1KQMC

Scallop myosin s1-amppnp in the actin-detached conformation
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
153
structure length
153
Chain Sequence
b'KLSQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYOSIN heavy chain
publication title Crystallographic findings on the internally uncoupled and near-rigor states of myosin: Further insights into the mechanics of the motor
pubmed doi rcsb
molecule tags Contractile protein
total genus 31
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2002-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kqmC01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kqmC02
2KGRA 2L4IA 1R6PA 3KHEA 3I5FB 3I5IB 3O78A 1BMOA 1DJIA 2KDHA 1A4PA 4HREE 1SL9A 2D8NA 2LV7A 2KFHA 2K7OA 2LVVA 4OCIA 2KNEA 3TDZA 2Q91A 2AAOA 2G2BA 5F6TA 2BECA 3EK4A 4JQ0D 3TUYC 2WOSA 5DKRA 2ZRSA 5AERA 4USLA 2M3WA 1MWNA 4MZKA 1KK8C 1SBJA 2HQWA 1KFXL 1CFCA 2NZ0A 2L2EA 1EJ3A 1B9AA 4ORBB 1B8CA 1EXRA 5JOLA 1LINA 4XJKB 1BLQA 2WC8A 2LUCA 1YUUA 1CLBA 5AANA 1TNXA 2JULA 2L0PA 1J55A 1G4YR 5PALA 4WRIA 1PVAA 1K8UA 1M31A 1IQ5A 1AVSA 2JRFA 2K7BA 4PE0A 2F2OA 4M2QA 1ZACA 1W7IB 2PALA 2ZNDA 1K94A 2KFGA 5DKQA 1AK8A 2KAVA 4PHMA 3DVEA 2SASA 4YGCB 1NX0A 4GGNA 1RFJA 2CNPA 1LA3A 5D7FA 5G08A 1K9UA 1JSAA 1JFKA 5AEQA 1GJYA 3EVUA 4ZCUA 4GFTA 2LP2A 1Y1AA 3OB1B 3EKHA 2BE6A 2CBLA 2LP3A 2M97A 2PSRA 1C7WA 1SNLA 1CDMA 2I18A 3LLEA 1Y1XA 2F3ZA 3O4YA 2ISDA 2JTZA 1S1EA 2BCAA 1JF2A 1YRUB 1DF0A 2K2AA 1B8RA 4ORAB 1H8BA 3FS7A 1D1OA 3CS1A 2LCPA 3JVTB 3IF7A 1K9KA 1IG5A 1XFVO 1KQVA 1UURA 1CM4A 1A03A 4L9MA 1J7QA 1NYAA 2JXLA 1UHNA 2EC6C 3RM1A 4OKHA 4P5OE 1ZMZA 4YI9A 1ALWA 1R2UA 3AKBA 1Y1UA 1SR6B 1SKTA 3TDUA 1L2OC 1L7ZA 1SK6D 1CDPA 3BUOB 4YGEB 4Q04A 1IGVA 2K7DA 3SG5A 4A4BA 4NQGA 1C7VA 1ZFSA 2KAYA 2M1KB 2BBMA 1KQMC 1IH0A 1IJ5A 3PN7C 2F2PA 2E30A 3CR5X 5HLVA 3ICBA 1BF5A 2JT0A 1IWQA 1M46A 2KHNA 3BXKA 1BU3A 4GGFA 3VRPA 5CSFA 2BL0B 2CTNA 3FIAA 4NDCA 1E8AA 1IRJA 1RECA 3EKJA 3TS5B 1FW4A 4QJ5B 1CFDA 2L4HA 2MHHA 1YRTB 1V1GA 2PRUA 2G9BA 2LMTA 1BT6A 2OPOA 1AJ4A 2COLB 1IQ3A 2KFFA 4ORCB 5KTYA 1A75B 4MN0A 1YUTA 1NX3A 2KGBC 1NCXA 1QX7A 1F8HA 1CDLA 4JPZB 1TNWA 1U5IA 1LVCD 3C1VA 1PVBA 1KFUS 1FF1A 3LCPC 3TUYB 1QLSA 2HPSA 2AMIA 1QV1A 1J7PA 4QJ3B 1KK8B 2Y4QA 2ZN8A 4PHNA 3WNXB 4QJ4B 3DD4A 2MRDA 3RLZA 4OVNF 3CGAA 3TS5C 1CMFA 1XFWO 1KSOA 2JQ6A 2LAPA 1MHOA 1ODBA 3SG2A 4PCWA 5CSIA 2JXCA 3PLFB 1JFJA 1NX1A 2CCMA 1CM1A 4IL1A 1QIWA 1DTLA 1YX8A 2KQ6A 1SL7A 3PALA 3SG7A 4WQ3A 3GK4X 5AFPA 5I2LA 5FYXA 2NXQA 2VRGA 4DRWA 5HKYA 1A29A 1SY9A 1Y0VH 1UHKA 5HLOA 3I5HC 4MZLA 3CTNA 4AOMA 1C07A 2JTTA 1NPQA 1G8IA 3PM8A 4UPGA 1B47A 5KU1A 3OX5A 3BYAA 2PVBA 1HT9A 1XFZO 2MA2A 1XYDA 4XJKA 1OMRA 2H2KA 3FWBA 4PDZA 1S6IA 4ICBA 1QV0A 1DVIA 2KYCA 4AQIA 3NSIA 4PALA 2BKIB 3SJSA 1F54A 1F71A 4MZJA 4PE1A 1EL4A 1YVLA 3OX6A 4DIRA 1CB1A 1XFYO 2EC6B 2MBXA 1B4CA 4OV2A 4CIDA 1JC2A 2I2RE 1PSRA 1FI5A 3F45A 1BG1A 1QX5B 1F55A 4MLWA 1SPYA 1L2OB 4P2YB 1XK4C 2WORA 2EGDA 1XFUO 2JT8A 2WNDA 4HSZA 2JPTA 1MXLC 3SG4A 1PK0D 2K0JA 1DT7B 1GGWA 1SCVA 5J3XA 3DVMA 2JU0A 2B1UA 1TNPA 1XFXO 4C0JA 1WLMA 1KQMB 1IJ6A 2M29A 3PN7B 2L98A 3KO0A 1OZSA 4N1GA 1CFFA 4YRUA 2NCPA 4MBEA 3CZTX 4DUQA 4CLNA 2M9GA 3SIAA 2KBIA 1YX7A 5D69A 3BOWB 4I5NB 1J1EA 2LE9B 2H61A 2ZFDA 3A8RA 2KAXA 1TNQA 5IBWA 5CPVA 2R2IA 3CWGA 4YBHB 4YGAA 2Y1NA 1F4QA 1WRLA 1CLMA 1OSAA 3LL8B 3WHUB 2EHBA 1LXFC 1BR4B 1OQPA 3AAKA 3KEVA 1SYMA 1V1FA 1JUOA 4GPLB 4CPVA 2TN4A 2IS9A 2V53A 1RWYA 1TCOB 3D0YB 1BR1B 2M1UA 4PHJA 5K89A 1B1GA 1CLLA 2LMUA 3BUXB 1CNPA 1WLZA 1QLKA 2M49B 1F4OA 2L5XB 1UHHA 4N1FA 4DCKA 3JTDC 3ZNIA 1TOPA 2JZIA 2GGZA 2OS8B 1XVJA 1RJVA 2JOJA 2LMVA 5ER5A 2FJUB 2HF5A 4I5KA 4M2PA 1JWDA 1KFUL 1NP8A 2L51A 3DVJA 1A75A 2O60A 4R1EA 1WRKA 3AKAA 4NDBA 2M8UA 1TN4A 2RGIA 4CFQA 2K7CA 1KCYA 1QS7A 3HCMA 3I5HB 5CSNA 1CFPA 3DF0B 2I7AA 4A4CA 2KI6D 2O5GA 1S36A 4PHKA 3HX4A 1DJWA 1S6CA 2JNFA 1RTP1 1UP5A 2Y5IA 3A4UB 1N0YA 1YURA 1YR5A 1YVHA 2WCBA 2QACA 3GK1A 4XYNA 4GBAA 3EK8A 2MJWB 1MF8B 3O6BA 1BJFA 2JC2A 2GV5A 2NLNA 1KK7Y 3NSLA 3PSRA 1TCFA 1J7OA 2OTGB 3IQOA 3CLNA 3OB2B 4JWQA 5AXIA 4M2OA 2OS8C 2MLFC 2KSPA 5CSJA 4WQ2A 1M63B 3PATA 1WDCC 1DGUA 2KI4C 3EVRA 2ZN9A 3M0WA 4GUKA 4NDDA 1DJXA 4U8DA 1MR8A 1EH2A 1A2XA 1JF0A 1M45A 1KWOC 2MAZA 1PALA 2Y1MA 1NCYA 3AAJA 4FTGA 1YTZC 2HQ8A 5HKWA 1PSBA 2FCDA 2CXJA 4YGDB 1LA0A 2MLEC 4GGFC 1SL8A 3D10A 3NXAA 2LVIA 4YI8A 2LLTA 3ZWHA 1B8LA 4HRGA 3EVVA 1MUXA 1FBVA 2BKHB 1NSHA 4D1EA 1OE9B 1SMGA 2KOTA 1PRWA 1MXEA 2JT3A 2AUCA 1SCMB 1NIWA 1SRAA 4ZCVA 2OTGC 1DJZA 1OMVA 2SCPA 5JJGA 3KPXA 4N5XA 1ZOTB 2M0RA 3KF9A 3I5GB 1AHRA 3K21A 1QATA 2ZRTA 2DOQA 2P6BB 2QPTA 3PFVA 1S6JA 1LKJA 2JWWA 1QVIZ 2A4JA 4I5LB 4BY4A 3LK1A 4AQJA 1NUBA 1QVIY 1M39A 4MRYA 4E68A 3WHTB 2F8PA 1NWDA 5GQQC 2ZNEA 1QXPA 1TIZA 3VRNA 1GQMA 1K93D 2E6WA 1H4BA 2LANA 1S5GZ 2LHLA 5HKZA 1S5GY 1HQVA 3E3RA 1DJYA 2I94A 2LC5A 1YUSA 1QTXA 1WRZA 1KFXS 2BCXA 2KQYA 2KYFA 4MSPA 1QJTA 3I5IC 1SCMC 3I5FC 1F70A 1NCZA 3BUMB 2CT9A 3CR2A 1FPWA 3LK0A 1OZOA 1S3PA 2LUXA 3BOWA 3SG6A 3JTDB 1N2DA 1UHIA 2Q4UA 1PULA 3I5GC 1Q80A 1DGVA 4C0LA 2F3YA 5B8IB 2PASA 3H4SE 1X02A 3FWCA 3VROA 1RK9A 3BUWB 2K61A 3GOFA 2WCFA 5I2QA 1XA5A 1NX2A 1AUIB 1G33A 1DF0B 1TTXA 2NCOA 1ALVA 1DJHA 3D0YA 3MSEB 1K95A 2FCEA 5DKNA 4C0KA 1Y6WA 1QIVA 1UUSA 1BODA 1N65A 1OOJA 3NSOA 4MRXA 3BQ3A 3VRQA 1DMOA 1K9PA 3EK7A 3SIBA 1EG4A 1VRKA 2PMYA 5HYDA 3TDIA 1J7RA 2WCEA 1K96A 2FOTA 4PE7A 1TRFA 1CKKA 5I2OA 1CDNA 2BBNA 4FQOA 4I5JA 1WDCB 4YGBB 3DVKA 3GK2A 1K90D 2KI4B 4BY5A 4DS7A 2K2FA 4TNCA 2KBMA 1B7TZ 2KI6C 1KWOB 1B7TY 3BUNB 3VGOA 1CMGA 3VRRA 3CR4X 1FI6A 4MEWA 2BCBA 3DF0A 3OHMB 1XO5A 1QX2A 2LNKA 2JNXA 1GGZA 3JVTC 3NSKA 4CFRA 1IKUA 5TNCA 2ZKMX 1SW8A 1CTRA 2M7NA 1KK7Z 2K8MB 2L50A 2H61C 4PE4A 3SG3A 1W7JB 3OP0A 5BPJA 5I8NA 1WY9A 1SR6C 2LM5A 1K2HA 1S26D 1BOCA 2M7LA 2HETA 3QRXA 4GNKB 4MVFA 1AJ5A 1MQ1A 1ZUZA 1RROA 4GAOA 4OR9B 3WXAA 1U5IB 1EG3A 2BE4A 2F33A 2LHIA 1XK4A 2LVJA 1UHJA 1UWOA 1JBAA 3TZ1A 1OMDA 2LVKA 4HRHA 2BL0C 4F0ZB 1AP4A 1DJGA 4ETOA 3IQQA 1KSMA 2LLUA 1QASA 2GGMA 1J1DA 3O2PA 5KSZA 5ER4X 2LLSA
chains in the Genus database with same CATH superfamily
2KGRA 2L4IA 1R6PA 3KHEA 3I5FB 3I5IB 3O78A 1BMOA 1DJIA 2KDHA 1A4PA 4FQTA 4HREE 1SL9A 4JD9A 2D8NA 2LV7A 2KFHA 2P70A 2K7OA 2LVVA 3CYZA 4OCIA 2KNEA 3TDZA 2Q91A 3DZTA 2AAOA 2G2BA 5F6TA 2BECA 2QEHA 3EK4A 4JQ0D 3TUYC 2WOSA 4OZDA 5DKRA 2ZRSA 5AERA 2L2CA 4USLA 2M3WA 2QEBA 1MWNA 4MZKA 1KK8C 1SBJA 2HQWA 1KFXL 1CFCA 2NZ0A 2L2EA 1EJ3A 1B9AA 4ORBB 1B8CA 1EXRA 2JPOA 5JOLA 1LINA 4XJKB 1BLQA 2WC8A 2LUCA 1YUUA 1CLBA 5AANA 1TNXA 2JULA 2L0PA 1J55A 1G4YR 5PALA 4WRIA 4F7FA 1PVAA 1K8UA 1M31A 1IQ5A 1AVSA 1OOGA 2JRFA 2K7BA 3D77A 4PE0A 2F2OA 3QMEA 4M2QA 1ZACA 1W7IB 2PALA 4KYNA 2ZNDA 1K94A 2KFGA 5DKQA 1AK8A 2KAVA 4PHMA 3DVEA 2SASA 4YGCB 3DXLA 1NX0A 4GGNA 1RFJA 2CNPA 1LA3A 5D7FA 5G08A 1K9UA 1JSAA 1JFKA 5AEQA 1GJYA 3EVUA 4ZCUA 4GFTA 2LP2A 1Y1AA 3OB1B 3EKHA 2BE6A 2CBLA 2LP3A 2M97A 2PSRA 1C7WA 1SNLA 5FI2A 4PT1A 1CDMA 2I18A 3LLEA 3BFAA 1Y1XA 2F3ZA 3O4YA 2ISDA 2JTZA 1S1EA 2BCAA 1JF2A 1YRUB 2WCHA 1DF0A 2K2AA 1B8RA 4ORAB 2FJYA 1H8BA 3FS7A 1D1OA 3CS1A 2LCPA 3JVTB 3IF7A 1K9KA 1IG5A 3S0GA 1XFVO 1KQVA 1UURA 1CM4A 1A03A 4L9MA 1J7QA 1NYAA 2JXLA 1UHNA 2EC6C 3RM1A 4OKHA 4P5OE 1ZMZA 4YI9A 1ALWA 3BJHA 1R2UA 3AKBA 1Y1UA 1SR6B 1SKTA 3TDUA 1L2OC 1GM0A 1L7ZA 1SK6D 1CDPA 3BUOB 4YGEB 4Q04A 1IGVA 2K7DA 3SG5A 4A4BA 4NQGA 1C7VA 1ZFSA 3N7HA 2KAYA 2M1KB 2BBMA 1KQMC 1C3YA 1IH0A 1IJ5A 3PN7C 2F2PA 2E30A 3CR5X 2WC6A 5HLVA 3ICBA 1BF5A 2JT0A 1IWQA 1M46A 2KHNA 3BXKA 1BU3A 4GGFA 3VRPA 1IIOA 5CSFA 2BL0B 2CTNA 3FIAA 3L47A 1E8AA 1IRJA 4NDCA 1RECA 3EKJA 2H8VA 1FW4A 3TS5B 3NGVA 4QJ5B 1CFDA 2L4HA 2MHHA 1YRTB 1V1GA 2PRUA 2G9BA 2L5YA 2LMTA 3S0BA 1BT6A 3UO9A 2BNXA 1AJ4A 2COLB 2OPOA 1IQ3A 2KFFA 4ORCB 5KTYA 3IVTA 1A75B 3SS3A 4MN0A 3L4LA 1YUTA 3PM2A 1NX3A 2KGBC 1NCXA 1QX7A 1F8HA 1CDLA 4JPZB 1TNWA 1U5IA 1LVCD 3C1VA 1PVBA 1KFUS 1FF1A 3LCPC 3TUYB 1QLSA 2HPSA 2AMIA 1QV1A 1J7PA 4QJ3B 1KK8B 2Y4QA 2ZN8A 4PHNA 3WNXB 3BFBA 4QJ4B 3DD4A 2MRDA 5FI7A 3RLZA 4OVNF 3CGAA 3TS5C 1CMFA 1XFWO 1KSOA 2JQ6A 2LAPA 1MHOA 1ODBA 2PYQA 3B87A 3SG2A 4PCWA 5CSIA 2JXCA 3PLFB 1JFJA 1NX1A 2CCMA 1CM1A 4IL1A 1QIWA 1DTLA 1YX8A 2KQ6A 1SL7A 3PALA 3SG7A 5HL1A 4WQ3A 3GK4X 5AFPA 2K60A 1TUJA 5I2LA 5FYXA 2NXQA 2VRGA 4DRWA 5HKYA 1A29A 1SY9A 1Y0VH 1UHKA 5HLOA 3I5HC 4MZLA 3CTNA 4AOMA 1C07A 1TWOA 2JTTA 1NPQA 1G8IA 2GTEA 3CABA 3CZ0A 3PM8A 4UPGA 1B47A 3S0EA 3OX5A 5KU1A 3BYAA 3Q8IA 2PVBA 1HT9A 1QWVA 1XFZO 2MA2A 1XYDA 5D3OA 3NHTA 1OMRA 2H2KA 3FWBA 2WCMA 1S6IA 4PDZA 4XJKA 4ICBA 1QV0A 1DVIA 2KYCA 4AQIA 3NSIA 4PALA 2BKIB 3D75A 3S0DA 3SJSA 1F54A 1F71A 4MZJA 4PE1A 1EL4A 1YVLA 3FE8A 3OX6A 4DIRA 1CB1A 1XFYO 2EC6B 2MBXA 1DELA 4OV2A 1B4CA 4CIDA 1JC2A 2I2RE 1PSRA 1FI5A 3F45A 1BG1A 3BFHA 1QX5B 1F55A 4MLWA 1SPYA 1L2OB 4P2YB 1XK4C 2WORA 2EGDA 1XFUO 2JT8A 2WNDA 4HSZA 2JPTA 1MXLC 3SG4A 1PK0D 2K0JA 1DT7B 1GGWA 1SCVA 5J3XA 3DVMA 2JU0A 1TNPA 1XFXO 2B1UA 4C0JA 2QDIA 1WLMA 1KQMB 1IJ6A 2M29A 3PN7B 2L98A 3KO0A 1OZSA 4INWA 4N1GA 1CFFA 4YRUA 1W9ZA 2NCPA 4MBEA 3CZTX 4DUQA 4CLNA 2YGUA 2M9GA 3SIAA 2KBIA 1YX7A 4INXA 3BOWB 5D69A 4I5NB 1J1EA 2LE9B 2H61A 2ZFDA 3A8RA 5FI6A 2KAXA 1TNQA 5IBWA 5CPVA 2R2IA 3CWGA 4YBHB 4YGAA 2Y1NA 1F4QA 3D74A 1WRLA 1CLMA 1OSAA 3LL8B 3WHUB 3S0FA 2EHBA 1LXFC 1BR4B 1OQPA 3AAKA 3KEVA 1SYMA 1V1FA 1JUOA 4GPLB 4CPVA 2TN4A 2IS9A 2V53A 1RWYA 1TCOB 2QEOA 3FE6A 3NHIA 3D0YB 1BR1B 2M1UA 4PHJA 5K89A 1DEKA 1B1GA 1CLLA 2LMUA 3BUXB 1CNPA 3V2LA 1WLZA 1QLKA 3L4AA 2M49B 1F4OA 2L5XB 1UHHA 4N1FA 3DY9A 4DCKA 3JTDC 3ZNIA 1TOPA 2JZIA 2GGZA 2OS8B 1XVJA 1RJVA 2JOJA 2LMVA 5ER5A 2FJUB 2HF5A 4I5KA 4M2PA 1Z4HA 1KFUL 1JWDA 1NP8A 3B86A 2L51A 3DVJA 1A75A 2O60A 4R1EA 1WRKA 1XFRA 3AKAA 3VB1A 4NDBA 2M8UA 1TN4A 2RGIA 4CFQA 2K7CA 1KCYA 1QS7A 3HCMA 3I5HB 5CSNA 1CFPA 3B6XA 3DF0B 2I7AA 4A4CA 2KI6D 2O5GA 1S36A 4PHKA 3HX4A 1DJWA 1S6CA 2JNFA 1RTP1 1UP5A 2Y5IA 3A4UB 3K1EA 1N0YA 1YURA 1YR5A 1YVHA 2WCBA 2QACA 3GK1A 4XYNA 4GBAA 1OW4A 3EK8A 2MJWB 1MF8B 2ERBA 1Z2CB 1BJFA 2JC2A 3O6BA 2GV5A 2NLNA 1KK7Y 3NSLA 3PSRA 1TCFA 3EG5B 1J7OA 2OTGB 3IQOA 3CLNA 3OB2B 4JWQA 5AXIA 4M2OA 2OS8C 3S0AA 2MLFC 2KSPA 5CSJA 4WQ2A 1M63B 3PATA 1WDCC 1DGUA 2KI4C 3EVRA 5DICA 1LS8A 2ZN9A 3M0WA 3R1OA 4GUKA 4NDDA 1DJXA 4U8DA 1MR8A 1EH2A 1A2XA 1JF0A 1M45A 1KWOC 2MAZA 1PALA 2Y1MA 1NCYA 3AAJA 4FTGA 1YTZC 2HQ8A 5HKWA 1PSBA 2FCDA 2CXJA 4YGDB 1LA0A 2MLEC 4GGFC 2QEVA 1SL8A 3D10A 3NXAA 2LVIA 4YI8A 2LLTA 3ZWHA 1B8LA 3O4XA 2WCKA 3EVVA 1MUXA 4HRGA 1FBVA 2BKHB 1NSHA 4D1EA 1OE9B 1SMGA 2KOTA 1PRWA 1MXEA 2JT3A 2AUCA 3PJIA 1SCMB 1NIWA 1SRAA 2P71A 2OTGC 3OBVA 4ZCVA 1DJZA 1OMVA 2KLDA 2SCPA 3KPXA 5JJGA 4N5XA 1SSEB 1ZOTB 2M0RA 3KF9A 3I5GB 1AHRA 3K21A 1QATA 2ZRTA 2DOQA 2P6BB 2QPTA 3PFVA 1S6JA 1LKJA 2JWWA 3OGNA 1QVIZ 2A4JA 4I5LB 4BY4A 3LK1A 4AQJA 1NUBA 1QVIY 1M39A 4MRYA 1TUZA 3WHTB 2F8PA 4E68A 1NWDA 5GQQC 2ZNEA 1QXPA 1TIZA 3VRNA 1GQMA 1K93D 2E6WA 3D76A 3R72A 2LANA 1H4BA 1S5GZ 2LHLA 1OOIX 5HKZA 1S5GY 1HQVA 3E3RA 1DJYA 3DYEA 3FE9A 2I94A 2LC5A 1YUSA 1QTXA 2WCJA 1WRZA 1KFXS 2BCXA 2KQYA 2KYFA 4MSPA 1QJTA 3I5IC 1SCMC 3I5FC 1F70A 1NCZA 3BUMB 2CT9A 3CR2A 1FPWA 3LK0A 1OZOA 2KLEA 1S3PA 2LUXA 3CZ2A 3BOWA 3SG6A 3JTDB 1N2DA 1UHIA 2Q4UA 1PULA 3I5GC 1Q80A 1DGVA 4C0LA 2WC5A 5I94A 2F3YA 3UNWA 5B8IB 2PASA 3H4SE 1X02A 3FWCA 3VROA 1RK9A 3BUWB 2K61A 1C3ZA 2WCFA 3GOFA 5I2QA 1XA5A 1NX2A 1AUIB 1G33A 1DF0B 1TTXA 2NCOA 1ALVA 1DJHA 3D0YA 3MSEB 1K95A 2FCEA 5DKNA 4C0KA 1DQEA 1QIVA 1Y6WA 1UUSA 1BODA 1T14A 1N65A 1OOJA 3NSOA 2BAPA 4MRXA 3BQ3A 3VRQA 1DMOA 1K9PA 3EK7A 3SIBA 1EG4A 1VRKA 2PMYA 3R1PA 2PQLA 5HYDA 3TDIA 1J7RA 2WCEA 1K96A 2FOTA 4PE7A 1TRFA 3RZSA 1CKKA 5I2OA 1CDNA 2BBNA 4FQOA 4I5JA 1WDCB 4IJ7A 3DVKA 3GK2A 4YGBB 1K90D 2KI4B 4BY5A 4DS7A 3B7AA 3CDNA 2K2FA 4TNCA 2KBMA 1B7TZ 2KI6C 1KWOB 1B7TY 3BUNB 3VGOA 1CMGA 3VRRA 3CR4X 1FI6A 4MEWA 2BCBA 3DF0A 3OHMB 1XO5A 1QX2A 2LNKA 2JNXA 1OOFA 1GGZA 3JVTC 3CZ1A 3NSKA 4CFRA 1IKUA 3B88A 5TNCA 2ZKMX 1SW8A 1CTRA 1ORGA 2M7NA 1KK7Z 3D73A 2K8MB 2L50A 2H61C 4PE4A 3SG3A 1W7JB 4JKTA 3OP0A 5BPJA 5I8NA 1WY9A 1SR6C 2LM5A 3SS5A 1K2HA 1S26D 1DC1A 1BOCA 2M7LA 2HETA 3QRXA 4GNKB 4MVFA 1AJ5A 1MQ1A 1ZUZA 1RROA 4GAOA 4OR9B 3WXAA 2WCLA 1U5IB 1EG3A 2BE4A 2F33A 2LHIA 1XK4A 3SS4A 2LVJA 1UHJA 1UWOA 1JBAA 3TZ1A 1P28A 3R1VA 1OOHA 1OMDA 2KPHA 2LVKA 4HRHA 2BL0C 4F0ZB 5EL2A 1AP4A 3D78A 1DJGA 4ETOA 3IQQA 1KSMA 2LLUA 1QASA 2GGMA 1J1DA 3O2PA 5KSZA 5ER4X 2LLSA
chains in the Genus database with same CATH topology
2KGRA 2L4IA 1R6PA 3KHEA 3I5FB 3I5IB 3O78A 1BMOA 1DJIA 2KDHA 1A4PA 4HREE 1SL9A 2D8NA 2LV7A 2KFHA 2K7OA 2LVVA 4OCIA 2KNEA 3TDZA 2Q91A 2AAOA 2G2BA 5F6TA 2BECA 3EK4A 4JQ0D 3TUYC 2WOSA 5DKRA 2ZRSA 5AERA 4USLA 2M3WA 1MWNA 4MZKA 1KK8C 1SBJA 2HQWA 1KFXL 1CFCA 2NZ0A 2L2EA 1EJ3A 1B9AA 4ORBB 1B8CA 1EXRA 5JOLA 1LINA 4XJKB 1BLQA 2WC8A 2LUCA 1YUUA 1CLBA 5AANA 1TNXA 2JULA 2L0PA 1J55A 1G4YR 5PALA 4WRIA 1PVAA 1K8UA 1M31A 1IQ5A 1AVSA 2JRFA 2K7BA 4PE0A 2F2OA 4M2QA 1ZACA 1W7IB 2PALA 2ZNDA 1K94A 2KFGA 5DKQA 1AK8A 2KAVA 4PHMA 3DVEA 2SASA 4YGCB 1NX0A 4GGNA 1RFJA 2CNPA 1LA3A 5D7FA 5G08A 1K9UA 1JSAA 1JFKA 5AEQA 1GJYA 3EVUA 4ZCUA 4GFTA 2LP2A 1Y1AA 3OB1B 3EKHA 2BE6A 2CBLA 2LP3A 2M97A 2PSRA 1C7WA 1SNLA 1CDMA 2I18A 3LLEA 1Y1XA 2F3ZA 3O4YA 2ISDA 2JTZA 1S1EA 2BCAA 1JF2A 1YRUB 1DF0A 2K2AA 1B8RA 4ORAB 1H8BA 3FS7A 1D1OA 3CS1A 2LCPA 3JVTB 3IF7A 1K9KA 1IG5A 1XFVO 1KQVA 1UURA 1CM4A 1A03A 4L9MA 1J7QA 1NYAA 2JXLA 1UHNA 2EC6C 3RM1A 4OKHA 4P5OE 1ZMZA 4YI9A 1ALWA 1R2UA 3AKBA 1Y1UA 1SR6B 1SKTA 3TDUA 1L2OC 1L7ZA 1SK6D 1CDPA 3BUOB 4YGEB 4Q04A 1IGVA 2K7DA 3SG5A 4A4BA 4NQGA 1C7VA 1ZFSA 2KAYA 2M1KB 2BBMA 1KQMC 1IH0A 1IJ5A 3PN7C 2F2PA 2E30A 3CR5X 5HLVA 3ICBA 1BF5A 2JT0A 1IWQA 1M46A 2KHNA 3BXKA 1BU3A 4GGFA 3VRPA 5CSFA 2BL0B 2CTNA 3FIAA 4NDCA 1E8AA 1IRJA 1RECA 3EKJA 3TS5B 1FW4A 4QJ5B 1CFDA 2L4HA 2MHHA 1YRTB 1V1GA 2PRUA 2G9BA 2LMTA 1BT6A 2OPOA 1AJ4A 2COLB 1IQ3A 2KFFA 4ORCB 5KTYA 1A75B 4MN0A 1YUTA 1NX3A 2KGBC 1NCXA 1QX7A 1F8HA 1CDLA 4JPZB 1TNWA 1U5IA 1LVCD 3C1VA 1PVBA 1KFUS 1FF1A 3LCPC 3TUYB 1QLSA 2HPSA 2AMIA 1QV1A 1J7PA 4QJ3B 1KK8B 2Y4QA 2ZN8A 4PHNA 3WNXB 4QJ4B 3DD4A 2MRDA 3RLZA 4OVNF 3CGAA 3TS5C 1CMFA 1XFWO 1KSOA 2JQ6A 2LAPA 1MHOA 1ODBA 3SG2A 4PCWA 5CSIA 2JXCA 3PLFB 1JFJA 1NX1A 2CCMA 1CM1A 4IL1A 1QIWA 1DTLA 1YX8A 2KQ6A 1SL7A 3PALA 3SG7A 4WQ3A 3GK4X 5AFPA 5I2LA 5FYXA 2NXQA 2VRGA 4DRWA 5HKYA 1A29A 1SY9A 1Y0VH 1UHKA 5HLOA 3I5HC 4MZLA 3CTNA 4AOMA 1C07A 2JTTA 1NPQA 1G8IA 3PM8A 4UPGA 1B47A 5KU1A 3OX5A 3BYAA 2PVBA 1HT9A 1XFZO 2MA2A 1XYDA 4XJKA 1OMRA 2H2KA 3FWBA 4PDZA 1S6IA 4ICBA 1QV0A 1DVIA 2KYCA 4AQIA 3NSIA 4PALA 2BKIB 3SJSA 1F54A 1F71A 4MZJA 4PE1A 1EL4A 1YVLA 3OX6A 4DIRA 1CB1A 1XFYO 2EC6B 2MBXA 1B4CA 4OV2A 4CIDA 1JC2A 2I2RE 1PSRA 1FI5A 3F45A 1BG1A 1QX5B 1F55A 4MLWA 1SPYA 1L2OB 4P2YB 1XK4C 2WORA 2EGDA 1XFUO 2JT8A 2WNDA 4HSZA 2JPTA 1MXLC 3SG4A 1PK0D 2K0JA 1DT7B 1GGWA 1SCVA 5J3XA 3DVMA 2JU0A 2B1UA 1TNPA 1XFXO 4C0JA 1WLMA 1KQMB 1IJ6A 2M29A 3PN7B 2L98A 3KO0A 1OZSA 4N1GA 1CFFA 4YRUA 2NCPA 4MBEA 3CZTX 4DUQA 4CLNA 2M9GA 3SIAA 2KBIA 1YX7A 5D69A 3BOWB 4I5NB 1J1EA 2LE9B 2H61A 2ZFDA 3A8RA 2KAXA 1TNQA 5IBWA 5CPVA 2R2IA 3CWGA 4YBHB 4YGAA 2Y1NA 1F4QA 1WRLA 1CLMA 1OSAA 3LL8B 3WHUB 2EHBA 1LXFC 1BR4B 1OQPA 3AAKA 3KEVA 1SYMA 1V1FA 1JUOA 4GPLB 4CPVA 2TN4A 2IS9A 2V53A 1RWYA 1TCOB 3D0YB 1BR1B 2M1UA 4PHJA 5K89A 1B1GA 1CLLA 2LMUA 3BUXB 1CNPA 1WLZA 1QLKA 2M49B 1F4OA 2L5XB 1UHHA 4N1FA 4DCKA 3JTDC 3ZNIA 1TOPA 2JZIA 2GGZA 2OS8B 1XVJA 1RJVA 2JOJA 2LMVA 5ER5A 2FJUB 2HF5A 4I5KA 4M2PA 1JWDA 1KFUL 1NP8A 2L51A 3DVJA 1A75A 2O60A 4R1EA 1WRKA 3AKAA 4NDBA 2M8UA 1TN4A 2RGIA 4CFQA 2K7CA 1KCYA 1QS7A 3HCMA 3I5HB 5CSNA 1CFPA 3DF0B 2I7AA 4A4CA 2KI6D 2O5GA 1S36A 4PHKA 3HX4A 1DJWA 1S6CA 2JNFA 1RTP1 1UP5A 2Y5IA 3A4UB 1N0YA 1YURA 1YR5A 1YVHA 2WCBA 2QACA 3GK1A 4XYNA 4GBAA 3EK8A 2MJWB 1MF8B 3O6BA 1BJFA 2JC2A 2GV5A 2NLNA 1KK7Y 3NSLA 3PSRA 1TCFA 1J7OA 2OTGB 3IQOA 3CLNA 3OB2B 4JWQA 5AXIA 4M2OA 2OS8C 2MLFC 2KSPA 5CSJA 4WQ2A 1M63B 3PATA 1WDCC 1DGUA 2KI4C 3EVRA 2ZN9A 3M0WA 4GUKA 4NDDA 1DJXA 4U8DA 1MR8A 1EH2A 1A2XA 1JF0A 1M45A 1KWOC 2MAZA 1PALA 2Y1MA 1NCYA 3AAJA 4FTGA 1YTZC 2HQ8A 5HKWA 1PSBA 2FCDA 2CXJA 4YGDB 1LA0A 2MLEC 4GGFC 1SL8A 3D10A 3NXAA 2LVIA 4YI8A 2LLTA 3ZWHA 1B8LA 4HRGA 3EVVA 1MUXA 1FBVA 2BKHB 1NSHA 4D1EA 1OE9B 1SMGA 2KOTA 1PRWA 1MXEA 2JT3A 2AUCA 1SCMB 1NIWA 1SRAA 4ZCVA 2OTGC 1DJZA 1OMVA 2SCPA 5JJGA 3KPXA 4N5XA 1ZOTB 2M0RA 3KF9A 3I5GB 1AHRA 3K21A 1QATA 2ZRTA 2DOQA 2P6BB 2QPTA 3PFVA 1S6JA 1LKJA 2JWWA 1QVIZ 2A4JA 4I5LB 4BY4A 3LK1A 4AQJA 1NUBA 1QVIY 1M39A 4MRYA 4E68A 3WHTB 2F8PA 1NWDA 5GQQC 2ZNEA 1QXPA 1TIZA 3VRNA 1GQMA 1K93D 2E6WA 1H4BA 2LANA 1S5GZ 2LHLA 5HKZA 1S5GY 1HQVA 3E3RA 1DJYA 2I94A 2LC5A 1YUSA 1QTXA 1WRZA 1KFXS 2BCXA 2KQYA 2KYFA 4MSPA 1QJTA 3I5IC 1SCMC 3I5FC 1F70A 1NCZA 3BUMB 2CT9A 3CR2A 1FPWA 3LK0A 1OZOA 1S3PA 2LUXA 3BOWA 3SG6A 3JTDB 1N2DA 1UHIA 2Q4UA 1PULA 3I5GC 1Q80A 1DGVA 4C0LA 2F3YA 5B8IB 2PASA 3H4SE 1X02A 3FWCA 3VROA 1RK9A 3BUWB 2K61A 3GOFA 2WCFA 5I2QA 1XA5A 1NX2A 1AUIB 1G33A 1DF0B 1TTXA 2NCOA 1ALVA 1DJHA 3D0YA 3MSEB 1K95A 2FCEA 5DKNA 4C0KA 1Y6WA 1QIVA 1UUSA 1BODA 1N65A 1OOJA 3NSOA 4MRXA 3BQ3A 3VRQA 1DMOA 1K9PA 3EK7A 3SIBA 1EG4A 1VRKA 2PMYA 5HYDA 3TDIA 1J7RA 2WCEA 1K96A 2FOTA 4PE7A 1TRFA 1CKKA 5I2OA 1CDNA 2BBNA 4FQOA 4I5JA 1WDCB 4YGBB 3DVKA 3GK2A 1K90D 2KI4B 4BY5A 4DS7A 2K2FA 4TNCA 2KBMA 1B7TZ 2KI6C 1KWOB 1B7TY 3BUNB 3VGOA 1CMGA 3VRRA 3CR4X 1FI6A 4MEWA 2BCBA 3DF0A 3OHMB 1XO5A 1QX2A 2LNKA 2JNXA 1GGZA 3JVTC 3NSKA 4CFRA 1IKUA 5TNCA 2ZKMX 1SW8A 1CTRA 2M7NA 1KK7Z 2K8MB 2L50A 2H61C 4PE4A 3SG3A 1W7JB 3OP0A 5BPJA 5I8NA 1WY9A 1SR6C 2LM5A 1K2HA 1S26D 1BOCA 2M7LA 2HETA 3QRXA 4GNKB 4MVFA 1AJ5A 1MQ1A 1ZUZA 1RROA 4GAOA 4OR9B 3WXAA 1U5IB 1EG3A 2BE4A 2F33A 2LHIA 1XK4A 2LVJA 1UHJA 1UWOA 1JBAA 3TZ1A 1OMDA 2LVKA 4HRHA 2BL0C 4F0ZB 1AP4A 1DJGA 4ETOA 3IQQA 1KSMA 2LLUA 1QASA 2GGMA 1J1DA 3O2PA 5KSZA 5ER4X 2LLSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGR A;  2L4I A;  1R6P A;  3KHE A;  3I5F B;  3I5I B;  3O78 A;  1BMO A;  1DJI A;  2KDH A;  1A4P A;  4HRE E;  1SL9 A;  2D8N A;  2LV7 A;  2KFH A;  2K7O A;  2LVV A;  4OCI A;  2KNE A;  3TDZ A;  2Q91 A;  2AAO A;  2G2B A;  5F6T A;  2BEC A;  3EK4 A;  4JQ0 D;  3TUY C;  2WOS A;  5DKR A;  2ZRS A;  5AER A;  4USL A;  2M3W A;  1MWN A;  4MZK A;  1KK8 C;  1SBJ A;  2HQW A;  1KFX L;  1CFC A;  2NZ0 A;  2L2E A;  1EJ3 A;  1B9A A;  4ORB B;  1B8C A;  1EXR A;  5JOL A;  1LIN A;  4XJK B;  1BLQ A;  2WC8 A;  2LUC A;  1YUU A;  1CLB A;  5AAN A;  1TNX A;  2JUL A;  2L0P A;  1J55 A;  1G4Y R;  5PAL A;  4WRI A;  1PVA A;  1K8U A;  1M31 A;  1IQ5 A;  1AVS A;  2JRF A;  2K7B A;  4PE0 A;  2F2O A;  4M2Q A;  1ZAC A;  1W7I B;  2PAL A;  2ZND A;  1K94 A;  2KFG A;  5DKQ A;  1AK8 A;  2KAV A;  4PHM A;  3DVE A;  2SAS A;  4YGC B;  1NX0 A;  4GGN A;  1RFJ A;  2CNP A;  1LA3 A;  5D7F A;  5G08 A;  1K9U A;  1JSA A;  1JFK A;  5AEQ A;  1GJY A;  3EVU A;  4ZCU A;  4GFT A;  2LP2 A;  1Y1A A;  3OB1 B;  3EKH A;  2BE6 A;  2CBL A;  2LP3 A;  2M97 A;  2PSR A;  1C7W A;  1SNL A;  1CDM A;  2I18 A;  3LLE A;  1Y1X A;  2F3Z A;  3O4Y A;  2ISD A;  2JTZ A;  1S1E A;  2BCA A;  1JF2 A;  1YRU B;  1DF0 A;  2K2A A;  1B8R A;  4ORA B;  1H8B A;  3FS7 A;  1D1O A;  3CS1 A;  2LCP A;  3JVT B;  3IF7 A;  1K9K A;  1IG5 A;  1XFV O;  1KQV A;  1UUR A;  1CM4 A;  1A03 A;  4L9M A;  1J7Q A;  1NYA A;  2JXL A;  1UHN A;  2EC6 C;  3RM1 A;  4OKH A;  4P5O E;  1ZMZ A;  4YI9 A;  1ALW A;  1R2U A;  3AKB A;  1Y1U A;  1SR6 B;  1SKT A;  3TDU A;  1L2O C;  1L7Z A;  1SK6 D;  1CDP A;  3BUO B;  4YGE B;  4Q04 A;  1IGV A;  2K7D A;  3SG5 A;  4A4B A;  4NQG A;  1C7V A;  1ZFS A;  2KAY A;  2M1K B;  2BBM A;  1KQM C;  1IH0 A;  1IJ5 A;  3PN7 C;  2F2P A;  2E30 A;  3CR5 X;  5HLV A;  3ICB A;  1BF5 A;  2JT0 A;  1IWQ A;  1M46 A;  2KHN A;  3BXK A;  1BU3 A;  4GGF A;  3VRP A;  5CSF A;  2BL0 B;  2CTN A;  3FIA A;  4NDC A;  1E8A A;  1IRJ A;  1REC A;  3EKJ A;  3TS5 B;  1FW4 A;  4QJ5 B;  1CFD A;  2L4H A;  2MHH A;  1YRT B;  1V1G A;  2PRU A;  2G9B A;  2LMT A;  1BT6 A;  2OPO A;  1AJ4 A;  2COL B;  1IQ3 A;  2KFF A;  4ORC B;  5KTY A;  1A75 B;  4MN0 A;  1YUT A;  1NX3 A;  2KGB C;  1NCX A;  1QX7 A;  1F8H A;  1CDL A;  4JPZ B;  1TNW A;  1U5I A;  1LVC D;  3C1V A;  1PVB A;  1KFU S;  1FF1 A;  3LCP C;  3TUY B;  1QLS A;  2HPS A;  2AMI A;  1QV1 A;  1J7P A;  4QJ3 B;  1KK8 B;  2Y4Q A;  2ZN8 A;  4PHN A;  3WNX B;  4QJ4 B;  3DD4 A;  2MRD A;  3RLZ A;  4OVN F;  3CGA A;  3TS5 C;  1CMF A;  1XFW O;  1KSO A;  2JQ6 A;  2LAP A;  1MHO A;  1ODB A;  3SG2 A;  4PCW A;  5CSI A;  2JXC A;  3PLF B;  1JFJ A;  1NX1 A;  2CCM A;  1CM1 A;  4IL1 A;  1QIW A;  1DTL A;  1YX8 A;  2KQ6 A;  1SL7 A;  3PAL A;  3SG7 A;  4WQ3 A;  3GK4 X;  5AFP A;  5I2L A;  5FYX A;  2NXQ A;  2VRG A;  4DRW A;  5HKY A;  1A29 A;  1SY9 A;  1Y0V H;  1UHK A;  5HLO A;  3I5H C;  4MZL A;  3CTN A;  4AOM A;  1C07 A;  2JTT A;  1NPQ A;  1G8I A;  3PM8 A;  4UPG A;  1B47 A;  5KU1 A;  3OX5 A;  3BYA A;  2PVB A;  1HT9 A;  1XFZ O;  2MA2 A;  1XYD A;  4XJK A;  1OMR A;  2H2K A;  3FWB A;  4PDZ A;  1S6I A;  4ICB A;  1QV0 A;  1DVI A;  2KYC A;  4AQI A;  3NSI A;  4PAL A;  2BKI B;  3SJS A;  1F54 A;  1F71 A;  4MZJ A;  4PE1 A;  1EL4 A;  1YVL A;  3OX6 A;  4DIR A;  1CB1 A;  1XFY O;  2EC6 B;  2MBX A;  1B4C A;  4OV2 A;  4CID A;  1JC2 A;  2I2R E;  1PSR A;  1FI5 A;  3F45 A;  1BG1 A;  1QX5 B;  1F55 A;  4MLW A;  1SPY A;  1L2O B;  4P2Y B;  1XK4 C;  2WOR A;  2EGD A;  1XFU O;  2JT8 A;  2WND A;  4HSZ A;  2JPT A;  1MXL C;  3SG4 A;  1PK0 D;  2K0J A;  1DT7 B;  1GGW A;  1SCV A;  5J3X A;  3DVM A;  2JU0 A;  2B1U A;  1TNP A;  1XFX O;  4C0J A;  1WLM A;  1KQM B;  1IJ6 A;  2M29 A;  3PN7 B;  2L98 A;  3KO0 A;  1OZS A;  4N1G A;  1CFF A;  4YRU A;  2NCP A;  4MBE A;  3CZT X;  4DUQ A;  4CLN A;  2M9G A;  3SIA A;  2KBI A;  1YX7 A;  5D69 A;  3BOW B;  4I5N B;  1J1E A;  2LE9 B;  2H61 A;  2ZFD A;  3A8R A;  2KAX A;  1TNQ A;  5IBW A;  5CPV A;  2R2I A;  3CWG A;  4YBH B;  4YGA A;  2Y1N A;  1F4Q A;  1WRL A;  1CLM A;  1OSA A;  3LL8 B;  3WHU B;  2EHB A;  1LXF C;  1BR4 B;  1OQP A;  3AAK A;  3KEV A;  1SYM A;  1V1F A;  1JUO A;  4GPL B;  4CPV A;  2TN4 A;  2IS9 A;  2V53 A;  1RWY A;  1TCO B;  3D0Y B;  1BR1 B;  2M1U A;  4PHJ A;  5K89 A;  1B1G A;  1CLL A;  2LMU A;  3BUX B;  1CNP A;  1WLZ A;  1QLK A;  2M49 B;  1F4O A;  2L5X B;  1UHH A;  4N1F A;  4DCK A;  3JTD C;  3ZNI A;  1TOP A;  2JZI A;  2GGZ A;  2OS8 B;  1XVJ A;  1RJV A;  2JOJ A;  2LMV A;  5ER5 A;  2FJU B;  2HF5 A;  4I5K A;  4M2P A;  1JWD A;  1KFU L;  1NP8 A;  2L51 A;  3DVJ A;  1A75 A;  2O60 A;  4R1E A;  1WRK A;  3AKA A;  4NDB A;  2M8U A;  1TN4 A;  2RGI A;  4CFQ A;  2K7C A;  1KCY A;  1QS7 A;  3HCM A;  3I5H B;  5CSN A;  1CFP A;  3DF0 B;  2I7A A;  4A4C A;  2KI6 D;  2O5G A;  1S36 A;  4PHK A;  3HX4 A;  1DJW A;  1S6C A;  2JNF A;  1RTP 1;  1UP5 A;  2Y5I A;  3A4U B;  1N0Y A;  1YUR A;  1YR5 A;  1YVH A;  2WCB A;  2QAC A;  3GK1 A;  4XYN A;  4GBA A;  3EK8 A;  2MJW B;  1MF8 B;  3O6B A;  1BJF A;  2JC2 A;  2GV5 A;  2NLN A;  1KK7 Y;  3NSL A;  3PSR A;  1TCF A;  1J7O A;  2OTG B;  3IQO A;  3CLN A;  3OB2 B;  4JWQ A;  5AXI A;  4M2O A;  2OS8 C;  2MLF C;  2KSP A;  5CSJ A;  4WQ2 A;  1M63 B;  3PAT A;  1WDC C;  1DGU A;  2KI4 C;  3EVR A;  2ZN9 A;  3M0W A;  4GUK A;  4NDD A;  1DJX A;  4U8D A;  1MR8 A;  1EH2 A;  1A2X A;  1JF0 A;  1M45 A;  1KWO C;  2MAZ A;  1PAL A;  2Y1M A;  1NCY A;  3AAJ A;  4FTG A;  1YTZ C;  2HQ8 A;  5HKW A;  1PSB A;  2FCD A;  2CXJ A;  4YGD B;  1LA0 A;  2MLE C;  4GGF C;  1SL8 A;  3D10 A;  3NXA A;  2LVI A;  4YI8 A;  2LLT A;  3ZWH A;  1B8L A;  4HRG A;  3EVV A;  1MUX A;  1FBV A;  2BKH B;  1NSH A;  4D1E A;  1OE9 B;  1SMG A;  2KOT A;  1PRW A;  1MXE A;  2JT3 A;  2AUC A;  1SCM B;  1NIW A;  1SRA A;  4ZCV A;  2OTG C;  1DJZ A;  1OMV A;  2SCP A;  5JJG A;  3KPX A;  4N5X A;  1ZOT B;  2M0R A;  3KF9 A;  3I5G B;  1AHR A;  3K21 A;  1QAT A;  2ZRT A;  2DOQ A;  2P6B B;  2QPT A;  3PFV A;  1S6J A;  1LKJ A;  2JWW A;  1QVI Z;  2A4J A;  4I5L B;  4BY4 A;  3LK1 A;  4AQJ A;  1NUB A;  1QVI Y;  1M39 A;  4MRY A;  4E68 A;  3WHT B;  2F8P A;  1NWD A;  5GQQ C;  2ZNE A;  1QXP A;  1TIZ A;  3VRN A;  1GQM A;  1K93 D;  2E6W A;  1H4B A;  2LAN A;  1S5G Z;  2LHL A;  5HKZ A;  1S5G Y;  1HQV A;  3E3R A;  1DJY A;  2I94 A;  2LC5 A;  1YUS A;  1QTX A;  1WRZ A;  1KFX S;  2BCX A;  2KQY A;  2KYF A;  4MSP A;  1QJT A;  3I5I C;  1SCM C;  3I5F C;  1F70 A;  1NCZ A;  3BUM B;  2CT9 A;  3CR2 A;  1FPW A;  3LK0 A;  1OZO A;  1S3P A;  2LUX A;  3BOW A;  3SG6 A;  3JTD B;  1N2D A;  1UHI A;  2Q4U A;  1PUL A;  3I5G C;  1Q80 A;  1DGV A;  4C0L A;  2F3Y A;  5B8I B;  2PAS A;  3H4S E;  1X02 A;  3FWC A;  3VRO A;  1RK9 A;  3BUW B;  2K61 A;  3GOF A;  2WCF A;  5I2Q A;  1XA5 A;  1NX2 A;  1AUI B;  1G33 A;  1DF0 B;  1TTX A;  2NCO A;  1ALV A;  1DJH A;  3D0Y A;  3MSE B;  1K95 A;  2FCE A;  5DKN A;  4C0K A;  1Y6W A;  1QIV A;  1UUS A;  1BOD A;  1N65 A;  1OOJ A;  3NSO A;  4MRX A;  3BQ3 A;  3VRQ A;  1DMO A;  1K9P A;  3EK7 A;  3SIB A;  1EG4 A;  1VRK A;  2PMY A;  5HYD A;  3TDI A;  1J7R A;  2WCE A;  1K96 A;  2FOT A;  4PE7 A;  1TRF A;  1CKK A;  5I2O A;  1CDN A;  2BBN A;  4FQO A;  4I5J A;  1WDC B;  4YGB B;  3DVK A;  3GK2 A;  1K90 D;  2KI4 B;  4BY5 A;  4DS7 A;  2K2F A;  4TNC A;  2KBM A;  1B7T Z;  2KI6 C;  1KWO B;  1B7T Y;  3BUN B;  3VGO A;  1CMG A;  3VRR A;  3CR4 X;  1FI6 A;  4MEW A;  2BCB A;  3DF0 A;  3OHM B;  1XO5 A;  1QX2 A;  2LNK A;  2JNX A;  1GGZ A;  3JVT C;  3NSK A;  4CFR A;  1IKU A;  5TNC A;  2ZKM X;  1SW8 A;  1CTR A;  2M7N A;  1KK7 Z;  2K8M B;  2L50 A;  2H61 C;  4PE4 A;  3SG3 A;  1W7J B;  3OP0 A;  5BPJ A;  5I8N A;  1WY9 A;  1SR6 C;  2LM5 A;  1K2H A;  1S26 D;  1BOC A;  2M7L A;  2HET A;  3QRX A;  4GNK B;  4MVF A;  1AJ5 A;  1MQ1 A;  1ZUZ A;  1RRO A;  4GAO A;  4OR9 B;  3WXA A;  1U5I B;  1EG3 A;  2BE4 A;  2F33 A;  2LHI A;  1XK4 A;  2LVJ A;  1UHJ A;  1UWO A;  1JBA A;  3TZ1 A;  1OMD A;  2LVK A;  4HRH A;  2BL0 C;  4F0Z B;  1AP4 A;  1DJG A;  4ETO A;  3IQQ A;  1KSM A;  2LLU A;  1QAS A;  2GGM A;  1J1D A;  3O2P A;  5KSZ A;  5ER4 X;  2LLS A; 
#chains in the Genus database with same CATH topology
 2KGR A;  2L4I A;  1R6P A;  3KHE A;  3I5F B;  3I5I B;  3O78 A;  1BMO A;  1DJI A;  2KDH A;  1A4P A;  4FQT A;  4HRE E;  1SL9 A;  4JD9 A;  2D8N A;  2LV7 A;  2KFH A;  2P70 A;  2K7O A;  2LVV A;  3CYZ A;  4OCI A;  2KNE A;  3TDZ A;  2Q91 A;  3DZT A;  2AAO A;  2G2B A;  5F6T A;  2BEC A;  2QEH A;  3EK4 A;  4JQ0 D;  3TUY C;  2WOS A;  4OZD A;  5DKR A;  2ZRS A;  5AER A;  2L2C A;  4USL A;  2M3W A;  2QEB A;  1MWN A;  4MZK A;  1KK8 C;  1SBJ A;  2HQW A;  1KFX L;  1CFC A;  2NZ0 A;  2L2E A;  1EJ3 A;  1B9A A;  4ORB B;  1B8C A;  1EXR A;  2JPO A;  5JOL A;  1LIN A;  4XJK B;  1BLQ A;  2WC8 A;  2LUC A;  1YUU A;  1CLB A;  5AAN A;  1TNX A;  2JUL A;  2L0P A;  1J55 A;  1G4Y R;  5PAL A;  4WRI A;  4F7F A;  1PVA A;  1K8U A;  1M31 A;  1IQ5 A;  1AVS A;  1OOG A;  2JRF A;  2K7B A;  3D77 A;  4PE0 A;  2F2O A;  3QME A;  4M2Q A;  1ZAC A;  1W7I B;  2PAL A;  4KYN A;  2ZND A;  1K94 A;  2KFG A;  5DKQ A;  1AK8 A;  2KAV A;  4PHM A;  3DVE A;  2SAS A;  4YGC B;  3DXL A;  1NX0 A;  4GGN A;  1RFJ A;  2CNP A;  1LA3 A;  5D7F A;  5G08 A;  1K9U A;  1JSA A;  1JFK A;  5AEQ A;  1GJY A;  3EVU A;  4ZCU A;  4GFT A;  2LP2 A;  1Y1A A;  3OB1 B;  3EKH A;  2BE6 A;  2CBL A;  2LP3 A;  2M97 A;  2PSR A;  1C7W A;  1SNL A;  5FI2 A;  4PT1 A;  1CDM A;  2I18 A;  3LLE A;  3BFA A;  1Y1X A;  2F3Z A;  3O4Y A;  2ISD A;  2JTZ A;  1S1E A;  2BCA A;  1JF2 A;  1YRU B;  2WCH A;  1DF0 A;  2K2A A;  1B8R A;  4ORA B;  2FJY A;  1H8B A;  3FS7 A;  1D1O A;  3CS1 A;  2LCP A;  3JVT B;  3IF7 A;  1K9K A;  1IG5 A;  3S0G A;  1XFV O;  1KQV A;  1UUR A;  1CM4 A;  1A03 A;  4L9M A;  1J7Q A;  1NYA A;  2JXL A;  1UHN A;  2EC6 C;  3RM1 A;  4OKH A;  4P5O E;  1ZMZ A;  4YI9 A;  1ALW A;  3BJH A;  1R2U A;  3AKB A;  1Y1U A;  1SR6 B;  1SKT A;  3TDU A;  1L2O C;  1GM0 A;  1L7Z A;  1SK6 D;  1CDP A;  3BUO B;  4YGE B;  4Q04 A;  1IGV A;  2K7D A;  3SG5 A;  4A4B A;  4NQG A;  1C7V A;  1ZFS A;  3N7H A;  2KAY A;  2M1K B;  2BBM A;  1KQM C;  1C3Y A;  1IH0 A;  1IJ5 A;  3PN7 C;  2F2P A;  2E30 A;  3CR5 X;  2WC6 A;  5HLV A;  3ICB A;  1BF5 A;  2JT0 A;  1IWQ A;  1M46 A;  2KHN A;  3BXK A;  1BU3 A;  4GGF A;  3VRP A;  1IIO A;  5CSF A;  2BL0 B;  2CTN A;  3FIA A;  3L47 A;  1E8A A;  1IRJ A;  4NDC A;  1REC A;  3EKJ A;  2H8V A;  1FW4 A;  3TS5 B;  3NGV A;  4QJ5 B;  1CFD A;  2L4H A;  2MHH A;  1YRT B;  1V1G A;  2PRU A;  2G9B A;  2L5Y A;  2LMT A;  3S0B A;  1BT6 A;  3UO9 A;  2BNX A;  1AJ4 A;  2COL B;  2OPO A;  1IQ3 A;  2KFF A;  4ORC B;  5KTY A;  3IVT A;  1A75 B;  3SS3 A;  4MN0 A;  3L4L A;  1YUT A;  3PM2 A;  1NX3 A;  2KGB C;  1NCX A;  1QX7 A;  1F8H A;  1CDL A;  4JPZ B;  1TNW A;  1U5I A;  1LVC D;  3C1V A;  1PVB A;  1KFU S;  1FF1 A;  3LCP C;  3TUY B;  1QLS A;  2HPS A;  2AMI A;  1QV1 A;  1J7P A;  4QJ3 B;  1KK8 B;  2Y4Q A;  2ZN8 A;  4PHN A;  3WNX B;  3BFB A;  4QJ4 B;  3DD4 A;  2MRD A;  5FI7 A;  3RLZ A;  4OVN F;  3CGA A;  3TS5 C;  1CMF A;  1XFW O;  1KSO A;  2JQ6 A;  2LAP A;  1MHO A;  1ODB A;  2PYQ A;  3B87 A;  3SG2 A;  4PCW A;  5CSI A;  2JXC A;  3PLF B;  1JFJ A;  1NX1 A;  2CCM A;  1CM1 A;  4IL1 A;  1QIW A;  1DTL A;  1YX8 A;  2KQ6 A;  1SL7 A;  3PAL A;  3SG7 A;  5HL1 A;  4WQ3 A;  3GK4 X;  5AFP A;  2K60 A;  1TUJ A;  5I2L A;  5FYX A;  2NXQ A;  2VRG A;  4DRW A;  5HKY A;  1A29 A;  1SY9 A;  1Y0V H;  1UHK A;  5HLO A;  3I5H C;  4MZL A;  3CTN A;  4AOM A;  1C07 A;  1TWO A;  2JTT A;  1NPQ A;  1G8I A;  2GTE A;  3CAB A;  3CZ0 A;  3PM8 A;  4UPG A;  1B47 A;  3S0E A;  3OX5 A;  5KU1 A;  3BYA A;  3Q8I A;  2PVB A;  1HT9 A;  1QWV A;  1XFZ O;  2MA2 A;  1XYD A;  5D3O A;  3NHT A;  1OMR A;  2H2K A;  3FWB A;  2WCM A;  1S6I A;  4PDZ A;  4XJK A;  4ICB A;  1QV0 A;  1DVI A;  2KYC A;  4AQI A;  3NSI A;  4PAL A;  2BKI B;  3D75 A;  3S0D A;  3SJS A;  1F54 A;  1F71 A;  4MZJ A;  4PE1 A;  1EL4 A;  1YVL A;  3FE8 A;  3OX6 A;  4DIR A;  1CB1 A;  1XFY O;  2EC6 B;  2MBX A;  1DEL A;  4OV2 A;  1B4C A;  4CID A;  1JC2 A;  2I2R E;  1PSR A;  1FI5 A;  3F45 A;  1BG1 A;  3BFH A;  1QX5 B;  1F55 A;  4MLW A;  1SPY A;  1L2O B;  4P2Y B;  1XK4 C;  2WOR A;  2EGD A;  1XFU O;  2JT8 A;  2WND A;  4HSZ A;  2JPT A;  1MXL C;  3SG4 A;  1PK0 D;  2K0J A;  1DT7 B;  1GGW A;  1SCV A;  5J3X A;  3DVM A;  2JU0 A;  1TNP A;  1XFX O;  2B1U A;  4C0J A;  2QDI A;  1WLM A;  1KQM B;  1IJ6 A;  2M29 A;  3PN7 B;  2L98 A;  3KO0 A;  1OZS A;  4INW A;  4N1G A;  1CFF A;  4YRU A;  1W9Z A;  2NCP A;  4MBE A;  3CZT X;  4DUQ A;  4CLN A;  2YGU A;  2M9G A;  3SIA A;  2KBI A;  1YX7 A;  4INX A;  3BOW B;  5D69 A;  4I5N B;  1J1E A;  2LE9 B;  2H61 A;  2ZFD A;  3A8R A;  5FI6 A;  2KAX A;  1TNQ A;  5IBW A;  5CPV A;  2R2I A;  3CWG A;  4YBH B;  4YGA A;  2Y1N A;  1F4Q A;  3D74 A;  1WRL A;  1CLM A;  1OSA A;  3LL8 B;  3WHU B;  3S0F A;  2EHB A;  1LXF C;  1BR4 B;  1OQP A;  3AAK A;  3KEV A;  1SYM A;  1V1F A;  1JUO A;  4GPL B;  4CPV A;  2TN4 A;  2IS9 A;  2V53 A;  1RWY A;  1TCO B;  2QEO A;  3FE6 A;  3NHI A;  3D0Y B;  1BR1 B;  2M1U A;  4PHJ A;  5K89 A;  1DEK A;  1B1G A;  1CLL A;  2LMU A;  3BUX B;  1CNP A;  3V2L A;  1WLZ A;  1QLK A;  3L4A A;  2M49 B;  1F4O A;  2L5X B;  1UHH A;  4N1F A;  3DY9 A;  4DCK A;  3JTD C;  3ZNI A;  1TOP A;  2JZI A;  2GGZ A;  2OS8 B;  1XVJ A;  1RJV A;  2JOJ A;  2LMV A;  5ER5 A;  2FJU B;  2HF5 A;  4I5K A;  4M2P A;  1Z4H A;  1KFU L;  1JWD A;  1NP8 A;  3B86 A;  2L51 A;  3DVJ A;  1A75 A;  2O60 A;  4R1E A;  1WRK A;  1XFR A;  3AKA A;  3VB1 A;  4NDB A;  2M8U A;  1TN4 A;  2RGI A;  4CFQ A;  2K7C A;  1KCY A;  1QS7 A;  3HCM A;  3I5H B;  5CSN A;  1CFP A;  3B6X A;  3DF0 B;  2I7A A;  4A4C A;  2KI6 D;  2O5G A;  1S36 A;  4PHK A;  3HX4 A;  1DJW A;  1S6C A;  2JNF A;  1RTP 1;  1UP5 A;  2Y5I A;  3A4U B;  3K1E A;  1N0Y A;  1YUR A;  1YR5 A;  1YVH A;  2WCB A;  2QAC A;  3GK1 A;  4XYN A;  4GBA A;  1OW4 A;  3EK8 A;  2MJW B;  1MF8 B;  2ERB A;  1Z2C B;  1BJF A;  2JC2 A;  3O6B A;  2GV5 A;  2NLN A;  1KK7 Y;  3NSL A;  3PSR A;  1TCF A;  3EG5 B;  1J7O A;  2OTG B;  3IQO A;  3CLN A;  3OB2 B;  4JWQ A;  5AXI A;  4M2O A;  2OS8 C;  3S0A A;  2MLF C;  2KSP A;  5CSJ A;  4WQ2 A;  1M63 B;  3PAT A;  1WDC C;  1DGU A;  2KI4 C;  3EVR A;  5DIC A;  1LS8 A;  2ZN9 A;  3M0W A;  3R1O A;  4GUK A;  4NDD A;  1DJX A;  4U8D A;  1MR8 A;  1EH2 A;  1A2X A;  1JF0 A;  1M45 A;  1KWO C;  2MAZ A;  1PAL A;  2Y1M A;  1NCY A;  3AAJ A;  4FTG A;  1YTZ C;  2HQ8 A;  5HKW A;  1PSB A;  2FCD A;  2CXJ A;  4YGD B;  1LA0 A;  2MLE C;  4GGF C;  2QEV A;  1SL8 A;  3D10 A;  3NXA A;  2LVI A;  4YI8 A;  2LLT A;  3ZWH A;  1B8L A;  3O4X A;  2WCK A;  3EVV A;  1MUX A;  4HRG A;  1FBV A;  2BKH B;  1NSH A;  4D1E A;  1OE9 B;  1SMG A;  2KOT A;  1PRW A;  1MXE A;  2JT3 A;  2AUC A;  3PJI A;  1SCM B;  1NIW A;  1SRA A;  2P71 A;  2OTG C;  3OBV A;  4ZCV A;  1DJZ A;  1OMV A;  2KLD A;  2SCP A;  3KPX A;  5JJG A;  4N5X A;  1SSE B;  1ZOT B;  2M0R A;  3KF9 A;  3I5G B;  1AHR A;  3K21 A;  1QAT A;  2ZRT A;  2DOQ A;  2P6B B;  2QPT A;  3PFV A;  1S6J A;  1LKJ A;  2JWW A;  3OGN A;  1QVI Z;  2A4J A;  4I5L B;  4BY4 A;  3LK1 A;  4AQJ A;  1NUB A;  1QVI Y;  1M39 A;  4MRY A;  1TUZ A;  3WHT B;  2F8P A;  4E68 A;  1NWD A;  5GQQ C;  2ZNE A;  1QXP A;  1TIZ A;  3VRN A;  1GQM A;  1K93 D;  2E6W A;  3D76 A;  3R72 A;  2LAN A;  1H4B A;  1S5G Z;  2LHL A;  1OOI X;  5HKZ A;  1S5G Y;  1HQV A;  3E3R A;  1DJY A;  3DYE A;  3FE9 A;  2I94 A;  2LC5 A;  1YUS A;  1QTX A;  2WCJ A;  1WRZ A;  1KFX S;  2BCX A;  2KQY A;  2KYF A;  4MSP A;  1QJT A;  3I5I C;  1SCM C;  3I5F C;  1F70 A;  1NCZ A;  3BUM B;  2CT9 A;  3CR2 A;  1FPW A;  3LK0 A;  1OZO A;  2KLE A;  1S3P A;  2LUX A;  3CZ2 A;  3BOW A;  3SG6 A;  3JTD B;  1N2D A;  1UHI A;  2Q4U A;  1PUL A;  3I5G C;  1Q80 A;  1DGV A;  4C0L A;  2WC5 A;  5I94 A;  2F3Y A;  3UNW A;  5B8I B;  2PAS A;  3H4S E;  1X02 A;  3FWC A;  3VRO A;  1RK9 A;  3BUW B;  2K61 A;  1C3Z A;  2WCF A;  3GOF A;  5I2Q A;  1XA5 A;  1NX2 A;  1AUI B;  1G33 A;  1DF0 B;  1TTX A;  2NCO A;  1ALV A;  1DJH A;  3D0Y A;  3MSE B;  1K95 A;  2FCE A;  5DKN A;  4C0K A;  1DQE A;  1QIV A;  1Y6W A;  1UUS A;  1BOD A;  1T14 A;  1N65 A;  1OOJ A;  3NSO A;  2BAP A;  4MRX A;  3BQ3 A;  3VRQ A;  1DMO A;  1K9P A;  3EK7 A;  3SIB A;  1EG4 A;  1VRK A;  2PMY A;  3R1P A;  2PQL A;  5HYD A;  3TDI A;  1J7R A;  2WCE A;  1K96 A;  2FOT A;  4PE7 A;  1TRF A;  3RZS A;  1CKK A;  5I2O A;  1CDN A;  2BBN A;  4FQO A;  4I5J A;  1WDC B;  4IJ7 A;  3DVK A;  3GK2 A;  4YGB B;  1K90 D;  2KI4 B;  4BY5 A;  4DS7 A;  3B7A A;  3CDN A;  2K2F A;  4TNC A;  2KBM A;  1B7T Z;  2KI6 C;  1KWO B;  1B7T Y;  3BUN B;  3VGO A;  1CMG A;  3VRR A;  3CR4 X;  1FI6 A;  4MEW A;  2BCB A;  3DF0 A;  3OHM B;  1XO5 A;  1QX2 A;  2LNK A;  2JNX A;  1OOF A;  1GGZ A;  3JVT C;  3CZ1 A;  3NSK A;  4CFR A;  1IKU A;  3B88 A;  5TNC A;  2ZKM X;  1SW8 A;  1CTR A;  1ORG A;  2M7N A;  1KK7 Z;  3D73 A;  2K8M B;  2L50 A;  2H61 C;  4PE4 A;  3SG3 A;  1W7J B;  4JKT A;  3OP0 A;  5BPJ A;  5I8N A;  1WY9 A;  1SR6 C;  2LM5 A;  3SS5 A;  1K2H A;  1S26 D;  1DC1 A;  1BOC A;  2M7L A;  2HET A;  3QRX A;  4GNK B;  4MVF A;  1AJ5 A;  1MQ1 A;  1ZUZ A;  1RRO A;  4GAO A;  4OR9 B;  3WXA A;  2WCL A;  1U5I B;  1EG3 A;  2BE4 A;  2F33 A;  2LHI A;  1XK4 A;  3SS4 A;  2LVJ A;  1UHJ A;  1UWO A;  1JBA A;  3TZ1 A;  1P28 A;  3R1V A;  1OOH A;  1OMD A;  2KPH A;  2LVK A;  4HRH A;  2BL0 C;  4F0Z B;  5EL2 A;  1AP4 A;  3D78 A;  1DJG A;  4ETO A;  3IQQ A;  1KSM A;  2LLU A;  1QAS A;  2GGM A;  1J1D A;  3O2P A;  5KSZ A;  5ER4 X;  2LLS A; 
#chains in the Genus database with same CATH homology
 2KGR A;  2L4I A;  1R6P A;  3KHE A;  3I5F B;  3I5I B;  3O78 A;  1BMO A;  1DJI A;  2KDH A;  1A4P A;  4HRE E;  1SL9 A;  2D8N A;  2LV7 A;  2KFH A;  2K7O A;  2LVV A;  4OCI A;  2KNE A;  3TDZ A;  2Q91 A;  2AAO A;  2G2B A;  5F6T A;  2BEC A;  3EK4 A;  4JQ0 D;  3TUY C;  2WOS A;  5DKR A;  2ZRS A;  5AER A;  4USL A;  2M3W A;  1MWN A;  4MZK A;  1KK8 C;  1SBJ A;  2HQW A;  1KFX L;  1CFC A;  2NZ0 A;  2L2E A;  1EJ3 A;  1B9A A;  4ORB B;  1B8C A;  1EXR A;  5JOL A;  1LIN A;  4XJK B;  1BLQ A;  2WC8 A;  2LUC A;  1YUU A;  1CLB A;  5AAN A;  1TNX A;  2JUL A;  2L0P A;  1J55 A;  1G4Y R;  5PAL A;  4WRI A;  1PVA A;  1K8U A;  1M31 A;  1IQ5 A;  1AVS A;  2JRF A;  2K7B A;  4PE0 A;  2F2O A;  4M2Q A;  1ZAC A;  1W7I B;  2PAL A;  2ZND A;  1K94 A;  2KFG A;  5DKQ A;  1AK8 A;  2KAV A;  4PHM A;  3DVE A;  2SAS A;  4YGC B;  1NX0 A;  4GGN A;  1RFJ A;  2CNP A;  1LA3 A;  5D7F A;  5G08 A;  1K9U A;  1JSA A;  1JFK A;  5AEQ A;  1GJY A;  3EVU A;  4ZCU A;  4GFT A;  2LP2 A;  1Y1A A;  3OB1 B;  3EKH A;  2BE6 A;  2CBL A;  2LP3 A;  2M97 A;  2PSR A;  1C7W A;  1SNL A;  1CDM A;  2I18 A;  3LLE A;  1Y1X A;  2F3Z A;  3O4Y A;  2ISD A;  2JTZ A;  1S1E A;  2BCA A;  1JF2 A;  1YRU B;  1DF0 A;  2K2A A;  1B8R A;  4ORA B;  1H8B A;  3FS7 A;  1D1O A;  3CS1 A;  2LCP A;  3JVT B;  3IF7 A;  1K9K A;  1IG5 A;  1XFV O;  1KQV A;  1UUR A;  1CM4 A;  1A03 A;  4L9M A;  1J7Q A;  1NYA A;  2JXL A;  1UHN A;  2EC6 C;  3RM1 A;  4OKH A;  4P5O E;  1ZMZ A;  4YI9 A;  1ALW A;  1R2U A;  3AKB A;  1Y1U A;  1SR6 B;  1SKT A;  3TDU A;  1L2O C;  1L7Z A;  1SK6 D;  1CDP A;  3BUO B;  4YGE B;  4Q04 A;  1IGV A;  2K7D A;  3SG5 A;  4A4B A;  4NQG A;  1C7V A;  1ZFS A;  2KAY A;  2M1K B;  2BBM A;  1KQM C;  1IH0 A;  1IJ5 A;  3PN7 C;  2F2P A;  2E30 A;  3CR5 X;  5HLV A;  3ICB A;  1BF5 A;  2JT0 A;  1IWQ A;  1M46 A;  2KHN A;  3BXK A;  1BU3 A;  4GGF A;  3VRP A;  5CSF A;  2BL0 B;  2CTN A;  3FIA A;  4NDC A;  1E8A A;  1IRJ A;  1REC A;  3EKJ A;  3TS5 B;  1FW4 A;  4QJ5 B;  1CFD A;  2L4H A;  2MHH A;  1YRT B;  1V1G A;  2PRU A;  2G9B A;  2LMT A;  1BT6 A;  2OPO A;  1AJ4 A;  2COL B;  1IQ3 A;  2KFF A;  4ORC B;  5KTY A;  1A75 B;  4MN0 A;  1YUT A;  1NX3 A;  2KGB C;  1NCX A;  1QX7 A;  1F8H A;  1CDL A;  4JPZ B;  1TNW A;  1U5I A;  1LVC D;  3C1V A;  1PVB A;  1KFU S;  1FF1 A;  3LCP C;  3TUY B;  1QLS A;  2HPS A;  2AMI A;  1QV1 A;  1J7P A;  4QJ3 B;  1KK8 B;  2Y4Q A;  2ZN8 A;  4PHN A;  3WNX B;  4QJ4 B;  3DD4 A;  2MRD A;  3RLZ A;  4OVN F;  3CGA A;  3TS5 C;  1CMF A;  1XFW O;  1KSO A;  2JQ6 A;  2LAP A;  1MHO A;  1ODB A;  3SG2 A;  4PCW A;  5CSI A;  2JXC A;  3PLF B;  1JFJ A;  1NX1 A;  2CCM A;  1CM1 A;  4IL1 A;  1QIW A;  1DTL A;  1YX8 A;  2KQ6 A;  1SL7 A;  3PAL A;  3SG7 A;  4WQ3 A;  3GK4 X;  5AFP A;  5I2L A;  5FYX A;  2NXQ A;  2VRG A;  4DRW A;  5HKY A;  1A29 A;  1SY9 A;  1Y0V H;  1UHK A;  5HLO A;  3I5H C;  4MZL A;  3CTN A;  4AOM A;  1C07 A;  2JTT A;  1NPQ A;  1G8I A;  3PM8 A;  4UPG A;  1B47 A;  5KU1 A;  3OX5 A;  3BYA A;  2PVB A;  1HT9 A;  1XFZ O;  2MA2 A;  1XYD A;  4XJK A;  1OMR A;  2H2K A;  3FWB A;  4PDZ A;  1S6I A;  4ICB A;  1QV0 A;  1DVI A;  2KYC A;  4AQI A;  3NSI A;  4PAL A;  2BKI B;  3SJS A;  1F54 A;  1F71 A;  4MZJ A;  4PE1 A;  1EL4 A;  1YVL A;  3OX6 A;  4DIR A;  1CB1 A;  1XFY O;  2EC6 B;  2MBX A;  1B4C A;  4OV2 A;  4CID A;  1JC2 A;  2I2R E;  1PSR A;  1FI5 A;  3F45 A;  1BG1 A;  1QX5 B;  1F55 A;  4MLW A;  1SPY A;  1L2O B;  4P2Y B;  1XK4 C;  2WOR A;  2EGD A;  1XFU O;  2JT8 A;  2WND A;  4HSZ A;  2JPT A;  1MXL C;  3SG4 A;  1PK0 D;  2K0J A;  1DT7 B;  1GGW A;  1SCV A;  5J3X A;  3DVM A;  2JU0 A;  2B1U A;  1TNP A;  1XFX O;  4C0J A;  1WLM A;  1KQM B;  1IJ6 A;  2M29 A;  3PN7 B;  2L98 A;  3KO0 A;  1OZS A;  4N1G A;  1CFF A;  4YRU A;  2NCP A;  4MBE A;  3CZT X;  4DUQ A;  4CLN A;  2M9G A;  3SIA A;  2KBI A;  1YX7 A;  5D69 A;  3BOW B;  4I5N B;  1J1E A;  2LE9 B;  2H61 A;  2ZFD A;  3A8R A;  2KAX A;  1TNQ A;  5IBW A;  5CPV A;  2R2I A;  3CWG A;  4YBH B;  4YGA A;  2Y1N A;  1F4Q A;  1WRL A;  1CLM A;  1OSA A;  3LL8 B;  3WHU B;  2EHB A;  1LXF C;  1BR4 B;  1OQP A;  3AAK A;  3KEV A;  1SYM A;  1V1F A;  1JUO A;  4GPL B;  4CPV A;  2TN4 A;  2IS9 A;  2V53 A;  1RWY A;  1TCO B;  3D0Y B;  1BR1 B;  2M1U A;  4PHJ A;  5K89 A;  1B1G A;  1CLL A;  2LMU A;  3BUX B;  1CNP A;  1WLZ A;  1QLK A;  2M49 B;  1F4O A;  2L5X B;  1UHH A;  4N1F A;  4DCK A;  3JTD C;  3ZNI A;  1TOP A;  2JZI A;  2GGZ A;  2OS8 B;  1XVJ A;  1RJV A;  2JOJ A;  2LMV A;  5ER5 A;  2FJU B;  2HF5 A;  4I5K A;  4M2P A;  1JWD A;  1KFU L;  1NP8 A;  2L51 A;  3DVJ A;  1A75 A;  2O60 A;  4R1E A;  1WRK A;  3AKA A;  4NDB A;  2M8U A;  1TN4 A;  2RGI A;  4CFQ A;  2K7C A;  1KCY A;  1QS7 A;  3HCM A;  3I5H B;  5CSN A;  1CFP A;  3DF0 B;  2I7A A;  4A4C A;  2KI6 D;  2O5G A;  1S36 A;  4PHK A;  3HX4 A;  1DJW A;  1S6C A;  2JNF A;  1RTP 1;  1UP5 A;  2Y5I A;  3A4U B;  1N0Y A;  1YUR A;  1YR5 A;  1YVH A;  2WCB A;  2QAC A;  3GK1 A;  4XYN A;  4GBA A;  3EK8 A;  2MJW B;  1MF8 B;  3O6B A;  1BJF A;  2JC2 A;  2GV5 A;  2NLN A;  1KK7 Y;  3NSL A;  3PSR A;  1TCF A;  1J7O A;  2OTG B;  3IQO A;  3CLN A;  3OB2 B;  4JWQ A;  5AXI A;  4M2O A;  2OS8 C;  2MLF C;  2KSP A;  5CSJ A;  4WQ2 A;  1M63 B;  3PAT A;  1WDC C;  1DGU A;  2KI4 C;  3EVR A;  2ZN9 A;  3M0W A;  4GUK A;  4NDD A;  1DJX A;  4U8D A;  1MR8 A;  1EH2 A;  1A2X A;  1JF0 A;  1M45 A;  1KWO C;  2MAZ A;  1PAL A;  2Y1M A;  1NCY A;  3AAJ A;  4FTG A;  1YTZ C;  2HQ8 A;  5HKW A;  1PSB A;  2FCD A;  2CXJ A;  4YGD B;  1LA0 A;  2MLE C;  4GGF C;  1SL8 A;  3D10 A;  3NXA A;  2LVI A;  4YI8 A;  2LLT A;  3ZWH A;  1B8L A;  4HRG A;  3EVV A;  1MUX A;  1FBV A;  2BKH B;  1NSH A;  4D1E A;  1OE9 B;  1SMG A;  2KOT A;  1PRW A;  1MXE A;  2JT3 A;  2AUC A;  1SCM B;  1NIW A;  1SRA A;  4ZCV A;  2OTG C;  1DJZ A;  1OMV A;  2SCP A;  5JJG A;  3KPX A;  4N5X A;  1ZOT B;  2M0R A;  3KF9 A;  3I5G B;  1AHR A;  3K21 A;  1QAT A;  2ZRT A;  2DOQ A;  2P6B B;  2QPT A;  3PFV A;  1S6J A;  1LKJ A;  2JWW A;  1QVI Z;  2A4J A;  4I5L B;  4BY4 A;  3LK1 A;  4AQJ A;  1NUB A;  1QVI Y;  1M39 A;  4MRY A;  4E68 A;  3WHT B;  2F8P A;  1NWD A;  5GQQ C;  2ZNE A;  1QXP A;  1TIZ A;  3VRN A;  1GQM A;  1K93 D;  2E6W A;  1H4B A;  2LAN A;  1S5G Z;  2LHL A;  5HKZ A;  1S5G Y;  1HQV A;  3E3R A;  1DJY A;  2I94 A;  2LC5 A;  1YUS A;  1QTX A;  1WRZ A;  1KFX S;  2BCX A;  2KQY A;  2KYF A;  4MSP A;  1QJT A;  3I5I C;  1SCM C;  3I5F C;  1F70 A;  1NCZ A;  3BUM B;  2CT9 A;  3CR2 A;  1FPW A;  3LK0 A;  1OZO A;  1S3P A;  2LUX A;  3BOW A;  3SG6 A;  3JTD B;  1N2D A;  1UHI A;  2Q4U A;  1PUL A;  3I5G C;  1Q80 A;  1DGV A;  4C0L A;  2F3Y A;  5B8I B;  2PAS A;  3H4S E;  1X02 A;  3FWC A;  3VRO A;  1RK9 A;  3BUW B;  2K61 A;  3GOF A;  2WCF A;  5I2Q A;  1XA5 A;  1NX2 A;  1AUI B;  1G33 A;  1DF0 B;  1TTX A;  2NCO A;  1ALV A;  1DJH A;  3D0Y A;  3MSE B;  1K95 A;  2FCE A;  5DKN A;  4C0K A;  1Y6W A;  1QIV A;  1UUS A;  1BOD A;  1N65 A;  1OOJ A;  3NSO A;  4MRX A;  3BQ3 A;  3VRQ A;  1DMO A;  1K9P A;  3EK7 A;  3SIB A;  1EG4 A;  1VRK A;  2PMY A;  5HYD A;  3TDI A;  1J7R A;  2WCE A;  1K96 A;  2FOT A;  4PE7 A;  1TRF A;  1CKK A;  5I2O A;  1CDN A;  2BBN A;  4FQO A;  4I5J A;  1WDC B;  4YGB B;  3DVK A;  3GK2 A;  1K90 D;  2KI4 B;  4BY5 A;  4DS7 A;  2K2F A;  4TNC A;  2KBM A;  1B7T Z;  2KI6 C;  1KWO B;  1B7T Y;  3BUN B;  3VGO A;  1CMG A;  3VRR A;  3CR4 X;  1FI6 A;  4MEW A;  2BCB A;  3DF0 A;  3OHM B;  1XO5 A;  1QX2 A;  2LNK A;  2JNX A;  1GGZ A;  3JVT C;  3NSK A;  4CFR A;  1IKU A;  5TNC A;  2ZKM X;  1SW8 A;  1CTR A;  2M7N A;  1KK7 Z;  2K8M B;  2L50 A;  2H61 C;  4PE4 A;  3SG3 A;  1W7J B;  3OP0 A;  5BPJ A;  5I8N A;  1WY9 A;  1SR6 C;  2LM5 A;  1K2H A;  1S26 D;  1BOC A;  2M7L A;  2HET A;  3QRX A;  4GNK B;  4MVF A;  1AJ5 A;  1MQ1 A;  1ZUZ A;  1RRO A;  4GAO A;  4OR9 B;  3WXA A;  1U5I B;  1EG3 A;  2BE4 A;  2F33 A;  2LHI A;  1XK4 A;  2LVJ A;  1UHJ A;  1UWO A;  1JBA A;  3TZ1 A;  1OMD A;  2LVK A;  4HRH A;  2BL0 C;  4F0Z B;  1AP4 A;  1DJG A;  4ETO A;  3IQQ A;  1KSM A;  2LLU A;  1QAS A;  2GGM A;  1J1D A;  3O2P A;  5KSZ A;  5ER4 X;  2LLS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...