4PDZA

Crystal structure of calcium-loaded s100b bound to sbi4172
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
90
structure length
90
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title Covalent Small Molecule Inhibitors of Ca(2+)-Bound S100B.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein/inhibitor
total genus 34
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4pdzA00
1QVIZ 1Y1AA 3DF0A 1DJGA 2OS8B 2JWWA 1WLZA 1SW8A 3EK7A 5I2QA 2GGZA 4M2QA 1B4CA 2SCPA 1YRUB 4AQJA 1CB1A 4AQIA 4I5KA 1ALVA 4MZKA 1IG5A 1S6CA 1J7QA 2KYCA 2JTTA 4I5LB 1YURA 2LANA 2I2RE 1QX5B 2NZ0A 3EVUA 3PN7B 4MRYA 3SG6A 2K8MB 4XJKA 1UP5A 4WQ2A 3BYAA 2JQ6A 3GOFA 1QVIY 2K7CA 1AHRA 1QX2A 2MAZA 2ZNEA 5D69A 1CLBA 1CNPA 2PSRA 4TNCA 1PALA 3F45A 1RWYA 1DVIA 1MUXA 2EC6C 2E6WA 1PK0D 1XO5A 1SL8A 3NSLA 2L0PA 4N5XA 2F8PA 1ZOTB 4N1GA 1TNWA 2BBMA 2Q91A 1BMOA 5D7FA 4ZCUA 1UHNA 1KWOB 1GJYA 2JT8A 1K9PA 4PE1A 1LINA 1QIWA 2WNDA 2LP3A 1B8CA 3HCMA 1F4OA 3BOWA 1OMRA 2E30A 5JJGA 2KFGA 2JOJA 1DJYA 3GK4X 3KO0A 4MSPA 2KQ6A 1OE9B 2ZRSA 4YGAA 1CMFA 1YVHA 3ICBA 4I5NB 4MZLA 4NQGA 4PHNA 1J1EA 4OCIA 4C0LA 5AERA 3TDIA 2Q4UA 4YGBB 2KQYA 2K7DA 2OPOA 2BECA 3VROA 2M49B 1ALWA 2BCXA 1RJVA 2FOTA 2K61A 2KI4B 1NSHA 2BL0B 2CBLA 5FYXA 2M97A 3JVTB 1TCFA 1NCZA 3KHEA 2JPTA 2KI6C 3TZ1A 2PMYA 1JFKA 2JXCA 4QJ3B 1C7WA 1YUTA 1LA3A 1QJTA 2OS8C 1PVBA 2KYFA 3RLZA 1QASA 2CTNA 1UHHA 3BUWB 1QIVA 4CLNA 1E8AA 4ORBB 1MF8B 1OOJA 4MN0A 2FCDA 1IJ5A 1TNXA 2WORA 1DJWA 3DF0B 1OZSA 5TNCA 2L4HA 1K90D 1YX8A 2I7AA 2LCPA 5ER4X 3I5FB 1MHOA 1K9UA 4YI9A 1U5IA 1CM4A 1MR8A 3BUOB 4C0KA 1XK4A 4U8DA 1BT6A 1YTZC 2EHBA 1DMOA 1HQVA 2JULA 5CSIA 2AUCA 3TUYB 2CXJA 4MLWA 1UHJA 2KFHA 4R1EA 1KFXL 1IJ6A 1B7TZ 1NIWA 2FCEA 2L98A 2PRUA 1QX7A 5KU1A 4XJKB 4ICBA 2KOTA 4DCKA 2NLNA 3AKBA 4ETOA 5AFPA 1XA5A 2KFFA 3WNXB 4FTGA 1J55A 3EKJA 1Y1UA 1AUIB 2M1UA 3I5GB 1CDPA 2P6BB 3BUMB 2HF5A 2LLSA 1KWOC 2WC8A 1KQVA 2M1KB 2PASA 1IQ5A 5HLOA 2LVKA 1NCXA 1X02A 1DJHA 5ER5A 4PHJA 1G4YR 2L50A 3EVVA 3MSEB 1Q80A 1B7TY 2KBMA 2WCFA 1JSAA 1KSOA 4MZJA 4WRIA 2LMVA 4YBHB 1A4PA 2K2AA 2KGBC 4XYNA 4A4BA 3OHMB 2B1UA 1EXRA 1KK7Z 2WCEA 3BOWB 2CNPA 1F54A 1F55A 1TRFA 1TNPA 3LK0A 1QLSA 5I2LA 4D1EA 3O2PA 3CLNA 4F0ZB 1ZACA 1NX0A 1KFUS 1N0YA 1SR6B 4GFTA 1B8LA 1XFZO 2G2BA 2QACA 1DT7B 1CM1A 1S3PA 3TDUA 4I5JA 4OVNF 3E3RA 2TN4A 1QS7A 5DKQA 4HRHA 3WHTB 4N1FA 4PHKA 3VRNA 2KI4C 2BL0C 1S26D 3O4YA 1DF0A 1J7PA 1JFJA 3JVTC 3JTDB 4Q04A 1JF2A 1KCYA 1UHIA 2KHNA 3VRQA 3WXAA 3IQOA 4A4CA 5K89A 1MXEA 1KK7Y 1ZMZA 2F33A 5IBWA 5KSZA 2ZFDA 1BG1A 4HRGA 2LV7A 1SNLA 3TDZA 1QV0A 4YGEB 4BY4A 1M46A 1BLQA 4GGFA 1GGWA 1S36A 1TCOB 1SY9A 2EGDA 1B8RA 5GQQC 1SL7A 1TTXA 2M7LA 1LA0A 3O6BA 1PSRA 2BCBA 1CDNA 1EH2A 3EK8A 3PFVA 1AJ4A 2MLEC 3SIAA 1QXPA 2KDHA 1TOPA 1IWQA 1H8BA 3I5FC 4MVFA 1SCVA 1LKJA 1WRKA 3FWCA 1DGUA 2KSPA 1DJXA 4M2PA 3TUYC 4UPGA 1U5IB 2LNKA 1DJIA 1M45A 1M39A 1AJ5A 3H4SE 4HREE 2M29A 3D0YA 4NDDA 1H4BA 1NX2A 1NYAA 1SYMA 3I5GC 1CFPA 5I2OA 1A2XA 2O60A 3OB1B 1KFUL 2BBNA 2BKHB 2CT9A 1C07A 3SG3A 3I5HB 1N2DA 2OTGB 3OB2B 2H61A 1EG4A 1L7ZA 1V1GA 4E68A 1SBJA 2VRGA 1QLKA 2K0JA 2ZRTA 2KAVA 1S1EA 2V53A 1DJZA 2HPSA 2WCBA 3EK4A 3VGOA 4MRXA 2I18A 1BODA 2LLTA 2KAXA 2ISDA 1YRTB 1KQMB 2JNFA 5KTYA 1J7OA 3A4UB 2JTZA 1DTLA 3TS5B 1L2OB 1SR6C 1F71A 3BXKA 4OKHA 4QJ4B 1NX3A 1YUSA 1OMDA 1KSMA 1QATA 1DGVA 5F6TA 3SG5A 3DVKA 3LLEA 3DVMA 3AKAA 5PALA 4JPZB 2JZIA 1A75A 1V1FA 3JTDC 4C0JA 2HETA 2NCPA 3CR2A 3I5IC 1YVLA 2LUCA 3BUXB 3LCPC 1PSBA 3PLFB 4ZCVA 2AMIA 4YI8A 1DF0B 1EL4A 4QJ5B 3FIAA 1Y1XA 3BUNB 2QPTA 3OX6A 1LXFC 1SKTA 1FW4A 1QTXA 2COLB 3OP0A 5HLVA 4PE0A 4GGNA 3SG7A 4AOMA 4GPLB 3DVJA 1J1DA 2ZNDA 3VRPA 1XFXO 3EVRA 2L2EA 3AAKA 1A29A 2KBIA 4OV2A 5AXIA 1CFDA 1PULA 4MEWA 1MQ1A 1WY9A 2BKIB 3ZNIA 1FI6A 2JT0A 1OZOA 1SK6D 5DKRA 3KF9A 2LM5A 2MA2A 2PVBA 2K7OA 2MJWB 1HT9A 1K94A 1XFYO 1AVSA 1XK4C 2MHHA 3CZTX 1SL9A 4P5OE 1F4QA 2LMUA 3K21A 1NCYA 2FJUB 2JU0A 2KAYA 1MXLC 1PVAA 2BE6A 1CTRA 1SRAA 2GV5A 2ZN9A 2MRDA 4GAOA 5CSFA 2M9GA 1CLLA 3D0YB 2LE9B 1CFCA 3I5HC 4DIRA 2M8UA 2OTGC 3NSOA 1WLMA 4CIDA 1JC2A 4PALA 3GK2A 2Y1NA 2D8NA 3LK1A 2LC5A 5AANA 1SCMC 3DD4A 1K8UA 4P2YB 3SG2A 1IGVA 1FPWA 1JWDA 1JUOA 3DVEA 4FQOA 3I5IB 3CS1A 3CTNA 1KQMC 2A4JA 5I8NA 1JBAA 3SJSA 1BJFA 5BPJA 1EG3A 3FS7A 3TS5C 5G08A 1UWOA 1JF0A 1L2OC 1RFJA 2NCOA 4M2OA 1NPQA 3SIBA 3PATA 3QRXA 4YGCB 2JT3A 1EJ3A 1SMGA 1S6JA 1GGZA 2R2IA 1B9AA 2AAOA 2H2KA 1PRWA 2KI6D 1BF5A 1QV1A 1K95A 4GBAA 1K2HA 1CDLA 4PDZA 1WRZA 2LVIA 1OQPA 2L5XB 1A75B 1NX1A 1CLMA 1C7VA 1BOCA 2HQWA 4CFQA 2JRFA 2IS9A 1F70A 1RK9A 1XFUO 2MLFC 3FWBA 4JWQA 1CMGA 2DOQA 1UHKA 4GGFC 1TN4A 1WDCB 3KEVA 2F3ZA 4PHMA 1OSAA 1XFVO 2LLUA 1KK8B 5HYDA 1B1GA 3PSRA 3ZWHA 2SASA 5J3XA 1ODBA 1RROA 1A03A 1BR4B 4NDBA 2HQ8A 1G8IA 4DRWA 3CWGA 1G33A 3NSIA 3EKHA 1M31A 1SCMB 3PALA 1KFXS 1RTP1 4CPVA 1J7RA 4JQ0D 4ORCB 2ZN8A 2JXLA 2WOSA 1CFFA 2Y4QA 1UUSA 1YR5A 3O78A 4L9MA 2K7BA 3SG4A 1RECA 4DS7A 1XYDA 2GGMA 3CR5X 1XVJA 2Y5IA 1B47A 1LVCD 4GNKB 1NUBA 2K2FA 1Y0VH 3GK1A 1R6PA 1W7IB 2LP2A 3M0WA 1K9KA 4USLA 2F3YA 4NDCA 4WQ3A 1BU3A 2KNEA 3CGAA 1BR1B 1TIZA 2LVVA 3IF7A 2H61C 2NXQA 1N65A 1IKUA 4HSZA 1MWNA 1NWDA 1IH0A 1K93D 2PALA 3AAJA 2O5GA 4ORAB 1AK8A 2Y1MA 3C1VA 1S5GZ 1S6IA 5JOLA 1OMVA 2JNXA 4GUKA 1ZFSA 5HKZA 1YUUA 5AEQA 2EC6B 1CDMA 3KPXA 1WRLA 2LHLA 4BY5A 3NSKA 3HX4A 4PCWA 3PM8A 1SPYA 3RM1A 3PN7C 5CSJA 1FI5A 2LVJA 1D1OA 2L51A 1F8HA 2I94A 1TNQA 2BE4A 1UURA 2L4IA 2LUXA 2F2OA 3WHUB 4OR9B 1AP4A 1XFWO 2KGRA 1IQ3A 1FF1A 1FBVA 1S5GY 1CKKA 4YGDB 3OX5A 1Y6WA 2MBXA 4MBEA 1W7JB 2LMTA 4IL1A 3NXAA 2JC2A 1ZUZA 2LAPA 1IRJA 1WDCC 5DKNA 1KK8C 4PE7A 2M7NA 1NP8A 3VRRA 5CPVA 2M3WA 1GQMA 1K96A 2M0RA 1M63B 2CCMA 2BCAA 3A8RA 4YRUA 3D10A 2RGIA 2LHIA 1YX7A 2G9BA 3CR4X 4DUQA 1VRKA 3BQ3A 3LL8B 1R2UA 5HKYA 5CSNA 4CFRA 3IQQA 2ZKMX 4PE4A 5HKWA 2F2PA 5B8IB
chains in the Genus database with same CATH superfamily
1QVIZ 1Y1AA 3DF0A 3OBVA 1DJGA 2OS8B 2JWWA 1WLZA 1SW8A 3EK7A 5I2QA 2GGZA 4M2QA 1B4CA 2SCPA 1YRUB 4AQJA 1CB1A 2FJYA 4FQTA 4AQIA 4I5KA 1ALVA 4MZKA 1IG5A 1S6CA 1J7QA 2KYCA 2JTTA 4I5LB 5FI2A 1YURA 2LANA 2I2RE 1QX5B 3BFAA 2NZ0A 3EVUA 3PN7B 2ERBA 4MRYA 3SG6A 2K8MB 4XJKA 1UP5A 4WQ2A 3BYAA 2JQ6A 1Z2CB 1QVIY 2K7CA 3GOFA 1AHRA 1QX2A 2MAZA 2ZNEA 5D69A 1CLBA 1CNPA 2PSRA 4TNCA 1PALA 3F45A 1RWYA 1DVIA 1MUXA 3CZ1A 2WCJA 2BAPA 2EC6C 2E6WA 1PK0D 1XO5A 1SL8A 3NSLA 2L0PA 4N5XA 2F8PA 1ZOTB 4N1GA 3N7HA 1TNWA 2BBMA 2Q91A 1BMOA 3B7AA 5D7FA 4ZCUA 3S0AA 1UHNA 1KWOB 1GJYA 2JT8A 1K9PA 4PE1A 1LINA 1QIWA 2WNDA 2LP3A 1B8CA 3HCMA 1F4OA 3BOWA 1OMRA 5D3OA 2E30A 2P71A 3SS3A 5JJGA 2KFGA 2JOJA 1DJYA 3GK4X 3KO0A 4MSPA 2KQ6A 1OE9B 2ZRSA 4YGAA 1CMFA 1YVHA 3ICBA 4I5NB 4MZLA 4NQGA 4PHNA 1J1EA 4OCIA 4C0LA 5AERA 3TDIA 2Q4UA 1C3YA 4YGBB 2KQYA 2K7DA 2OPOA 2BECA 3VROA 2M49B 1ALWA 1QWVA 1RJVA 2BCXA 3BJHA 2FOTA 2K61A 2KI4B 2WC5A 1NSHA 2BL0B 2CBLA 5FYXA 2M97A 3JVTB 1OOIX 1TCFA 1NCZA 3KHEA 2JPTA 2KI6C 3TZ1A 2PMYA 1JFKA 2JXCA 4QJ3B 1C7WA 1YUTA 1LA3A 1QJTA 2OS8C 1PVBA 2KYFA 3RLZA 1QASA 2WCKA 2CTNA 1UHHA 3BUWB 1QIVA 4CLNA 1E8AA 4ORBB 1MF8B 2KLEA 1OOJA 1OOGA 4MN0A 3S0EA 2FCDA 1IJ5A 1TNXA 2WORA 1DJWA 3DF0B 1OZSA 5TNCA 2WCHA 2L4HA 3FE6A 1K90D 1YX8A 2I7AA 2LCPA 5ER4X 2KPHA 3I5FB 1MHOA 1K9UA 4YI9A 1U5IA 1CM4A 1W9ZA 1MR8A 3BUOB 4C0KA 5EL2A 1XK4A 4U8DA 3EG5B 1BT6A 1YTZC 2EHBA 1DMOA 1HQVA 1ORGA 2JULA 2AUCA 5CSIA 2CXJA 4MLWA 3TUYB 1UHJA 2KFHA 4R1EA 1KFXL 1IJ6A 1B7TZ 1NIWA 2FCEA 2L98A 2PRUA 1QX7A 3DXLA 3QMEA 5KU1A 4XJKB 4ICBA 2KOTA 3CZ0A 4DCKA 2NLNA 1P28A 3AKBA 4ETOA 1XA5A 5AFPA 2KFFA 3WNXB 1Z4HA 4FTGA 1J55A 3EKJA 1Y1UA 1AUIB 2M1UA 3I5GB 1CDPA 2P6BB 3BUMB 2HF5A 2LLSA 1KWOC 2WC8A 1DEKA 1KQVA 2M1KB 2PASA 1IQ5A 5HLOA 2QDIA 2LVKA 1NCXA 1X02A 3D75A 1DJHA 5ER5A 4PHJA 1G4YR 2L50A 3EVVA 3MSEB 1Q80A 1B7TY 2KBMA 3K1EA 2H8VA 2WCFA 2WC6A 1KSOA 4MZJA 1OW4A 3B6XA 3DYEA 2LMVA 4WRIA 1A4PA 4YBHB 5I94A 2K2AA 2KGBC 4XYNA 4A4BA 3OHMB 2B1UA 1EXRA 1KK7Z 2WCEA 3BOWB 2CNPA 1F54A 1F55A 1TRFA 1TNPA 3LK0A 1QLSA 5I2LA 4D1EA 3O2PA 3CLNA 4F0ZB 1ZACA 1NX0A 1KFUS 1N0YA 1SR6B 4GFTA 1B8LA 1XFZO 2G2BA 2QACA 1DT7B 1CM1A 1S3PA 3TDUA 4I5JA 4OVNF 3E3RA 2TN4A 1QS7A 5DKQA 4HRHA 3WHTB 4N1FA 4PHKA 3VRNA 2KI4C 2BL0C 1S26D 3D78A 1DF0A 3O4YA 1J7PA 1JFJA 3JVTC 3JTDB 4Q04A 1JF2A 1KCYA 1UHIA 2KHNA 3VRQA 3WXAA 3IQOA 4A4CA 5K89A 1MXEA 1KK7Y 1ZMZA 2F33A 5IBWA 5KSZA 2ZFDA 1BG1A 4HRGA 2LV7A 1SNLA 3TDZA 1QV0A 4YGEB 4BY4A 1M46A 1BLQA 4GGFA 3FE8A 3L4LA 3B87A 3R1VA 1GGWA 1S36A 1TCOB 1SY9A 2EGDA 1B8RA 5GQQC 1SL7A 1TTXA 1TWOA 2M7LA 1LA0A 3O6BA 3VB1A 1PSRA 2BCBA 1CDNA 1EH2A 3EK8A 3PFVA 1AJ4A 2MLEC 3SIAA 1QXPA 2KDHA 1TOPA 1IWQA 1H8BA 3I5FC 4MVFA 1SCVA 1LKJA 1WRKA 3FWCA 1DGUA 2KSPA 1DJXA 4M2PA 3CDNA 3TUYC 4UPGA 1U5IB 2LNKA 1DJIA 1M45A 1M39A 1AJ5A 5FI6A 1XFRA 3H4SE 4HREE 2M29A 3D0YA 4NDDA 1H4BA 1NX2A 1NYAA 1SYMA 3I5GC 1CFPA 5I2OA 1A2XA 2O60A 3OB1B 1KFUL 2BBNA 2BKHB 2CT9A 2QEOA 3SG3A 1C07A 3I5HB 1N2DA 2OTGB 3OB2B 2H61A 1EG4A 1L7ZA 1V1GA 4E68A 2L2CA 1SBJA 2VRGA 1QLKA 2K0JA 2ZRTA 2KAVA 1S1EA 2V53A 1DJZA 2HPSA 2WCBA 3EK4A 3VGOA 4MRXA 2I18A 3S0FA 1BODA 2LLTA 2KAXA 2ISDA 3R1OA 3CZ2A 4INWA 1YRTB 1KQMB 2JNFA 4PT1A 5KTYA 1J7OA 3A4UB 2JTZA 1DTLA 3TS5B 1L2OB 1SR6C 3PJIA 1F71A 3BXKA 4OKHA 4QJ4B 1NX3A 1YUSA 1OMDA 1KSMA 1QATA 1DGVA 5F6TA 3SG5A 3DVKA 3LLEA 3DVMA 3AKAA 5PALA 4JPZB 2JZIA 1A75A 1V1FA 1SSEB 3JTDC 4C0JA 2K60A 2HETA 2NCPA 3CR2A 3I5IC 1YVLA 2LUCA 3BUXB 3LCPC 1PSBA 3PLFB 4ZCVA 2AMIA 4YI8A 2BNXA 1DF0B 1EL4A 4JKTA 3SS4A 4QJ5B 3FIAA 1Y1XA 3BUNB 2QPTA 3OX6A 1LXFC 1SKTA 1FW4A 1QTXA 2COLB 3OP0A 5HLVA 4PE0A 4GGNA 4OZDA 3SG7A 4GPLB 4AOMA 3DVJA 3R1PA 1J1DA 2ZNDA 3VRPA 1XFXO 1OOFA 3EVRA 3V2LA 2L2EA 3AAKA 1A29A 2KBIA 4OV2A 5AXIA 3BFBA 1CFDA 1PULA 4MEWA 1MQ1A 1WY9A 2BKIB 3ZNIA 1FI6A 3RZSA 1C3ZA 2JT0A 1OZOA 1SK6D 1DQEA 5DKRA 3KF9A 2LM5A 2MA2A 2PQLA 2PVBA 2K7OA 3CABA 2MJWB 4JD9A 3Q8IA 1HT9A 3R72A 1K94A 1XFYO 1AVSA 1XK4C 2MHHA 3CZTX 1SL9A 4P5OE 3NHTA 1F4QA 2LMUA 3K21A 1NCYA 2FJUB 2JU0A 1T14A 2KAYA 1MXLC 1PVAA 3OGNA 2BE6A 1CTRA 1SRAA 2GV5A 2ZN9A 2MRDA 4GAOA 5CSFA 2M9GA 1CLLA 3D0YB 2LE9B 3IVTA 1CFCA 3I5HC 4DIRA 2M8UA 2OTGC 3NSOA 1WLMA 4CIDA 1JC2A 4PALA 3GK2A 2Y1NA 2P70A 2D8NA 3LK1A 2LC5A 5AANA 1SCMC 3DD4A 1K8UA 3CYZA 4P2YB 3SG2A 1IGVA 1FPWA 1JWDA 1JUOA 3DVEA 4FQOA 3I5IB 4F7FA 3CS1A 1JSAA 2GTEA 1KQMC 2A4JA 3CTNA 5I8NA 3NGVA 3SJSA 1JBAA 1BJFA 5BPJA 2YGUA 1EG3A 3FS7A 3TS5C 5G08A 1UWOA 1JF0A 1L2OC 1RFJA 2NCOA 4M2OA 1NPQA 3SIBA 3PATA 4INXA 3QRXA 4YGCB 2JT3A 1EJ3A 1OOHA 1SMGA 1S6JA 2KLDA 1GGZA 2R2IA 1B9AA 2AAOA 2H2KA 1PRWA 3FE9A 2KI6D 4KYNA 2L5YA 1BF5A 1QV1A 1K95A 2WCLA 4GBAA 1CDLA 4PDZA 1WRZA 2LVIA 1K2HA 1OQPA 2L5XB 1A75B 1NX1A 1CLMA 1C7VA 3S0BA 1BOCA 2HQWA 4CFQA 2JRFA 2IS9A 1F70A 1RK9A 1XFUO 3B88A 2MLFC 3FWBA 4JWQA 1CMGA 2DOQA 1UHKA 4GGFC 1TN4A 1WDCB 3KEVA 2F3ZA 4PHMA 1OSAA 1XFVO 2LLUA 1KK8B 3O4XA 5HYDA 1B1GA 3PSRA 3ZWHA 2SASA 5J3XA 1GM0A 1ODBA 1RROA 3DZTA 1A03A 1BR4B 4NDBA 2HQ8A 1G8IA 1TUZA 4DRWA 3CWGA 1G33A 3NSIA 3EKHA 1M31A 1SCMB 3PALA 1KFXS 1RTP1 4CPVA 1J7RA 4JQ0D 4ORCB 2ZN8A 2JXLA 2WOSA 3D77A 1CFFA 2Y4QA 1UUSA 1YR5A 3O78A 4L9MA 2K7BA 3SG4A 1RECA 4DS7A 1XYDA 2GGMA 3CR5X 1XVJA 2Y5IA 1B47A 1LVCD 5HL1A 4GNKB 1NUBA 2K2FA 2PYQA 1Y0VH 3GK1A 1R6PA 3L4AA 1W7IB 2LP2A 3M0WA 1K9KA 3D76A 4USLA 2F3YA 3UO9A 1TUJA 4NDCA 4WQ3A 1BU3A 5FI7A 2KNEA 3CGAA 1BR1B 1TIZA 2LVVA 3IF7A 2H61C 2NXQA 1N65A 1DELA 1IKUA 4HSZA 1MWNA 1NWDA 1IH0A 3SS5A 1K93D 2PALA 3AAJA 2O5GA 4ORAB 2JPOA 1AK8A 2Y1MA 3C1VA 1S5GZ 1S6IA 2QEVA 5JOLA 1OMVA 2JNXA 4GUKA 1ZFSA 4IJ7A 5HKZA 1YUUA 5AEQA 2EC6B 1CDMA 3KPXA 3D74A 1WRLA 2LHLA 4BY5A 3NSKA 3HX4A 4PCWA 3PM8A 1SPYA 3S0DA 3RM1A 3PN7C 5CSJA 1FI5A 2LVJA 1D1OA 2L51A 1F8HA 2I94A 1TNQA 2BE4A 1UURA 2L4IA 2LUXA 2QEHA 2F2OA 3B86A 3NHIA 4OR9B 3WHUB 1AP4A 1XFWO 2KGRA 5DICA 1IQ3A 2WCMA 1FF1A 1FBVA 1S5GY 1CKKA 4YGDB 3OX5A 1Y6WA 3L47A 2MBXA 4MBEA 1W7JB 2LMTA 3D73A 4IL1A 3NXAA 2JC2A 1DC1A 1ZUZA 1IIOA 2LAPA 3DY9A 1IRJA 1WDCC 5DKNA 1KK8C 4PE7A 3UNWA 2M7NA 1NP8A 3VRRA 5CPVA 1LS8A 2M3WA 1GQMA 1K96A 2M0RA 1M63B 2CCMA 2BCAA 3A8RA 4YRUA 3D10A 3PM2A 2RGIA 3S0GA 2LHIA 1YX7A 2G9BA 3CR4X 4DUQA 1VRKA 3BQ3A 3LL8B 3BFHA 1R2UA 5HKYA 5CSNA 4CFRA 3IQQA 2ZKMX 4PE4A 5HKWA 2QEBA 2F2PA 5B8IB
chains in the Genus database with same CATH topology
1QVIZ 1Y1AA 3DF0A 1DJGA 2OS8B 2JWWA 1WLZA 1SW8A 3EK7A 5I2QA 2GGZA 4M2QA 1B4CA 2SCPA 1YRUB 4AQJA 1CB1A 4AQIA 4I5KA 1ALVA 4MZKA 1IG5A 1S6CA 1J7QA 2KYCA 2JTTA 4I5LB 1YURA 2LANA 2I2RE 1QX5B 2NZ0A 3EVUA 3PN7B 4MRYA 3SG6A 2K8MB 4XJKA 1UP5A 4WQ2A 3BYAA 2JQ6A 3GOFA 1QVIY 2K7CA 1AHRA 1QX2A 2MAZA 2ZNEA 5D69A 1CLBA 1CNPA 2PSRA 4TNCA 1PALA 3F45A 1RWYA 1DVIA 1MUXA 2EC6C 2E6WA 1PK0D 1XO5A 1SL8A 3NSLA 2L0PA 4N5XA 2F8PA 1ZOTB 4N1GA 1TNWA 2BBMA 2Q91A 1BMOA 5D7FA 4ZCUA 1UHNA 1KWOB 1GJYA 2JT8A 1K9PA 4PE1A 1LINA 1QIWA 2WNDA 2LP3A 1B8CA 3HCMA 1F4OA 3BOWA 1OMRA 2E30A 5JJGA 2KFGA 2JOJA 1DJYA 3GK4X 3KO0A 4MSPA 2KQ6A 1OE9B 2ZRSA 4YGAA 1CMFA 1YVHA 3ICBA 4I5NB 4MZLA 4NQGA 4PHNA 1J1EA 4OCIA 4C0LA 5AERA 3TDIA 2Q4UA 4YGBB 2KQYA 2K7DA 2OPOA 2BECA 3VROA 2M49B 1ALWA 2BCXA 1RJVA 2FOTA 2K61A 2KI4B 1NSHA 2BL0B 2CBLA 5FYXA 2M97A 3JVTB 1TCFA 1NCZA 3KHEA 2JPTA 2KI6C 3TZ1A 2PMYA 1JFKA 2JXCA 4QJ3B 1C7WA 1YUTA 1LA3A 1QJTA 2OS8C 1PVBA 2KYFA 3RLZA 1QASA 2CTNA 1UHHA 3BUWB 1QIVA 4CLNA 1E8AA 4ORBB 1MF8B 1OOJA 4MN0A 2FCDA 1IJ5A 1TNXA 2WORA 1DJWA 3DF0B 1OZSA 5TNCA 2L4HA 1K90D 1YX8A 2I7AA 2LCPA 5ER4X 3I5FB 1MHOA 1K9UA 4YI9A 1U5IA 1CM4A 1MR8A 3BUOB 4C0KA 1XK4A 4U8DA 1BT6A 1YTZC 2EHBA 1DMOA 1HQVA 2JULA 5CSIA 2AUCA 3TUYB 2CXJA 4MLWA 1UHJA 2KFHA 4R1EA 1KFXL 1IJ6A 1B7TZ 1NIWA 2FCEA 2L98A 2PRUA 1QX7A 5KU1A 4XJKB 4ICBA 2KOTA 4DCKA 2NLNA 3AKBA 4ETOA 5AFPA 1XA5A 2KFFA 3WNXB 4FTGA 1J55A 3EKJA 1Y1UA 1AUIB 2M1UA 3I5GB 1CDPA 2P6BB 3BUMB 2HF5A 2LLSA 1KWOC 2WC8A 1KQVA 2M1KB 2PASA 1IQ5A 5HLOA 2LVKA 1NCXA 1X02A 1DJHA 5ER5A 4PHJA 1G4YR 2L50A 3EVVA 3MSEB 1Q80A 1B7TY 2KBMA 2WCFA 1JSAA 1KSOA 4MZJA 4WRIA 2LMVA 4YBHB 1A4PA 2K2AA 2KGBC 4XYNA 4A4BA 3OHMB 2B1UA 1EXRA 1KK7Z 2WCEA 3BOWB 2CNPA 1F54A 1F55A 1TRFA 1TNPA 3LK0A 1QLSA 5I2LA 4D1EA 3O2PA 3CLNA 4F0ZB 1ZACA 1NX0A 1KFUS 1N0YA 1SR6B 4GFTA 1B8LA 1XFZO 2G2BA 2QACA 1DT7B 1CM1A 1S3PA 3TDUA 4I5JA 4OVNF 3E3RA 2TN4A 1QS7A 5DKQA 4HRHA 3WHTB 4N1FA 4PHKA 3VRNA 2KI4C 2BL0C 1S26D 3O4YA 1DF0A 1J7PA 1JFJA 3JVTC 3JTDB 4Q04A 1JF2A 1KCYA 1UHIA 2KHNA 3VRQA 3WXAA 3IQOA 4A4CA 5K89A 1MXEA 1KK7Y 1ZMZA 2F33A 5IBWA 5KSZA 2ZFDA 1BG1A 4HRGA 2LV7A 1SNLA 3TDZA 1QV0A 4YGEB 4BY4A 1M46A 1BLQA 4GGFA 1GGWA 1S36A 1TCOB 1SY9A 2EGDA 1B8RA 5GQQC 1SL7A 1TTXA 2M7LA 1LA0A 3O6BA 1PSRA 2BCBA 1CDNA 1EH2A 3EK8A 3PFVA 1AJ4A 2MLEC 3SIAA 1QXPA 2KDHA 1TOPA 1IWQA 1H8BA 3I5FC 4MVFA 1SCVA 1LKJA 1WRKA 3FWCA 1DGUA 2KSPA 1DJXA 4M2PA 3TUYC 4UPGA 1U5IB 2LNKA 1DJIA 1M45A 1M39A 1AJ5A 3H4SE 4HREE 2M29A 3D0YA 4NDDA 1H4BA 1NX2A 1NYAA 1SYMA 3I5GC 1CFPA 5I2OA 1A2XA 2O60A 3OB1B 1KFUL 2BBNA 2BKHB 2CT9A 1C07A 3SG3A 3I5HB 1N2DA 2OTGB 3OB2B 2H61A 1EG4A 1L7ZA 1V1GA 4E68A 1SBJA 2VRGA 1QLKA 2K0JA 2ZRTA 2KAVA 1S1EA 2V53A 1DJZA 2HPSA 2WCBA 3EK4A 3VGOA 4MRXA 2I18A 1BODA 2LLTA 2KAXA 2ISDA 1YRTB 1KQMB 2JNFA 5KTYA 1J7OA 3A4UB 2JTZA 1DTLA 3TS5B 1L2OB 1SR6C 1F71A 3BXKA 4OKHA 4QJ4B 1NX3A 1YUSA 1OMDA 1KSMA 1QATA 1DGVA 5F6TA 3SG5A 3DVKA 3LLEA 3DVMA 3AKAA 5PALA 4JPZB 2JZIA 1A75A 1V1FA 3JTDC 4C0JA 2HETA 2NCPA 3CR2A 3I5IC 1YVLA 2LUCA 3BUXB 3LCPC 1PSBA 3PLFB 4ZCVA 2AMIA 4YI8A 1DF0B 1EL4A 4QJ5B 3FIAA 1Y1XA 3BUNB 2QPTA 3OX6A 1LXFC 1SKTA 1FW4A 1QTXA 2COLB 3OP0A 5HLVA 4PE0A 4GGNA 3SG7A 4AOMA 4GPLB 3DVJA 1J1DA 2ZNDA 3VRPA 1XFXO 3EVRA 2L2EA 3AAKA 1A29A 2KBIA 4OV2A 5AXIA 1CFDA 1PULA 4MEWA 1MQ1A 1WY9A 2BKIB 3ZNIA 1FI6A 2JT0A 1OZOA 1SK6D 5DKRA 3KF9A 2LM5A 2MA2A 2PVBA 2K7OA 2MJWB 1HT9A 1K94A 1XFYO 1AVSA 1XK4C 2MHHA 3CZTX 1SL9A 4P5OE 1F4QA 2LMUA 3K21A 1NCYA 2FJUB 2JU0A 2KAYA 1MXLC 1PVAA 2BE6A 1CTRA 1SRAA 2GV5A 2ZN9A 2MRDA 4GAOA 5CSFA 2M9GA 1CLLA 3D0YB 2LE9B 1CFCA 3I5HC 4DIRA 2M8UA 2OTGC 3NSOA 1WLMA 4CIDA 1JC2A 4PALA 3GK2A 2Y1NA 2D8NA 3LK1A 2LC5A 5AANA 1SCMC 3DD4A 1K8UA 4P2YB 3SG2A 1IGVA 1FPWA 1JWDA 1JUOA 3DVEA 4FQOA 3I5IB 3CS1A 3CTNA 1KQMC 2A4JA 5I8NA 1JBAA 3SJSA 1BJFA 5BPJA 1EG3A 3FS7A 3TS5C 5G08A 1UWOA 1JF0A 1L2OC 1RFJA 2NCOA 4M2OA 1NPQA 3SIBA 3PATA 3QRXA 4YGCB 2JT3A 1EJ3A 1SMGA 1S6JA 1GGZA 2R2IA 1B9AA 2AAOA 2H2KA 1PRWA 2KI6D 1BF5A 1QV1A 1K95A 4GBAA 1K2HA 1CDLA 4PDZA 1WRZA 2LVIA 1OQPA 2L5XB 1A75B 1NX1A 1CLMA 1C7VA 1BOCA 2HQWA 4CFQA 2JRFA 2IS9A 1F70A 1RK9A 1XFUO 2MLFC 3FWBA 4JWQA 1CMGA 2DOQA 1UHKA 4GGFC 1TN4A 1WDCB 3KEVA 2F3ZA 4PHMA 1OSAA 1XFVO 2LLUA 1KK8B 5HYDA 1B1GA 3PSRA 3ZWHA 2SASA 5J3XA 1ODBA 1RROA 1A03A 1BR4B 4NDBA 2HQ8A 1G8IA 4DRWA 3CWGA 1G33A 3NSIA 3EKHA 1M31A 1SCMB 3PALA 1KFXS 1RTP1 4CPVA 1J7RA 4JQ0D 4ORCB 2ZN8A 2JXLA 2WOSA 1CFFA 2Y4QA 1UUSA 1YR5A 3O78A 4L9MA 2K7BA 3SG4A 1RECA 4DS7A 1XYDA 2GGMA 3CR5X 1XVJA 2Y5IA 1B47A 1LVCD 4GNKB 1NUBA 2K2FA 1Y0VH 3GK1A 1R6PA 1W7IB 2LP2A 3M0WA 1K9KA 4USLA 2F3YA 4NDCA 4WQ3A 1BU3A 2KNEA 3CGAA 1BR1B 1TIZA 2LVVA 3IF7A 2H61C 2NXQA 1N65A 1IKUA 4HSZA 1MWNA 1NWDA 1IH0A 1K93D 2PALA 3AAJA 2O5GA 4ORAB 1AK8A 2Y1MA 3C1VA 1S5GZ 1S6IA 5JOLA 1OMVA 2JNXA 4GUKA 1ZFSA 5HKZA 1YUUA 5AEQA 2EC6B 1CDMA 3KPXA 1WRLA 2LHLA 4BY5A 3NSKA 3HX4A 4PCWA 3PM8A 1SPYA 3RM1A 3PN7C 5CSJA 1FI5A 2LVJA 1D1OA 2L51A 1F8HA 2I94A 1TNQA 2BE4A 1UURA 2L4IA 2LUXA 2F2OA 3WHUB 4OR9B 1AP4A 1XFWO 2KGRA 1IQ3A 1FF1A 1FBVA 1S5GY 1CKKA 4YGDB 3OX5A 1Y6WA 2MBXA 4MBEA 1W7JB 2LMTA 4IL1A 3NXAA 2JC2A 1ZUZA 2LAPA 1IRJA 1WDCC 5DKNA 1KK8C 4PE7A 2M7NA 1NP8A 3VRRA 5CPVA 2M3WA 1GQMA 1K96A 2M0RA 1M63B 2CCMA 2BCAA 3A8RA 4YRUA 3D10A 2RGIA 2LHIA 1YX7A 2G9BA 3CR4X 4DUQA 1VRKA 3BQ3A 3LL8B 1R2UA 5HKYA 5CSNA 4CFRA 3IQQA 2ZKMX 4PE4A 5HKWA 2F2PA 5B8IB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVI Z;  1Y1A A;  3DF0 A;  1DJG A;  2OS8 B;  2JWW A;  1WLZ A;  1SW8 A;  3EK7 A;  5I2Q A;  2GGZ A;  4M2Q A;  1B4C A;  2SCP A;  1YRU B;  4AQJ A;  1CB1 A;  4AQI A;  4I5K A;  1ALV A;  4MZK A;  1IG5 A;  1S6C A;  1J7Q A;  2KYC A;  2JTT A;  4I5L B;  1YUR A;  2LAN A;  2I2R E;  1QX5 B;  2NZ0 A;  3EVU A;  3PN7 B;  4MRY A;  3SG6 A;  2K8M B;  4XJK A;  1UP5 A;  4WQ2 A;  3BYA A;  2JQ6 A;  3GOF A;  1QVI Y;  2K7C A;  1AHR A;  1QX2 A;  2MAZ A;  2ZNE A;  5D69 A;  1CLB A;  1CNP A;  2PSR A;  4TNC A;  1PAL A;  3F45 A;  1RWY A;  1DVI A;  1MUX A;  2EC6 C;  2E6W A;  1PK0 D;  1XO5 A;  1SL8 A;  3NSL A;  2L0P A;  4N5X A;  2F8P A;  1ZOT B;  4N1G A;  1TNW A;  2BBM A;  2Q91 A;  1BMO A;  5D7F A;  4ZCU A;  1UHN A;  1KWO B;  1GJY A;  2JT8 A;  1K9P A;  4PE1 A;  1LIN A;  1QIW A;  2WND A;  2LP3 A;  1B8C A;  3HCM A;  1F4O A;  3BOW A;  1OMR A;  2E30 A;  5JJG A;  2KFG A;  2JOJ A;  1DJY A;  3GK4 X;  3KO0 A;  4MSP A;  2KQ6 A;  1OE9 B;  2ZRS A;  4YGA A;  1CMF A;  1YVH A;  3ICB A;  4I5N B;  4MZL A;  4NQG A;  4PHN A;  1J1E A;  4OCI A;  4C0L A;  5AER A;  3TDI A;  2Q4U A;  4YGB B;  2KQY A;  2K7D A;  2OPO A;  2BEC A;  3VRO A;  2M49 B;  1ALW A;  2BCX A;  1RJV A;  2FOT A;  2K61 A;  2KI4 B;  1NSH A;  2BL0 B;  2CBL A;  5FYX A;  2M97 A;  3JVT B;  1TCF A;  1NCZ A;  3KHE A;  2JPT A;  2KI6 C;  3TZ1 A;  2PMY A;  1JFK A;  2JXC A;  4QJ3 B;  1C7W A;  1YUT A;  1LA3 A;  1QJT A;  2OS8 C;  1PVB A;  2KYF A;  3RLZ A;  1QAS A;  2CTN A;  1UHH A;  3BUW B;  1QIV A;  4CLN A;  1E8A A;  4ORB B;  1MF8 B;  1OOJ A;  4MN0 A;  2FCD A;  1IJ5 A;  1TNX A;  2WOR A;  1DJW A;  3DF0 B;  1OZS A;  5TNC A;  2L4H A;  1K90 D;  1YX8 A;  2I7A A;  2LCP A;  5ER4 X;  3I5F B;  1MHO A;  1K9U A;  4YI9 A;  1U5I A;  1CM4 A;  1MR8 A;  3BUO B;  4C0K A;  1XK4 A;  4U8D A;  1BT6 A;  1YTZ C;  2EHB A;  1DMO A;  1HQV A;  2JUL A;  5CSI A;  2AUC A;  3TUY B;  2CXJ A;  4MLW A;  1UHJ A;  2KFH A;  4R1E A;  1KFX L;  1IJ6 A;  1B7T Z;  1NIW A;  2FCE A;  2L98 A;  2PRU A;  1QX7 A;  5KU1 A;  4XJK B;  4ICB A;  2KOT A;  4DCK A;  2NLN A;  3AKB A;  4ETO A;  5AFP A;  1XA5 A;  2KFF A;  3WNX B;  4FTG A;  1J55 A;  3EKJ A;  1Y1U A;  1AUI B;  2M1U A;  3I5G B;  1CDP A;  2P6B B;  3BUM B;  2HF5 A;  2LLS A;  1KWO C;  2WC8 A;  1KQV A;  2M1K B;  2PAS A;  1IQ5 A;  5HLO A;  2LVK A;  1NCX A;  1X02 A;  1DJH A;  5ER5 A;  4PHJ A;  1G4Y R;  2L50 A;  3EVV A;  3MSE B;  1Q80 A;  1B7T Y;  2KBM A;  2WCF A;  1JSA A;  1KSO A;  4MZJ A;  4WRI A;  2LMV A;  4YBH B;  1A4P A;  2K2A A;  2KGB C;  4XYN A;  4A4B A;  3OHM B;  2B1U A;  1EXR A;  1KK7 Z;  2WCE A;  3BOW B;  2CNP A;  1F54 A;  1F55 A;  1TRF A;  1TNP A;  3LK0 A;  1QLS A;  5I2L A;  4D1E A;  3O2P A;  3CLN A;  4F0Z B;  1ZAC A;  1NX0 A;  1KFU S;  1N0Y A;  1SR6 B;  4GFT A;  1B8L A;  1XFZ O;  2G2B A;  2QAC A;  1DT7 B;  1CM1 A;  1S3P A;  3TDU A;  4I5J A;  4OVN F;  3E3R A;  2TN4 A;  1QS7 A;  5DKQ A;  4HRH A;  3WHT B;  4N1F A;  4PHK A;  3VRN A;  2KI4 C;  2BL0 C;  1S26 D;  3O4Y A;  1DF0 A;  1J7P A;  1JFJ A;  3JVT C;  3JTD B;  4Q04 A;  1JF2 A;  1KCY A;  1UHI A;  2KHN A;  3VRQ A;  3WXA A;  3IQO A;  4A4C A;  5K89 A;  1MXE A;  1KK7 Y;  1ZMZ A;  2F33 A;  5IBW A;  5KSZ A;  2ZFD A;  1BG1 A;  4HRG A;  2LV7 A;  1SNL A;  3TDZ A;  1QV0 A;  4YGE B;  4BY4 A;  1M46 A;  1BLQ A;  4GGF A;  1GGW A;  1S36 A;  1TCO B;  1SY9 A;  2EGD A;  1B8R A;  5GQQ C;  1SL7 A;  1TTX A;  2M7L A;  1LA0 A;  3O6B A;  1PSR A;  2BCB A;  1CDN A;  1EH2 A;  3EK8 A;  3PFV A;  1AJ4 A;  2MLE C;  3SIA A;  1QXP A;  2KDH A;  1TOP A;  1IWQ A;  1H8B A;  3I5F C;  4MVF A;  1SCV A;  1LKJ A;  1WRK A;  3FWC A;  1DGU A;  2KSP A;  1DJX A;  4M2P A;  3TUY C;  4UPG A;  1U5I B;  2LNK A;  1DJI A;  1M45 A;  1M39 A;  1AJ5 A;  3H4S E;  4HRE E;  2M29 A;  3D0Y A;  4NDD A;  1H4B A;  1NX2 A;  1NYA A;  1SYM A;  3I5G C;  1CFP A;  5I2O A;  1A2X A;  2O60 A;  3OB1 B;  1KFU L;  2BBN A;  2BKH B;  2CT9 A;  1C07 A;  3SG3 A;  3I5H B;  1N2D A;  2OTG B;  3OB2 B;  2H61 A;  1EG4 A;  1L7Z A;  1V1G A;  4E68 A;  1SBJ A;  2VRG A;  1QLK A;  2K0J A;  2ZRT A;  2KAV A;  1S1E A;  2V53 A;  1DJZ A;  2HPS A;  2WCB A;  3EK4 A;  3VGO A;  4MRX A;  2I18 A;  1BOD A;  2LLT A;  2KAX A;  2ISD A;  1YRT B;  1KQM B;  2JNF A;  5KTY A;  1J7O A;  3A4U B;  2JTZ A;  1DTL A;  3TS5 B;  1L2O B;  1SR6 C;  1F71 A;  3BXK A;  4OKH A;  4QJ4 B;  1NX3 A;  1YUS A;  1OMD A;  1KSM A;  1QAT A;  1DGV A;  5F6T A;  3SG5 A;  3DVK A;  3LLE A;  3DVM A;  3AKA A;  5PAL A;  4JPZ B;  2JZI A;  1A75 A;  1V1F A;  3JTD C;  4C0J A;  2HET A;  2NCP A;  3CR2 A;  3I5I C;  1YVL A;  2LUC A;  3BUX B;  3LCP C;  1PSB A;  3PLF B;  4ZCV A;  2AMI A;  4YI8 A;  1DF0 B;  1EL4 A;  4QJ5 B;  3FIA A;  1Y1X A;  3BUN B;  2QPT A;  3OX6 A;  1LXF C;  1SKT A;  1FW4 A;  1QTX A;  2COL B;  3OP0 A;  5HLV A;  4PE0 A;  4GGN A;  3SG7 A;  4AOM A;  4GPL B;  3DVJ A;  1J1D A;  2ZND A;  3VRP A;  1XFX O;  3EVR A;  2L2E A;  3AAK A;  1A29 A;  2KBI A;  4OV2 A;  5AXI A;  1CFD A;  1PUL A;  4MEW A;  1MQ1 A;  1WY9 A;  2BKI B;  3ZNI A;  1FI6 A;  2JT0 A;  1OZO A;  1SK6 D;  5DKR A;  3KF9 A;  2LM5 A;  2MA2 A;  2PVB A;  2K7O A;  2MJW B;  1HT9 A;  1K94 A;  1XFY O;  1AVS A;  1XK4 C;  2MHH A;  3CZT X;  1SL9 A;  4P5O E;  1F4Q A;  2LMU A;  3K21 A;  1NCY A;  2FJU B;  2JU0 A;  2KAY A;  1MXL C;  1PVA A;  2BE6 A;  1CTR A;  1SRA A;  2GV5 A;  2ZN9 A;  2MRD A;  4GAO A;  5CSF A;  2M9G A;  1CLL A;  3D0Y B;  2LE9 B;  1CFC A;  3I5H C;  4DIR A;  2M8U A;  2OTG C;  3NSO A;  1WLM A;  4CID A;  1JC2 A;  4PAL A;  3GK2 A;  2Y1N A;  2D8N A;  3LK1 A;  2LC5 A;  5AAN A;  1SCM C;  3DD4 A;  1K8U A;  4P2Y B;  3SG2 A;  1IGV A;  1FPW A;  1JWD A;  1JUO A;  3DVE A;  4FQO A;  3I5I B;  3CS1 A;  3CTN A;  1KQM C;  2A4J A;  5I8N A;  1JBA A;  3SJS A;  1BJF A;  5BPJ A;  1EG3 A;  3FS7 A;  3TS5 C;  5G08 A;  1UWO A;  1JF0 A;  1L2O C;  1RFJ A;  2NCO A;  4M2O A;  1NPQ A;  3SIB A;  3PAT A;  3QRX A;  4YGC B;  2JT3 A;  1EJ3 A;  1SMG A;  1S6J A;  1GGZ A;  2R2I A;  1B9A A;  2AAO A;  2H2K A;  1PRW A;  2KI6 D;  1BF5 A;  1QV1 A;  1K95 A;  4GBA A;  1K2H A;  1CDL A;  4PDZ A;  1WRZ A;  2LVI A;  1OQP A;  2L5X B;  1A75 B;  1NX1 A;  1CLM A;  1C7V A;  1BOC A;  2HQW A;  4CFQ A;  2JRF A;  2IS9 A;  1F70 A;  1RK9 A;  1XFU O;  2MLF C;  3FWB A;  4JWQ A;  1CMG A;  2DOQ A;  1UHK A;  4GGF C;  1TN4 A;  1WDC B;  3KEV A;  2F3Z A;  4PHM A;  1OSA A;  1XFV O;  2LLU A;  1KK8 B;  5HYD A;  1B1G A;  3PSR A;  3ZWH A;  2SAS A;  5J3X A;  1ODB A;  1RRO A;  1A03 A;  1BR4 B;  4NDB A;  2HQ8 A;  1G8I A;  4DRW A;  3CWG A;  1G33 A;  3NSI A;  3EKH A;  1M31 A;  1SCM B;  3PAL A;  1KFX S;  1RTP 1;  4CPV A;  1J7R A;  4JQ0 D;  4ORC B;  2ZN8 A;  2JXL A;  2WOS A;  1CFF A;  2Y4Q A;  1UUS A;  1YR5 A;  3O78 A;  4L9M A;  2K7B A;  3SG4 A;  1REC A;  4DS7 A;  1XYD A;  2GGM A;  3CR5 X;  1XVJ A;  2Y5I A;  1B47 A;  1LVC D;  4GNK B;  1NUB A;  2K2F A;  1Y0V H;  3GK1 A;  1R6P A;  1W7I B;  2LP2 A;  3M0W A;  1K9K A;  4USL A;  2F3Y A;  4NDC A;  4WQ3 A;  1BU3 A;  2KNE A;  3CGA A;  1BR1 B;  1TIZ A;  2LVV A;  3IF7 A;  2H61 C;  2NXQ A;  1N65 A;  1IKU A;  4HSZ A;  1MWN A;  1NWD A;  1IH0 A;  1K93 D;  2PAL A;  3AAJ A;  2O5G A;  4ORA B;  1AK8 A;  2Y1M A;  3C1V A;  1S5G Z;  1S6I A;  5JOL A;  1OMV A;  2JNX A;  4GUK A;  1ZFS A;  5HKZ A;  1YUU A;  5AEQ A;  2EC6 B;  1CDM A;  3KPX A;  1WRL A;  2LHL A;  4BY5 A;  3NSK A;  3HX4 A;  4PCW A;  3PM8 A;  1SPY A;  3RM1 A;  3PN7 C;  5CSJ A;  1FI5 A;  2LVJ A;  1D1O A;  2L51 A;  1F8H A;  2I94 A;  1TNQ A;  2BE4 A;  1UUR A;  2L4I A;  2LUX A;  2F2O A;  3WHU B;  4OR9 B;  1AP4 A;  1XFW O;  2KGR A;  1IQ3 A;  1FF1 A;  1FBV A;  1S5G Y;  1CKK A;  4YGD B;  3OX5 A;  1Y6W A;  2MBX A;  4MBE A;  1W7J B;  2LMT A;  4IL1 A;  3NXA A;  2JC2 A;  1ZUZ A;  2LAP A;  1IRJ A;  1WDC C;  5DKN A;  1KK8 C;  4PE7 A;  2M7N A;  1NP8 A;  3VRR A;  5CPV A;  2M3W A;  1GQM A;  1K96 A;  2M0R A;  1M63 B;  2CCM A;  2BCA A;  3A8R A;  4YRU A;  3D10 A;  2RGI A;  2LHI A;  1YX7 A;  2G9B A;  3CR4 X;  4DUQ A;  1VRK A;  3BQ3 A;  3LL8 B;  1R2U A;  5HKY A;  5CSN A;  4CFR A;  3IQQ A;  2ZKM X;  4PE4 A;  5HKW A;  2F2P A;  5B8I B; 
#chains in the Genus database with same CATH topology
 1QVI Z;  1Y1A A;  3DF0 A;  3OBV A;  1DJG A;  2OS8 B;  2JWW A;  1WLZ A;  1SW8 A;  3EK7 A;  5I2Q A;  2GGZ A;  4M2Q A;  1B4C A;  2SCP A;  1YRU B;  4AQJ A;  1CB1 A;  2FJY A;  4FQT A;  4AQI A;  4I5K A;  1ALV A;  4MZK A;  1IG5 A;  1S6C A;  1J7Q A;  2KYC A;  2JTT A;  4I5L B;  5FI2 A;  1YUR A;  2LAN A;  2I2R E;  1QX5 B;  3BFA A;  2NZ0 A;  3EVU A;  3PN7 B;  2ERB A;  4MRY A;  3SG6 A;  2K8M B;  4XJK A;  1UP5 A;  4WQ2 A;  3BYA A;  2JQ6 A;  1Z2C B;  1QVI Y;  2K7C A;  3GOF A;  1AHR A;  1QX2 A;  2MAZ A;  2ZNE A;  5D69 A;  1CLB A;  1CNP A;  2PSR A;  4TNC A;  1PAL A;  3F45 A;  1RWY A;  1DVI A;  1MUX A;  3CZ1 A;  2WCJ A;  2BAP A;  2EC6 C;  2E6W A;  1PK0 D;  1XO5 A;  1SL8 A;  3NSL A;  2L0P A;  4N5X A;  2F8P A;  1ZOT B;  4N1G A;  3N7H A;  1TNW A;  2BBM A;  2Q91 A;  1BMO A;  3B7A A;  5D7F A;  4ZCU A;  3S0A A;  1UHN A;  1KWO B;  1GJY A;  2JT8 A;  1K9P A;  4PE1 A;  1LIN A;  1QIW A;  2WND A;  2LP3 A;  1B8C A;  3HCM A;  1F4O A;  3BOW A;  1OMR A;  5D3O A;  2E30 A;  2P71 A;  3SS3 A;  5JJG A;  2KFG A;  2JOJ A;  1DJY A;  3GK4 X;  3KO0 A;  4MSP A;  2KQ6 A;  1OE9 B;  2ZRS A;  4YGA A;  1CMF A;  1YVH A;  3ICB A;  4I5N B;  4MZL A;  4NQG A;  4PHN A;  1J1E A;  4OCI A;  4C0L A;  5AER A;  3TDI A;  2Q4U A;  1C3Y A;  4YGB B;  2KQY A;  2K7D A;  2OPO A;  2BEC A;  3VRO A;  2M49 B;  1ALW A;  1QWV A;  1RJV A;  2BCX A;  3BJH A;  2FOT A;  2K61 A;  2KI4 B;  2WC5 A;  1NSH A;  2BL0 B;  2CBL A;  5FYX A;  2M97 A;  3JVT B;  1OOI X;  1TCF A;  1NCZ A;  3KHE A;  2JPT A;  2KI6 C;  3TZ1 A;  2PMY A;  1JFK A;  2JXC A;  4QJ3 B;  1C7W A;  1YUT A;  1LA3 A;  1QJT A;  2OS8 C;  1PVB A;  2KYF A;  3RLZ A;  1QAS A;  2WCK A;  2CTN A;  1UHH A;  3BUW B;  1QIV A;  4CLN A;  1E8A A;  4ORB B;  1MF8 B;  2KLE A;  1OOJ A;  1OOG A;  4MN0 A;  3S0E A;  2FCD A;  1IJ5 A;  1TNX A;  2WOR A;  1DJW A;  3DF0 B;  1OZS A;  5TNC A;  2WCH A;  2L4H A;  3FE6 A;  1K90 D;  1YX8 A;  2I7A A;  2LCP A;  5ER4 X;  2KPH A;  3I5F B;  1MHO A;  1K9U A;  4YI9 A;  1U5I A;  1CM4 A;  1W9Z A;  1MR8 A;  3BUO B;  4C0K A;  5EL2 A;  1XK4 A;  4U8D A;  3EG5 B;  1BT6 A;  1YTZ C;  2EHB A;  1DMO A;  1HQV A;  1ORG A;  2JUL A;  2AUC A;  5CSI A;  2CXJ A;  4MLW A;  3TUY B;  1UHJ A;  2KFH A;  4R1E A;  1KFX L;  1IJ6 A;  1B7T Z;  1NIW A;  2FCE A;  2L98 A;  2PRU A;  1QX7 A;  3DXL A;  3QME A;  5KU1 A;  4XJK B;  4ICB A;  2KOT A;  3CZ0 A;  4DCK A;  2NLN A;  1P28 A;  3AKB A;  4ETO A;  1XA5 A;  5AFP A;  2KFF A;  3WNX B;  1Z4H A;  4FTG A;  1J55 A;  3EKJ A;  1Y1U A;  1AUI B;  2M1U A;  3I5G B;  1CDP A;  2P6B B;  3BUM B;  2HF5 A;  2LLS A;  1KWO C;  2WC8 A;  1DEK A;  1KQV A;  2M1K B;  2PAS A;  1IQ5 A;  5HLO A;  2QDI A;  2LVK A;  1NCX A;  1X02 A;  3D75 A;  1DJH A;  5ER5 A;  4PHJ A;  1G4Y R;  2L50 A;  3EVV A;  3MSE B;  1Q80 A;  1B7T Y;  2KBM A;  3K1E A;  2H8V A;  2WCF A;  2WC6 A;  1KSO A;  4MZJ A;  1OW4 A;  3B6X A;  3DYE A;  2LMV A;  4WRI A;  1A4P A;  4YBH B;  5I94 A;  2K2A A;  2KGB C;  4XYN A;  4A4B A;  3OHM B;  2B1U A;  1EXR A;  1KK7 Z;  2WCE A;  3BOW B;  2CNP A;  1F54 A;  1F55 A;  1TRF A;  1TNP A;  3LK0 A;  1QLS A;  5I2L A;  4D1E A;  3O2P A;  3CLN A;  4F0Z B;  1ZAC A;  1NX0 A;  1KFU S;  1N0Y A;  1SR6 B;  4GFT A;  1B8L A;  1XFZ O;  2G2B A;  2QAC A;  1DT7 B;  1CM1 A;  1S3P A;  3TDU A;  4I5J A;  4OVN F;  3E3R A;  2TN4 A;  1QS7 A;  5DKQ A;  4HRH A;  3WHT B;  4N1F A;  4PHK A;  3VRN A;  2KI4 C;  2BL0 C;  1S26 D;  3D78 A;  1DF0 A;  3O4Y A;  1J7P A;  1JFJ A;  3JVT C;  3JTD B;  4Q04 A;  1JF2 A;  1KCY A;  1UHI A;  2KHN A;  3VRQ A;  3WXA A;  3IQO A;  4A4C A;  5K89 A;  1MXE A;  1KK7 Y;  1ZMZ A;  2F33 A;  5IBW A;  5KSZ A;  2ZFD A;  1BG1 A;  4HRG A;  2LV7 A;  1SNL A;  3TDZ A;  1QV0 A;  4YGE B;  4BY4 A;  1M46 A;  1BLQ A;  4GGF A;  3FE8 A;  3L4L A;  3B87 A;  3R1V A;  1GGW A;  1S36 A;  1TCO B;  1SY9 A;  2EGD A;  1B8R A;  5GQQ C;  1SL7 A;  1TTX A;  1TWO A;  2M7L A;  1LA0 A;  3O6B A;  3VB1 A;  1PSR A;  2BCB A;  1CDN A;  1EH2 A;  3EK8 A;  3PFV A;  1AJ4 A;  2MLE C;  3SIA A;  1QXP A;  2KDH A;  1TOP A;  1IWQ A;  1H8B A;  3I5F C;  4MVF A;  1SCV A;  1LKJ A;  1WRK A;  3FWC A;  1DGU A;  2KSP A;  1DJX A;  4M2P A;  3CDN A;  3TUY C;  4UPG A;  1U5I B;  2LNK A;  1DJI A;  1M45 A;  1M39 A;  1AJ5 A;  5FI6 A;  1XFR A;  3H4S E;  4HRE E;  2M29 A;  3D0Y A;  4NDD A;  1H4B A;  1NX2 A;  1NYA A;  1SYM A;  3I5G C;  1CFP A;  5I2O A;  1A2X A;  2O60 A;  3OB1 B;  1KFU L;  2BBN A;  2BKH B;  2CT9 A;  2QEO A;  3SG3 A;  1C07 A;  3I5H B;  1N2D A;  2OTG B;  3OB2 B;  2H61 A;  1EG4 A;  1L7Z A;  1V1G A;  4E68 A;  2L2C A;  1SBJ A;  2VRG A;  1QLK A;  2K0J A;  2ZRT A;  2KAV A;  1S1E A;  2V53 A;  1DJZ A;  2HPS A;  2WCB A;  3EK4 A;  3VGO A;  4MRX A;  2I18 A;  3S0F A;  1BOD A;  2LLT A;  2KAX A;  2ISD A;  3R1O A;  3CZ2 A;  4INW A;  1YRT B;  1KQM B;  2JNF A;  4PT1 A;  5KTY A;  1J7O A;  3A4U B;  2JTZ A;  1DTL A;  3TS5 B;  1L2O B;  1SR6 C;  3PJI A;  1F71 A;  3BXK A;  4OKH A;  4QJ4 B;  1NX3 A;  1YUS A;  1OMD A;  1KSM A;  1QAT A;  1DGV A;  5F6T A;  3SG5 A;  3DVK A;  3LLE A;  3DVM A;  3AKA A;  5PAL A;  4JPZ B;  2JZI A;  1A75 A;  1V1F A;  1SSE B;  3JTD C;  4C0J A;  2K60 A;  2HET A;  2NCP A;  3CR2 A;  3I5I C;  1YVL A;  2LUC A;  3BUX B;  3LCP C;  1PSB A;  3PLF B;  4ZCV A;  2AMI A;  4YI8 A;  2BNX A;  1DF0 B;  1EL4 A;  4JKT A;  3SS4 A;  4QJ5 B;  3FIA A;  1Y1X A;  3BUN B;  2QPT A;  3OX6 A;  1LXF C;  1SKT A;  1FW4 A;  1QTX A;  2COL B;  3OP0 A;  5HLV A;  4PE0 A;  4GGN A;  4OZD A;  3SG7 A;  4GPL B;  4AOM A;  3DVJ A;  3R1P A;  1J1D A;  2ZND A;  3VRP A;  1XFX O;  1OOF A;  3EVR A;  3V2L A;  2L2E A;  3AAK A;  1A29 A;  2KBI A;  4OV2 A;  5AXI A;  3BFB A;  1CFD A;  1PUL A;  4MEW A;  1MQ1 A;  1WY9 A;  2BKI B;  3ZNI A;  1FI6 A;  3RZS A;  1C3Z A;  2JT0 A;  1OZO A;  1SK6 D;  1DQE A;  5DKR A;  3KF9 A;  2LM5 A;  2MA2 A;  2PQL A;  2PVB A;  2K7O A;  3CAB A;  2MJW B;  4JD9 A;  3Q8I A;  1HT9 A;  3R72 A;  1K94 A;  1XFY O;  1AVS A;  1XK4 C;  2MHH A;  3CZT X;  1SL9 A;  4P5O E;  3NHT A;  1F4Q A;  2LMU A;  3K21 A;  1NCY A;  2FJU B;  2JU0 A;  1T14 A;  2KAY A;  1MXL C;  1PVA A;  3OGN A;  2BE6 A;  1CTR A;  1SRA A;  2GV5 A;  2ZN9 A;  2MRD A;  4GAO A;  5CSF A;  2M9G A;  1CLL A;  3D0Y B;  2LE9 B;  3IVT A;  1CFC A;  3I5H C;  4DIR A;  2M8U A;  2OTG C;  3NSO A;  1WLM A;  4CID A;  1JC2 A;  4PAL A;  3GK2 A;  2Y1N A;  2P70 A;  2D8N A;  3LK1 A;  2LC5 A;  5AAN A;  1SCM C;  3DD4 A;  1K8U A;  3CYZ A;  4P2Y B;  3SG2 A;  1IGV A;  1FPW A;  1JWD A;  1JUO A;  3DVE A;  4FQO A;  3I5I B;  4F7F A;  3CS1 A;  1JSA A;  2GTE A;  1KQM C;  2A4J A;  3CTN A;  5I8N A;  3NGV A;  3SJS A;  1JBA A;  1BJF A;  5BPJ A;  2YGU A;  1EG3 A;  3FS7 A;  3TS5 C;  5G08 A;  1UWO A;  1JF0 A;  1L2O C;  1RFJ A;  2NCO A;  4M2O A;  1NPQ A;  3SIB A;  3PAT A;  4INX A;  3QRX A;  4YGC B;  2JT3 A;  1EJ3 A;  1OOH A;  1SMG A;  1S6J A;  2KLD A;  1GGZ A;  2R2I A;  1B9A A;  2AAO A;  2H2K A;  1PRW A;  3FE9 A;  2KI6 D;  4KYN A;  2L5Y A;  1BF5 A;  1QV1 A;  1K95 A;  2WCL A;  4GBA A;  1CDL A;  4PDZ A;  1WRZ A;  2LVI A;  1K2H A;  1OQP A;  2L5X B;  1A75 B;  1NX1 A;  1CLM A;  1C7V A;  3S0B A;  1BOC A;  2HQW A;  4CFQ A;  2JRF A;  2IS9 A;  1F70 A;  1RK9 A;  1XFU O;  3B88 A;  2MLF C;  3FWB A;  4JWQ A;  1CMG A;  2DOQ A;  1UHK A;  4GGF C;  1TN4 A;  1WDC B;  3KEV A;  2F3Z A;  4PHM A;  1OSA A;  1XFV O;  2LLU A;  1KK8 B;  3O4X A;  5HYD A;  1B1G A;  3PSR A;  3ZWH A;  2SAS A;  5J3X A;  1GM0 A;  1ODB A;  1RRO A;  3DZT A;  1A03 A;  1BR4 B;  4NDB A;  2HQ8 A;  1G8I A;  1TUZ A;  4DRW A;  3CWG A;  1G33 A;  3NSI A;  3EKH A;  1M31 A;  1SCM B;  3PAL A;  1KFX S;  1RTP 1;  4CPV A;  1J7R A;  4JQ0 D;  4ORC B;  2ZN8 A;  2JXL A;  2WOS A;  3D77 A;  1CFF A;  2Y4Q A;  1UUS A;  1YR5 A;  3O78 A;  4L9M A;  2K7B A;  3SG4 A;  1REC A;  4DS7 A;  1XYD A;  2GGM A;  3CR5 X;  1XVJ A;  2Y5I A;  1B47 A;  1LVC D;  5HL1 A;  4GNK B;  1NUB A;  2K2F A;  2PYQ A;  1Y0V H;  3GK1 A;  1R6P A;  3L4A A;  1W7I B;  2LP2 A;  3M0W A;  1K9K A;  3D76 A;  4USL A;  2F3Y A;  3UO9 A;  1TUJ A;  4NDC A;  4WQ3 A;  1BU3 A;  5FI7 A;  2KNE A;  3CGA A;  1BR1 B;  1TIZ A;  2LVV A;  3IF7 A;  2H61 C;  2NXQ A;  1N65 A;  1DEL A;  1IKU A;  4HSZ A;  1MWN A;  1NWD A;  1IH0 A;  3SS5 A;  1K93 D;  2PAL A;  3AAJ A;  2O5G A;  4ORA B;  2JPO A;  1AK8 A;  2Y1M A;  3C1V A;  1S5G Z;  1S6I A;  2QEV A;  5JOL A;  1OMV A;  2JNX A;  4GUK A;  1ZFS A;  4IJ7 A;  5HKZ A;  1YUU A;  5AEQ A;  2EC6 B;  1CDM A;  3KPX A;  3D74 A;  1WRL A;  2LHL A;  4BY5 A;  3NSK A;  3HX4 A;  4PCW A;  3PM8 A;  1SPY A;  3S0D A;  3RM1 A;  3PN7 C;  5CSJ A;  1FI5 A;  2LVJ A;  1D1O A;  2L51 A;  1F8H A;  2I94 A;  1TNQ A;  2BE4 A;  1UUR A;  2L4I A;  2LUX A;  2QEH A;  2F2O A;  3B86 A;  3NHI A;  4OR9 B;  3WHU B;  1AP4 A;  1XFW O;  2KGR A;  5DIC A;  1IQ3 A;  2WCM A;  1FF1 A;  1FBV A;  1S5G Y;  1CKK A;  4YGD B;  3OX5 A;  1Y6W A;  3L47 A;  2MBX A;  4MBE A;  1W7J B;  2LMT A;  3D73 A;  4IL1 A;  3NXA A;  2JC2 A;  1DC1 A;  1ZUZ A;  1IIO A;  2LAP A;  3DY9 A;  1IRJ A;  1WDC C;  5DKN A;  1KK8 C;  4PE7 A;  3UNW A;  2M7N A;  1NP8 A;  3VRR A;  5CPV A;  1LS8 A;  2M3W A;  1GQM A;  1K96 A;  2M0R A;  1M63 B;  2CCM A;  2BCA A;  3A8R A;  4YRU A;  3D10 A;  3PM2 A;  2RGI A;  3S0G A;  2LHI A;  1YX7 A;  2G9B A;  3CR4 X;  4DUQ A;  1VRK A;  3BQ3 A;  3LL8 B;  3BFH A;  1R2U A;  5HKY A;  5CSN A;  4CFR A;  3IQQ A;  2ZKM X;  4PE4 A;  5HKW A;  2QEB A;  2F2P A;  5B8I B; 
#chains in the Genus database with same CATH homology
 1QVI Z;  1Y1A A;  3DF0 A;  1DJG A;  2OS8 B;  2JWW A;  1WLZ A;  1SW8 A;  3EK7 A;  5I2Q A;  2GGZ A;  4M2Q A;  1B4C A;  2SCP A;  1YRU B;  4AQJ A;  1CB1 A;  4AQI A;  4I5K A;  1ALV A;  4MZK A;  1IG5 A;  1S6C A;  1J7Q A;  2KYC A;  2JTT A;  4I5L B;  1YUR A;  2LAN A;  2I2R E;  1QX5 B;  2NZ0 A;  3EVU A;  3PN7 B;  4MRY A;  3SG6 A;  2K8M B;  4XJK A;  1UP5 A;  4WQ2 A;  3BYA A;  2JQ6 A;  3GOF A;  1QVI Y;  2K7C A;  1AHR A;  1QX2 A;  2MAZ A;  2ZNE A;  5D69 A;  1CLB A;  1CNP A;  2PSR A;  4TNC A;  1PAL A;  3F45 A;  1RWY A;  1DVI A;  1MUX A;  2EC6 C;  2E6W A;  1PK0 D;  1XO5 A;  1SL8 A;  3NSL A;  2L0P A;  4N5X A;  2F8P A;  1ZOT B;  4N1G A;  1TNW A;  2BBM A;  2Q91 A;  1BMO A;  5D7F A;  4ZCU A;  1UHN A;  1KWO B;  1GJY A;  2JT8 A;  1K9P A;  4PE1 A;  1LIN A;  1QIW A;  2WND A;  2LP3 A;  1B8C A;  3HCM A;  1F4O A;  3BOW A;  1OMR A;  2E30 A;  5JJG A;  2KFG A;  2JOJ A;  1DJY A;  3GK4 X;  3KO0 A;  4MSP A;  2KQ6 A;  1OE9 B;  2ZRS A;  4YGA A;  1CMF A;  1YVH A;  3ICB A;  4I5N B;  4MZL A;  4NQG A;  4PHN A;  1J1E A;  4OCI A;  4C0L A;  5AER A;  3TDI A;  2Q4U A;  4YGB B;  2KQY A;  2K7D A;  2OPO A;  2BEC A;  3VRO A;  2M49 B;  1ALW A;  2BCX A;  1RJV A;  2FOT A;  2K61 A;  2KI4 B;  1NSH A;  2BL0 B;  2CBL A;  5FYX A;  2M97 A;  3JVT B;  1TCF A;  1NCZ A;  3KHE A;  2JPT A;  2KI6 C;  3TZ1 A;  2PMY A;  1JFK A;  2JXC A;  4QJ3 B;  1C7W A;  1YUT A;  1LA3 A;  1QJT A;  2OS8 C;  1PVB A;  2KYF A;  3RLZ A;  1QAS A;  2CTN A;  1UHH A;  3BUW B;  1QIV A;  4CLN A;  1E8A A;  4ORB B;  1MF8 B;  1OOJ A;  4MN0 A;  2FCD A;  1IJ5 A;  1TNX A;  2WOR A;  1DJW A;  3DF0 B;  1OZS A;  5TNC A;  2L4H A;  1K90 D;  1YX8 A;  2I7A A;  2LCP A;  5ER4 X;  3I5F B;  1MHO A;  1K9U A;  4YI9 A;  1U5I A;  1CM4 A;  1MR8 A;  3BUO B;  4C0K A;  1XK4 A;  4U8D A;  1BT6 A;  1YTZ C;  2EHB A;  1DMO A;  1HQV A;  2JUL A;  5CSI A;  2AUC A;  3TUY B;  2CXJ A;  4MLW A;  1UHJ A;  2KFH A;  4R1E A;  1KFX L;  1IJ6 A;  1B7T Z;  1NIW A;  2FCE A;  2L98 A;  2PRU A;  1QX7 A;  5KU1 A;  4XJK B;  4ICB A;  2KOT A;  4DCK A;  2NLN A;  3AKB A;  4ETO A;  5AFP A;  1XA5 A;  2KFF A;  3WNX B;  4FTG A;  1J55 A;  3EKJ A;  1Y1U A;  1AUI B;  2M1U A;  3I5G B;  1CDP A;  2P6B B;  3BUM B;  2HF5 A;  2LLS A;  1KWO C;  2WC8 A;  1KQV A;  2M1K B;  2PAS A;  1IQ5 A;  5HLO A;  2LVK A;  1NCX A;  1X02 A;  1DJH A;  5ER5 A;  4PHJ A;  1G4Y R;  2L50 A;  3EVV A;  3MSE B;  1Q80 A;  1B7T Y;  2KBM A;  2WCF A;  1JSA A;  1KSO A;  4MZJ A;  4WRI A;  2LMV A;  4YBH B;  1A4P A;  2K2A A;  2KGB C;  4XYN A;  4A4B A;  3OHM B;  2B1U A;  1EXR A;  1KK7 Z;  2WCE A;  3BOW B;  2CNP A;  1F54 A;  1F55 A;  1TRF A;  1TNP A;  3LK0 A;  1QLS A;  5I2L A;  4D1E A;  3O2P A;  3CLN A;  4F0Z B;  1ZAC A;  1NX0 A;  1KFU S;  1N0Y A;  1SR6 B;  4GFT A;  1B8L A;  1XFZ O;  2G2B A;  2QAC A;  1DT7 B;  1CM1 A;  1S3P A;  3TDU A;  4I5J A;  4OVN F;  3E3R A;  2TN4 A;  1QS7 A;  5DKQ A;  4HRH A;  3WHT B;  4N1F A;  4PHK A;  3VRN A;  2KI4 C;  2BL0 C;  1S26 D;  3O4Y A;  1DF0 A;  1J7P A;  1JFJ A;  3JVT C;  3JTD B;  4Q04 A;  1JF2 A;  1KCY A;  1UHI A;  2KHN A;  3VRQ A;  3WXA A;  3IQO A;  4A4C A;  5K89 A;  1MXE A;  1KK7 Y;  1ZMZ A;  2F33 A;  5IBW A;  5KSZ A;  2ZFD A;  1BG1 A;  4HRG A;  2LV7 A;  1SNL A;  3TDZ A;  1QV0 A;  4YGE B;  4BY4 A;  1M46 A;  1BLQ A;  4GGF A;  1GGW A;  1S36 A;  1TCO B;  1SY9 A;  2EGD A;  1B8R A;  5GQQ C;  1SL7 A;  1TTX A;  2M7L A;  1LA0 A;  3O6B A;  1PSR A;  2BCB A;  1CDN A;  1EH2 A;  3EK8 A;  3PFV A;  1AJ4 A;  2MLE C;  3SIA A;  1QXP A;  2KDH A;  1TOP A;  1IWQ A;  1H8B A;  3I5F C;  4MVF A;  1SCV A;  1LKJ A;  1WRK A;  3FWC A;  1DGU A;  2KSP A;  1DJX A;  4M2P A;  3TUY C;  4UPG A;  1U5I B;  2LNK A;  1DJI A;  1M45 A;  1M39 A;  1AJ5 A;  3H4S E;  4HRE E;  2M29 A;  3D0Y A;  4NDD A;  1H4B A;  1NX2 A;  1NYA A;  1SYM A;  3I5G C;  1CFP A;  5I2O A;  1A2X A;  2O60 A;  3OB1 B;  1KFU L;  2BBN A;  2BKH B;  2CT9 A;  1C07 A;  3SG3 A;  3I5H B;  1N2D A;  2OTG B;  3OB2 B;  2H61 A;  1EG4 A;  1L7Z A;  1V1G A;  4E68 A;  1SBJ A;  2VRG A;  1QLK A;  2K0J A;  2ZRT A;  2KAV A;  1S1E A;  2V53 A;  1DJZ A;  2HPS A;  2WCB A;  3EK4 A;  3VGO A;  4MRX A;  2I18 A;  1BOD A;  2LLT A;  2KAX A;  2ISD A;  1YRT B;  1KQM B;  2JNF A;  5KTY A;  1J7O A;  3A4U B;  2JTZ A;  1DTL A;  3TS5 B;  1L2O B;  1SR6 C;  1F71 A;  3BXK A;  4OKH A;  4QJ4 B;  1NX3 A;  1YUS A;  1OMD A;  1KSM A;  1QAT A;  1DGV A;  5F6T A;  3SG5 A;  3DVK A;  3LLE A;  3DVM A;  3AKA A;  5PAL A;  4JPZ B;  2JZI A;  1A75 A;  1V1F A;  3JTD C;  4C0J A;  2HET A;  2NCP A;  3CR2 A;  3I5I C;  1YVL A;  2LUC A;  3BUX B;  3LCP C;  1PSB A;  3PLF B;  4ZCV A;  2AMI A;  4YI8 A;  1DF0 B;  1EL4 A;  4QJ5 B;  3FIA A;  1Y1X A;  3BUN B;  2QPT A;  3OX6 A;  1LXF C;  1SKT A;  1FW4 A;  1QTX A;  2COL B;  3OP0 A;  5HLV A;  4PE0 A;  4GGN A;  3SG7 A;  4AOM A;  4GPL B;  3DVJ A;  1J1D A;  2ZND A;  3VRP A;  1XFX O;  3EVR A;  2L2E A;  3AAK A;  1A29 A;  2KBI A;  4OV2 A;  5AXI A;  1CFD A;  1PUL A;  4MEW A;  1MQ1 A;  1WY9 A;  2BKI B;  3ZNI A;  1FI6 A;  2JT0 A;  1OZO A;  1SK6 D;  5DKR A;  3KF9 A;  2LM5 A;  2MA2 A;  2PVB A;  2K7O A;  2MJW B;  1HT9 A;  1K94 A;  1XFY O;  1AVS A;  1XK4 C;  2MHH A;  3CZT X;  1SL9 A;  4P5O E;  1F4Q A;  2LMU A;  3K21 A;  1NCY A;  2FJU B;  2JU0 A;  2KAY A;  1MXL C;  1PVA A;  2BE6 A;  1CTR A;  1SRA A;  2GV5 A;  2ZN9 A;  2MRD A;  4GAO A;  5CSF A;  2M9G A;  1CLL A;  3D0Y B;  2LE9 B;  1CFC A;  3I5H C;  4DIR A;  2M8U A;  2OTG C;  3NSO A;  1WLM A;  4CID A;  1JC2 A;  4PAL A;  3GK2 A;  2Y1N A;  2D8N A;  3LK1 A;  2LC5 A;  5AAN A;  1SCM C;  3DD4 A;  1K8U A;  4P2Y B;  3SG2 A;  1IGV A;  1FPW A;  1JWD A;  1JUO A;  3DVE A;  4FQO A;  3I5I B;  3CS1 A;  3CTN A;  1KQM C;  2A4J A;  5I8N A;  1JBA A;  3SJS A;  1BJF A;  5BPJ A;  1EG3 A;  3FS7 A;  3TS5 C;  5G08 A;  1UWO A;  1JF0 A;  1L2O C;  1RFJ A;  2NCO A;  4M2O A;  1NPQ A;  3SIB A;  3PAT A;  3QRX A;  4YGC B;  2JT3 A;  1EJ3 A;  1SMG A;  1S6J A;  1GGZ A;  2R2I A;  1B9A A;  2AAO A;  2H2K A;  1PRW A;  2KI6 D;  1BF5 A;  1QV1 A;  1K95 A;  4GBA A;  1K2H A;  1CDL A;  4PDZ A;  1WRZ A;  2LVI A;  1OQP A;  2L5X B;  1A75 B;  1NX1 A;  1CLM A;  1C7V A;  1BOC A;  2HQW A;  4CFQ A;  2JRF A;  2IS9 A;  1F70 A;  1RK9 A;  1XFU O;  2MLF C;  3FWB A;  4JWQ A;  1CMG A;  2DOQ A;  1UHK A;  4GGF C;  1TN4 A;  1WDC B;  3KEV A;  2F3Z A;  4PHM A;  1OSA A;  1XFV O;  2LLU A;  1KK8 B;  5HYD A;  1B1G A;  3PSR A;  3ZWH A;  2SAS A;  5J3X A;  1ODB A;  1RRO A;  1A03 A;  1BR4 B;  4NDB A;  2HQ8 A;  1G8I A;  4DRW A;  3CWG A;  1G33 A;  3NSI A;  3EKH A;  1M31 A;  1SCM B;  3PAL A;  1KFX S;  1RTP 1;  4CPV A;  1J7R A;  4JQ0 D;  4ORC B;  2ZN8 A;  2JXL A;  2WOS A;  1CFF A;  2Y4Q A;  1UUS A;  1YR5 A;  3O78 A;  4L9M A;  2K7B A;  3SG4 A;  1REC A;  4DS7 A;  1XYD A;  2GGM A;  3CR5 X;  1XVJ A;  2Y5I A;  1B47 A;  1LVC D;  4GNK B;  1NUB A;  2K2F A;  1Y0V H;  3GK1 A;  1R6P A;  1W7I B;  2LP2 A;  3M0W A;  1K9K A;  4USL A;  2F3Y A;  4NDC A;  4WQ3 A;  1BU3 A;  2KNE A;  3CGA A;  1BR1 B;  1TIZ A;  2LVV A;  3IF7 A;  2H61 C;  2NXQ A;  1N65 A;  1IKU A;  4HSZ A;  1MWN A;  1NWD A;  1IH0 A;  1K93 D;  2PAL A;  3AAJ A;  2O5G A;  4ORA B;  1AK8 A;  2Y1M A;  3C1V A;  1S5G Z;  1S6I A;  5JOL A;  1OMV A;  2JNX A;  4GUK A;  1ZFS A;  5HKZ A;  1YUU A;  5AEQ A;  2EC6 B;  1CDM A;  3KPX A;  1WRL A;  2LHL A;  4BY5 A;  3NSK A;  3HX4 A;  4PCW A;  3PM8 A;  1SPY A;  3RM1 A;  3PN7 C;  5CSJ A;  1FI5 A;  2LVJ A;  1D1O A;  2L51 A;  1F8H A;  2I94 A;  1TNQ A;  2BE4 A;  1UUR A;  2L4I A;  2LUX A;  2F2O A;  3WHU B;  4OR9 B;  1AP4 A;  1XFW O;  2KGR A;  1IQ3 A;  1FF1 A;  1FBV A;  1S5G Y;  1CKK A;  4YGD B;  3OX5 A;  1Y6W A;  2MBX A;  4MBE A;  1W7J B;  2LMT A;  4IL1 A;  3NXA A;  2JC2 A;  1ZUZ A;  2LAP A;  1IRJ A;  1WDC C;  5DKN A;  1KK8 C;  4PE7 A;  2M7N A;  1NP8 A;  3VRR A;  5CPV A;  2M3W A;  1GQM A;  1K96 A;  2M0R A;  1M63 B;  2CCM A;  2BCA A;  3A8R A;  4YRU A;  3D10 A;  2RGI A;  2LHI A;  1YX7 A;  2G9B A;  3CR4 X;  4DUQ A;  1VRK A;  3BQ3 A;  3LL8 B;  1R2U A;  5HKY A;  5CSN A;  4CFR A;  3IQQ A;  2ZKM X;  4PE4 A;  5HKW A;  2F2P A;  5B8I B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...