 2Y1MA 1K93D 4XJKB 1QLSA 3DVMA 4DS7A 4JQ0D 1QV1A 3O2PA 4A4BA 1Y1UA 1K96A 2BE4A 3BQ3A 3OX5A 1WDCB 1WRLA 2KNEA 2JTZA 2L0PA 2CTNA 5I2QA 4HREE 1CKKA 3O78A 4Q04A 5CSJA 4E68A 2K7DA 1LA0A 4WQ2A 1L2OC 2F33A 3TS5B 1DJZA 2LMVA 2LUCA 1QV0A 1OOJA 3NXAA 4ORAB 5AXIA 2K7OA 3IQQA 1BODA 2BECA 1HT9A 2L51A 4WRIA 1UHNA 1BG1A 1YUUA 5FYXA 2MLEC 2L4HA 3OP0A 1KQMC 2KQ6A 1NCXA 1NX3A 3AAKA 2M97A 2IS9A 3DVEA 2KSPA 3SIAA 1NX2A 3EK7A 1G33A 5HKWA 1RK9A 3AAJA 3AKBA 3O6BA 1UURA 1KK7Y 4QJ4B 1A03A 3PSRA 2TN4A 1XA5A 2M8UA 1FI5A 1NIWA 1J7QA 2JULA 1N65A 4PE1A 5I2OA 4DCKA 2OTGB 1IGVA 2KYCA 1CFPA 2L4IA 3TDZA 1C7WA 1QX2A 1QLKA 1NX0A 2ZN8A 3EVUA 1RFJA 4MRYA 4ICBA 1YX7A 2LP2A 3KHEA 1KSOA 2WCEA 1RTP1 3SG5A 2KFGA 1LINA 4TNCA 2F3YA 2CBLA 1CFDA 1JFKA 1YR5A 2D8NA 2PSRA 1DF0A 1QATA 3TDUA 1Y1AA 1YUTA 4YGCB 1WDCC 4HRHA 5AFPA 1YX8A 3WHTB 1YTZC 2JRFA 2MJWB 5ER5A 1R6PA 2JT8A 3TDIA 3TS5C 3JVTB 2LVJA 4N1GA 1IH0A 4L9MA 2NXQA 2LHIA 3DVKA 4YI8A 4MLWA 3KO0A 1EJ3A 2G2BA 4PE0A 2Y5IA 1SK6D 1DJHA 3D0YA 4JWQA 2OPOA 1OZSA 5BPJA 1LKJA 1BF5A 1XFWO 3EK4A 4MEWA 1TCFA 1WRZA 2BBNA 1QTXA 4BY5A 1K95A 3K21A 2OS8B 2GGMA 1SL7A 2F3ZA 4GAOA 3WNXB 1BR4B 2BKHB 3SG7A 1KWOB 2M1UA 4PHKA 1XK4C 1C07A 1U5IA 4I5LB 1RWYA 1S1EA 4YGDB 1DJGA 1PRWA 3BOWA 1SNLA 1SY9A 2PRUA 1CM4A 2OTGC 3OB1B 4GGNA 1OE9B 1XO5A 1JFJA 1M31A 2Y1NA 2JT3A 1FBVA 2BCAA 1TNQA 4BY4A 1A2XA 1F71A 1JSAA 5I8NA 1FF1A 1QVIZ 1YURA 1MXLC 4I5JA 1DT7B 2M3WA 1UHKA 3KF9A 2HETA 4HRGA 1J7OA 2K2FA 1PSBA 1SRAA 5DKRA 5DKQA 2NZ0A 2MAZA 3BUMB 3WXAA 4PCWA 3KEVA 2Y4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WQ3 A;  1XYD A;  2K7B A;  1SL9 A;  1B8R A;  1H8B A;  3BUN B;  2L2E A;  5PAL A;  2MLF C;  4GGF A;  2KHN A;  4MRX A;  1W7I B;  1FPW A;  4C0K A;  1J1D A;  1SCV A;  3FWB A;  1A75 B;  2BL0 B;  3VRQ A;  2I7A A;  1CMG A;  3NSI A;  4DRW A;  5KSZ A;  1JUO A;  3JVT C;  1CDM A;  4NDC A;  2JNF A;  4MVF A;  2K2A A;  1NX1 A;  1LVC D;  1TOP A;  4IL1 A;  2JTT A;  1J7P A;  1IJ5 A;  2F2P A;  3CGA A;  1GGW A;  2H61 A;  4M2O A;  1JBA A;  4YRU A;  2K7C A;  3BUO B;  3VRN A;  1JF0 A;  5AAN A;  1UHJ A;  1AJ4 A;  4YGE B;  2OS8 C;  1MR8 A;  1F4O A;  4MSP A;  5JOL A;  2JWW A;  3HX4 A;  4PHJ A;  2AAO A;  5KTY A;  1CFC A;  1KWO C;  1QS7 A;  4UPG A;  1QX5 B;  1YRT B;  2A4J A;  1KFX L;  1ZMZ A;  3VRR A;  1BMO A;  3VRP A;  3EKH A;  4PE4 A;  1V1G A;  4YI9 A;  1SR6 B;  2E30 A;  2QAC A;  2DOQ A;  2EGD A;  2HQW A;  4ORC B;  3VGO A;  4OVN F;  4QJ5 B;  2G9B A;  3BXK A;  3PAL A;  2H2K A;  1J7R A;  2LAP A;  2GGZ A;  4PHN A;  1BT6 A;  3EVV A;  1K2H A;  3SG2 A;  4JPZ B;  1TIZ A;  1F4Q A;  1XFV O;  2KGR A;  1G8I A;  1S6I A;  3SG6 A;  5TNC A;  2WCF A;  3JTD B;  3NSK A;  1QIW A;  1QAS A;  1WLZ A;  1TCO B;  2NLN A;  2M9G A;  4GUK A;  4C0J A;  1XFX O;  3GK4 X;  2QPT A;  1W7J B;  1OMV A;  3IQO A;  1YUS A;  2BL0 C;  1TNW A;  1AUI B;  4P2Y B;  2ZNE A;  2NCO A;  4F0Z B;  1CLL A;  2O5G A;  1UHI A;  5HLO A;  4CFQ A;  2LLT A;  1M45 A;  3QRX A;  2KOT A;  1AP4 A;  1SL8 A;  3EVR A;  2K8M B;  5DKN A;  2EC6 B;  3WHU B;  1MXE A;  4AQJ A;  1XFU O;  4DUQ A;  1OSA A;  2V53 A;  5IBW A;  1KCY A;  2FCE A;  1VRK A;  1KK7 Z;  2ZN9 A;  1HQV A;  3BYA A;  5CPV A;  3MSE B;  4N1F A;  4PAL A;  1KFX S;  3DF0 B;  1TNP A;  1XFZ O;  2RGI A;  4FTG A;  1F54 A;  2LC5 A;  4A4C A;  3CWG A;  1LA3 A;  3LK0 A;  2MA2 A;  1ZOT B;  2F8P A;  3FIA A;  1SR6 C;  1SYM A;  1J55 A;  4GBA A;  2LM5 A;  2WC8 A;  1NP8 A;  4I5K A;  1PVA A;  1QX7 A;  2R2I A;  2LMT A;  4XYN A;  1K9U A;  3CR4 X;  4PE7 A;  2LAN A;  1DJX A;  4ETO A;  1CTR A;  1EXR A;  2PMY A;  5AER A;  2JU0 A;  1EH2 A;  2JOJ A;  1PSR A;  1SCM B;  3LL8 B;  4CPV A;  2LLU A;  3GOF A;  3M0W A;  1REC A;  4DIR A;  3RM1 A;  2FJU B;  1QVI Y;  1S5G Z;  1XVJ A;  2SCP A;  1B7T Z;  1K9K A;  1DJY A;  2BBM A;  2ZKM X;  2I18 A;  3JTD C;  1CNP A;  2LV7 A;  4N5X A;  1BOC A;  1JC2 A;  2CXJ A;  2WOR A;  3CLN A;  3PN7 B;  3OX6 A;  1GQM A;  1M63 B;  2WOS A;  3TUY B;  1J1E A;  3LK1 A;  2KAV A;  1Y0V H;  4CFR A;  1AVS A;  4ZCU A;  1IG5 A;  1LXF C;  2Q4U A;  3ZWH A;  1DVI A;  2E6W A;  1B9A A;  1AJ5 A;  1ODB A;  2KQY A;  1OMR A;  2EC6 C;  1Y1X A;  3ZNI A;  2Q91 A;  1BR1 B;  4GPL B;  2KI4 B;  2LLS A;  2KGB C;  2KI6 C;  1GGZ A;  1YVL A;  2FCD A;  2B1U A;  5JJG A;  3GK1 A;  4PDZ A;  2BE6 A;  1EG3 A;  3I5H B;  4OR9 B;  1PVB A;  1CLM A;  1F70 A;  1BU3 A;  5GQQ C;  5HKZ A;  1DGV A;  1H4B A;  2KYF A;  2MRD A;  1MUX A;  1KQV A;  4I5N B;  3IF7 A;  1B8L A;  3SIB A;  3DD4 A;  2M29 A;  5CSF A;  3CS1 A;  4D1E A;  1SKT A;  2L98 A;  4OV2 A;  3I5F B;  3AKA A;  1AK8 A;  3NSO A;  1N0Y A;  3LLE A;  2ZRT A;  1DF0 B;  1CDL A;  2M7L A;  2M49 B;  3DVJ A;  1TN4 A;  2F2O A;  1PUL A;  3SJS A;  3I5G B;  4MZL A;  1UUS A;  5D69 A;  2H61 C;  3I5I B;  2VRG A;  1SCM C;  1IRJ A;  2HF5 A;  2KAX A;  3A8R A;  1CM1 A;  1FW4 A;  2MBX A;  3C1V A;  1S6J A;  2CT9 A;  2AMI A;  1TRF A;  1QJT A;  4OKH A;  2LMU A;  4CID A;  2LHL A;  2BCX A;  1L7Z A;  3D0Y B;  3PN7 C;  3TUY C;  1CFF A;  2KFF A;  1CDP A;  2NCP A;  1CB1 A;  4C0L A;  2JZI A;  1MHO A;  3D10 A;  1V1F A;  5F6T A;  4MN0 A;  2AUC A;  4YBH B;  1BJF A;  1DGU A;  1N2D A;  1ALV A;  1F55 A;  4YGA A;  1QIV A;  5CSI A;  4M2Q A;  3VRO A;  2M1K B;  2CCM A;  2I2R E;  4NDD A;  4R1E A;  1EL4 A;  2KBI A;  4M2P A;  1JF2 A;  1B1G A;  1KK8 B;  3KPX A;  4OCI A;  1NPQ A;  1UWO A;  2ZFD A;  3EKJ A;  3PM8 A;  1NUB A;  1B4C A;  2KI4 C;  5ER4 X;  1U5I B;  5CSN A;  1D1O A;  3BOW B;  3SG4 A;  2LVV A;  2LUX A;  3A4U B;  1UHH A;  3I5H C;  2ZRS A;  1DMO A;  1E8A A;  1OZO A;  4U8D A;  1DTL A;  4HSZ A;  1S36 A;  3SG3 A;  1IKU A;  1NSH A;  1K94 A;  1A75 A;  2M0R A;  3BUX B;  4XJK A;  3BUW B;  1R2U A;  4USL A;  1JWD A;  1YRU B;  4NDB A;  1S3P A;  2I94 A;  1UP5 A;  3I5F C;  1K90 D;  3OB2 B;  2ISD A;  1AHR A;  3CR2 A;  1IWQ A;  2COL B;  2CNP A;  5G08 A;  4AQI A;  3E3R A;  1SW8 A;  1K8U A;  4GNK B;  1RJV A;  3I5G C;  4FQO A;  3GK2 A;  1K9P A;  1Y6W A;  1WRK A;  2LP3 A;  3I5I C;  1MF8 B;  1CMF A;  1SPY A;  1M46 A;  1KFU L;  2WCB A;  1BLQ A;  2LE9 B;  5J3X A;  1IQ5 A;  1X02 A;  2K0J A;  5HKY A;  3H4S E;  2MHH A;  3NSL A;  5HLV A;  1DJW A;  1S5G Y;  2SAS A;  1CDN A;  3LCP C;  1ZAC A;  3CZT X;  1B7T Y;  2HPS A;  5D7F A;  2M7N A;  1F8H A;  1GJY A;  2JNX A;  1B8C A;  3EK8 A;  3HCM A;  1RRO A;  3FS7 A;  2BCB A;  4P5O E;  1S26 D;  1G4Y R;  5AEQ A;  1SBJ A;  1IJ6 A;  1ZUZ A;  4ORB B;  1OQP A;  1PK0 D;  2KFH A;  2PAS A;  1MQ1 A;  1XK4 A;  2L5X B;  3TZ1 A;  1TTX A;  2JXL A;  1KK8 C;  3CTN A;  1C7V A;  2WND A;  1M39 A;  4CLN A;  1FI6 A;  2JXC A;  1PAL A;  1L2O B;  1ZFS A;  4PHM A;  2LCP A;  1WY9 A;  1TNX A;  2KI6 D;  2JQ6 A;  3ICB A;  1DJI A;  4MZJ A;  1CLB A;  3PFV A;  3OHM B;  4MZK A;  1WLM A;  2KBM A;  2LVI A;  3PAT A;  1NCY A;  1KQM B;  4GFT A;  4NQG A;  1A4P A;  5HYD A;  1NYA A;  3O4Y A;  3FWC A;  2BKI B;  1NCZ A;  5K89 A;  3PLF B;  4MBE A;  2GV5 A;  3F45 A;  2P6B B;  2HQ8 A;  1S6C A;  1EG4 A;  4AOM A;  2LNK A;  1XFY O;  2PVB A;  2L50 A;  4ZCV A;  1ALW A;  4YGB B;  2JPT A;  2KDH A;  1QXP A;  2JC2 A;  5I2L A;  1KFU S;  4GGF C;  3RLZ A;  2K61 A;  3CR5 X;  2PAL A;  2ZND A;  1NWD A;  2LVK A;  5KU1 A;  1A29 A;  3DF0 A;  1OMD A;  2FOT A;  2KAY A;  1KSM A;  1B47 A;  1IQ3 A;  4QJ3 B;  5B8I B;  2O60 A;  1Q80 A;  1MWN A;  2JT0 A;  2EHB A;  1SMG A;  1YVH A;  2Y1M A;  1K93 D;  4XJK B;  1QLS A;  3DVM A;  4DS7 A;  4JQ0 D;  1QV1 A;  3O2P A;  4A4B A;  1Y1U A;  1K96 A;  2BE4 A;  3BQ3 A;  3OX5 A;  1WDC B;  1WRL A;  2KNE A;  2JTZ A;  2L0P A;  2CTN A;  5I2Q A;  4HRE E;  1CKK A;  3O78 A;  4Q04 A;  5CSJ A;  4E68 A;  2K7D A;  1LA0 A;  4WQ2 A;  1L2O C;  2F33 A;  3TS5 B;  1DJZ A;  2LMV A;  2LUC A;  1QV0 A;  1OOJ A;  3NXA A;  4ORA B;  5AXI A;  2K7O A;  3IQQ A;  1BOD A;  2BEC A;  1HT9 A;  2L51 A;  4WRI A;  1UHN A;  1BG1 A;  1YUU A;  5FYX A;  2MLE C;  2L4H A;  3OP0 A;  1KQM C;  2KQ6 A;  1NCX A;  1NX3 A;  3AAK A;  2M97 A;  2IS9 A;  3DVE A;  2KSP A;  3SIA A;  1NX2 A;  3EK7 A;  1G33 A;  5HKW A;  1RK9 A;  3AAJ A;  3AKB A;  3O6B A;  1UUR A;  1KK7 Y;  4QJ4 B;  1A03 A;  3PSR A;  2TN4 A;  1XA5 A;  2M8U A;  1FI5 A;  1NIW A;  1J7Q A;  2JUL A;  1N65 A;  4PE1 A;  5I2O A;  4DCK A;  2OTG B;  1IGV A;  2KYC A;  1CFP A;  2L4I A;  3TDZ A;  1C7W A;  1QX2 A;  1QLK A;  1NX0 A;  2ZN8 A;  3EVU A;  1RFJ A;  4MRY A;  4ICB A;  1YX7 A;  2LP2 A;  3KHE A;  1KSO A;  2WCE A;  1RTP 1;  3SG5 A;  2KFG A;  1LIN A;  4TNC A;  2F3Y A;  2CBL A;  1CFD A;  1JFK A;  1YR5 A;  2D8N A;  2PSR A;  1DF0 A;  1QAT A;  3TDU A;  1Y1A A;  1YUT A;  4YGC B;  1WDC C;  4HRH A;  5AFP A;  1YX8 A;  3WHT B;  1YTZ C;  2JRF A;  2MJW B;  5ER5 A;  1R6P A;  2JT8 A;  3TDI A;  3TS5 C;  3JVT B;  2LVJ A;  4N1G A;  1IH0 A;  4L9M A;  2NXQ A;  2LHI A;  3DVK A;  4YI8 A;  4MLW A;  3KO0 A;  1EJ3 A;  2G2B A;  4PE0 A;  2Y5I A;  1SK6 D;  1DJH A;  3D0Y A;  4JWQ A;  2OPO A;  1OZS A;  5BPJ A;  1LKJ A;  1BF5 A;  1XFW O;  3EK4 A;  4MEW A;  1TCF A;  1WRZ A;  2BBN A;  1QTX A;  4BY5 A;  1K95 A;  3K21 A;  2OS8 B;  2GGM A;  1SL7 A;  2F3Z A;  4GAO A;  3WNX B;  1BR4 B;  2BKH B;  3SG7 A;  1KWO B;  2M1U A;  4PHK A;  1XK4 C;  1C07 A;  1U5I A;  4I5L B;  1RWY A;  1S1E A;  4YGD B;  1DJG A;  1PRW A;  3BOW A;  1SNL A;  1SY9 A;  2PRU A;  1CM4 A;  2OTG C;  3OB1 B;  4GGN A;  1OE9 B;  1XO5 A;  1JFJ A;  1M31 A;  2Y1N A;  2JT3 A;  1FBV A;  2BCA A;  1TNQ A;  4BY4 A;  1A2X A;  1F71 A;  1JSA A;  5I8N A;  1FF1 A;  1QVI Z;  1YUR A;  1MXL C;  4I5J A;  1DT7 B;  2M3W A;  1UHK A;  3KF9 A;  2HET A;  4HRG A;  1J7O A;  2K2F A;  1PSB A;  1SRA A;  5DKR A;  5DKQ A;  2NZ0 A;  2MAZ A;  3BUM B;  3WXA A;  4PCW A;  3KEV A;  2Y4Q A; 
#chains in the Genus database with same CATH topology
 4WQ3 A;  1XYD A;  2K7B A;  1SL9 A;  3S0F A;  1B8R A;  1H8B A;  3BUN B;  2L2E A;  5PAL A;  2MLF C;  4GGF A;  2KHN A;  4MRX A;  1W7I B;  1FPW A;  4C0K A;  1J1D A;  1SCV A;  3FWB A;  1A75 B;  2WCM A;  2BL0 B;  3VRQ A;  2I7A A;  1CMG A;  3NSI A;  4DRW A;  5KSZ A;  1JUO A;  3JVT C;  1CDM A;  4NDC A;  2JNF A;  4MVF A;  1QWV A;  4KYN A;  2K2A A;  3UNW A;  1NX1 A;  1LVC D;  1TOP A;  4IL1 A;  2JTT A;  3S0B A;  1J7P A;  1IJ5 A;  2F2P A;  3CGA A;  1TWO A;  3DY9 A;  1GGW A;  2H61 A;  4M2O A;  1JBA A;  5I94 A;  4YRU A;  2K7C A;  3BUO B;  3VRN A;  1JF0 A;  5AAN A;  1UHJ A;  1AJ4 A;  3FE9 A;  2OS8 C;  3O4X A;  4YGE B;  1MR8 A;  1F4O A;  1OOH A;  4MSP A;  2JWW A;  3HX4 A;  4PHJ A;  2GTE A;  5JOL A;  3SS3 A;  2AAO A;  5KTY A;  1CFC A;  1KWO C;  1QS7 A;  4UPG A;  1QX5 B;  1YRT B;  1ZMZ A;  1KFX L;  2A4J A;  3VRR A;  3DZT A;  3CZ0 A;  1BMO A;  3VRP A;  3EKH A;  4PE4 A;  1V1G A;  1W9Z A;  4YI9 A;  1SR6 B;  2E30 A;  2QAC A;  2DOQ A;  2EGD A;  2HQW A;  3D74 A;  4ORC B;  2KLD A;  4OVN F;  3VGO A;  4QJ5 B;  2G9B A;  3BXK A;  3PAL A;  1Z2C B;  2H2K A;  1J7R A;  2LAP A;  2GGZ A;  4PHN A;  1BT6 A;  3EVV A;  1K2H A;  3SG2 A;  1B1G A;  3UO9 A;  4JPZ B;  2JPO A;  1TIZ A;  1F4Q A;  3OGN A;  3B86 A;  1XFV O;  2KGR A;  1G8I A;  1S6I A;  3SG6 A;  5TNC A;  2WCF A;  3JTD B;  3NSK A;  1QIW A;  1QAS A;  1WLZ A;  1TCO B;  2NLN A;  3D78 A;  2M9G A;  4GUK A;  4C0J A;  1XFX O;  3GK4 X;  2QPT A;  1W7J B;  1OMV A;  3IQO A;  1YUS A;  2BL0 C;  1TNW A;  1AUI B;  4P2Y B;  2ZNE A;  3PJI A;  2NCO A;  4F0Z B;  1CLL A;  2O5G A;  1UHI A;  5HLO A;  4CFQ A;  2LLT A;  1M45 A;  3QRX A;  2KOT A;  1AP4 A;  1SL8 A;  3EVR A;  2K8M B;  5DKN A;  2EC6 B;  3WHU B;  1MXE A;  4AQJ A;  4OZD A;  3CAB A;  1XFU O;  3BFH A;  1OSA A;  4JKT A;  4DUQ A;  3SS5 A;  2V53 A;  5IBW A;  1KCY A;  2FCE A;  1VRK A;  1KK7 Z;  2ZN9 A;  1HQV A;  3BYA A;  2L5Y A;  3PM2 A;  5CPV A;  3MSE B;  2QEV A;  4N1F A;  1KFX S;  3DF0 B;  1TNP A;  1XFZ O;  2RGI A;  4FTG A;  4PAL A;  1C3Y A;  1F54 A;  2LC5 A;  4A4C A;  3CWG A;  1LA3 A;  3LK0 A;  2MA2 A;  5HL1 A;  1ZOT B;  2F8P A;  3FIA A;  1SR6 C;  1SYM A;  1J55 A;  4GBA A;  2LM5 A;  2WC8 A;  1NP8 A;  4I5K A;  1PVA A;  1QX7 A;  2R2I A;  3K1E A;  2LMT A;  4XYN A;  1K9U A;  3CR4 X;  4PE7 A;  2LAN A;  1DJX A;  4ETO A;  1CTR A;  1EXR A;  2PMY A;  5AER A;  2JU0 A;  1EH2 A;  2JOJ A;  1PSR A;  1SCM B;  3LL8 B;  4CPV A;  2LLU A;  3GOF A;  3M0W A;  4FQT A;  1REC A;  4DIR A;  3RM1 A;  2FJU B;  1QVI Y;  1S5G Z;  1XVJ A;  2SCP A;  1B7T Z;  1K9K A;  1DJY A;  2BBM A;  2ZKM X;  2I18 A;  3JTD C;  1CNP A;  2LV7 A;  4IJ7 A;  4N5X A;  1BOC A;  1JC2 A;  1ORG A;  2CXJ A;  2WOR A;  3CLN A;  3PN7 B;  3OX6 A;  1GQM A;  1M63 B;  2WOS A;  3TUY B;  1J1E A;  3LK1 A;  2KAV A;  1Y0V H;  2BNX A;  4CFR A;  1AVS A;  4ZCU A;  1IG5 A;  1LXF C;  1P28 A;  2Q4U A;  3ZWH A;  1DVI A;  2E6W A;  3QME A;  1B9A A;  1AJ5 A;  1ODB A;  2KQY A;  1OMR A;  2EC6 C;  1Y1X A;  3ZNI A;  2Q91 A;  1BR1 B;  4GPL B;  2KI4 B;  2LLS A;  2KGB C;  2KI6 C;  1GGZ A;  1YVL A;  2FCD A;  2B1U A;  1TUZ A;  3CZ2 A;  3GK1 A;  5JJG A;  2FJY A;  4PDZ A;  2BE6 A;  1EG3 A;  3I5H B;  4OR9 B;  1PVB A;  1CLM A;  1F70 A;  1BU3 A;  5GQQ C;  5HKZ A;  1DGV A;  1H4B A;  2KYF A;  2MRD A;  1MUX A;  1KQV A;  4I5N B;  3IF7 A;  1B8L A;  3SIB A;  3DD4 A;  2M29 A;  5CSF A;  3CS1 A;  4D1E A;  1SKT A;  2L98 A;  4OV2 A;  3I5F B;  3AKA A;  1AK8 A;  3NSO A;  1N0Y A;  3LLE A;  2ZRT A;  1DF0 B;  1CDL A;  5FI2 A;  2M49 B;  2M7L A;  4INX A;  3DVJ A;  1TN4 A;  2F2O A;  1PUL A;  3SJS A;  3I5G B;  4MZL A;  1UUS A;  3L4L A;  5D69 A;  2H61 C;  3I5I B;  2VRG A;  1SCM C;  1IRJ A;  2HF5 A;  2KAX A;  3A8R A;  1CM1 A;  1FW4 A;  2BAP A;  2MBX A;  3BJH A;  1S6J A;  3C1V A;  2CT9 A;  2AMI A;  1TRF A;  1QJT A;  4OKH A;  2LMU A;  4CID A;  2LHL A;  2BCX A;  1L7Z A;  2KLE A;  3CYZ A;  3D0Y B;  3PN7 C;  3TUY C;  3RZS A;  1CFF A;  2KFF A;  1CDP A;  2NCP A;  3S0D A;  1CB1 A;  4C0L A;  2JZI A;  1MHO A;  3D10 A;  1V1F A;  3NHI A;  2L2C A;  4MN0 A;  5F6T A;  2AUC A;  4YBH B;  1BJF A;  1DGU A;  1N2D A;  1ALV A;  1F55 A;  4YGA A;  1QIV A;  5CSI A;  2P71 A;  4M2Q A;  2M1K B;  2CCM A;  3VRO A;  2I2R E;  4NDD A;  4R1E A;  1EL4 A;  1Z4H A;  2KBI A;  1JF2 A;  4M2P A;  1KK8 B;  3KPX A;  4OCI A;  1NPQ A;  1UWO A;  2ZFD A;  3EKJ A;  3PM8 A;  1NUB A;  1B4C A;  2KI4 C;  5ER4 X;  1U5I B;  2QEH A;  5CSN A;  1D1O A;  3BOW B;  3N7H A;  3SG4 A;  2LVV A;  2LUX A;  3A4U B;  1UHH A;  2KPH A;  3I5H C;  2ZRS A;  1DMO A;  1E8A A;  1OZO A;  4U8D A;  1DTL A;  4HSZ A;  1S36 A;  3SG3 A;  1IKU A;  1NSH A;  5D3O A;  1K94 A;  1A75 A;  2M0R A;  3BUX B;  4XJK A;  2QDI A;  3BUW B;  3B88 A;  3Q8I A;  1R2U A;  4USL A;  1JWD A;  1DEL A;  1YRU B;  4NDB A;  1S3P A;  2I94 A;  1UP5 A;  3I5F C;  1K90 D;  2QEO A;  3OB2 B;  1AHR A;  3CR2 A;  2ISD A;  1IWQ A;  2COL B;  2CNP A;  5G08 A;  4AQI A;  3E3R A;  3VB1 A;  1SW8 A;  1K8U A;  4GNK B;  1RJV A;  3I5G C;  4FQO A;  3GK2 A;  1K9P A;  1Y6W A;  1WRK A;  2LP3 A;  3I5I C;  1MF8 B;  1CMF A;  1SPY A;  1M46 A;  1KFU L;  2WCB A;  1BLQ A;  2LE9 B;  5J3X A;  1IQ5 A;  1X02 A;  2K0J A;  5HKY A;  3H4S E;  2MHH A;  3NSL A;  5HLV A;  1DJW A;  1S5G Y;  2SAS A;  1CDN A;  3LCP C;  1ZAC A;  3CZT X;  1B7T Y;  3V2L A;  5FI7 A;  2HPS A;  5D7F A;  2M7N A;  1F8H A;  1GJY A;  2JNX A;  1B8C A;  3EK8 A;  3HCM A;  1RRO A;  3FS7 A;  2BCB A;  4P5O E;  1S26 D;  1G4Y R;  5AEQ A;  1SBJ A;  1IJ6 A;  1ZUZ A;  3EG5 B;  4ORB B;  1OQP A;  1PK0 D;  2KFH A;  2PAS A;  1MQ1 A;  1XK4 A;  2L5X B;  3D77 A;  3TZ1 A;  1TTX A;  2JXL A;  1KK8 C;  3CTN A;  1C7V A;  2WCK A;  2WND A;  1M39 A;  4CLN A;  1FI6 A;  2JXC A;  1PAL A;  1L2O B;  1DEK A;  1ZFS A;  4PHM A;  2LCP A;  1WY9 A;  1TNX A;  2KI6 D;  2JQ6 A;  3ICB A;  1DJI A;  4MZJ A;  1OOG A;  1CLB A;  3PFV A;  3OHM B;  4MZK A;  1WLM A;  2KBM A;  2LVI A;  3PAT A;  1NCY A;  1KQM B;  4GFT A;  4NQG A;  1A4P A;  5HYD A;  1NYA A;  3O4Y A;  3FWC A;  2BKI B;  1NCZ A;  5K89 A;  3PLF B;  4MBE A;  2GV5 A;  3F45 A;  2P6B B;  3SS4 A;  2HQ8 A;  1S6C A;  1EG4 A;  1OOF A;  3S0G A;  2LNK A;  4AOM A;  1XFY O;  2PVB A;  2L50 A;  2WCH A;  4ZCV A;  2PQL A;  1ALW A;  4YGB B;  2JPT A;  2KDH A;  2P70 A;  1QXP A;  2JC2 A;  5I2L A;  1T14 A;  1TUJ A;  1KFU S;  4GGF C;  3RLZ A;  1GM0 A;  3B7A A;  2K61 A;  3CR5 X;  2PAL A;  2ZND A;  3OBV A;  1NWD A;  3R1O A;  2LVK A;  3B6X A;  5KU1 A;  1A29 A;  3DF0 A;  2WC5 A;  1DC1 A;  1OMD A;  2FOT A;  2KAY A;  1KSM A;  1B47 A;  1IQ3 A;  4QJ3 B;  5B8I B;  2O60 A;  4INW A;  1Q80 A;  1MWN A;  2JT0 A;  2EHB A;  1SMG A;  1YVH A;  2Y1M A;  1K93 D;  4XJK B;  1QLS A;  3DVM A;  4DS7 A;  4JQ0 D;  3NHT A;  1QV1 A;  2WC6 A;  3O2P A;  4A4B A;  1Y1U A;  1K96 A;  2BE4 A;  3BQ3 A;  3OX5 A;  1WDC B;  1WRL A;  2KNE A;  2JTZ A;  2L0P A;  2CTN A;  5I2Q A;  4HRE E;  1CKK A;  3R1P A;  3O78 A;  4Q04 A;  5CSJ A;  4E68 A;  2K7D A;  1LA0 A;  4WQ2 A;  1L2O C;  2F33 A;  3TS5 B;  1DJZ A;  2LMV A;  2LUC A;  1QV0 A;  1OOJ A;  3D76 A;  3NXA A;  4ORA B;  5AXI A;  3NGV A;  3D75 A;  2K7O A;  3IQQ A;  1BOD A;  2BEC A;  1HT9 A;  2L51 A;  4WRI A;  1UHN A;  1BG1 A;  1YUU A;  5FYX A;  1DQE A;  2MLE C;  2L4H A;  3OP0 A;  1KQM C;  2KQ6 A;  1NCX A;  1NX3 A;  3AAK A;  2M97 A;  3DXL A;  3CZ1 A;  2IS9 A;  3DVE A;  2WCL A;  3FE6 A;  1OOI X;  2KSP A;  3SIA A;  1NX2 A;  3EK7 A;  1G33 A;  5HKW A;  1RK9 A;  3AAJ A;  3AKB A;  4F7F A;  3O6B A;  1UUR A;  1KK7 Y;  3FE8 A;  3IVT A;  4QJ4 B;  1A03 A;  3PSR A;  2TN4 A;  1XA5 A;  2M8U A;  1FI5 A;  1NIW A;  1J7Q A;  2H8V A;  2JUL A;  1N65 A;  4PE1 A;  5I2O A;  1JFJ A;  4DCK A;  2OTG B;  1IGV A;  2KYC A;  1CFP A;  2L4I A;  3TDZ A;  3CDN A;  1C7W A;  1QX2 A;  1QLK A;  1NX0 A;  2ZN8 A;  3DYE A;  3EVU A;  1RFJ A;  2WCJ A;  4MRY A;  4ICB A;  1YX7 A;  2LP2 A;  3KHE A;  1KSO A;  2WCE A;  1RTP 1;  3SG5 A;  2KFG A;  1LIN A;  4TNC A;  3BFA A;  2F3Y A;  2CBL A;  5DIC A;  1CFD A;  1JFK A;  3S0A A;  1YR5 A;  2D8N A;  2PSR A;  1DF0 A;  1QAT A;  3TDU A;  1Y1A A;  3BFB A;  1YUT A;  4YGC B;  1WDC C;  4HRH A;  5AFP A;  1LS8 A;  1YX8 A;  3WHT B;  1YTZ C;  2JRF A;  2MJW B;  5ER5 A;  3B87 A;  1R6P A;  2JT8 A;  3TDI A;  3TS5 C;  3JVT B;  2LVJ A;  4N1G A;  1IH0 A;  4L9M A;  2PYQ A;  2NXQ A;  2LHI A;  3DVK A;  4YI8 A;  4MLW A;  1XFR A;  3KO0 A;  1EJ3 A;  2G2B A;  4PE0 A;  2Y5I A;  1SK6 D;  1DJH A;  3D0Y A;  4JWQ A;  2OPO A;  1OZS A;  2ERB A;  1IIO A;  2QEB A;  5BPJ A;  1LKJ A;  1BF5 A;  1XFW O;  3EK4 A;  2YGU A;  4MEW A;  1TCF A;  1SSE B;  1WRZ A;  2BBN A;  1QTX A;  3L47 A;  4BY5 A;  4PT1 A;  1K95 A;  3K21 A;  2OS8 B;  2GGM A;  1SL7 A;  2F3Z A;  4GAO A;  3WNX B;  1BR4 B;  3R72 A;  5EL2 A;  2BKH B;  3SG7 A;  1KWO B;  2M1U A;  4PHK A;  4JD9 A;  1XK4 C;  1C07 A;  1U5I A;  4I5L B;  1RWY A;  1S1E A;  4YGD B;  1DJG A;  1PRW A;  5FI6 A;  3BOW A;  1SNL A;  1SY9 A;  2PRU A;  3D73 A;  1CM4 A;  2OTG C;  1OW4 A;  3OB1 B;  1OE9 B;  1XO5 A;  4GGN A;  1M31 A;  2Y1N A;  2JT3 A;  1FBV A;  2BCA A;  1TNQ A;  3S0E A;  4BY4 A;  1A2X A;  1F71 A;  1JSA A;  5I8N A;  1FF1 A;  1QVI Z;  1YUR A;  1MXL C;  4I5J A;  1DT7 B;  3R1V A;  2M3W A;  2K60 A;  1UHK A;  3KF9 A;  2HET A;  4HRG A;  3L4A A;  1J7O A;  2K2F A;  1PSB A;  1SRA A;  5DKR A;  5DKQ A;  2NZ0 A;  2MAZ A;  1C3Z A;  3BUM B;  3WXA A;  4PCW A;  3KEV A;  2Y4Q A; 
#chains in the Genus database with same CATH homology
 4WQ3 A;  1XYD A;  2K7B A;  1SL9 A;  1B8R A;  1H8B A;  3BUN B;  2L2E A;  5PAL A;  2MLF C;  4GGF A;  2KHN A;  4MRX A;  1W7I B;  1FPW A;  4C0K A;  1J1D A;  1SCV A;  3FWB A;  1A75 B;  2BL0 B;  3VRQ A;  2I7A A;  1CMG A;  3NSI A;  4DRW A;  5KSZ A;  1JUO A;  3JVT C;  1CDM A;  4NDC A;  2JNF A;  4MVF A;  2K2A A;  1NX1 A;  1LVC D;  1TOP A;  4IL1 A;  2JTT A;  1J7P A;  1IJ5 A;  2F2P A;  3CGA A;  1GGW A;  2H61 A;  4M2O A;  1JBA A;  4YRU A;  2K7C A;  3BUO B;  3VRN A;  1JF0 A;  5AAN A;  1UHJ A;  1AJ4 A;  4YGE B;  2OS8 C;  1MR8 A;  1F4O A;  4MSP A;  5JOL A;  2JWW A;  3HX4 A;  4PHJ A;  2AAO A;  5KTY A;  1CFC A;  1KWO C;  1QS7 A;  4UPG A;  1QX5 B;  1YRT B;  2A4J A;  1KFX L;  1ZMZ A;  3VRR A;  1BMO A;  3VRP A;  3EKH A;  4PE4 A;  1V1G A;  4YI9 A;  1SR6 B;  2E30 A;  2QAC A;  2DOQ A;  2EGD A;  2HQW A;  4ORC B;  3VGO A;  4OVN F;  4QJ5 B;  2G9B A;  3BXK A;  3PAL A;  2H2K A;  1J7R A;  2LAP A;  2GGZ A;  4PHN A;  1BT6 A;  3EVV A;  1K2H A;  3SG2 A;  4JPZ B;  1TIZ A;  1F4Q A;  1XFV O;  2KGR A;  1G8I A;  1S6I A;  3SG6 A;  5TNC A;  2WCF A;  3JTD B;  3NSK A;  1QIW A;  1QAS A;  1WLZ A;  1TCO B;  2NLN A;  2M9G A;  4GUK A;  4C0J A;  1XFX O;  3GK4 X;  2QPT A;  1W7J B;  1OMV A;  3IQO A;  1YUS A;  2BL0 C;  1TNW A;  1AUI B;  4P2Y B;  2ZNE A;  2NCO A;  4F0Z B;  1CLL A;  2O5G A;  1UHI A;  5HLO A;  4CFQ A;  2LLT A;  1M45 A;  3QRX A;  2KOT A;  1AP4 A;  1SL8 A;  3EVR A;  2K8M B;  5DKN A;  2EC6 B;  3WHU B;  1MXE A;  4AQJ A;  1XFU O;  4DUQ A;  1OSA A;  2V53 A;  5IBW A;  1KCY A;  2FCE A;  1VRK A;  1KK7 Z;  2ZN9 A;  1HQV A;  3BYA A;  5CPV A;  3MSE B;  4N1F A;  4PAL A;  1KFX S;  3DF0 B;  1TNP A;  1XFZ O;  2RGI A;  4FTG A;  1F54 A;  2LC5 A;  4A4C A;  3CWG A;  1LA3 A;  3LK0 A;  2MA2 A;  1ZOT B;  2F8P A;  3FIA A;  1SR6 C;  1SYM A;  1J55 A;  4GBA A;  2LM5 A;  2WC8 A;  1NP8 A;  4I5K A;  1PVA A;  1QX7 A;  2R2I A;  2LMT A;  4XYN A;  1K9U A;  3CR4 X;  4PE7 A;  2LAN A;  1DJX A;  4ETO A;  1CTR A;  1EXR A;  2PMY A;  5AER A;  2JU0 A;  1EH2 A;  2JOJ A;  1PSR A;  1SCM B;  3LL8 B;  4CPV A;  2LLU A;  3GOF A;  3M0W A;  1REC A;  4DIR A;  3RM1 A;  2FJU B;  1QVI Y;  1S5G Z;  1XVJ A;  2SCP A;  1B7T Z;  1K9K A;  1DJY A;  2BBM A;  2ZKM X;  2I18 A;  3JTD C;  1CNP A;  2LV7 A;  4N5X A;  1BOC A;  1JC2 A;  2CXJ A;  2WOR A;  3CLN A;  3PN7 B;  3OX6 A;  1GQM A;  1M63 B;  2WOS A;  3TUY B;  1J1E A;  3LK1 A;  2KAV A;  1Y0V H;  4CFR A;  1AVS A;  4ZCU A;  1IG5 A;  1LXF C;  2Q4U A;  3ZWH A;  1DVI A;  2E6W A;  1B9A A;  1AJ5 A;  1ODB A;  2KQY A;  1OMR A;  2EC6 C;  1Y1X A;  3ZNI A;  2Q91 A;  1BR1 B;  4GPL B;  2KI4 B;  2LLS A;  2KGB C;  2KI6 C;  1GGZ A;  1YVL A;  2FCD A;  2B1U A;  5JJG A;  3GK1 A;  4PDZ A;  2BE6 A;  1EG3 A;  3I5H B;  4OR9 B;  1PVB A;  1CLM A;  1F70 A;  1BU3 A;  5GQQ C;  5HKZ A;  1DGV A;  1H4B A;  2KYF A;  2MRD A;  1MUX A;  1KQV A;  4I5N B;  3IF7 A;  1B8L A;  3SIB A;  3DD4 A;  2M29 A;  5CSF A;  3CS1 A;  4D1E A;  1SKT A;  2L98 A;  4OV2 A;  3I5F B;  3AKA A;  1AK8 A;  3NSO A;  1N0Y A;  3LLE A;  2ZRT A;  1DF0 B;  1CDL A;  2M7L A;  2M49 B;  3DVJ A;  1TN4 A;  2F2O A;  1PUL A;  3SJS A;  3I5G B;  4MZL A;  1UUS A;  5D69 A;  2H61 C;  3I5I B;  2VRG A;  1SCM C;  1IRJ A;  2HF5 A;  2KAX A;  3A8R A;  1CM1 A;  1FW4 A;  2MBX A;  3C1V A;  1S6J A;  2CT9 A;  2AMI A;  1TRF A;  1QJT A;  4OKH A;  2LMU A;  4CID A;  2LHL A;  2BCX A;  1L7Z A;  3D0Y B;  3PN7 C;  3TUY C;  1CFF A;  2KFF A;  1CDP A;  2NCP A;  1CB1 A;  4C0L A;  2JZI A;  1MHO A;  3D10 A;  1V1F A;  5F6T A;  4MN0 A;  2AUC A;  4YBH B;  1BJF A;  1DGU A;  1N2D A;  1ALV A;  1F55 A;  4YGA A;  1QIV A;  5CSI A;  4M2Q A;  3VRO A;  2M1K B;  2CCM A;  2I2R E;  4NDD A;  4R1E A;  1EL4 A;  2KBI A;  4M2P A;  1JF2 A;  1B1G A;  1KK8 B;  3KPX A;  4OCI A;  1NPQ A;  1UWO A;  2ZFD A;  3EKJ A;  3PM8 A;  1NUB A;  1B4C A;  2KI4 C;  5ER4 X;  1U5I B;  5CSN A;  1D1O A;  3BOW B;  3SG4 A;  2LVV A;  2LUX A;  3A4U B;  1UHH A;  3I5H C;  2ZRS A;  1DMO A;  1E8A A;  1OZO A;  4U8D A;  1DTL A;  4HSZ A;  1S36 A;  3SG3 A;  1IKU A;  1NSH A;  1K94 A;  1A75 A;  2M0R A;  3BUX B;  4XJK A;  3BUW B;  1R2U A;  4USL A;  1JWD A;  1YRU B;  4NDB A;  1S3P A;  2I94 A;  1UP5 A;  3I5F C;  1K90 D;  3OB2 B;  2ISD A;  1AHR A;  3CR2 A;  1IWQ A;  2COL B;  2CNP A;  5G08 A;  4AQI A;  3E3R A;  1SW8 A;  1K8U A;  4GNK B;  1RJV A;  3I5G C;  4FQO A;  3GK2 A;  1K9P A;  1Y6W A;  1WRK A;  2LP3 A;  3I5I C;  1MF8 B;  1CMF A;  1SPY A;  1M46 A;  1KFU L;  2WCB A;  1BLQ A;  2LE9 B;  5J3X A;  1IQ5 A;  1X02 A;  2K0J A;  5HKY A;  3H4S E;  2MHH A;  3NSL A;  5HLV A;  1DJW A;  1S5G Y;  2SAS A;  1CDN A;  3LCP C;  1ZAC A;  3CZT X;  1B7T Y;  2HPS A;  5D7F A;  2M7N A;  1F8H A;  1GJY A;  2JNX A;  1B8C A;  3EK8 A;  3HCM A;  1RRO A;  3FS7 A;  2BCB A;  4P5O E;  1S26 D;  1G4Y R;  5AEQ A;  1SBJ A;  1IJ6 A;  1ZUZ A;  4ORB B;  1OQP A;  1PK0 D;  2KFH A;  2PAS A;  1MQ1 A;  1XK4 A;  2L5X B;  3TZ1 A;  1TTX A;  2JXL A;  1KK8 C;  3CTN A;  1C7V A;  2WND A;  1M39 A;  4CLN A;  1FI6 A;  2JXC A;  1PAL A;  1L2O B;  1ZFS A;  4PHM A;  2LCP A;  1WY9 A;  1TNX A;  2KI6 D;  2JQ6 A;  3ICB A;  1DJI A;  4MZJ A;  1CLB A;  3PFV A;  3OHM B;  4MZK A;  1WLM A;  2KBM A;  2LVI A;  3PAT A;  1NCY A;  1KQM B;  4GFT A;  4NQG A;  1A4P A;  5HYD A;  1NYA A;  3O4Y A;  3FWC A;  2BKI B;  1NCZ A;  5K89 A;  3PLF B;  4MBE A;  2GV5 A;  3F45 A;  2P6B B;  2HQ8 A;  1S6C A;  1EG4 A;  4AOM A;  2LNK A;  1XFY O;  2PVB A;  2L50 A;  4ZCV A;  1ALW A;  4YGB B;  2JPT A;  2KDH A;  1QXP A;  2JC2 A;  5I2L A;  1KFU S;  4GGF C;  3RLZ A;  2K61 A;  3CR5 X;  2PAL A;  2ZND A;  1NWD A;  2LVK A;  5KU1 A;  1A29 A;  3DF0 A;  1OMD A;  2FOT A;  2KAY A;  1KSM A;  1B47 A;  1IQ3 A;  4QJ3 B;  5B8I B;  2O60 A;  1Q80 A;  1MWN A;  2JT0 A;  2EHB A;  1SMG A;  1YVH A;  2Y1M A;  1K93 D;  4XJK B;  1QLS A;  3DVM A;  4DS7 A;  4JQ0 D;  1QV1 A;  3O2P A;  4A4B A;  1Y1U A;  1K96 A;  2BE4 A;  3BQ3 A;  3OX5 A;  1WDC B;  1WRL A;  2KNE A;  2JTZ A;  2L0P A;  2CTN A;  5I2Q A;  4HRE E;  1CKK A;  3O78 A;  4Q04 A;  5CSJ A;  4E68 A;  2K7D A;  1LA0 A;  4WQ2 A;  1L2O C;  2F33 A;  3TS5 B;  1DJZ A;  2LMV A;  2LUC A;  1QV0 A;  1OOJ A;  3NXA A;  4ORA B;  5AXI A;  2K7O A;  3IQQ A;  1BOD A;  2BEC A;  1HT9 A;  2L51 A;  4WRI A;  1UHN A;  1BG1 A;  1YUU A;  5FYX A;  2MLE C;  2L4H A;  3OP0 A;  1KQM C;  2KQ6 A;  1NCX A;  1NX3 A;  3AAK A;  2M97 A;  2IS9 A;  3DVE A;  2KSP A;  3SIA A;  1NX2 A;  3EK7 A;  1G33 A;  5HKW A;  1RK9 A;  3AAJ A;  3AKB A;  3O6B A;  1UUR A;  1KK7 Y;  4QJ4 B;  1A03 A;  3PSR A;  2TN4 A;  1XA5 A;  2M8U A;  1FI5 A;  1NIW A;  1J7Q A;  2JUL A;  1N65 A;  4PE1 A;  5I2O A;  4DCK A;  2OTG B;  1IGV A;  2KYC A;  1CFP A;  2L4I A;  3TDZ A;  1C7W A;  1QX2 A;  1QLK A;  1NX0 A;  2ZN8 A;  3EVU A;  1RFJ A;  4MRY A;  4ICB A;  1YX7 A;  2LP2 A;  3KHE A;  1KSO A;  2WCE A;  1RTP 1;  3SG5 A;  2KFG A;  1LIN A;  4TNC A;  2F3Y A;  2CBL A;  1CFD A;  1JFK A;  1YR5 A;  2D8N A;  2PSR A;  1DF0 A;  1QAT A;  3TDU A;  1Y1A A;  1YUT A;  4YGC B;  1WDC C;  4HRH A;  5AFP A;  1YX8 A;  3WHT B;  1YTZ C;  2JRF A;  2MJW B;  5ER5 A;  1R6P A;  2JT8 A;  3TDI A;  3TS5 C;  3JVT B;  2LVJ A;  4N1G A;  1IH0 A;  4L9M A;  2NXQ A;  2LHI A;  3DVK A;  4YI8 A;  4MLW A;  3KO0 A;  1EJ3 A;  2G2B A;  4PE0 A;  2Y5I A;  1SK6 D;  1DJH A;  3D0Y A;  4JWQ A;  2OPO A;  1OZS A;  5BPJ A;  1LKJ A;  1BF5 A;  1XFW O;  3EK4 A;  4MEW A;  1TCF A;  1WRZ A;  2BBN A;  1QTX A;  4BY5 A;  1K95 A;  3K21 A;  2OS8 B;  2GGM A;  1SL7 A;  2F3Z A;  4GAO A;  3WNX B;  1BR4 B;  2BKH B;  3SG7 A;  1KWO B;  2M1U A;  4PHK A;  1XK4 C;  1C07 A;  1U5I A;  4I5L B;  1RWY A;  1S1E A;  4YGD B;  1DJG A;  1PRW A;  3BOW A;  1SNL A;  1SY9 A;  2PRU A;  1CM4 A;  2OTG C;  3OB1 B;  4GGN A;  1OE9 B;  1XO5 A;  1JFJ A;  1M31 A;  2Y1N A;  2JT3 A;  1FBV A;  2BCA A;  1TNQ A;  4BY4 A;  1A2X A;  1F71 A;  1JSA A;  5I8N A;  1FF1 A;  1QVI Z;  1YUR A;  1MXL C;  4I5J A;  1DT7 B;  2M3W A;  1UHK A;  3KF9 A;  2HET A;  4HRG A;  1J7O A;  2K2F A;  1PSB A;  1SRA A;  5DKR A;  5DKQ A;  2NZ0 A;  2MAZ A;  3BUM B;  3WXA A;  4PCW A;  3KEV A;  2Y4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...