1KQMC

Scallop myosin s1-amppnp in the actin-detached conformation
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
153
structure length
153
Chain Sequence
b'KLSQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYOSIN heavy chain
publication title Crystallographic findings on the internally uncoupled and near-rigor states of myosin: Further insights into the mechanics of the motor
pubmed doi rcsb
molecule tags Contractile protein
total genus 31
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2002-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kqmC01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kqmC02
2M8UA 3PM8A 1MXEA 1EG3A 3AAKA 1SYMA 5D69A 4QJ5B 3NXAA 1KFXL 4PDZA 1B4CA 2Q91A 2KFHA 1SR6B 1S5GZ 1ALVA 1IQ5A 1RFJA 1S3PA 2OPOA 5BPJA 1FPWA 2MLFC 3LLEA 2F2PA 1NIWA 2PASA 2OTGC 3BYAA 5F6TA 4A4BA 1N2DA 2K0JA 3GK4X 3EVUA 1OQPA 2FCDA 2JQ6A 1B1GA 2JU0A 1V1GA 1BODA 2FOTA 3K21A 3PSRA 5HLOA 2LM5A 1DT7B 1WRZA 2BE6A 1NSHA 1DGVA 1XO5A 1WDCC 4GNKB 4QJ4B 3I5FC 1GJYA 2F8PA 1M31A 2LANA 2ISDA 1YX7A 4YGEB 1SNLA 2CT9A 2ZNDA 1V1FA 3O2PA 1AHRA 1WY9A 2JNXA 1IH0A 3SG4A 1NX0A 4PE7A 3OP0A 4E68A 4MLWA 4ORBB 4I5KA 4I5JA 1IKUA 4YI8A 1G8IA 1B8CA 2K7DA 2O5GA 4MBEA 3C1VA 3BQ3A 1J7OA 4JQ0D 4MVFA 1F70A 4A4CA 1K93D 2LLUA 5HLVA 2JXCA 1M63B 2K7CA 2Y5IA 3I5HC 1DF0B 1CDLA 1FBVA 1Q80A 2JTTA 2LV7A 4IL1A 3GOFA 5KTYA 4TNCA 1DJGA 2JTZA 3CR4X 2PSRA 1YUTA 1LKJA 2H2KA 4L9MA 2D8NA 4ORCB 3AAJA 1JC2A 1PVAA 1QV1A 2EC6B 4FTGA 1BU3A 4ORAB 3DF0B 1B8LA 2M0RA 4M2QA 2LCPA 2MHHA 1CKKA 1AJ5A 1ZOTB 5HYDA 4OV2A 1S1EA 2LUXA 4M2PA 2AUCA 4YGBB 2LUCA 4HRHA 1TN4A 2EHBA 4N1FA 5D7FA 1QV0A 2KNEA 1AP4A 2A4JA 1S5GY 2V53A 2LMVA 4BY5A 4YI9A 4AQIA 2HPSA 1SMGA 2K8MB 3ZNIA 1U5IA 1JFJA 1WRLA 1F4QA 2LLSA 1KFUS 1QX5B 3SIAA 1A4PA 1M46A 4F0ZB 5CSFA 1SKTA 1J7QA 3TUYB 1XFWO 4GFTA 3WNXB 3LK1A 4PHMA 4D1EA 2FCEA 1UWOA 2MBXA 1YUUA 2CXJA 1J55A 2ZN9A 1B47A 2NZ0A 3A8RA 1NPQA 1NX3A 3EKJA 4WQ3A 1LA3A 2MRDA 3DVKA 4NQGA 4PE4A 1W7IB 1KFUL 2LVVA 1B9AA 1L7ZA 3DD4A 5AFPA 1SL7A 1AUIB 3BUXB 3M0WA 2BL0C 3CTNA 3BXKA 5DKQA 2PALA 1IJ5A 1DJHA 1UUSA 1LVCD 1KK7Z 2JNFA 1IJ6A 2L5XB 2QACA 3KEVA 4DRWA 1YX8A 3NSOA 3SG3A 4OVNF 2LNKA 1X02A 1DJIA 1B7TZ 1SRAA 4DS7A 1QLKA 2F3ZA 2M3WA 2Q4UA 1BF5A 1A03A 1PALA 2KHNA 1IG5A 2KI4B 2LE9B 3CGAA 3EKHA 4GAOA 2WCEA 1BMOA 4CFRA 1RK9A 2M97A 1K95A 2CCMA 1L2OC 1SPYA 5CSJA 2HQ8A 2H61C 3I5IC 5HKWA 1J1EA 2BBMA 2PMYA 3JVTB 1DJXA 1BR1B 2BECA 2NLNA 1WLZA 1DJYA 5TNCA 2L4IA 3TDZA 4PHJA 1Y1UA 3VRNA 5DKRA 4CFQA 1XFXO 3ZWHA 1OE9B 3D0YA 1UHJA 2GGMA 1AJ4A 4R1EA 1QXPA 5J3XA 3PFVA 3OHMB 1IQ3A 1F54A 3EVRA 3PN7B 1SY9A 1YVLA 3SG2A 2KI6D 4NDCA 2EGDA 1TNQA 1K96A 3CWGA 1QS7A 3EK4A 1TOPA 5I2QA 1TTXA 1YRTB 1KK8C 2I2RE 2KFFA 4XJKA 1CM1A 2KBIA 3CLNA 2K2AA 4YGDB 3RLZA 1JBAA 2L2EA 1LXFC 3AKAA 1H8BA 1NCXA 2HQWA 2K2FA 1MUXA 2B1UA 1BJFA 1FI5A 1EXRA 3WHTB 2WOSA 3HX4A 2AMIA 1OZSA 1EG4A 1XYDA 1KWOB 4I5NB 3RM1A 2LC5A 2LVIA 2LP3A 1DTLA 5ER4X 3TDIA 4ETOA 1CDNA 1BR4B 1F55A 1OMRA 1NX2A 1XFZO 3DVEA 1KCYA 3I5GB 1SCMC 2OS8C 2PVBA 5GQQC 3CZTX 3NSIA 4OR9B 4GPLB 1WRKA 2I7AA 2HETA 5CSIA 1KK7Y 1YRUB 1Y6WA 2JXLA 3JTDC 1NYAA 2I18A 1MQ1A 1XFYO 2GGZA 1YTZC 1JFKA 1M39A 1B7TY 1U5IB 2Y1NA 3LK0A 3VRRA 1KSOA 1LA0A 1N65A 1YR5A 3WXAA 2JT8A 2KOTA 4YGAA 5JOLA 5K89A 3GK1A 2BCAA 2BCXA 3BOWA 4DIRA 3SG7A 5JJGA 1MWNA 2KAYA 3CR2A 4C0JA 2BE4A 1DJZA 1NCZA 5AEQA 2PRUA 1DJWA 4MSPA 5KU1A 1KQMC 1UURA 1YUSA 1IWQA 4HSZA 2E30A 5I8NA 1NX1A 2KYFA 1ZACA 1TCOB 3TS5C 5HKZA 1Y1AA 1ZFSA 1J7PA 1EH2A 1UHKA 2K7BA 4DCKA 1OZOA 1XVJA 4MN0A 2JRFA 1CLBA 2CNPA 1CM4A 2NXQA 3MSEB 1C7WA 1UHNA 1CFFA 1M45A 1K9UA 1SR6C 1UHHA 1RECA 1F4OA 2JT0A 1JWDA 2JT3A 4WRIA 2VRGA 4ICBA 1RTP1 3VGOA 1F71A 4GGFC 1FI6A 1NCYA 4HREE 2OTGB 3NSKA 1MXLC 4PHKA 3SG5A 5G08A 2RGIA 3D0YB 3IQOA 1Y0VH 5DKNA 2R2IA 5I2LA 2ZNEA 1QVIZ 2L98A 5AXIA 2H61A 4HRGA 2WORA 4QJ3B 1CNPA 2KBMA 1WDCB 1S26D 1HT9A 1K9PA 3I5FB 4GBAA 2DOQA 4NDDA 1IGVA 4CPVA 5IBWA 1CLMA 2L51A 3GK2A 2M7NA 2LHLA 1XFUO 1ZUZA 3H4SE 4XJKB 2BKIB 4PE0A 1FF1A 1K90D 2ZFDA 1YVHA 3CR5X 1TRFA 4XYNA 2LHIA 1IRJA 2JZIA 2M7LA 2GV5A 3EVVA 1C07A 1CB1A 1D1OA 3LL8B 1G4YR 2KGBC 1F8HA 2COLB 1QATA 3D10A 3FS7A 3OX6A 4YBHB 5AERA 2KGRA 1OOJA 3I5HB 4C0KA 1BT6A 2JC2A 4N1GA 1DGUA 4OCIA 1W7JB 4FQOA 1CFDA 4PCWA 1QIWA 3OX5A 1RROA 4YGCB 3LCPC 2NCPA 1E8AA 2K61A 2EC6C 2SCPA 1MHOA 2K7OA 1A2XA 2ZRTA 2G9BA 3DVMA 1CTRA 1NUBA 2Y1MA 1BG1A 3BUOB 3KF9A 1QASA 1KFXS 1QTXA 1DMOA 4CIDA 5ER5A 1OSAA 1R6PA 2SASA 2JPTA 1CFPA 5KSZA 3VROA 2WCBA 2WC8A 4GUKA 4ZCUA 4I5LB 4C0LA 4PHNA 3BOWB 2L50A 1LINA 1CDMA 1NWDA 2LVKA 3FWBA 2LLTA 3QRXA 3PATA 1K2HA 1S6CA 1SL8A 1BOCA 2I94A 3O6BA 2LAPA 4ZCVA 3TUYC 2LMUA 2KI6C 1CDPA 1PULA 1J1DA 2ZN8A 2F3YA 1QVIY 1TNWA 4GGNA 1CFCA 5AANA 4YRUA 4AOMA 1MF8B 3E3RA 2AAOA 2WCFA 2HF5A 4PALA 2ZKMX 1XFVO 2O60A 3KPXA 1A75A 2BL0B 1QX2A 2M29A 1RWYA 3EK8A 1PRWA 3VRQA 1B8RA 1TNPA 1TCFA 1VRKA 2KSPA 3ICBA 1WLMA 2ZRSA 2KAXA 1QIVA 1DVIA 4MZJA 2KQ6A 3SG6A 5CSNA 2KI4C 1QJTA 2KDHA 4MZKA 4NDBA 3F45A 1EJ3A 3DVJA 3TZ1A 3KO0A 2KYCA 4PE1A 2LVJA 2BKHB 1L2OB 3VRPA 3JVTC 1FW4A 3I5IB 1UP5A 1SW8A 3O4YA 2KAVA 1K8UA 4OKHA 4GGFA 3IQQA 1A29A 2MLEC 5PALA 3FIAA 1UHIA 4WQ2A 2M1UA 1SBJA 3SJSA 4MEWA 4JWQA 1J7RA 1SCVA 3PN7C 4AQJA 1CLLA 1AVSA 1YURA 1HQVA 1S36A 1SK6D 1QLSA 3TDUA 2NCOA 1XK4A 3OB1B 1K9KA 2BBNA 2MA2A 1OMVA 1PVBA 2TN4A 2JWWA 2M49B 1NP8A 2BCBA 3BUMB 1KK8B 1N0YA 3A4UB 1TNXA 1Y1XA 2L0PA 3SIBA 4M2OA 3CS1A 3WHUB 2FJUB 1TIZA 1JSAA 2WNDA 4UPGA 1S6JA 2MAZA 5HKYA 4MRYA 1CMGA 4MRXA 2KFGA 1ODBA 1ZMZA 1XK4C 2CBLA 1DF0A 4JPZB 3FWCA 4MZLA 1KWOC 1AK8A 1KSMA 2M9GA 1PK0D 5FYXA 1GGWA 1G33A 3I5GC 2F33A 4N5XA 1SCMB 2OS8B 4USLA 3HCMA 1ALWA 2CTNA 3BUNB 1MR8A 2G2BA 3DF0A 3O78A 2L4HA 3JTDB 2JULA 1GGZA 1OMDA 3KHEA 2E6WA 2M1KB 1QX7A 1SL9A 1C7VA 5I2OA 5CPVA 1EL4A 4Q04A 2F2OA 1JF2A 1PSBA 3NSLA 1KQVA 2LMTA 1XA5A 2Y4QA 1JUOA 1R2UA 3BUWB 2P6BB 4BY4A 1H4BA 5B8IB 2IS9A 2JOJA 4U8DA 2QPTA 1KQMB 1PSRA 1K94A 3EK7A 4DUQA 1GQMA 3AKBA 1BLQA 1CMFA 1RJVA 3PLFB 2LP2A 1A75B 1S6IA 4P5OE 2MJWB 2KQYA 4CLNA 3OB2B 3TS5B 4P2YB 3PALA 3IF7A 1JF0A
chains in the Genus database with same CATH superfamily
2M8UA 3R1OA 3PM8A 1MXEA 1EG3A 3AAKA 1P28A 1SYMA 5D69A 4QJ5B 3NXAA 1KFXL 4PDZA 1B4CA 1TUJA 3FE9A 2Q91A 2KFHA 1SR6B 1S5GZ 1ALVA 1IQ5A 1RFJA 1S3PA 2OPOA 5BPJA 1FPWA 2MLFC 3LLEA 2F2PA 1NIWA 2PASA 2OTGC 3BYAA 5F6TA 4A4BA 1N2DA 2K0JA 3N7HA 3GK4X 3EVUA 1OQPA 2FCDA 3FE6A 2JQ6A 1B1GA 2JU0A 1V1GA 1BODA 2FOTA 3K21A 3PSRA 5HLOA 2LM5A 1DT7B 1WRZA 2WC5A 3D78A 2BE6A 1NSHA 1DGVA 1XO5A 1WDCC 4GNKB 4QJ4B 3I5FC 1GJYA 2F8PA 1M31A 3D75A 2LANA 2ISDA 1YX7A 3B88A 4YGEB 1SNLA 2CT9A 2ZNDA 1V1FA 3O2PA 1AHRA 1WY9A 2QEVA 2JNXA 1IH0A 3SG4A 1GM0A 1NX0A 4PE7A 3OP0A 4E68A 4MLWA 1OOHA 4I5KA 4I5JA 4ORBB 4INWA 5I94A 1IKUA 4YI8A 1G8IA 1B8CA 2K7DA 2O5GA 4MBEA 3C1VA 3BQ3A 1J7OA 4JQ0D 4MVFA 1F70A 3SS3A 1K93D 2LLUA 5HLVA 4A4CA 2JXCA 2BNXA 3S0FA 1M63B 2K7CA 2Y5IA 3I5HC 1DF0B 1CDLA 1FBVA 1Q80A 2JTTA 2LV7A 4IL1A 3GOFA 5KTYA 3L4LA 4TNCA 1DJGA 2JTZA 3CR4X 2PSRA 1YUTA 1LKJA 2H2KA 4L9MA 2D8NA 4ORCB 1DQEA 3AAJA 1JC2A 3R1VA 1OW4A 1PVAA 1QV1A 2EC6B 4FTGA 1BU3A 4ORAB 3DF0B 1B8LA 2M0RA 4INXA 4M2QA 2LCPA 2MHHA 1CKKA 1AJ5A 1ZOTB 5HYDA 1ORGA 4OV2A 1S1EA 3DZTA 2LUXA 4M2PA 2AUCA 3L4AA 4YGBB 2LUCA 4HRHA 1TN4A 2EHBA 4N1FA 5D7FA 1OOIX 1QV0A 2KNEA 1AP4A 2A4JA 1S5GY 2V53A 2LMVA 1OOFA 4BY5A 4YI9A 4AQIA 2HPSA 1SMGA 2K8MB 3ZNIA 1U5IA 1JFJA 1WRLA 1F4QA 2LLSA 1KFUS 1QX5B 4F7FA 3SIAA 1A4PA 1M46A 4F0ZB 1Z4HA 5CSFA 1SKTA 1J7QA 3TUYB 1XFWO 4GFTA 3WNXB 3LK1A 4PHMA 4D1EA 2FCEA 1UWOA 2MBXA 1YUUA 2CXJA 1J55A 2ZN9A 1B47A 2NZ0A 3A8RA 1NPQA 1NX3A 3EKJA 4WQ3A 1LA3A 2MRDA 3DVKA 4NQGA 4PE4A 1W7IB 1KFUL 2LVVA 1B9AA 2QEBA 1L7ZA 3DD4A 5AFPA 1SL7A 1AUIB 3BUXB 3M0WA 2GTEA 2BL0C 3CTNA 1Z2CB 3BXKA 5DKQA 5FI6A 2PALA 1IJ5A 1DJHA 1UUSA 1LVCD 1KK7Z 2JNFA 3B87A 1IJ6A 2L5XB 2QACA 3KEVA 4DRWA 1YX8A 3NSOA 3SG3A 4OVNF 1TUZA 1X02A 1DJIA 1B7TZ 1SRAA 2LNKA 1QLKA 2F3ZA 2M3WA 2Q4UA 2WC6A 3B6XA 5FI7A 4DS7A 1A03A 1PALA 2KHNA 1IG5A 2KI4B 2LE9B 3CGAA 3EKHA 4GAOA 1QWVA 2WCEA 1BMOA 4CFRA 1RK9A 2M97A 1K95A 2CCMA 1L2OC 1SPYA 3CYZA 2HQ8A 2H61C 3I5IC 5CSJA 1J1EA 5HKWA 2BBMA 2PMYA 3JVTB 1DJXA 1BR1B 2QEHA 2BECA 2NLNA 1WLZA 1DJYA 4IJ7A 2L4IA 5TNCA 4KYNA 4PHJA 3TDZA 1Y1UA 3VRNA 5DKRA 3S0DA 4CFQA 1XFXO 3ZWHA 1OE9B 3D0YA 1UHJA 2GGMA 1AJ4A 4R1EA 1QXPA 5J3XA 3PFVA 3OHMB 1IQ3A 1F54A 3EVRA 3PN7B 1SY9A 1YVLA 3SG2A 3D74A 2KI6D 4NDCA 2EGDA 1TNQA 1K96A 3CWGA 1QS7A 3EK4A 1TOPA 3UO9A 5I2QA 1TTXA 1YRTB 1KK8C 1W9ZA 2I2RE 2KFFA 4XJKA 1CM1A 3V2LA 2KBIA 3B86A 3CLNA 3CZ2A 2K2AA 4YGDB 3RLZA 1JBAA 1C3ZA 1LXFC 2L2EA 3AKAA 1H8BA 1NCXA 2HQWA 2K2FA 1MUXA 2B1UA 1BJFA 1FI5A 1EXRA 3WHTB 4FQTA 2WOSA 3NGVA 3HX4A 1XYDA 1OZSA 1EG4A 2AMIA 1KWOB 4I5NB 3RM1A 1TWOA 2LC5A 2LVIA 2LP3A 1DTLA 5ER4X 3TDIA 4ETOA 1CDNA 1BR4B 1F55A 1OMRA 1NX2A 1XFZO 3DVEA 1KCYA 3I5GB 1SCMC 2OS8C 2PVBA 5GQQC 3CZTX 2L2CA 3NSIA 4OR9B 2H8VA 4GPLB 1WRKA 2I7AA 2HETA 5CSIA 1KK7Y 1YRUB 1Y6WA 2JXLA 3JTDC 1NYAA 2I18A 1MQ1A 1XFYO 2GGZA 1YTZC 1JFKA 1M39A 1B7TY 1U5IB 2Y1NA 3LK0A 3VRRA 1KSOA 1LA0A 1N65A 1YR5A 3WXAA 2JT8A 2KOTA 4YGAA 5JOLA 5K89A 3GK1A 2BCAA 1T14A 2BCXA 5DICA 3BOWA 3CZ0A 4DIRA 3SG7A 5JJGA 1MWNA 2KAYA 3CR2A 4C0JA 2BE4A 1DJZA 1NCZA 5AEQA 2PRUA 1DJWA 4MSPA 5KU1A 1KQMC 1UURA 4PT1A 1YUSA 1IWQA 4HSZA 2E30A 5I8NA 1NX1A 2KYFA 1ZACA 1TCOB 3TS5C 5HKZA 1Y1AA 1ZFSA 3UNWA 1J7PA 1EH2A 1UHKA 2K7BA 4DCKA 1OZOA 1XVJA 4MN0A 2JRFA 1CLBA 2CNPA 1CM4A 2NXQA 2QEOA 1SSEB 3MSEB 1C7WA 1UHNA 1CFFA 1M45A 3R1PA 1K9UA 1SR6C 2PQLA 1UHHA 1RECA 1F4OA 2JT0A 1JWDA 2JT3A 2WCJA 4WRIA 2VRGA 4ICBA 1RTP1 3VGOA 1F71A 4GGFC 2WCMA 1FI6A 1NCYA 4HREE 2OTGB 3NSKA 1MXLC 4PHKA 3SG5A 1DEKA 5G08A 2RGIA 3D0YB 2FJYA 3IQOA 3NHIA 1Y0VH 1XFRA 3S0EA 5DKNA 2R2IA 5I2LA 2ZNEA 1QVIZ 2L98A 5AXIA 2H61A 4HRGA 3S0GA 2WCKA 2WORA 3R72A 4QJ3B 1CNPA 2KBMA 1WDCB 1S26D 1HT9A 1K9PA 3I5FB 4GBAA 2DOQA 4NDDA 1IGVA 2BAPA 4CPVA 5IBWA 1CLMA 2L51A 3GK2A 2M7NA 2LHLA 3FE8A 1XFUO 1ZUZA 3H4SE 4XJKB 2BKIB 4PE0A 1FF1A 3QMEA 1K90D 2ZFDA 1YVHA 3CR5X 1TRFA 4XYNA 2LHIA 1IRJA 2JZIA 2M7LA 2GV5A 3EVVA 1C07A 1CB1A 1D1OA 3S0BA 3LL8B 1G4YR 3S0AA 2KGBC 1F8HA 2COLB 1QATA 3D10A 3FS7A 3OX6A 4YBHB 5AERA 2KGRA 1OOJA 3I5HB 3O4XA 1BT6A 2JC2A 4C0KA 4N1GA 1DGUA 4OCIA 3D77A 1W7JB 4FQOA 1CFDA 4PCWA 3OGNA 1QIWA 3OX5A 1RROA 4YGCB 3LCPC 2NCPA 1E8AA 2K61A 2KLEA 2EC6C 2SCPA 1MHOA 2K7OA 1A2XA 2ZRTA 2G9BA 3DVMA 1CTRA 1NUBA 2Y1MA 1BG1A 3BUOB 3CDNA 3KF9A 1QASA 1KFXS 1QTXA 1DMOA 4CIDA 5ER5A 1OSAA 3DXLA 1R6PA 4JKTA 2SASA 2WCLA 2JPTA 1CFPA 5KSZA 3VROA 2WCBA 2WC8A 4GUKA 4ZCUA 4I5LB 4C0LA 3RZSA 4PHNA 3BOWB 2L50A 1LINA 1CDMA 1NWDA 2LVKA 3FWBA 2LLTA 2KLDA 3OBVA 3QRXA 3PATA 1K2HA 1S6CA 1SL8A 3K1EA 1BOCA 2I94A 3O6BA 3NHTA 3PJIA 2LAPA 4ZCVA 3DY9A 3TUYC 2LMUA 2KI6C 1CDPA 1PULA 1J1DA 2ZN8A 2QDIA 2JPOA 3D76A 2F3YA 1QVIY 1TNWA 4GGNA 1CFCA 5AANA 4YRUA 3B7AA 4AOMA 1MF8B 3E3RA 3SS4A 2AAOA 2P71A 2WCFA 2HF5A 4PALA 1IIOA 2ZKMX 1DELA 1XFVO 2O60A 3KPXA 1A75A 2BL0B 1QX2A 2M29A 1RWYA 3EK8A 1PRWA 3VRQA 1B8RA 1TNPA 1TCFA 1VRKA 2KSPA 3ICBA 1WLMA 2ZRSA 2KAXA 1QIVA 1DVIA 4MZJA 2KQ6A 3SG6A 5CSNA 2KI4C 1QJTA 2KDHA 4MZKA 4NDBA 3F45A 1EJ3A 2KPHA 3DVJA 3TZ1A 1DC1A 3KO0A 3EG5B 2KYCA 4PE1A 2LVJA 3BJHA 2BKHB 1L2OB 3VRPA 3JVTC 1FW4A 3I5IB 1UP5A 1SW8A 3O4YA 2KAVA 1K8UA 4OKHA 4GGFA 3IQQA 1A29A 2MLEC 5PALA 3FIAA 1UHIA 4WQ2A 2M1UA 1SBJA 3CABA 3BFBA 3SJSA 4MEWA 4JWQA 1J7RA 1SCVA 4JD9A 3PN7C 4AQJA 1CLLA 1AVSA 1YURA 1HQVA 1S36A 1SK6D 1QLSA 3TDUA 2NCOA 1OOGA 1XK4A 3OB1B 1K9KA 3BFAA 2BBNA 2MA2A 1OMVA 1PVBA 2TN4A 2JWWA 2M49B 3BFHA 1NP8A 3D73A 2BCBA 3BUMB 1KK8B 1N0YA 3A4UB 1TNXA 1Y1XA 2L0PA 3SIBA 4M2OA 3CS1A 3WHUB 2FJUB 1TIZA 1JSAA 2WNDA 4UPGA 1S6JA 3L47A 2MAZA 5HKYA 4MRYA 1CMGA 4MRXA 3DYEA 2KFGA 2YGUA 5FI2A 1ODBA 1ZMZA 3VB1A 1XK4C 2CBLA 1DF0A 4JPZB 3FWCA 4MZLA 4OZDA 1C3YA 1KWOC 1AK8A 1KSMA 2M9GA 1PK0D 5HL1A 2K60A 5FYXA 3Q8IA 1GGWA 2ERBA 1G33A 3CZ1A 3I5GC 2F33A 4N5XA 1SCMB 2OS8B 4USLA 3HCMA 5EL2A 1BF5A 1ALWA 2CTNA 3BUNB 1MR8A 2G2BA 2PYQA 3DF0A 3O78A 2L4HA 3JTDB 2JULA 1GGZA 1OMDA 3KHEA 2E6WA 2M1KB 1QX7A 1SL9A 3IVTA 5D3OA 1C7VA 2L5YA 3PM2A 5I2OA 5CPVA 1EL4A 4Q04A 2F2OA 1LS8A 1JF2A 1PSBA 3NSLA 1KQVA 2LMTA 1XA5A 2Y4QA 1JUOA 1R2UA 3BUWB 2P6BB 4BY4A 1H4BA 5B8IB 2IS9A 2JOJA 4U8DA 2QPTA 1KQMB 1PSRA 1K94A 3EK7A 4DUQA 1GQMA 2WCHA 3AKBA 1BLQA 1RJVA 1CMFA 3PLFB 2LP2A 1A75B 1S6IA 2P70A 4P5OE 2MJWB 2KQYA 4CLNA 3OB2B 3TS5B 4P2YB 3PALA 3IF7A 1JF0A 3SS5A
chains in the Genus database with same CATH topology
2M8UA 3PM8A 1MXEA 1EG3A 3AAKA 1SYMA 5D69A 4QJ5B 3NXAA 1KFXL 4PDZA 1B4CA 2Q91A 2KFHA 1SR6B 1S5GZ 1ALVA 1IQ5A 1RFJA 1S3PA 2OPOA 5BPJA 1FPWA 2MLFC 3LLEA 2F2PA 1NIWA 2PASA 2OTGC 3BYAA 5F6TA 4A4BA 1N2DA 2K0JA 3GK4X 3EVUA 1OQPA 2FCDA 2JQ6A 1B1GA 2JU0A 1V1GA 1BODA 2FOTA 3K21A 3PSRA 5HLOA 2LM5A 1DT7B 1WRZA 2BE6A 1NSHA 1DGVA 1XO5A 1WDCC 4GNKB 4QJ4B 3I5FC 1GJYA 2F8PA 1M31A 2LANA 2ISDA 1YX7A 4YGEB 1SNLA 2CT9A 2ZNDA 1V1FA 3O2PA 1AHRA 1WY9A 2JNXA 1IH0A 3SG4A 1NX0A 4PE7A 3OP0A 4E68A 4MLWA 4ORBB 4I5KA 4I5JA 1IKUA 4YI8A 1G8IA 1B8CA 2K7DA 2O5GA 4MBEA 3C1VA 3BQ3A 1J7OA 4JQ0D 4MVFA 1F70A 4A4CA 1K93D 2LLUA 5HLVA 2JXCA 1M63B 2K7CA 2Y5IA 3I5HC 1DF0B 1CDLA 1FBVA 1Q80A 2JTTA 2LV7A 4IL1A 3GOFA 5KTYA 4TNCA 1DJGA 2JTZA 3CR4X 2PSRA 1YUTA 1LKJA 2H2KA 4L9MA 2D8NA 4ORCB 3AAJA 1JC2A 1PVAA 1QV1A 2EC6B 4FTGA 1BU3A 4ORAB 3DF0B 1B8LA 2M0RA 4M2QA 2LCPA 2MHHA 1CKKA 1AJ5A 1ZOTB 5HYDA 4OV2A 1S1EA 2LUXA 4M2PA 2AUCA 4YGBB 2LUCA 4HRHA 1TN4A 2EHBA 4N1FA 5D7FA 1QV0A 2KNEA 1AP4A 2A4JA 1S5GY 2V53A 2LMVA 4BY5A 4YI9A 4AQIA 2HPSA 1SMGA 2K8MB 3ZNIA 1U5IA 1JFJA 1WRLA 1F4QA 2LLSA 1KFUS 1QX5B 3SIAA 1A4PA 1M46A 4F0ZB 5CSFA 1SKTA 1J7QA 3TUYB 1XFWO 4GFTA 3WNXB 3LK1A 4PHMA 4D1EA 2FCEA 1UWOA 2MBXA 1YUUA 2CXJA 1J55A 2ZN9A 1B47A 2NZ0A 3A8RA 1NPQA 1NX3A 3EKJA 4WQ3A 1LA3A 2MRDA 3DVKA 4NQGA 4PE4A 1W7IB 1KFUL 2LVVA 1B9AA 1L7ZA 3DD4A 5AFPA 1SL7A 1AUIB 3BUXB 3M0WA 2BL0C 3CTNA 3BXKA 5DKQA 2PALA 1IJ5A 1DJHA 1UUSA 1LVCD 1KK7Z 2JNFA 1IJ6A 2L5XB 2QACA 3KEVA 4DRWA 1YX8A 3NSOA 3SG3A 4OVNF 2LNKA 1X02A 1DJIA 1B7TZ 1SRAA 4DS7A 1QLKA 2F3ZA 2M3WA 2Q4UA 1BF5A 1A03A 1PALA 2KHNA 1IG5A 2KI4B 2LE9B 3CGAA 3EKHA 4GAOA 2WCEA 1BMOA 4CFRA 1RK9A 2M97A 1K95A 2CCMA 1L2OC 1SPYA 5CSJA 2HQ8A 2H61C 3I5IC 5HKWA 1J1EA 2BBMA 2PMYA 3JVTB 1DJXA 1BR1B 2BECA 2NLNA 1WLZA 1DJYA 5TNCA 2L4IA 3TDZA 4PHJA 1Y1UA 3VRNA 5DKRA 4CFQA 1XFXO 3ZWHA 1OE9B 3D0YA 1UHJA 2GGMA 1AJ4A 4R1EA 1QXPA 5J3XA 3PFVA 3OHMB 1IQ3A 1F54A 3EVRA 3PN7B 1SY9A 1YVLA 3SG2A 2KI6D 4NDCA 2EGDA 1TNQA 1K96A 3CWGA 1QS7A 3EK4A 1TOPA 5I2QA 1TTXA 1YRTB 1KK8C 2I2RE 2KFFA 4XJKA 1CM1A 2KBIA 3CLNA 2K2AA 4YGDB 3RLZA 1JBAA 2L2EA 1LXFC 3AKAA 1H8BA 1NCXA 2HQWA 2K2FA 1MUXA 2B1UA 1BJFA 1FI5A 1EXRA 3WHTB 2WOSA 3HX4A 2AMIA 1OZSA 1EG4A 1XYDA 1KWOB 4I5NB 3RM1A 2LC5A 2LVIA 2LP3A 1DTLA 5ER4X 3TDIA 4ETOA 1CDNA 1BR4B 1F55A 1OMRA 1NX2A 1XFZO 3DVEA 1KCYA 3I5GB 1SCMC 2OS8C 2PVBA 5GQQC 3CZTX 3NSIA 4OR9B 4GPLB 1WRKA 2I7AA 2HETA 5CSIA 1KK7Y 1YRUB 1Y6WA 2JXLA 3JTDC 1NYAA 2I18A 1MQ1A 1XFYO 2GGZA 1YTZC 1JFKA 1M39A 1B7TY 1U5IB 2Y1NA 3LK0A 3VRRA 1KSOA 1LA0A 1N65A 1YR5A 3WXAA 2JT8A 2KOTA 4YGAA 5JOLA 5K89A 3GK1A 2BCAA 2BCXA 3BOWA 4DIRA 3SG7A 5JJGA 1MWNA 2KAYA 3CR2A 4C0JA 2BE4A 1DJZA 1NCZA 5AEQA 2PRUA 1DJWA 4MSPA 5KU1A 1KQMC 1UURA 1YUSA 1IWQA 4HSZA 2E30A 5I8NA 1NX1A 2KYFA 1ZACA 1TCOB 3TS5C 5HKZA 1Y1AA 1ZFSA 1J7PA 1EH2A 1UHKA 2K7BA 4DCKA 1OZOA 1XVJA 4MN0A 2JRFA 1CLBA 2CNPA 1CM4A 2NXQA 3MSEB 1C7WA 1UHNA 1CFFA 1M45A 1K9UA 1SR6C 1UHHA 1RECA 1F4OA 2JT0A 1JWDA 2JT3A 4WRIA 2VRGA 4ICBA 1RTP1 3VGOA 1F71A 4GGFC 1FI6A 1NCYA 4HREE 2OTGB 3NSKA 1MXLC 4PHKA 3SG5A 5G08A 2RGIA 3D0YB 3IQOA 1Y0VH 5DKNA 2R2IA 5I2LA 2ZNEA 1QVIZ 2L98A 5AXIA 2H61A 4HRGA 2WORA 4QJ3B 1CNPA 2KBMA 1WDCB 1S26D 1HT9A 1K9PA 3I5FB 4GBAA 2DOQA 4NDDA 1IGVA 4CPVA 5IBWA 1CLMA 2L51A 3GK2A 2M7NA 2LHLA 1XFUO 1ZUZA 3H4SE 4XJKB 2BKIB 4PE0A 1FF1A 1K90D 2ZFDA 1YVHA 3CR5X 1TRFA 4XYNA 2LHIA 1IRJA 2JZIA 2M7LA 2GV5A 3EVVA 1C07A 1CB1A 1D1OA 3LL8B 1G4YR 2KGBC 1F8HA 2COLB 1QATA 3D10A 3FS7A 3OX6A 4YBHB 5AERA 2KGRA 1OOJA 3I5HB 4C0KA 1BT6A 2JC2A 4N1GA 1DGUA 4OCIA 1W7JB 4FQOA 1CFDA 4PCWA 1QIWA 3OX5A 1RROA 4YGCB 3LCPC 2NCPA 1E8AA 2K61A 2EC6C 2SCPA 1MHOA 2K7OA 1A2XA 2ZRTA 2G9BA 3DVMA 1CTRA 1NUBA 2Y1MA 1BG1A 3BUOB 3KF9A 1QASA 1KFXS 1QTXA 1DMOA 4CIDA 5ER5A 1OSAA 1R6PA 2SASA 2JPTA 1CFPA 5KSZA 3VROA 2WCBA 2WC8A 4GUKA 4ZCUA 4I5LB 4C0LA 4PHNA 3BOWB 2L50A 1LINA 1CDMA 1NWDA 2LVKA 3FWBA 2LLTA 3QRXA 3PATA 1K2HA 1S6CA 1SL8A 1BOCA 2I94A 3O6BA 2LAPA 4ZCVA 3TUYC 2LMUA 2KI6C 1CDPA 1PULA 1J1DA 2ZN8A 2F3YA 1QVIY 1TNWA 4GGNA 1CFCA 5AANA 4YRUA 4AOMA 1MF8B 3E3RA 2AAOA 2WCFA 2HF5A 4PALA 2ZKMX 1XFVO 2O60A 3KPXA 1A75A 2BL0B 1QX2A 2M29A 1RWYA 3EK8A 1PRWA 3VRQA 1B8RA 1TNPA 1TCFA 1VRKA 2KSPA 3ICBA 1WLMA 2ZRSA 2KAXA 1QIVA 1DVIA 4MZJA 2KQ6A 3SG6A 5CSNA 2KI4C 1QJTA 2KDHA 4MZKA 4NDBA 3F45A 1EJ3A 3DVJA 3TZ1A 3KO0A 2KYCA 4PE1A 2LVJA 2BKHB 1L2OB 3VRPA 3JVTC 1FW4A 3I5IB 1UP5A 1SW8A 3O4YA 2KAVA 1K8UA 4OKHA 4GGFA 3IQQA 1A29A 2MLEC 5PALA 3FIAA 1UHIA 4WQ2A 2M1UA 1SBJA 3SJSA 4MEWA 4JWQA 1J7RA 1SCVA 3PN7C 4AQJA 1CLLA 1AVSA 1YURA 1HQVA 1S36A 1SK6D 1QLSA 3TDUA 2NCOA 1XK4A 3OB1B 1K9KA 2BBNA 2MA2A 1OMVA 1PVBA 2TN4A 2JWWA 2M49B 1NP8A 2BCBA 3BUMB 1KK8B 1N0YA 3A4UB 1TNXA 1Y1XA 2L0PA 3SIBA 4M2OA 3CS1A 3WHUB 2FJUB 1TIZA 1JSAA 2WNDA 4UPGA 1S6JA 2MAZA 5HKYA 4MRYA 1CMGA 4MRXA 2KFGA 1ODBA 1ZMZA 1XK4C 2CBLA 1DF0A 4JPZB 3FWCA 4MZLA 1KWOC 1AK8A 1KSMA 2M9GA 1PK0D 5FYXA 1GGWA 1G33A 3I5GC 2F33A 4N5XA 1SCMB 2OS8B 4USLA 3HCMA 1ALWA 2CTNA 3BUNB 1MR8A 2G2BA 3DF0A 3O78A 2L4HA 3JTDB 2JULA 1GGZA 1OMDA 3KHEA 2E6WA 2M1KB 1QX7A 1SL9A 1C7VA 5I2OA 5CPVA 1EL4A 4Q04A 2F2OA 1JF2A 1PSBA 3NSLA 1KQVA 2LMTA 1XA5A 2Y4QA 1JUOA 1R2UA 3BUWB 2P6BB 4BY4A 1H4BA 5B8IB 2IS9A 2JOJA 4U8DA 2QPTA 1KQMB 1PSRA 1K94A 3EK7A 4DUQA 1GQMA 3AKBA 1BLQA 1CMFA 1RJVA 3PLFB 2LP2A 1A75B 1S6IA 4P5OE 2MJWB 2KQYA 4CLNA 3OB2B 3TS5B 4P2YB 3PALA 3IF7A 1JF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M8U A;  3PM8 A;  1MXE A;  1EG3 A;  3AAK A;  1SYM A;  5D69 A;  4QJ5 B;  3NXA A;  1KFX L;  4PDZ A;  1B4C A;  2Q91 A;  2KFH A;  1SR6 B;  1S5G Z;  1ALV A;  1IQ5 A;  1RFJ A;  1S3P A;  2OPO A;  5BPJ A;  1FPW A;  2MLF C;  3LLE A;  2F2P A;  1NIW A;  2PAS A;  2OTG C;  3BYA A;  5F6T A;  4A4B A;  1N2D A;  2K0J A;  3GK4 X;  3EVU A;  1OQP A;  2FCD A;  2JQ6 A;  1B1G A;  2JU0 A;  1V1G A;  1BOD A;  2FOT A;  3K21 A;  3PSR A;  5HLO A;  2LM5 A;  1DT7 B;  1WRZ A;  2BE6 A;  1NSH A;  1DGV A;  1XO5 A;  1WDC C;  4GNK B;  4QJ4 B;  3I5F C;  1GJY A;  2F8P A;  1M31 A;  2LAN A;  2ISD A;  1YX7 A;  4YGE B;  1SNL A;  2CT9 A;  2ZND A;  1V1F A;  3O2P A;  1AHR A;  1WY9 A;  2JNX A;  1IH0 A;  3SG4 A;  1NX0 A;  4PE7 A;  3OP0 A;  4E68 A;  4MLW A;  4ORB B;  4I5K A;  4I5J A;  1IKU A;  4YI8 A;  1G8I A;  1B8C A;  2K7D A;  2O5G A;  4MBE A;  3C1V A;  3BQ3 A;  1J7O A;  4JQ0 D;  4MVF A;  1F70 A;  4A4C A;  1K93 D;  2LLU A;  5HLV A;  2JXC A;  1M63 B;  2K7C A;  2Y5I A;  3I5H C;  1DF0 B;  1CDL A;  1FBV A;  1Q80 A;  2JTT A;  2LV7 A;  4IL1 A;  3GOF A;  5KTY A;  4TNC A;  1DJG A;  2JTZ A;  3CR4 X;  2PSR A;  1YUT A;  1LKJ A;  2H2K A;  4L9M A;  2D8N A;  4ORC B;  3AAJ A;  1JC2 A;  1PVA A;  1QV1 A;  2EC6 B;  4FTG A;  1BU3 A;  4ORA B;  3DF0 B;  1B8L A;  2M0R A;  4M2Q A;  2LCP A;  2MHH A;  1CKK A;  1AJ5 A;  1ZOT B;  5HYD A;  4OV2 A;  1S1E A;  2LUX A;  4M2P A;  2AUC A;  4YGB B;  2LUC A;  4HRH A;  1TN4 A;  2EHB A;  4N1F A;  5D7F A;  1QV0 A;  2KNE A;  1AP4 A;  2A4J A;  1S5G Y;  2V53 A;  2LMV A;  4BY5 A;  4YI9 A;  4AQI A;  2HPS A;  1SMG A;  2K8M B;  3ZNI A;  1U5I A;  1JFJ A;  1WRL A;  1F4Q A;  2LLS A;  1KFU S;  1QX5 B;  3SIA A;  1A4P A;  1M46 A;  4F0Z B;  5CSF A;  1SKT A;  1J7Q A;  3TUY B;  1XFW O;  4GFT A;  3WNX B;  3LK1 A;  4PHM A;  4D1E A;  2FCE A;  1UWO A;  2MBX A;  1YUU A;  2CXJ A;  1J55 A;  2ZN9 A;  1B47 A;  2NZ0 A;  3A8R A;  1NPQ A;  1NX3 A;  3EKJ A;  4WQ3 A;  1LA3 A;  2MRD A;  3DVK A;  4NQG A;  4PE4 A;  1W7I B;  1KFU L;  2LVV A;  1B9A A;  1L7Z A;  3DD4 A;  5AFP A;  1SL7 A;  1AUI B;  3BUX B;  3M0W A;  2BL0 C;  3CTN A;  3BXK A;  5DKQ A;  2PAL A;  1IJ5 A;  1DJH A;  1UUS A;  1LVC D;  1KK7 Z;  2JNF A;  1IJ6 A;  2L5X B;  2QAC A;  3KEV A;  4DRW A;  1YX8 A;  3NSO A;  3SG3 A;  4OVN F;  2LNK A;  1X02 A;  1DJI A;  1B7T Z;  1SRA A;  4DS7 A;  1QLK A;  2F3Z A;  2M3W A;  2Q4U A;  1BF5 A;  1A03 A;  1PAL A;  2KHN A;  1IG5 A;  2KI4 B;  2LE9 B;  3CGA A;  3EKH A;  4GAO A;  2WCE A;  1BMO A;  4CFR A;  1RK9 A;  2M97 A;  1K95 A;  2CCM A;  1L2O C;  1SPY A;  5CSJ A;  2HQ8 A;  2H61 C;  3I5I C;  5HKW A;  1J1E A;  2BBM A;  2PMY A;  3JVT B;  1DJX A;  1BR1 B;  2BEC A;  2NLN A;  1WLZ A;  1DJY A;  5TNC A;  2L4I A;  3TDZ A;  4PHJ A;  1Y1U A;  3VRN A;  5DKR A;  4CFQ A;  1XFX O;  3ZWH A;  1OE9 B;  3D0Y A;  1UHJ A;  2GGM A;  1AJ4 A;  4R1E A;  1QXP A;  5J3X A;  3PFV A;  3OHM B;  1IQ3 A;  1F54 A;  3EVR A;  3PN7 B;  1SY9 A;  1YVL A;  3SG2 A;  2KI6 D;  4NDC A;  2EGD A;  1TNQ A;  1K96 A;  3CWG A;  1QS7 A;  3EK4 A;  1TOP A;  5I2Q A;  1TTX A;  1YRT B;  1KK8 C;  2I2R E;  2KFF A;  4XJK A;  1CM1 A;  2KBI A;  3CLN A;  2K2A A;  4YGD B;  3RLZ A;  1JBA A;  2L2E A;  1LXF C;  3AKA A;  1H8B A;  1NCX A;  2HQW A;  2K2F A;  1MUX A;  2B1U A;  1BJF A;  1FI5 A;  1EXR A;  3WHT B;  2WOS A;  3HX4 A;  2AMI A;  1OZS A;  1EG4 A;  1XYD A;  1KWO B;  4I5N B;  3RM1 A;  2LC5 A;  2LVI A;  2LP3 A;  1DTL A;  5ER4 X;  3TDI A;  4ETO A;  1CDN A;  1BR4 B;  1F55 A;  1OMR A;  1NX2 A;  1XFZ O;  3DVE A;  1KCY A;  3I5G B;  1SCM C;  2OS8 C;  2PVB A;  5GQQ C;  3CZT X;  3NSI A;  4OR9 B;  4GPL B;  1WRK A;  2I7A A;  2HET A;  5CSI A;  1KK7 Y;  1YRU B;  1Y6W A;  2JXL A;  3JTD C;  1NYA A;  2I18 A;  1MQ1 A;  1XFY O;  2GGZ A;  1YTZ C;  1JFK A;  1M39 A;  1B7T Y;  1U5I B;  2Y1N A;  3LK0 A;  3VRR A;  1KSO A;  1LA0 A;  1N65 A;  1YR5 A;  3WXA A;  2JT8 A;  2KOT A;  4YGA A;  5JOL A;  5K89 A;  3GK1 A;  2BCA A;  2BCX A;  3BOW A;  4DIR A;  3SG7 A;  5JJG A;  1MWN A;  2KAY A;  3CR2 A;  4C0J A;  2BE4 A;  1DJZ A;  1NCZ A;  5AEQ A;  2PRU A;  1DJW A;  4MSP A;  5KU1 A;  1KQM C;  1UUR A;  1YUS A;  1IWQ A;  4HSZ A;  2E30 A;  5I8N A;  1NX1 A;  2KYF A;  1ZAC A;  1TCO B;  3TS5 C;  5HKZ A;  1Y1A A;  1ZFS A;  1J7P A;  1EH2 A;  1UHK A;  2K7B A;  4DCK A;  1OZO A;  1XVJ A;  4MN0 A;  2JRF A;  1CLB A;  2CNP A;  1CM4 A;  2NXQ A;  3MSE B;  1C7W A;  1UHN A;  1CFF A;  1M45 A;  1K9U A;  1SR6 C;  1UHH A;  1REC A;  1F4O A;  2JT0 A;  1JWD A;  2JT3 A;  4WRI A;  2VRG A;  4ICB A;  1RTP 1;  3VGO A;  1F71 A;  4GGF C;  1FI6 A;  1NCY A;  4HRE E;  2OTG B;  3NSK A;  1MXL C;  4PHK A;  3SG5 A;  5G08 A;  2RGI A;  3D0Y B;  3IQO A;  1Y0V H;  5DKN A;  2R2I A;  5I2L A;  2ZNE A;  1QVI Z;  2L98 A;  5AXI A;  2H61 A;  4HRG A;  2WOR A;  4QJ3 B;  1CNP A;  2KBM A;  1WDC B;  1S26 D;  1HT9 A;  1K9P A;  3I5F B;  4GBA A;  2DOQ A;  4NDD A;  1IGV A;  4CPV A;  5IBW A;  1CLM A;  2L51 A;  3GK2 A;  2M7N A;  2LHL A;  1XFU O;  1ZUZ A;  3H4S E;  4XJK B;  2BKI B;  4PE0 A;  1FF1 A;  1K90 D;  2ZFD A;  1YVH A;  3CR5 X;  1TRF A;  4XYN A;  2LHI A;  1IRJ A;  2JZI A;  2M7L A;  2GV5 A;  3EVV A;  1C07 A;  1CB1 A;  1D1O A;  3LL8 B;  1G4Y R;  2KGB C;  1F8H A;  2COL B;  1QAT A;  3D10 A;  3FS7 A;  3OX6 A;  4YBH B;  5AER A;  2KGR A;  1OOJ A;  3I5H B;  4C0K A;  1BT6 A;  2JC2 A;  4N1G A;  1DGU A;  4OCI A;  1W7J B;  4FQO A;  1CFD A;  4PCW A;  1QIW A;  3OX5 A;  1RRO A;  4YGC B;  3LCP C;  2NCP A;  1E8A A;  2K61 A;  2EC6 C;  2SCP A;  1MHO A;  2K7O A;  1A2X A;  2ZRT A;  2G9B A;  3DVM A;  1CTR A;  1NUB A;  2Y1M A;  1BG1 A;  3BUO B;  3KF9 A;  1QAS A;  1KFX S;  1QTX A;  1DMO A;  4CID A;  5ER5 A;  1OSA A;  1R6P A;  2SAS A;  2JPT A;  1CFP A;  5KSZ A;  3VRO A;  2WCB A;  2WC8 A;  4GUK A;  4ZCU A;  4I5L B;  4C0L A;  4PHN A;  3BOW B;  2L50 A;  1LIN A;  1CDM A;  1NWD A;  2LVK A;  3FWB A;  2LLT A;  3QRX A;  3PAT A;  1K2H A;  1S6C A;  1SL8 A;  1BOC A;  2I94 A;  3O6B A;  2LAP A;  4ZCV A;  3TUY C;  2LMU A;  2KI6 C;  1CDP A;  1PUL A;  1J1D A;  2ZN8 A;  2F3Y A;  1QVI Y;  1TNW A;  4GGN A;  1CFC A;  5AAN A;  4YRU A;  4AOM A;  1MF8 B;  3E3R A;  2AAO A;  2WCF A;  2HF5 A;  4PAL A;  2ZKM X;  1XFV O;  2O60 A;  3KPX A;  1A75 A;  2BL0 B;  1QX2 A;  2M29 A;  1RWY A;  3EK8 A;  1PRW A;  3VRQ A;  1B8R A;  1TNP A;  1TCF A;  1VRK A;  2KSP A;  3ICB A;  1WLM A;  2ZRS A;  2KAX A;  1QIV A;  1DVI A;  4MZJ A;  2KQ6 A;  3SG6 A;  5CSN A;  2KI4 C;  1QJT A;  2KDH A;  4MZK A;  4NDB A;  3F45 A;  1EJ3 A;  3DVJ A;  3TZ1 A;  3KO0 A;  2KYC A;  4PE1 A;  2LVJ A;  2BKH B;  1L2O B;  3VRP A;  3JVT C;  1FW4 A;  3I5I B;  1UP5 A;  1SW8 A;  3O4Y A;  2KAV A;  1K8U A;  4OKH A;  4GGF A;  3IQQ A;  1A29 A;  2MLE C;  5PAL A;  3FIA A;  1UHI A;  4WQ2 A;  2M1U A;  1SBJ A;  3SJS A;  4MEW A;  4JWQ A;  1J7R A;  1SCV A;  3PN7 C;  4AQJ A;  1CLL A;  1AVS A;  1YUR A;  1HQV A;  1S36 A;  1SK6 D;  1QLS A;  3TDU A;  2NCO A;  1XK4 A;  3OB1 B;  1K9K A;  2BBN A;  2MA2 A;  1OMV A;  1PVB A;  2TN4 A;  2JWW A;  2M49 B;  1NP8 A;  2BCB A;  3BUM B;  1KK8 B;  1N0Y A;  3A4U B;  1TNX A;  1Y1X A;  2L0P A;  3SIB A;  4M2O A;  3CS1 A;  3WHU B;  2FJU B;  1TIZ A;  1JSA A;  2WND A;  4UPG A;  1S6J A;  2MAZ A;  5HKY A;  4MRY A;  1CMG A;  4MRX A;  2KFG A;  1ODB A;  1ZMZ A;  1XK4 C;  2CBL A;  1DF0 A;  4JPZ B;  3FWC A;  4MZL A;  1KWO C;  1AK8 A;  1KSM A;  2M9G A;  1PK0 D;  5FYX A;  1GGW A;  1G33 A;  3I5G C;  2F33 A;  4N5X A;  1SCM B;  2OS8 B;  4USL A;  3HCM A;  1ALW A;  2CTN A;  3BUN B;  1MR8 A;  2G2B A;  3DF0 A;  3O78 A;  2L4H A;  3JTD B;  2JUL A;  1GGZ A;  1OMD A;  3KHE A;  2E6W A;  2M1K B;  1QX7 A;  1SL9 A;  1C7V A;  5I2O A;  5CPV A;  1EL4 A;  4Q04 A;  2F2O A;  1JF2 A;  1PSB A;  3NSL A;  1KQV A;  2LMT A;  1XA5 A;  2Y4Q A;  1JUO A;  1R2U A;  3BUW B;  2P6B B;  4BY4 A;  1H4B A;  5B8I B;  2IS9 A;  2JOJ A;  4U8D A;  2QPT A;  1KQM B;  1PSR A;  1K94 A;  3EK7 A;  4DUQ A;  1GQM A;  3AKB A;  1BLQ A;  1CMF A;  1RJV A;  3PLF B;  2LP2 A;  1A75 B;  1S6I A;  4P5O E;  2MJW B;  2KQY A;  4CLN A;  3OB2 B;  3TS5 B;  4P2Y B;  3PAL A;  3IF7 A;  1JF0 A; 
#chains in the Genus database with same CATH topology
 2M8U A;  3R1O A;  3PM8 A;  1MXE A;  1EG3 A;  3AAK A;  1P28 A;  1SYM A;  5D69 A;  4QJ5 B;  3NXA A;  1KFX L;  4PDZ A;  1B4C A;  1TUJ A;  3FE9 A;  2Q91 A;  2KFH A;  1SR6 B;  1S5G Z;  1ALV A;  1IQ5 A;  1RFJ A;  1S3P A;  2OPO A;  5BPJ A;  1FPW A;  2MLF C;  3LLE A;  2F2P A;  1NIW A;  2PAS A;  2OTG C;  3BYA A;  5F6T A;  4A4B A;  1N2D A;  2K0J A;  3N7H A;  3GK4 X;  3EVU A;  1OQP A;  2FCD A;  3FE6 A;  2JQ6 A;  1B1G A;  2JU0 A;  1V1G A;  1BOD A;  2FOT A;  3K21 A;  3PSR A;  5HLO A;  2LM5 A;  1DT7 B;  1WRZ A;  2WC5 A;  3D78 A;  2BE6 A;  1NSH A;  1DGV A;  1XO5 A;  1WDC C;  4GNK B;  4QJ4 B;  3I5F C;  1GJY A;  2F8P A;  1M31 A;  3D75 A;  2LAN A;  2ISD A;  1YX7 A;  3B88 A;  4YGE B;  1SNL A;  2CT9 A;  2ZND A;  1V1F A;  3O2P A;  1AHR A;  1WY9 A;  2QEV A;  2JNX A;  1IH0 A;  3SG4 A;  1GM0 A;  1NX0 A;  4PE7 A;  3OP0 A;  4E68 A;  4MLW A;  1OOH A;  4I5K A;  4I5J A;  4ORB B;  4INW A;  5I94 A;  1IKU A;  4YI8 A;  1G8I A;  1B8C A;  2K7D A;  2O5G A;  4MBE A;  3C1V A;  3BQ3 A;  1J7O A;  4JQ0 D;  4MVF A;  1F70 A;  3SS3 A;  1K93 D;  2LLU A;  5HLV A;  4A4C A;  2JXC A;  2BNX A;  3S0F A;  1M63 B;  2K7C A;  2Y5I A;  3I5H C;  1DF0 B;  1CDL A;  1FBV A;  1Q80 A;  2JTT A;  2LV7 A;  4IL1 A;  3GOF A;  5KTY A;  3L4L A;  4TNC A;  1DJG A;  2JTZ A;  3CR4 X;  2PSR A;  1YUT A;  1LKJ A;  2H2K A;  4L9M A;  2D8N A;  4ORC B;  1DQE A;  3AAJ A;  1JC2 A;  3R1V A;  1OW4 A;  1PVA A;  1QV1 A;  2EC6 B;  4FTG A;  1BU3 A;  4ORA B;  3DF0 B;  1B8L A;  2M0R A;  4INX A;  4M2Q A;  2LCP A;  2MHH A;  1CKK A;  1AJ5 A;  1ZOT B;  5HYD A;  1ORG A;  4OV2 A;  1S1E A;  3DZT A;  2LUX A;  4M2P A;  2AUC A;  3L4A A;  4YGB B;  2LUC A;  4HRH A;  1TN4 A;  2EHB A;  4N1F A;  5D7F A;  1OOI X;  1QV0 A;  2KNE A;  1AP4 A;  2A4J A;  1S5G Y;  2V53 A;  2LMV A;  1OOF A;  4BY5 A;  4YI9 A;  4AQI A;  2HPS A;  1SMG A;  2K8M B;  3ZNI A;  1U5I A;  1JFJ A;  1WRL A;  1F4Q A;  2LLS A;  1KFU S;  1QX5 B;  4F7F A;  3SIA A;  1A4P A;  1M46 A;  4F0Z B;  1Z4H A;  5CSF A;  1SKT A;  1J7Q A;  3TUY B;  1XFW O;  4GFT A;  3WNX B;  3LK1 A;  4PHM A;  4D1E A;  2FCE A;  1UWO A;  2MBX A;  1YUU A;  2CXJ A;  1J55 A;  2ZN9 A;  1B47 A;  2NZ0 A;  3A8R A;  1NPQ A;  1NX3 A;  3EKJ A;  4WQ3 A;  1LA3 A;  2MRD A;  3DVK A;  4NQG A;  4PE4 A;  1W7I B;  1KFU L;  2LVV A;  1B9A A;  2QEB A;  1L7Z A;  3DD4 A;  5AFP A;  1SL7 A;  1AUI B;  3BUX B;  3M0W A;  2GTE A;  2BL0 C;  3CTN A;  1Z2C B;  3BXK A;  5DKQ A;  5FI6 A;  2PAL A;  1IJ5 A;  1DJH A;  1UUS A;  1LVC D;  1KK7 Z;  2JNF A;  3B87 A;  1IJ6 A;  2L5X B;  2QAC A;  3KEV A;  4DRW A;  1YX8 A;  3NSO A;  3SG3 A;  4OVN F;  1TUZ A;  1X02 A;  1DJI A;  1B7T Z;  1SRA A;  2LNK A;  1QLK A;  2F3Z A;  2M3W A;  2Q4U A;  2WC6 A;  3B6X A;  5FI7 A;  4DS7 A;  1A03 A;  1PAL A;  2KHN A;  1IG5 A;  2KI4 B;  2LE9 B;  3CGA A;  3EKH A;  4GAO A;  1QWV A;  2WCE A;  1BMO A;  4CFR A;  1RK9 A;  2M97 A;  1K95 A;  2CCM A;  1L2O C;  1SPY A;  3CYZ A;  2HQ8 A;  2H61 C;  3I5I C;  5CSJ A;  1J1E A;  5HKW A;  2BBM A;  2PMY A;  3JVT B;  1DJX A;  1BR1 B;  2QEH A;  2BEC A;  2NLN A;  1WLZ A;  1DJY A;  4IJ7 A;  2L4I A;  5TNC A;  4KYN A;  4PHJ A;  3TDZ A;  1Y1U A;  3VRN A;  5DKR A;  3S0D A;  4CFQ A;  1XFX O;  3ZWH A;  1OE9 B;  3D0Y A;  1UHJ A;  2GGM A;  1AJ4 A;  4R1E A;  1QXP A;  5J3X A;  3PFV A;  3OHM B;  1IQ3 A;  1F54 A;  3EVR A;  3PN7 B;  1SY9 A;  1YVL A;  3SG2 A;  3D74 A;  2KI6 D;  4NDC A;  2EGD A;  1TNQ A;  1K96 A;  3CWG A;  1QS7 A;  3EK4 A;  1TOP A;  3UO9 A;  5I2Q A;  1TTX A;  1YRT B;  1KK8 C;  1W9Z A;  2I2R E;  2KFF A;  4XJK A;  1CM1 A;  3V2L A;  2KBI A;  3B86 A;  3CLN A;  3CZ2 A;  2K2A A;  4YGD B;  3RLZ A;  1JBA A;  1C3Z A;  1LXF C;  2L2E A;  3AKA A;  1H8B A;  1NCX A;  2HQW A;  2K2F A;  1MUX A;  2B1U A;  1BJF A;  1FI5 A;  1EXR A;  3WHT B;  4FQT A;  2WOS A;  3NGV A;  3HX4 A;  1XYD A;  1OZS A;  1EG4 A;  2AMI A;  1KWO B;  4I5N B;  3RM1 A;  1TWO A;  2LC5 A;  2LVI A;  2LP3 A;  1DTL A;  5ER4 X;  3TDI A;  4ETO A;  1CDN A;  1BR4 B;  1F55 A;  1OMR A;  1NX2 A;  1XFZ O;  3DVE A;  1KCY A;  3I5G B;  1SCM C;  2OS8 C;  2PVB A;  5GQQ C;  3CZT X;  2L2C A;  3NSI A;  4OR9 B;  2H8V A;  4GPL B;  1WRK A;  2I7A A;  2HET A;  5CSI A;  1KK7 Y;  1YRU B;  1Y6W A;  2JXL A;  3JTD C;  1NYA A;  2I18 A;  1MQ1 A;  1XFY O;  2GGZ A;  1YTZ C;  1JFK A;  1M39 A;  1B7T Y;  1U5I B;  2Y1N A;  3LK0 A;  3VRR A;  1KSO A;  1LA0 A;  1N65 A;  1YR5 A;  3WXA A;  2JT8 A;  2KOT A;  4YGA A;  5JOL A;  5K89 A;  3GK1 A;  2BCA A;  1T14 A;  2BCX A;  5DIC A;  3BOW A;  3CZ0 A;  4DIR A;  3SG7 A;  5JJG A;  1MWN A;  2KAY A;  3CR2 A;  4C0J A;  2BE4 A;  1DJZ A;  1NCZ A;  5AEQ A;  2PRU A;  1DJW A;  4MSP A;  5KU1 A;  1KQM C;  1UUR A;  4PT1 A;  1YUS A;  1IWQ A;  4HSZ A;  2E30 A;  5I8N A;  1NX1 A;  2KYF A;  1ZAC A;  1TCO B;  3TS5 C;  5HKZ A;  1Y1A A;  1ZFS A;  3UNW A;  1J7P A;  1EH2 A;  1UHK A;  2K7B A;  4DCK A;  1OZO A;  1XVJ A;  4MN0 A;  2JRF A;  1CLB A;  2CNP A;  1CM4 A;  2NXQ A;  2QEO A;  1SSE B;  3MSE B;  1C7W A;  1UHN A;  1CFF A;  1M45 A;  3R1P A;  1K9U A;  1SR6 C;  2PQL A;  1UHH A;  1REC A;  1F4O A;  2JT0 A;  1JWD A;  2JT3 A;  2WCJ A;  4WRI A;  2VRG A;  4ICB A;  1RTP 1;  3VGO A;  1F71 A;  4GGF C;  2WCM A;  1FI6 A;  1NCY A;  4HRE E;  2OTG B;  3NSK A;  1MXL C;  4PHK A;  3SG5 A;  1DEK A;  5G08 A;  2RGI A;  3D0Y B;  2FJY A;  3IQO A;  3NHI A;  1Y0V H;  1XFR A;  3S0E A;  5DKN A;  2R2I A;  5I2L A;  2ZNE A;  1QVI Z;  2L98 A;  5AXI A;  2H61 A;  4HRG A;  3S0G A;  2WCK A;  2WOR A;  3R72 A;  4QJ3 B;  1CNP A;  2KBM A;  1WDC B;  1S26 D;  1HT9 A;  1K9P A;  3I5F B;  4GBA A;  2DOQ A;  4NDD A;  1IGV A;  2BAP A;  4CPV A;  5IBW A;  1CLM A;  2L51 A;  3GK2 A;  2M7N A;  2LHL A;  3FE8 A;  1XFU O;  1ZUZ A;  3H4S E;  4XJK B;  2BKI B;  4PE0 A;  1FF1 A;  3QME A;  1K90 D;  2ZFD A;  1YVH A;  3CR5 X;  1TRF A;  4XYN A;  2LHI A;  1IRJ A;  2JZI A;  2M7L A;  2GV5 A;  3EVV A;  1C07 A;  1CB1 A;  1D1O A;  3S0B A;  3LL8 B;  1G4Y R;  3S0A A;  2KGB C;  1F8H A;  2COL B;  1QAT A;  3D10 A;  3FS7 A;  3OX6 A;  4YBH B;  5AER A;  2KGR A;  1OOJ A;  3I5H B;  3O4X A;  1BT6 A;  2JC2 A;  4C0K A;  4N1G A;  1DGU A;  4OCI A;  3D77 A;  1W7J B;  4FQO A;  1CFD A;  4PCW A;  3OGN A;  1QIW A;  3OX5 A;  1RRO A;  4YGC B;  3LCP C;  2NCP A;  1E8A A;  2K61 A;  2KLE A;  2EC6 C;  2SCP A;  1MHO A;  2K7O A;  1A2X A;  2ZRT A;  2G9B A;  3DVM A;  1CTR A;  1NUB A;  2Y1M A;  1BG1 A;  3BUO B;  3CDN A;  3KF9 A;  1QAS A;  1KFX S;  1QTX A;  1DMO A;  4CID A;  5ER5 A;  1OSA A;  3DXL A;  1R6P A;  4JKT A;  2SAS A;  2WCL A;  2JPT A;  1CFP A;  5KSZ A;  3VRO A;  2WCB A;  2WC8 A;  4GUK A;  4ZCU A;  4I5L B;  4C0L A;  3RZS A;  4PHN A;  3BOW B;  2L50 A;  1LIN A;  1CDM A;  1NWD A;  2LVK A;  3FWB A;  2LLT A;  2KLD A;  3OBV A;  3QRX A;  3PAT A;  1K2H A;  1S6C A;  1SL8 A;  3K1E A;  1BOC A;  2I94 A;  3O6B A;  3NHT A;  3PJI A;  2LAP A;  4ZCV A;  3DY9 A;  3TUY C;  2LMU A;  2KI6 C;  1CDP A;  1PUL A;  1J1D A;  2ZN8 A;  2QDI A;  2JPO A;  3D76 A;  2F3Y A;  1QVI Y;  1TNW A;  4GGN A;  1CFC A;  5AAN A;  4YRU A;  3B7A A;  4AOM A;  1MF8 B;  3E3R A;  3SS4 A;  2AAO A;  2P71 A;  2WCF A;  2HF5 A;  4PAL A;  1IIO A;  2ZKM X;  1DEL A;  1XFV O;  2O60 A;  3KPX A;  1A75 A;  2BL0 B;  1QX2 A;  2M29 A;  1RWY A;  3EK8 A;  1PRW A;  3VRQ A;  1B8R A;  1TNP A;  1TCF A;  1VRK A;  2KSP A;  3ICB A;  1WLM A;  2ZRS A;  2KAX A;  1QIV A;  1DVI A;  4MZJ A;  2KQ6 A;  3SG6 A;  5CSN A;  2KI4 C;  1QJT A;  2KDH A;  4MZK A;  4NDB A;  3F45 A;  1EJ3 A;  2KPH A;  3DVJ A;  3TZ1 A;  1DC1 A;  3KO0 A;  3EG5 B;  2KYC A;  4PE1 A;  2LVJ A;  3BJH A;  2BKH B;  1L2O B;  3VRP A;  3JVT C;  1FW4 A;  3I5I B;  1UP5 A;  1SW8 A;  3O4Y A;  2KAV A;  1K8U A;  4OKH A;  4GGF A;  3IQQ A;  1A29 A;  2MLE C;  5PAL A;  3FIA A;  1UHI A;  4WQ2 A;  2M1U A;  1SBJ A;  3CAB A;  3BFB A;  3SJS A;  4MEW A;  4JWQ A;  1J7R A;  1SCV A;  4JD9 A;  3PN7 C;  4AQJ A;  1CLL A;  1AVS A;  1YUR A;  1HQV A;  1S36 A;  1SK6 D;  1QLS A;  3TDU A;  2NCO A;  1OOG A;  1XK4 A;  3OB1 B;  1K9K A;  3BFA A;  2BBN A;  2MA2 A;  1OMV A;  1PVB A;  2TN4 A;  2JWW A;  2M49 B;  3BFH A;  1NP8 A;  3D73 A;  2BCB A;  3BUM B;  1KK8 B;  1N0Y A;  3A4U B;  1TNX A;  1Y1X A;  2L0P A;  3SIB A;  4M2O A;  3CS1 A;  3WHU B;  2FJU B;  1TIZ A;  1JSA A;  2WND A;  4UPG A;  1S6J A;  3L47 A;  2MAZ A;  5HKY A;  4MRY A;  1CMG A;  4MRX A;  3DYE A;  2KFG A;  2YGU A;  5FI2 A;  1ODB A;  1ZMZ A;  3VB1 A;  1XK4 C;  2CBL A;  1DF0 A;  4JPZ B;  3FWC A;  4MZL A;  4OZD A;  1C3Y A;  1KWO C;  1AK8 A;  1KSM A;  2M9G A;  1PK0 D;  5HL1 A;  2K60 A;  5FYX A;  3Q8I A;  1GGW A;  2ERB A;  1G33 A;  3CZ1 A;  3I5G C;  2F33 A;  4N5X A;  1SCM B;  2OS8 B;  4USL A;  3HCM A;  5EL2 A;  1BF5 A;  1ALW A;  2CTN A;  3BUN B;  1MR8 A;  2G2B A;  2PYQ A;  3DF0 A;  3O78 A;  2L4H A;  3JTD B;  2JUL A;  1GGZ A;  1OMD A;  3KHE A;  2E6W A;  2M1K B;  1QX7 A;  1SL9 A;  3IVT A;  5D3O A;  1C7V A;  2L5Y A;  3PM2 A;  5I2O A;  5CPV A;  1EL4 A;  4Q04 A;  2F2O A;  1LS8 A;  1JF2 A;  1PSB A;  3NSL A;  1KQV A;  2LMT A;  1XA5 A;  2Y4Q A;  1JUO A;  1R2U A;  3BUW B;  2P6B B;  4BY4 A;  1H4B A;  5B8I B;  2IS9 A;  2JOJ A;  4U8D A;  2QPT A;  1KQM B;  1PSR A;  1K94 A;  3EK7 A;  4DUQ A;  1GQM A;  2WCH A;  3AKB A;  1BLQ A;  1RJV A;  1CMF A;  3PLF B;  2LP2 A;  1A75 B;  1S6I A;  2P70 A;  4P5O E;  2MJW B;  2KQY A;  4CLN A;  3OB2 B;  3TS5 B;  4P2Y B;  3PAL A;  3IF7 A;  1JF0 A;  3SS5 A; 
#chains in the Genus database with same CATH homology
 2M8U A;  3PM8 A;  1MXE A;  1EG3 A;  3AAK A;  1SYM A;  5D69 A;  4QJ5 B;  3NXA A;  1KFX L;  4PDZ A;  1B4C A;  2Q91 A;  2KFH A;  1SR6 B;  1S5G Z;  1ALV A;  1IQ5 A;  1RFJ A;  1S3P A;  2OPO A;  5BPJ A;  1FPW A;  2MLF C;  3LLE A;  2F2P A;  1NIW A;  2PAS A;  2OTG C;  3BYA A;  5F6T A;  4A4B A;  1N2D A;  2K0J A;  3GK4 X;  3EVU A;  1OQP A;  2FCD A;  2JQ6 A;  1B1G A;  2JU0 A;  1V1G A;  1BOD A;  2FOT A;  3K21 A;  3PSR A;  5HLO A;  2LM5 A;  1DT7 B;  1WRZ A;  2BE6 A;  1NSH A;  1DGV A;  1XO5 A;  1WDC C;  4GNK B;  4QJ4 B;  3I5F C;  1GJY A;  2F8P A;  1M31 A;  2LAN A;  2ISD A;  1YX7 A;  4YGE B;  1SNL A;  2CT9 A;  2ZND A;  1V1F A;  3O2P A;  1AHR A;  1WY9 A;  2JNX A;  1IH0 A;  3SG4 A;  1NX0 A;  4PE7 A;  3OP0 A;  4E68 A;  4MLW A;  4ORB B;  4I5K A;  4I5J A;  1IKU A;  4YI8 A;  1G8I A;  1B8C A;  2K7D A;  2O5G A;  4MBE A;  3C1V A;  3BQ3 A;  1J7O A;  4JQ0 D;  4MVF A;  1F70 A;  4A4C A;  1K93 D;  2LLU A;  5HLV A;  2JXC A;  1M63 B;  2K7C A;  2Y5I A;  3I5H C;  1DF0 B;  1CDL A;  1FBV A;  1Q80 A;  2JTT A;  2LV7 A;  4IL1 A;  3GOF A;  5KTY A;  4TNC A;  1DJG A;  2JTZ A;  3CR4 X;  2PSR A;  1YUT A;  1LKJ A;  2H2K A;  4L9M A;  2D8N A;  4ORC B;  3AAJ A;  1JC2 A;  1PVA A;  1QV1 A;  2EC6 B;  4FTG A;  1BU3 A;  4ORA B;  3DF0 B;  1B8L A;  2M0R A;  4M2Q A;  2LCP A;  2MHH A;  1CKK A;  1AJ5 A;  1ZOT B;  5HYD A;  4OV2 A;  1S1E A;  2LUX A;  4M2P A;  2AUC A;  4YGB B;  2LUC A;  4HRH A;  1TN4 A;  2EHB A;  4N1F A;  5D7F A;  1QV0 A;  2KNE A;  1AP4 A;  2A4J A;  1S5G Y;  2V53 A;  2LMV A;  4BY5 A;  4YI9 A;  4AQI A;  2HPS A;  1SMG A;  2K8M B;  3ZNI A;  1U5I A;  1JFJ A;  1WRL A;  1F4Q A;  2LLS A;  1KFU S;  1QX5 B;  3SIA A;  1A4P A;  1M46 A;  4F0Z B;  5CSF A;  1SKT A;  1J7Q A;  3TUY B;  1XFW O;  4GFT A;  3WNX B;  3LK1 A;  4PHM A;  4D1E A;  2FCE A;  1UWO A;  2MBX A;  1YUU A;  2CXJ A;  1J55 A;  2ZN9 A;  1B47 A;  2NZ0 A;  3A8R A;  1NPQ A;  1NX3 A;  3EKJ A;  4WQ3 A;  1LA3 A;  2MRD A;  3DVK A;  4NQG A;  4PE4 A;  1W7I B;  1KFU L;  2LVV A;  1B9A A;  1L7Z A;  3DD4 A;  5AFP A;  1SL7 A;  1AUI B;  3BUX B;  3M0W A;  2BL0 C;  3CTN A;  3BXK A;  5DKQ A;  2PAL A;  1IJ5 A;  1DJH A;  1UUS A;  1LVC D;  1KK7 Z;  2JNF A;  1IJ6 A;  2L5X B;  2QAC A;  3KEV A;  4DRW A;  1YX8 A;  3NSO A;  3SG3 A;  4OVN F;  2LNK A;  1X02 A;  1DJI A;  1B7T Z;  1SRA A;  4DS7 A;  1QLK A;  2F3Z A;  2M3W A;  2Q4U A;  1BF5 A;  1A03 A;  1PAL A;  2KHN A;  1IG5 A;  2KI4 B;  2LE9 B;  3CGA A;  3EKH A;  4GAO A;  2WCE A;  1BMO A;  4CFR A;  1RK9 A;  2M97 A;  1K95 A;  2CCM A;  1L2O C;  1SPY A;  5CSJ A;  2HQ8 A;  2H61 C;  3I5I C;  5HKW A;  1J1E A;  2BBM A;  2PMY A;  3JVT B;  1DJX A;  1BR1 B;  2BEC A;  2NLN A;  1WLZ A;  1DJY A;  5TNC A;  2L4I A;  3TDZ A;  4PHJ A;  1Y1U A;  3VRN A;  5DKR A;  4CFQ A;  1XFX O;  3ZWH A;  1OE9 B;  3D0Y A;  1UHJ A;  2GGM A;  1AJ4 A;  4R1E A;  1QXP A;  5J3X A;  3PFV A;  3OHM B;  1IQ3 A;  1F54 A;  3EVR A;  3PN7 B;  1SY9 A;  1YVL A;  3SG2 A;  2KI6 D;  4NDC A;  2EGD A;  1TNQ A;  1K96 A;  3CWG A;  1QS7 A;  3EK4 A;  1TOP A;  5I2Q A;  1TTX A;  1YRT B;  1KK8 C;  2I2R E;  2KFF A;  4XJK A;  1CM1 A;  2KBI A;  3CLN A;  2K2A A;  4YGD B;  3RLZ A;  1JBA A;  2L2E A;  1LXF C;  3AKA A;  1H8B A;  1NCX A;  2HQW A;  2K2F A;  1MUX A;  2B1U A;  1BJF A;  1FI5 A;  1EXR A;  3WHT B;  2WOS A;  3HX4 A;  2AMI A;  1OZS A;  1EG4 A;  1XYD A;  1KWO B;  4I5N B;  3RM1 A;  2LC5 A;  2LVI A;  2LP3 A;  1DTL A;  5ER4 X;  3TDI A;  4ETO A;  1CDN A;  1BR4 B;  1F55 A;  1OMR A;  1NX2 A;  1XFZ O;  3DVE A;  1KCY A;  3I5G B;  1SCM C;  2OS8 C;  2PVB A;  5GQQ C;  3CZT X;  3NSI A;  4OR9 B;  4GPL B;  1WRK A;  2I7A A;  2HET A;  5CSI A;  1KK7 Y;  1YRU B;  1Y6W A;  2JXL A;  3JTD C;  1NYA A;  2I18 A;  1MQ1 A;  1XFY O;  2GGZ A;  1YTZ C;  1JFK A;  1M39 A;  1B7T Y;  1U5I B;  2Y1N A;  3LK0 A;  3VRR A;  1KSO A;  1LA0 A;  1N65 A;  1YR5 A;  3WXA A;  2JT8 A;  2KOT A;  4YGA A;  5JOL A;  5K89 A;  3GK1 A;  2BCA A;  2BCX A;  3BOW A;  4DIR A;  3SG7 A;  5JJG A;  1MWN A;  2KAY A;  3CR2 A;  4C0J A;  2BE4 A;  1DJZ A;  1NCZ A;  5AEQ A;  2PRU A;  1DJW A;  4MSP A;  5KU1 A;  1KQM C;  1UUR A;  1YUS A;  1IWQ A;  4HSZ A;  2E30 A;  5I8N A;  1NX1 A;  2KYF A;  1ZAC A;  1TCO B;  3TS5 C;  5HKZ A;  1Y1A A;  1ZFS A;  1J7P A;  1EH2 A;  1UHK A;  2K7B A;  4DCK A;  1OZO A;  1XVJ A;  4MN0 A;  2JRF A;  1CLB A;  2CNP A;  1CM4 A;  2NXQ A;  3MSE B;  1C7W A;  1UHN A;  1CFF A;  1M45 A;  1K9U A;  1SR6 C;  1UHH A;  1REC A;  1F4O A;  2JT0 A;  1JWD A;  2JT3 A;  4WRI A;  2VRG A;  4ICB A;  1RTP 1;  3VGO A;  1F71 A;  4GGF C;  1FI6 A;  1NCY A;  4HRE E;  2OTG B;  3NSK A;  1MXL C;  4PHK A;  3SG5 A;  5G08 A;  2RGI A;  3D0Y B;  3IQO A;  1Y0V H;  5DKN A;  2R2I A;  5I2L A;  2ZNE A;  1QVI Z;  2L98 A;  5AXI A;  2H61 A;  4HRG A;  2WOR A;  4QJ3 B;  1CNP A;  2KBM A;  1WDC B;  1S26 D;  1HT9 A;  1K9P A;  3I5F B;  4GBA A;  2DOQ A;  4NDD A;  1IGV A;  4CPV A;  5IBW A;  1CLM A;  2L51 A;  3GK2 A;  2M7N A;  2LHL A;  1XFU O;  1ZUZ A;  3H4S E;  4XJK B;  2BKI B;  4PE0 A;  1FF1 A;  1K90 D;  2ZFD A;  1YVH A;  3CR5 X;  1TRF A;  4XYN A;  2LHI A;  1IRJ A;  2JZI A;  2M7L A;  2GV5 A;  3EVV A;  1C07 A;  1CB1 A;  1D1O A;  3LL8 B;  1G4Y R;  2KGB C;  1F8H A;  2COL B;  1QAT A;  3D10 A;  3FS7 A;  3OX6 A;  4YBH B;  5AER A;  2KGR A;  1OOJ A;  3I5H B;  4C0K A;  1BT6 A;  2JC2 A;  4N1G A;  1DGU A;  4OCI A;  1W7J B;  4FQO A;  1CFD A;  4PCW A;  1QIW A;  3OX5 A;  1RRO A;  4YGC B;  3LCP C;  2NCP A;  1E8A A;  2K61 A;  2EC6 C;  2SCP A;  1MHO A;  2K7O A;  1A2X A;  2ZRT A;  2G9B A;  3DVM A;  1CTR A;  1NUB A;  2Y1M A;  1BG1 A;  3BUO B;  3KF9 A;  1QAS A;  1KFX S;  1QTX A;  1DMO A;  4CID A;  5ER5 A;  1OSA A;  1R6P A;  2SAS A;  2JPT A;  1CFP A;  5KSZ A;  3VRO A;  2WCB A;  2WC8 A;  4GUK A;  4ZCU A;  4I5L B;  4C0L A;  4PHN A;  3BOW B;  2L50 A;  1LIN A;  1CDM A;  1NWD A;  2LVK A;  3FWB A;  2LLT A;  3QRX A;  3PAT A;  1K2H A;  1S6C A;  1SL8 A;  1BOC A;  2I94 A;  3O6B A;  2LAP A;  4ZCV A;  3TUY C;  2LMU A;  2KI6 C;  1CDP A;  1PUL A;  1J1D A;  2ZN8 A;  2F3Y A;  1QVI Y;  1TNW A;  4GGN A;  1CFC A;  5AAN A;  4YRU A;  4AOM A;  1MF8 B;  3E3R A;  2AAO A;  2WCF A;  2HF5 A;  4PAL A;  2ZKM X;  1XFV O;  2O60 A;  3KPX A;  1A75 A;  2BL0 B;  1QX2 A;  2M29 A;  1RWY A;  3EK8 A;  1PRW A;  3VRQ A;  1B8R A;  1TNP A;  1TCF A;  1VRK A;  2KSP A;  3ICB A;  1WLM A;  2ZRS A;  2KAX A;  1QIV A;  1DVI A;  4MZJ A;  2KQ6 A;  3SG6 A;  5CSN A;  2KI4 C;  1QJT A;  2KDH A;  4MZK A;  4NDB A;  3F45 A;  1EJ3 A;  3DVJ A;  3TZ1 A;  3KO0 A;  2KYC A;  4PE1 A;  2LVJ A;  2BKH B;  1L2O B;  3VRP A;  3JVT C;  1FW4 A;  3I5I B;  1UP5 A;  1SW8 A;  3O4Y A;  2KAV A;  1K8U A;  4OKH A;  4GGF A;  3IQQ A;  1A29 A;  2MLE C;  5PAL A;  3FIA A;  1UHI A;  4WQ2 A;  2M1U A;  1SBJ A;  3SJS A;  4MEW A;  4JWQ A;  1J7R A;  1SCV A;  3PN7 C;  4AQJ A;  1CLL A;  1AVS A;  1YUR A;  1HQV A;  1S36 A;  1SK6 D;  1QLS A;  3TDU A;  2NCO A;  1XK4 A;  3OB1 B;  1K9K A;  2BBN A;  2MA2 A;  1OMV A;  1PVB A;  2TN4 A;  2JWW A;  2M49 B;  1NP8 A;  2BCB A;  3BUM B;  1KK8 B;  1N0Y A;  3A4U B;  1TNX A;  1Y1X A;  2L0P A;  3SIB A;  4M2O A;  3CS1 A;  3WHU B;  2FJU B;  1TIZ A;  1JSA A;  2WND A;  4UPG A;  1S6J A;  2MAZ A;  5HKY A;  4MRY A;  1CMG A;  4MRX A;  2KFG A;  1ODB A;  1ZMZ A;  1XK4 C;  2CBL A;  1DF0 A;  4JPZ B;  3FWC A;  4MZL A;  1KWO C;  1AK8 A;  1KSM A;  2M9G A;  1PK0 D;  5FYX A;  1GGW A;  1G33 A;  3I5G C;  2F33 A;  4N5X A;  1SCM B;  2OS8 B;  4USL A;  3HCM A;  1ALW A;  2CTN A;  3BUN B;  1MR8 A;  2G2B A;  3DF0 A;  3O78 A;  2L4H A;  3JTD B;  2JUL A;  1GGZ A;  1OMD A;  3KHE A;  2E6W A;  2M1K B;  1QX7 A;  1SL9 A;  1C7V A;  5I2O A;  5CPV A;  1EL4 A;  4Q04 A;  2F2O A;  1JF2 A;  1PSB A;  3NSL A;  1KQV A;  2LMT A;  1XA5 A;  2Y4Q A;  1JUO A;  1R2U A;  3BUW B;  2P6B B;  4BY4 A;  1H4B A;  5B8I B;  2IS9 A;  2JOJ A;  4U8D A;  2QPT A;  1KQM B;  1PSR A;  1K94 A;  3EK7 A;  4DUQ A;  1GQM A;  3AKB A;  1BLQ A;  1CMF A;  1RJV A;  3PLF B;  2LP2 A;  1A75 B;  1S6I A;  4P5O E;  2MJW B;  2KQY A;  4CLN A;  3OB2 B;  3TS5 B;  4P2Y B;  3PAL A;  3IF7 A;  1JF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...