1KQMC

Scallop myosin s1-amppnp in the actin-detached conformation
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
153
structure length
153
Chain Sequence
KLSQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic findings on the internally uncoupled and near-rigor states of myosin: Further insights into the mechanics of the motor
pubmed doi rcsb
molecule tags Contractile protein
molecule keywords MYOSIN heavy chain
total genus 31
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2002-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kqmC01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kqmC02
2KI6D 5K89A 2ZNDA 1Y1UA 3IF7A 5DKQA 1YR5A 5IBWA 4UPGA 2I94A 3AAKA 1M46A 1QX2A 1MXLC 3PFVA 5CSNA 1TNXA 1F70A 4CFRA 2BCAA 2GGZA 2GV5A 3TZ1A 4CPVA 4HRHA 1CB1A 4DCKA 4ORBB 2JZIA 1W7JB 5DKNA 1IWQA 2COLB 2P6BB 1QS7A 1XFYO 2EC6B 5CSFA 2H61C 3LL8B 1RROA 2K0JA 4PDZA 4BY5A 1Y1XA 1H8BA 1KWOB 2G2BA 2FCDA 3BUMB 4D1EA 1GQMA 1AVSA 1BODA 2E30A 2FOTA 1BR1B 2AAOA 1PSRA 1BU3A 3ZWHA 4CIDA 2L4IA 1K9PA 3VRPA 2LNKA 4M2OA 1B4CA 1CLBA 2WOSA 3A4UB 1BF5A 1WDCB 1WRLA 2SCPA 5KSZA 1QVIY 4PE1A 2KI4B 1JF2A 1SL8A 2KAYA 2LP3A 1XO5A 2BKHB 1ZUZA 2JT8A 2BBNA 1DGVA 1KK7Z 2AUCA 1GGZA 5CSJA 4CLNA 3VRRA 4OKHA 2KSPA 2OPOA 2EC6C 1CFCA 1B7TY 2MBXA 2QPTA 1KWOC 2OS8B 2BE6A 1SK6D 4GGFC 2LHLA 5HKWA 1GJYA 2L98A 1QJTA 4A4CA 3JTDB 5KTYA 1MHOA 1F8HA 3F45A 1UHNA 2PALA 2ZN9A 3OX5A 1TTXA 2KI4C 1K94A 2CT9A 4YI8A 3FWCA 3TUYC 1MQ1A 1OQPA 2WC8A 1LXFC 1MR8A 1SL7A 4M2PA 4MN0A 1AJ5A 4GBAA 1IKUA 5AANA 1CTRA 1OOJA 3SG7A 5HKYA 2M49B 1QLSA 1IQ5A 3TUYB 1L2OC 2M9GA 3EVRA 1F4QA 2LANA 3VRQA 2F3YA 2PASA 4PHKA 3O78A 4P2YB 4MZKA 3PALA 1LVCD 1JWDA 4GAOA 1ZFSA 1QIWA 2ZKMX 1J55A 2KHNA 2MHHA 1M45A 3D0YB 1A75B 1JF0A 3GK4X 4I5JA 1IRJA 1CFPA 1QATA 2Y1MA 2LMVA 1IH0A 2BBMA 1NX1A 3I5HC 1EG4A 1S1EA 2M0RA 2LHIA 4YI9A 5CPVA 3D10A 1FF1A 1Y1AA 1QV0A 2F2PA 1DJWA 4NQGA 1J7QA 4YGDB 4OV2A 1XFXO 1J7RA 1SW8A 2PRUA 1XVJA 1MUXA 4GPLB 1S3PA 2OTGC 1J1EA 1V1GA 1CM4A 4AQIA 2LCPA 1RECA 1HQVA 1PVBA 2Y4QA 3TDUA 4JWQA 4OVNF 1F4OA 1OZSA 2VRGA 1NX0A 1K8UA 2DOQA 1TIZA 3CLNA 4M2QA 1SY9A 2WCFA 1RFJA 1DVIA 1YURA 1LA0A 2BL0B 2M1UA 3WNXB 1KFUL 1SPYA 4OCIA 2L2EA 4HSZA 3DVKA 5J3XA 2M3WA 1JUOA 1TCOB 1UUSA 1B1GA 1MWNA 2E6WA 3SIBA 3H4SE 2LLUA 1M63B 2NXQA 1DJXA 2BCBA 1SNLA 1XK4C 2F8PA 3I5HB 5HKZA 2JNXA 3NSKA 2LE9B 4CFQA 1SKTA 3KF9A 1EL4A 1QIVA 1J7PA 1DJIA 3EKJA 1YUTA 3DVEA 2LVIA 3OHMB 1KK8B 2JT3A 4YGEB 2O5GA 1CFFA 2KYFA 1K90D 5I2OA 4I5LB 1PK0D 2BCXA 1KFUS 2AMIA 2Y5IA 1ZACA 1L2OB 3FWBA 2NCPA 2ZFDA 3DVJA 3I5IB 2Y1NA 1F54A 4N1FA 2M29A 1TRFA 2ZRTA 2KFHA 2OTGB 2PMYA 2Q4UA 3BUWB 3GK1A 3PN7B 3CR2A 1KQVA 3IQQA 1KQMC 1WRZA 2G9BA 2JRFA 5PALA 4C0KA 1JFKA 3CZTX 1HT9A 1RWYA 4QJ3B 3DF0B 1CLMA 2H2KA 1CMFA 4MEWA 2LP2A 3PATA 1IQ3A 2HQ8A 2LUXA 1E8AA 2JU0A 3RM1A 1KQMB 2WNDA 2LVKA 3EVVA 2JT0A 5BPJA 4N1GA 1DT7B 1AP4A 1OMRA 2LUCA 3M0WA 2L4HA 3BUOB 1N0YA 1XYDA 1CKKA 1MXEA 1A29A 1WLMA 5I2QA 1FI6A 3I5IC 3HCMA 1NCYA 3I5GB 1TOPA 1CDNA 1YVHA 2WCBA 1IG5A 4YBHB 2JPTA 2JOJA 5I2LA 1FPWA 3WHTB 3EVUA 5AFPA 1BG1A 2KYCA 1SCMB 1CNPA 1KK7Y 2LAPA 3GK2A 2KI6C 1NCZA 1EXRA 1K9UA 4U8DA 1CMGA 1EJ3A 2HPSA 1M31A 1K9KA 3OB1B 1JSAA 1FBVA 2KOTA 4YGCB 4YRUA 1TNQA 1CLLA 4PE4A 1K95A 5JJGA 1Y6WA 2M7LA 3E3RA 1NYAA 2KGRA 5DKRA 5CSIA 2KFGA 3OP0A 5HYDA 2KDHA 5JOLA 3DF0A 3C1VA 4IL1A 1UP5A 1H4BA 4OR9B 1XFWO 1SR6B 2CCMA 4E68A 4PHMA 1YTZC 4FQOA 2OS8C 2PSRA 1AJ4A 1YVLA 2K7CA 1B8CA 1PULA 4MVFA 3CR4X 4MRXA 5GQQC 2KNEA 2L5XB 2F33A 2M97A 1SYMA 3WXAA 1R2UA 3BUNB 3PM8A 2MRDA 2Q91A 1DGUA 1UWOA 1C7WA 1TN4A 2JWWA 2K61A 1YRUB 1JFJA 2HETA 4DRWA 1Y0VH 3MSEB 3OB2B 1N65A 1L7ZA 1XK4A 2EHBA 1JBAA 1V1FA 3LLEA 3AKAA 3PN7C 4NDBA 4MSPA 3TDIA 4QJ4B 3VROA 1OMVA 1CDLA 2K7BA 2NCOA 4XJKB 3SJSA 2ISDA 2BECA 2BL0C 4GGNA 5I8NA 3I5GC 2WORA 5AERA 3BQ3A 1YUSA 4PE7A 2MJWB 1IJ5A 3CTNA 2JULA 4NDCA 1XFZO 1J7OA 3WHUB 4WQ2A 2K2AA 3O6BA 3NSOA 2I2RE 3EK8A 1WRKA 1QXPA 1S6IA 1LKJA 1DJHA 4BY4A 1A75A 1DF0B 2NLNA 4R1EA 1NP8A 1KSMA 4P5OE 4ZCUA 2BKIB 4GFTA 3O4YA 3ZNIA 1JC2A 2ZN8A 1KCYA 4ICBA 4ORCB 1RTP1 2JNFA 3PLFB 1S6CA 1EG3A 4YGAA 3JVTB 3FIAA 2ZNEA 1Q80A 2CBLA 3FS7A 1SR6C 3LCPC 4USLA 2L0PA 1YX7A 3ICBA 4MBEA 2EGDA 3CS1A 1TNPA 4WQ3A 2FCEA 3RLZA 2L50A 1NSHA 3SG2A 4I5KA 5ER4X 1S26D 3AKBA 1J1DA 1QX5B 2KBMA 3OX6A 4FTGA 2JTZA 3NXAA 4MLWA 2B1UA 5KU1A 1QASA 1K93D 1XA5A 3A8RA 1F55A 2L51A 1OE9B 1CFDA 5AXIA 2K7OA 4MZLA 1OMDA 1UHJA 4DUQA 1A03A 2F3ZA 1AK8A 3KPXA 4ORAB 4XYNA 4AOMA 4C0JA 1S5GZ 1KFXS 2KQYA 1U5IA 2KFFA 2LLSA 2WCEA 1PSBA 2MLEC 1PRWA 1UHIA 1G4YR 2R2IA 3AAJA 1B7TZ 4Q04A 1XFVO 4JPZB 2LVJA 3EKHA 1M39A 1CDMA 1QV1A 1QVIZ 4QJ5B 5G08A 2ZRSA 3JTDC 5D69A 2MA2A 1SBJA 2V53A 4ZCVA 4A4BA 1IJ6A 1B47A 5F6TA 1K2HA 2MLFC 1OSAA 2LM5A 1NX3A 4AQJA 3KO0A 1ALVA 3D0YA 3GOFA 3KEVA 3KHEA 1A2XA 1RJVA 1BR4B 4ETOA 3BUXB 2LMUA 2D8NA 1SCVA 3IQOA 1KSOA 1WY9A 1LINA 1B9AA 1DF0A 2M1KB 2H61A 1PALA 1UHKA 1SCMC 1A4PA 1PVAA 2KQ6A 3JVTC 3SG5A 2RGIA 4PCWA 1W7IB 1FI5A 1BOCA 2I18A 3EK4A 4WRIA 3VGOA 2HF5A 2M7NA 1DJZA 1D1OA 1B8LA 3SG4A 3EK7A 2NZ0A 4MRYA 1NUBA 5HLOA 3QRXA 1WLZA 2K7DA 1DJYA 5ER5A 1RK9A 1K96A 2JQ6A 1FW4A 1U5IB 2LMTA 3LK0A 3NSIA 1DJGA 2QACA 1BMOA 1G33A 3LK1A 4NDDA 5HLVA 1BLQA 2KGBC 2M8UA 2CNPA 3I5FB 2GGMA 2JXLA 5D7FA 1NIWA 4MZJA 4DIRA 4DS7A 3BOWA 1XFUO 1DTLA 2MAZA 4GUKA 4TNCA 4F0ZB 3CR5X 4GNKB 1KFXL 3TS5C 4PE0A 1S36A 4GGFA 1ZOTB 4PALA 1QLKA 2JXCA 5B8IB 1F71A 1CDPA 2CXJA 2LV7A 3BYAA 2K2FA 1SRAA 5TNCA 3SIAA 3CGAA 1YRTB 2I7AA 2IS9A 1OZOA 5FYXA 3VRNA 1UHHA 4HREE 3SG6A 1ODBA 1G8IA 3TS5B 4YGBB 2JTTA 3NSLA 1ALWA 1DMOA 1KK8C 1QTXA 4PHNA 3CWGA 2F2OA 3BOWB 4N5XA 4PHJA 3DD4A 1MF8B 1LA3A 3O2PA 1CM1A 1YUUA 2K8MB 2JC2A 3I5FC 4I5NB 1WDCC 4L9MA 1N2DA 1UURA 1ZMZA 2A4JA 1C07A 2SASA 1YX8A 1NPQA 2LVVA 2KAVA 3HX4A 4C0LA 1BT6A 1NWDA 1NCXA 3DVMA 4HRGA 1GGWA 1SL9A 2KAXA 2LLTA 1X02A 3BXKA 3K21A 3SG3A 3TDZA 2CTNA 1S5GY 2LC5A 2TN4A 1AUIB 1BJFA 1VRKA 2KBIA 5AEQA 1R6PA 1B8RA 4JQ0D 2BE4A 1TCFA 2O60A 4XJKA 1QX7A 1TNWA 2FJUB 2PVBA 1S6JA 3PSRA 1C7VA 1AHRA 1IGVA 2HQWA 1EH2A 1SMGA 1NX2A
chains in the Genus database with same CATH superfamily
2KI6D 5K89A 2ZNDA 1Y1UA 3IF7A 5DKQA 1YR5A 2KLDA 5IBWA 2JPOA 4UPGA 2I94A 3AAKA 1M46A 1QX2A 1MXLC 3PFVA 5CSNA 1TNXA 1F70A 4CFRA 2BCAA 2GGZA 2GV5A 3TZ1A 3DXLA 4CPVA 4HRHA 1CB1A 4DCKA 4ORBB 3VB1A 2JZIA 1W7JB 5DKNA 1IWQA 3OBVA 2COLB 3CZ2A 2P6BB 1QS7A 1XFYO 2EC6B 3CZ1A 5CSFA 2H61C 3LL8B 1RROA 2K0JA 4PDZA 4BY5A 1Y1XA 1H8BA 1KWOB 3B86A 2FCDA 2G2BA 3BUMB 3FE8A 4D1EA 1GQMA 1LS8A 3BFHA 1AVSA 1BODA 3B87A 2E30A 2GTEA 2FOTA 1BR1B 3S0FA 2AAOA 1PSRA 1BU3A 5EL2A 3ZWHA 2QEBA 4CIDA 2L4IA 1K9PA 3VRPA 2LNKA 4M2OA 1B4CA 1CLBA 2WOSA 3A4UB 1BF5A 1WDCB 1WRLA 3NHTA 2SCPA 3D78A 1QVIY 5KSZA 4PE1A 2KI4B 1JF2A 3DZTA 1ORGA 1SL8A 3BFAA 2KAYA 2LP3A 1XO5A 2BKHB 1ZUZA 2JT8A 2BBNA 1DGVA 1KK7Z 2AUCA 1GGZA 5CSJA 4CLNA 3QMEA 4OKHA 2KSPA 2OPOA 3VRRA 2EC6C 1CFCA 1B7TY 2MBXA 2QPTA 1KWOC 2OS8B 2BE6A 1SK6D 4GGFC 2LHLA 5HKWA 3S0DA 1GJYA 2L98A 1QJTA 3S0BA 4A4CA 1DC1A 3R1PA 3JTDB 5KTYA 1MHOA 1F8HA 3F45A 1UHNA 2PALA 2ZN9A 3OX5A 1TTXA 5D3OA 1DEKA 2KI4C 1K94A 2CT9A 4YI8A 3FWCA 3TUYC 1MQ1A 1OQPA 2WC8A 1LXFC 1MR8A 1TWOA 1SL7A 4M2PA 4MN0A 1AJ5A 3CDNA 4GBAA 1IKUA 5AANA 1CTRA 1OOJA 3SG7A 5HKYA 2M49B 1QLSA 1IQ5A 3TUYB 1L2OC 2M9GA 3EVRA 1F4QA 2LANA 3V2LA 3VRQA 2F3YA 2PASA 4JKTA 3S0AA 4PHKA 3O78A 4P2YB 4MZKA 3PALA 1LVCD 3D75A 1JWDA 4GAOA 1ZFSA 1QIWA 2ZKMX 1J55A 2KHNA 2MHHA 1M45A 3D0YB 1A75B 1JF0A 3DY9A 3GK4X 1IRJA 4I5JA 1QATA 5HL1A 2Y1MA 2LMVA 1IH0A 2BBMA 1NX1A 3I5HC 1EG4A 1S1EA 2M0RA 2LHIA 4YI9A 5CPVA 3D10A 1FF1A 1Y1AA 4IJ7A 1QV0A 2F2PA 1DJWA 4NQGA 1J7QA 4YGDB 4OV2A 3FE6A 1XFXO 1J7RA 1SW8A 2PRUA 1XVJA 1MUXA 4GPLB 1S3PA 2OTGC 1J1EA 1V1GA 1CM4A 4AQIA 2LCPA 1RECA 1HQVA 1PVBA 2Y4QA 3TDUA 4JWQA 5FI2A 3FE9A 1F4OA 4OVNF 1OZSA 2VRGA 1NX0A 1K8UA 2DOQA 1TIZA 3CLNA 4M2QA 1SY9A 2WCFA 1RFJA 1DVIA 1YURA 1GM0A 1LA0A 2BL0B 2M1UA 4FQTA 3WNXB 1KFUL 1SPYA 4OCIA 2L2EA 4HSZA 3DVKA 1C3YA 5J3XA 2M3WA 1JUOA 1TCOB 1UUSA 1B1GA 1MWNA 2E6WA 2ERBA 3H4SE 3SIBA 2LLUA 1M63B 2NXQA 2QEVA 1DJXA 2BCBA 1SNLA 1XK4C 2F8PA 2WCMA 3I5HB 5HKZA 2JNXA 3NSKA 2LE9B 4CFQA 1SKTA 3KF9A 1TUZA 1EL4A 1QIVA 1J7PA 1DJIA 1Z4HA 1YUTA 3DVEA 3EKJA 2LVIA 3OHMB 1KK8B 2JT3A 4YGEB 2O5GA 1OOHA 2KYFA 1K90D 1CFFA 5I2OA 4I5LB 1PK0D 2BCXA 3CYZA 1KFUS 2AMIA 2Y5IA 1Z2CB 1ZACA 1L2OB 3FWBA 2NCPA 2ZFDA 3DVJA 2PYQA 3CABA 2Y1NA 3I5IB 4N1FA 1F54A 2K60A 2M29A 1TRFA 2ZRTA 2KFHA 2KPHA 2OTGB 2PMYA 2Q4UA 3BUWB 3GK1A 3CR2A 3PN7B 1KQVA 3IQQA 1KQMC 1WRZA 3R72A 3SS4A 2G9BA 2JRFA 5PALA 4C0KA 1JFKA 3CZTX 1HT9A 1RWYA 4QJ3B 3DF0B 1CLMA 2H2KA 1CMFA 4MEWA 2LP2A 3PATA 1IQ3A 2HQ8A 2LUXA 1E8AA 2JU0A 3RM1A 1KQMB 2WNDA 2LVKA 2QEOA 3B88A 3EVVA 2JT0A 5BPJA 4N1GA 1DT7B 3D77A 1AP4A 1OMRA 2LUCA 1OOIX 3M0WA 2L4HA 3BUOB 1N0YA 1XYDA 1CKKA 1MXEA 1A29A 1WLMA 5I2QA 1FI6A 3I5IC 3HCMA 1NCYA 3I5GB 1TOPA 3UNWA 1CDNA 1YVHA 2WCBA 1IG5A 4YBHB 2JPTA 2JOJA 5I2LA 1FPWA 3WHTB 2KLEA 3EVUA 5AFPA 1BG1A 2KYCA 1SCMB 1CNPA 1KK7Y 2LAPA 3GK2A 1XFRA 2KI6C 1NCZA 1EXRA 1K9UA 4U8DA 1CMGA 1EJ3A 1M31A 2HPSA 1K9KA 3OB1B 2BAPA 4OZDA 1JSAA 1FBVA 2KOTA 4YGCB 4YRUA 1TNQA 1CLLA 4PE4A 1K95A 5JJGA 1Y6WA 2M7LA 3E3RA 1NYAA 2KGRA 5DKRA 5CSIA 2KFGA 3OP0A 5HYDA 2KDHA 5JOLA 3DF0A 3C1VA 4IL1A 1UP5A 1H4BA 4OR9B 1XFWO 1SR6B 2CCMA 3L4AA 4E68A 4PHMA 1YTZC 4FQOA 2OS8C 2PSRA 1AJ4A 1YVLA 2K7CA 1B8CA 1PULA 4MVFA 3S0GA 3CR4X 4MRXA 5GQQC 2KNEA 2L5XB 1OOFA 2F33A 2M97A 3NHIA 1SYMA 3WXAA 1R2UA 3BUNB 3O4XA 3PM8A 2MRDA 2Q91A 1DGUA 1UWOA 1C7WA 1TN4A 2JWWA 2K61A 1YRUB 1P28A 1JFJA 2HETA 1T14A 1Y0VH 4DRWA 3MSEB 3OB2B 1N65A 1L7ZA 1XK4A 2EHBA 1JBAA 1V1FA 2WC5A 3LLEA 3AKAA 3PN7C 4NDBA 4MSPA 2L5YA 3TDIA 1W9ZA 4QJ4B 3VROA 1OMVA 1CDLA 2K7BA 3BJHA 3OGNA 2NCOA 4XJKB 3SJSA 2ISDA 2BECA 2BL0C 2PQLA 4GGNA 5I8NA 3I5GC 2WORA 4KYNA 3BQ3A 5AERA 1YUSA 4PE7A 2MJWB 2P70A 1IJ5A 3CTNA 2JULA 4NDCA 1XFZO 1J7OA 3WHUB 4WQ2A 2K2AA 3O6BA 3NSOA 2I2RE 3EK8A 1WRKA 1QXPA 1S6IA 1LKJA 1DJHA 4BY4A 1A75A 1DF0B 2NLNA 4R1EA 1NP8A 1KSMA 4P5OE 4ZCUA 2BKIB 4GFTA 3O4YA 1SSEB 3ZNIA 1JC2A 2ZN8A 1KCYA 4ICBA 4ORCB 1RTP1 2JNFA 3PLFB 1S6CA 1EG3A 4YGAA 3JVTB 3FIAA 2ZNEA 1Q80A 2CBLA 3FS7A 1SR6C 3L47A 3LCPC 4USLA 2L0PA 1YX7A 2FJYA 3ICBA 4MBEA 2QDIA 2EGDA 3CS1A 1TNPA 4WQ3A 2FCEA 3RLZA 2L50A 1NSHA 3SG2A 5FI7A 4I5KA 5ER4X 1S26D 3AKBA 1J1DA 1QX5B 2KBMA 3OX6A 4FTGA 2JTZA 3NXAA 4MLWA 2B1UA 5KU1A 1QASA 1K93D 5DICA 1XA5A 3A8RA 3L4LA 1F55A 2L51A 1OE9B 3R1VA 3Q8IA 1CFDA 5AXIA 2K7OA 4MZLA 1OMDA 1UHJA 4DUQA 1A03A 2F3ZA 1AK8A 3KPXA 4ORAB 3K1EA 2WC6A 3D74A 4XYNA 4AOMA 4C0JA 1S5GZ 1KFXS 1DQEA 2KQYA 1U5IA 2KFFA 2LLSA 2WCEA 5FI6A 1PSBA 2MLEC 1PRWA 1UHIA 1G4YR 2R2IA 3AAJA 1B7TZ 4Q04A 2YGUA 1XFVO 4JPZB 2LVJA 3EKHA 1M39A 1C3ZA 1CDMA 3D76A 1QV1A 4JD9A 1QVIZ 4QJ5B 3N7HA 5G08A 2ZRSA 3JTDC 5D69A 2WCJA 2MA2A 1SBJA 2V53A 2WCLA 4ZCVA 4A4BA 1IJ6A 1B47A 5F6TA 1K2HA 2MLFC 1OSAA 2LM5A 1NX3A 4AQJA 3KO0A 1ALVA 3R1OA 3D0YA 1QWVA 3BFBA 1TUJA 3GOFA 1A2XA 3KEVA 1RJVA 3KHEA 1BR4B 4INWA 3BUXB 2LMUA 4ETOA 2D8NA 1SCVA 3IQOA 1KSOA 1WY9A 1LINA 1B9AA 1DF0A 2M1KB 2H61A 3SS5A 1PALA 1UHKA 1SCMC 1A4PA 1PVAA 2KQ6A 3JVTC 3PJIA 3SS3A 3SG5A 2RGIA 4PCWA 1W7IB 1FI5A 1BOCA 2I18A 3EK4A 4WRIA 3VGOA 2HF5A 2M7NA 1DJZA 1D1OA 1B8LA 3SG4A 3EK7A 2NZ0A 4MRYA 1NUBA 3D73A 5HLOA 3QRXA 1WLZA 2K7DA 1DJYA 5ER5A 1RK9A 1K96A 1OOGA 1DELA 2JQ6A 1FW4A 1U5IB 2LMTA 3LK0A 3NSIA 1DJGA 2QACA 1BMOA 1G33A 3LK1A 4NDDA 5HLVA 1BLQA 3RZSA 2KGBC 2M8UA 2CNPA 3I5FB 2GGMA 2JXLA 1OW4A 5D7FA 1NIWA 4MZJA 4DIRA 4DS7A 3BOWA 1XFUO 1DTLA 2MAZA 4GUKA 3UO9A 2WCHA 4TNCA 4F0ZB 3IVTA 3CR5X 4PT1A 4GNKB 2H8VA 1KFXL 3TS5C 4PE0A 1S36A 4GGFA 1ZOTB 4PALA 1QLKA 2JXCA 5B8IB 1F71A 1CDPA 2CXJA 2LV7A 3BYAA 2K2FA 1SRAA 3NGVA 5TNCA 3SIAA 2QEHA 1YRTB 2I7AA 2IS9A 1OZOA 3CGAA 5FYXA 3VRNA 1UHHA 4HREE 3SG6A 1ODBA 1G8IA 3TS5B 3PM2A 2JTTA 3NSLA 4YGBB 1ALWA 3CZ0A 1KK8C 1QTXA 4PHNA 5I94A 1DMOA 3CWGA 2F2OA 3S0EA 3BOWB 4N5XA 4PHJA 3DD4A 1MF8B 1LA3A 3O2PA 1CM1A 1YUUA 2K8MB 2JC2A 3I5FC 4I5NB 1WDCC 2BNXA 4L9MA 1N2DA 3DYEA 1UURA 1ZMZA 2A4JA 3EG5B 1C07A 2SASA 1YX8A 1NPQA 2WCKA 2LVVA 2KAVA 3HX4A 4C0LA 1BT6A 1NWDA 1NCXA 2P71A 3DVMA 4HRGA 1CFPA 1GGWA 1SL9A 2KAXA 2LLTA 1X02A 3BXKA 3K21A 3SG3A 3TDZA 2CTNA 1S5GY 2LC5A 2TN4A 1AUIB 1BJFA 1VRKA 2KBIA 4INXA 5AEQA 1R6PA 1B8RA 4JQ0D 4F7FA 2L2CA 2BE4A 1TCFA 2O60A 3B7AA 1QX7A 1TNWA 2FJUB 2PVBA 4XJKA 1IIOA 1S6JA 3PSRA 1C7VA 1AHRA 1IGVA 2HQWA 1EH2A 1SMGA 3B6XA 1NX2A
chains in the Genus database with same CATH topology
2KI6D 5K89A 2ZNDA 1Y1UA 3IF7A 5DKQA 1YR5A 5IBWA 4UPGA 2I94A 3AAKA 1M46A 1QX2A 1MXLC 3PFVA 5CSNA 1TNXA 1F70A 4CFRA 2BCAA 2GGZA 2GV5A 3TZ1A 4CPVA 4HRHA 1CB1A 4DCKA 4ORBB 2JZIA 1W7JB 5DKNA 1IWQA 2COLB 2P6BB 1QS7A 1XFYO 2EC6B 5CSFA 2H61C 3LL8B 1RROA 2K0JA 4PDZA 4BY5A 1Y1XA 1H8BA 1KWOB 2G2BA 2FCDA 3BUMB 4D1EA 1GQMA 1AVSA 1BODA 2E30A 2FOTA 1BR1B 2AAOA 1PSRA 1BU3A 3ZWHA 4CIDA 2L4IA 1K9PA 3VRPA 2LNKA 4M2OA 1B4CA 1CLBA 2WOSA 3A4UB 1BF5A 1WDCB 1WRLA 2SCPA 5KSZA 1QVIY 4PE1A 2KI4B 1JF2A 1SL8A 2KAYA 2LP3A 1XO5A 2BKHB 1ZUZA 2JT8A 2BBNA 1DGVA 1KK7Z 2AUCA 1GGZA 5CSJA 4CLNA 3VRRA 4OKHA 2KSPA 2OPOA 2EC6C 1CFCA 1B7TY 2MBXA 2QPTA 1KWOC 2OS8B 2BE6A 1SK6D 4GGFC 2LHLA 5HKWA 1GJYA 2L98A 1QJTA 4A4CA 3JTDB 5KTYA 1MHOA 1F8HA 3F45A 1UHNA 2PALA 2ZN9A 3OX5A 1TTXA 2KI4C 1K94A 2CT9A 4YI8A 3FWCA 3TUYC 1MQ1A 1OQPA 2WC8A 1LXFC 1MR8A 1SL7A 4M2PA 4MN0A 1AJ5A 4GBAA 1IKUA 5AANA 1CTRA 1OOJA 3SG7A 5HKYA 2M49B 1QLSA 1IQ5A 3TUYB 1L2OC 2M9GA 3EVRA 1F4QA 2LANA 3VRQA 2F3YA 2PASA 4PHKA 3O78A 4P2YB 4MZKA 3PALA 1LVCD 1JWDA 4GAOA 1ZFSA 1QIWA 2ZKMX 1J55A 2KHNA 2MHHA 1M45A 3D0YB 1A75B 1JF0A 3GK4X 4I5JA 1IRJA 1CFPA 1QATA 2Y1MA 2LMVA 1IH0A 2BBMA 1NX1A 3I5HC 1EG4A 1S1EA 2M0RA 2LHIA 4YI9A 5CPVA 3D10A 1FF1A 1Y1AA 1QV0A 2F2PA 1DJWA 4NQGA 1J7QA 4YGDB 4OV2A 1XFXO 1J7RA 1SW8A 2PRUA 1XVJA 1MUXA 4GPLB 1S3PA 2OTGC 1J1EA 1V1GA 1CM4A 4AQIA 2LCPA 1RECA 1HQVA 1PVBA 2Y4QA 3TDUA 4JWQA 4OVNF 1F4OA 1OZSA 2VRGA 1NX0A 1K8UA 2DOQA 1TIZA 3CLNA 4M2QA 1SY9A 2WCFA 1RFJA 1DVIA 1YURA 1LA0A 2BL0B 2M1UA 3WNXB 1KFUL 1SPYA 4OCIA 2L2EA 4HSZA 3DVKA 5J3XA 2M3WA 1JUOA 1TCOB 1UUSA 1B1GA 1MWNA 2E6WA 3SIBA 3H4SE 2LLUA 1M63B 2NXQA 1DJXA 2BCBA 1SNLA 1XK4C 2F8PA 3I5HB 5HKZA 2JNXA 3NSKA 2LE9B 4CFQA 1SKTA 3KF9A 1EL4A 1QIVA 1J7PA 1DJIA 3EKJA 1YUTA 3DVEA 2LVIA 3OHMB 1KK8B 2JT3A 4YGEB 2O5GA 1CFFA 2KYFA 1K90D 5I2OA 4I5LB 1PK0D 2BCXA 1KFUS 2AMIA 2Y5IA 1ZACA 1L2OB 3FWBA 2NCPA 2ZFDA 3DVJA 3I5IB 2Y1NA 1F54A 4N1FA 2M29A 1TRFA 2ZRTA 2KFHA 2OTGB 2PMYA 2Q4UA 3BUWB 3GK1A 3PN7B 3CR2A 1KQVA 3IQQA 1KQMC 1WRZA 2G9BA 2JRFA 5PALA 4C0KA 1JFKA 3CZTX 1HT9A 1RWYA 4QJ3B 3DF0B 1CLMA 2H2KA 1CMFA 4MEWA 2LP2A 3PATA 1IQ3A 2HQ8A 2LUXA 1E8AA 2JU0A 3RM1A 1KQMB 2WNDA 2LVKA 3EVVA 2JT0A 5BPJA 4N1GA 1DT7B 1AP4A 1OMRA 2LUCA 3M0WA 2L4HA 3BUOB 1N0YA 1XYDA 1CKKA 1MXEA 1A29A 1WLMA 5I2QA 1FI6A 3I5IC 3HCMA 1NCYA 3I5GB 1TOPA 1CDNA 1YVHA 2WCBA 1IG5A 4YBHB 2JPTA 2JOJA 5I2LA 1FPWA 3WHTB 3EVUA 5AFPA 1BG1A 2KYCA 1SCMB 1CNPA 1KK7Y 2LAPA 3GK2A 2KI6C 1NCZA 1EXRA 1K9UA 4U8DA 1CMGA 1EJ3A 2HPSA 1M31A 1K9KA 3OB1B 1JSAA 1FBVA 2KOTA 4YGCB 4YRUA 1TNQA 1CLLA 4PE4A 1K95A 5JJGA 1Y6WA 2M7LA 3E3RA 1NYAA 2KGRA 5DKRA 5CSIA 2KFGA 3OP0A 5HYDA 2KDHA 5JOLA 3DF0A 3C1VA 4IL1A 1UP5A 1H4BA 4OR9B 1XFWO 1SR6B 2CCMA 4E68A 4PHMA 1YTZC 4FQOA 2OS8C 2PSRA 1AJ4A 1YVLA 2K7CA 1B8CA 1PULA 4MVFA 3CR4X 4MRXA 5GQQC 2KNEA 2L5XB 2F33A 2M97A 1SYMA 3WXAA 1R2UA 3BUNB 3PM8A 2MRDA 2Q91A 1DGUA 1UWOA 1C7WA 1TN4A 2JWWA 2K61A 1YRUB 1JFJA 2HETA 4DRWA 1Y0VH 3MSEB 3OB2B 1N65A 1L7ZA 1XK4A 2EHBA 1JBAA 1V1FA 3LLEA 3AKAA 3PN7C 4NDBA 4MSPA 3TDIA 4QJ4B 3VROA 1OMVA 1CDLA 2K7BA 2NCOA 4XJKB 3SJSA 2ISDA 2BECA 2BL0C 4GGNA 5I8NA 3I5GC 2WORA 5AERA 3BQ3A 1YUSA 4PE7A 2MJWB 1IJ5A 3CTNA 2JULA 4NDCA 1XFZO 1J7OA 3WHUB 4WQ2A 2K2AA 3O6BA 3NSOA 2I2RE 3EK8A 1WRKA 1QXPA 1S6IA 1LKJA 1DJHA 4BY4A 1A75A 1DF0B 2NLNA 4R1EA 1NP8A 1KSMA 4P5OE 4ZCUA 2BKIB 4GFTA 3O4YA 3ZNIA 1JC2A 2ZN8A 1KCYA 4ICBA 4ORCB 1RTP1 2JNFA 3PLFB 1S6CA 1EG3A 4YGAA 3JVTB 3FIAA 2ZNEA 1Q80A 2CBLA 3FS7A 1SR6C 3LCPC 4USLA 2L0PA 1YX7A 3ICBA 4MBEA 2EGDA 3CS1A 1TNPA 4WQ3A 2FCEA 3RLZA 2L50A 1NSHA 3SG2A 4I5KA 5ER4X 1S26D 3AKBA 1J1DA 1QX5B 2KBMA 3OX6A 4FTGA 2JTZA 3NXAA 4MLWA 2B1UA 5KU1A 1QASA 1K93D 1XA5A 3A8RA 1F55A 2L51A 1OE9B 1CFDA 5AXIA 2K7OA 4MZLA 1OMDA 1UHJA 4DUQA 1A03A 2F3ZA 1AK8A 3KPXA 4ORAB 4XYNA 4AOMA 4C0JA 1S5GZ 1KFXS 2KQYA 1U5IA 2KFFA 2LLSA 2WCEA 1PSBA 2MLEC 1PRWA 1UHIA 1G4YR 2R2IA 3AAJA 1B7TZ 4Q04A 1XFVO 4JPZB 2LVJA 3EKHA 1M39A 1CDMA 1QV1A 1QVIZ 4QJ5B 5G08A 2ZRSA 3JTDC 5D69A 2MA2A 1SBJA 2V53A 4ZCVA 4A4BA 1IJ6A 1B47A 5F6TA 1K2HA 2MLFC 1OSAA 2LM5A 1NX3A 4AQJA 3KO0A 1ALVA 3D0YA 3GOFA 3KEVA 3KHEA 1A2XA 1RJVA 1BR4B 4ETOA 3BUXB 2LMUA 2D8NA 1SCVA 3IQOA 1KSOA 1WY9A 1LINA 1B9AA 1DF0A 2M1KB 2H61A 1PALA 1UHKA 1SCMC 1A4PA 1PVAA 2KQ6A 3JVTC 3SG5A 2RGIA 4PCWA 1W7IB 1FI5A 1BOCA 2I18A 3EK4A 4WRIA 3VGOA 2HF5A 2M7NA 1DJZA 1D1OA 1B8LA 3SG4A 3EK7A 2NZ0A 4MRYA 1NUBA 5HLOA 3QRXA 1WLZA 2K7DA 1DJYA 5ER5A 1RK9A 1K96A 2JQ6A 1FW4A 1U5IB 2LMTA 3LK0A 3NSIA 1DJGA 2QACA 1BMOA 1G33A 3LK1A 4NDDA 5HLVA 1BLQA 2KGBC 2M8UA 2CNPA 3I5FB 2GGMA 2JXLA 5D7FA 1NIWA 4MZJA 4DIRA 4DS7A 3BOWA 1XFUO 1DTLA 2MAZA 4GUKA 4TNCA 4F0ZB 3CR5X 4GNKB 1KFXL 3TS5C 4PE0A 1S36A 4GGFA 1ZOTB 4PALA 1QLKA 2JXCA 5B8IB 1F71A 1CDPA 2CXJA 2LV7A 3BYAA 2K2FA 1SRAA 5TNCA 3SIAA 3CGAA 1YRTB 2I7AA 2IS9A 1OZOA 5FYXA 3VRNA 1UHHA 4HREE 3SG6A 1ODBA 1G8IA 3TS5B 4YGBB 2JTTA 3NSLA 1ALWA 1DMOA 1KK8C 1QTXA 4PHNA 3CWGA 2F2OA 3BOWB 4N5XA 4PHJA 3DD4A 1MF8B 1LA3A 3O2PA 1CM1A 1YUUA 2K8MB 2JC2A 3I5FC 4I5NB 1WDCC 4L9MA 1N2DA 1UURA 1ZMZA 2A4JA 1C07A 2SASA 1YX8A 1NPQA 2LVVA 2KAVA 3HX4A 4C0LA 1BT6A 1NWDA 1NCXA 3DVMA 4HRGA 1GGWA 1SL9A 2KAXA 2LLTA 1X02A 3BXKA 3K21A 3SG3A 3TDZA 2CTNA 1S5GY 2LC5A 2TN4A 1AUIB 1BJFA 1VRKA 2KBIA 5AEQA 1R6PA 1B8RA 4JQ0D 2BE4A 1TCFA 2O60A 4XJKA 1QX7A 1TNWA 2FJUB 2PVBA 1S6JA 3PSRA 1C7VA 1AHRA 1IGVA 2HQWA 1EH2A 1SMGA 1NX2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KI6 D;  5K89 A;  2ZND A;  1Y1U A;  3IF7 A;  5DKQ A;  1YR5 A;  5IBW A;  4UPG A;  2I94 A;  3AAK A;  1M46 A;  1QX2 A;  1MXL C;  3PFV A;  5CSN A;  1TNX A;  1F70 A;  4CFR A;  2BCA A;  2GGZ A;  2GV5 A;  3TZ1 A;  4CPV A;  4HRH A;  1CB1 A;  4DCK A;  4ORB B;  2JZI A;  1W7J B;  5DKN A;  1IWQ A;  2COL B;  2P6B B;  1QS7 A;  1XFY O;  2EC6 B;  5CSF A;  2H61 C;  3LL8 B;  1RRO A;  2K0J A;  4PDZ A;  4BY5 A;  1Y1X A;  1H8B A;  1KWO B;  2G2B A;  2FCD A;  3BUM B;  4D1E A;  1GQM A;  1AVS A;  1BOD A;  2E30 A;  2FOT A;  1BR1 B;  2AAO A;  1PSR A;  1BU3 A;  3ZWH A;  4CID A;  2L4I A;  1K9P A;  3VRP A;  2LNK A;  4M2O A;  1B4C A;  1CLB A;  2WOS A;  3A4U B;  1BF5 A;  1WDC B;  1WRL A;  2SCP A;  5KSZ A;  1QVI Y;  4PE1 A;  2KI4 B;  1JF2 A;  1SL8 A;  2KAY A;  2LP3 A;  1XO5 A;  2BKH B;  1ZUZ A;  2JT8 A;  2BBN A;  1DGV A;  1KK7 Z;  2AUC A;  1GGZ A;  5CSJ A;  4CLN A;  3VRR A;  4OKH A;  2KSP A;  2OPO A;  2EC6 C;  1CFC A;  1B7T Y;  2MBX A;  2QPT A;  1KWO C;  2OS8 B;  2BE6 A;  1SK6 D;  4GGF C;  2LHL A;  5HKW A;  1GJY A;  2L98 A;  1QJT A;  4A4C A;  3JTD B;  5KTY A;  1MHO A;  1F8H A;  3F45 A;  1UHN A;  2PAL A;  2ZN9 A;  3OX5 A;  1TTX A;  2KI4 C;  1K94 A;  2CT9 A;  4YI8 A;  3FWC A;  3TUY C;  1MQ1 A;  1OQP A;  2WC8 A;  1LXF C;  1MR8 A;  1SL7 A;  4M2P A;  4MN0 A;  1AJ5 A;  4GBA A;  1IKU A;  5AAN A;  1CTR A;  1OOJ A;  3SG7 A;  5HKY A;  2M49 B;  1QLS A;  1IQ5 A;  3TUY B;  1L2O C;  2M9G A;  3EVR A;  1F4Q A;  2LAN A;  3VRQ A;  2F3Y A;  2PAS A;  4PHK A;  3O78 A;  4P2Y B;  4MZK A;  3PAL A;  1LVC D;  1JWD A;  4GAO A;  1ZFS A;  1QIW A;  2ZKM X;  1J55 A;  2KHN A;  2MHH A;  1M45 A;  3D0Y B;  1A75 B;  1JF0 A;  3GK4 X;  4I5J A;  1IRJ A;  1CFP A;  1QAT A;  2Y1M A;  2LMV A;  1IH0 A;  2BBM A;  1NX1 A;  3I5H C;  1EG4 A;  1S1E A;  2M0R A;  2LHI A;  4YI9 A;  5CPV A;  3D10 A;  1FF1 A;  1Y1A A;  1QV0 A;  2F2P A;  1DJW A;  4NQG A;  1J7Q A;  4YGD B;  4OV2 A;  1XFX O;  1J7R A;  1SW8 A;  2PRU A;  1XVJ A;  1MUX A;  4GPL B;  1S3P A;  2OTG C;  1J1E A;  1V1G A;  1CM4 A;  4AQI A;  2LCP A;  1REC A;  1HQV A;  1PVB A;  2Y4Q A;  3TDU A;  4JWQ A;  4OVN F;  1F4O A;  1OZS A;  2VRG A;  1NX0 A;  1K8U A;  2DOQ A;  1TIZ A;  3CLN A;  4M2Q A;  1SY9 A;  2WCF A;  1RFJ A;  1DVI A;  1YUR A;  1LA0 A;  2BL0 B;  2M1U A;  3WNX B;  1KFU L;  1SPY A;  4OCI A;  2L2E A;  4HSZ A;  3DVK A;  5J3X A;  2M3W A;  1JUO A;  1TCO B;  1UUS A;  1B1G A;  1MWN A;  2E6W A;  3SIB A;  3H4S E;  2LLU A;  1M63 B;  2NXQ A;  1DJX A;  2BCB A;  1SNL A;  1XK4 C;  2F8P A;  3I5H B;  5HKZ A;  2JNX A;  3NSK A;  2LE9 B;  4CFQ A;  1SKT A;  3KF9 A;  1EL4 A;  1QIV A;  1J7P A;  1DJI A;  3EKJ A;  1YUT A;  3DVE A;  2LVI A;  3OHM B;  1KK8 B;  2JT3 A;  4YGE B;  2O5G A;  1CFF A;  2KYF A;  1K90 D;  5I2O A;  4I5L B;  1PK0 D;  2BCX A;  1KFU S;  2AMI A;  2Y5I A;  1ZAC A;  1L2O B;  3FWB A;  2NCP A;  2ZFD A;  3DVJ A;  3I5I B;  2Y1N A;  1F54 A;  4N1F A;  2M29 A;  1TRF A;  2ZRT A;  2KFH A;  2OTG B;  2PMY A;  2Q4U A;  3BUW B;  3GK1 A;  3PN7 B;  3CR2 A;  1KQV A;  3IQQ A;  1KQM C;  1WRZ A;  2G9B A;  2JRF A;  5PAL A;  4C0K A;  1JFK A;  3CZT X;  1HT9 A;  1RWY A;  4QJ3 B;  3DF0 B;  1CLM A;  2H2K A;  1CMF A;  4MEW A;  2LP2 A;  3PAT A;  1IQ3 A;  2HQ8 A;  2LUX A;  1E8A A;  2JU0 A;  3RM1 A;  1KQM B;  2WND A;  2LVK A;  3EVV A;  2JT0 A;  5BPJ A;  4N1G A;  1DT7 B;  1AP4 A;  1OMR A;  2LUC A;  3M0W A;  2L4H A;  3BUO B;  1N0Y A;  1XYD A;  1CKK A;  1MXE A;  1A29 A;  1WLM A;  5I2Q A;  1FI6 A;  3I5I C;  3HCM A;  1NCY A;  3I5G B;  1TOP A;  1CDN A;  1YVH A;  2WCB A;  1IG5 A;  4YBH B;  2JPT A;  2JOJ A;  5I2L A;  1FPW A;  3WHT B;  3EVU A;  5AFP A;  1BG1 A;  2KYC A;  1SCM B;  1CNP A;  1KK7 Y;  2LAP A;  3GK2 A;  2KI6 C;  1NCZ A;  1EXR A;  1K9U A;  4U8D A;  1CMG A;  1EJ3 A;  2HPS A;  1M31 A;  1K9K A;  3OB1 B;  1JSA A;  1FBV A;  2KOT A;  4YGC B;  4YRU A;  1TNQ A;  1CLL A;  4PE4 A;  1K95 A;  5JJG A;  1Y6W A;  2M7L A;  3E3R A;  1NYA A;  2KGR A;  5DKR A;  5CSI A;  2KFG A;  3OP0 A;  5HYD A;  2KDH A;  5JOL A;  3DF0 A;  3C1V A;  4IL1 A;  1UP5 A;  1H4B A;  4OR9 B;  1XFW O;  1SR6 B;  2CCM A;  4E68 A;  4PHM A;  1YTZ C;  4FQO A;  2OS8 C;  2PSR A;  1AJ4 A;  1YVL A;  2K7C A;  1B8C A;  1PUL A;  4MVF A;  3CR4 X;  4MRX A;  5GQQ C;  2KNE A;  2L5X B;  2F33 A;  2M97 A;  1SYM A;  3WXA A;  1R2U A;  3BUN B;  3PM8 A;  2MRD A;  2Q91 A;  1DGU A;  1UWO A;  1C7W A;  1TN4 A;  2JWW A;  2K61 A;  1YRU B;  1JFJ A;  2HET A;  4DRW A;  1Y0V H;  3MSE B;  3OB2 B;  1N65 A;  1L7Z A;  1XK4 A;  2EHB A;  1JBA A;  1V1F A;  3LLE A;  3AKA A;  3PN7 C;  4NDB A;  4MSP A;  3TDI A;  4QJ4 B;  3VRO A;  1OMV A;  1CDL A;  2K7B A;  2NCO A;  4XJK B;  3SJS A;  2ISD A;  2BEC A;  2BL0 C;  4GGN A;  5I8N A;  3I5G C;  2WOR A;  5AER A;  3BQ3 A;  1YUS A;  4PE7 A;  2MJW B;  1IJ5 A;  3CTN A;  2JUL A;  4NDC A;  1XFZ O;  1J7O A;  3WHU B;  4WQ2 A;  2K2A A;  3O6B A;  3NSO A;  2I2R E;  3EK8 A;  1WRK A;  1QXP A;  1S6I A;  1LKJ A;  1DJH A;  4BY4 A;  1A75 A;  1DF0 B;  2NLN A;  4R1E A;  1NP8 A;  1KSM A;  4P5O E;  4ZCU A;  2BKI B;  4GFT A;  3O4Y A;  3ZNI A;  1JC2 A;  2ZN8 A;  1KCY A;  4ICB A;  4ORC B;  1RTP 1;  2JNF A;  3PLF B;  1S6C A;  1EG3 A;  4YGA A;  3JVT B;  3FIA A;  2ZNE A;  1Q80 A;  2CBL A;  3FS7 A;  1SR6 C;  3LCP C;  4USL A;  2L0P A;  1YX7 A;  3ICB A;  4MBE A;  2EGD A;  3CS1 A;  1TNP A;  4WQ3 A;  2FCE A;  3RLZ A;  2L50 A;  1NSH A;  3SG2 A;  4I5K A;  5ER4 X;  1S26 D;  3AKB A;  1J1D A;  1QX5 B;  2KBM A;  3OX6 A;  4FTG A;  2JTZ A;  3NXA A;  4MLW A;  2B1U A;  5KU1 A;  1QAS A;  1K93 D;  1XA5 A;  3A8R A;  1F55 A;  2L51 A;  1OE9 B;  1CFD A;  5AXI A;  2K7O A;  4MZL A;  1OMD A;  1UHJ A;  4DUQ A;  1A03 A;  2F3Z A;  1AK8 A;  3KPX A;  4ORA B;  4XYN A;  4AOM A;  4C0J A;  1S5G Z;  1KFX S;  2KQY A;  1U5I A;  2KFF A;  2LLS A;  2WCE A;  1PSB A;  2MLE C;  1PRW A;  1UHI A;  1G4Y R;  2R2I A;  3AAJ A;  1B7T Z;  4Q04 A;  1XFV O;  4JPZ B;  2LVJ A;  3EKH A;  1M39 A;  1CDM A;  1QV1 A;  1QVI Z;  4QJ5 B;  5G08 A;  2ZRS A;  3JTD C;  5D69 A;  2MA2 A;  1SBJ A;  2V53 A;  4ZCV A;  4A4B A;  1IJ6 A;  1B47 A;  5F6T A;  1K2H A;  2MLF C;  1OSA A;  2LM5 A;  1NX3 A;  4AQJ A;  3KO0 A;  1ALV A;  3D0Y A;  3GOF A;  3KEV A;  3KHE A;  1A2X A;  1RJV A;  1BR4 B;  4ETO A;  3BUX B;  2LMU A;  2D8N A;  1SCV A;  3IQO A;  1KSO A;  1WY9 A;  1LIN A;  1B9A A;  1DF0 A;  2M1K B;  2H61 A;  1PAL A;  1UHK A;  1SCM C;  1A4P A;  1PVA A;  2KQ6 A;  3JVT C;  3SG5 A;  2RGI A;  4PCW A;  1W7I B;  1FI5 A;  1BOC A;  2I18 A;  3EK4 A;  4WRI A;  3VGO A;  2HF5 A;  2M7N A;  1DJZ A;  1D1O A;  1B8L A;  3SG4 A;  3EK7 A;  2NZ0 A;  4MRY A;  1NUB A;  5HLO A;  3QRX A;  1WLZ A;  2K7D A;  1DJY A;  5ER5 A;  1RK9 A;  1K96 A;  2JQ6 A;  1FW4 A;  1U5I B;  2LMT A;  3LK0 A;  3NSI A;  1DJG A;  2QAC A;  1BMO A;  1G33 A;  3LK1 A;  4NDD A;  5HLV A;  1BLQ A;  2KGB C;  2M8U A;  2CNP A;  3I5F B;  2GGM A;  2JXL A;  5D7F A;  1NIW A;  4MZJ A;  4DIR A;  4DS7 A;  3BOW A;  1XFU O;  1DTL A;  2MAZ A;  4GUK A;  4TNC A;  4F0Z B;  3CR5 X;  4GNK B;  1KFX L;  3TS5 C;  4PE0 A;  1S36 A;  4GGF A;  1ZOT B;  4PAL A;  1QLK A;  2JXC A;  5B8I B;  1F71 A;  1CDP A;  2CXJ A;  2LV7 A;  3BYA A;  2K2F A;  1SRA A;  5TNC A;  3SIA A;  3CGA A;  1YRT B;  2I7A A;  2IS9 A;  1OZO A;  5FYX A;  3VRN A;  1UHH A;  4HRE E;  3SG6 A;  1ODB A;  1G8I A;  3TS5 B;  4YGB B;  2JTT A;  3NSL A;  1ALW A;  1DMO A;  1KK8 C;  1QTX A;  4PHN A;  3CWG A;  2F2O A;  3BOW B;  4N5X A;  4PHJ A;  3DD4 A;  1MF8 B;  1LA3 A;  3O2P A;  1CM1 A;  1YUU A;  2K8M B;  2JC2 A;  3I5F C;  4I5N B;  1WDC C;  4L9M A;  1N2D A;  1UUR A;  1ZMZ A;  2A4J A;  1C07 A;  2SAS A;  1YX8 A;  1NPQ A;  2LVV A;  2KAV A;  3HX4 A;  4C0L A;  1BT6 A;  1NWD A;  1NCX A;  3DVM A;  4HRG A;  1GGW A;  1SL9 A;  2KAX A;  2LLT A;  1X02 A;  3BXK A;  3K21 A;  3SG3 A;  3TDZ A;  2CTN A;  1S5G Y;  2LC5 A;  2TN4 A;  1AUI B;  1BJF A;  1VRK A;  2KBI A;  5AEQ A;  1R6P A;  1B8R A;  4JQ0 D;  2BE4 A;  1TCF A;  2O60 A;  4XJK A;  1QX7 A;  1TNW A;  2FJU B;  2PVB A;  1S6J A;  3PSR A;  1C7V A;  1AHR A;  1IGV A;  2HQW A;  1EH2 A;  1SMG A;  1NX2 A; 
#chains in the Genus database with same CATH topology
 2KI6 D;  5K89 A;  2ZND A;  1Y1U A;  3IF7 A;  5DKQ A;  1YR5 A;  2KLD A;  5IBW A;  2JPO A;  4UPG A;  2I94 A;  3AAK A;  1M46 A;  1QX2 A;  1MXL C;  3PFV A;  5CSN A;  1TNX A;  1F70 A;  4CFR A;  2BCA A;  2GGZ A;  2GV5 A;  3TZ1 A;  3DXL A;  4CPV A;  4HRH A;  1CB1 A;  4DCK A;  4ORB B;  3VB1 A;  2JZI A;  1W7J B;  5DKN A;  1IWQ A;  3OBV A;  2COL B;  3CZ2 A;  2P6B B;  1QS7 A;  1XFY O;  2EC6 B;  3CZ1 A;  5CSF A;  2H61 C;  3LL8 B;  1RRO A;  2K0J A;  4PDZ A;  4BY5 A;  1Y1X A;  1H8B A;  1KWO B;  3B86 A;  2FCD A;  2G2B A;  3BUM B;  3FE8 A;  4D1E A;  1GQM A;  1LS8 A;  3BFH A;  1AVS A;  1BOD A;  3B87 A;  2E30 A;  2GTE A;  2FOT A;  1BR1 B;  3S0F A;  2AAO A;  1PSR A;  1BU3 A;  5EL2 A;  3ZWH A;  2QEB A;  4CID A;  2L4I A;  1K9P A;  3VRP A;  2LNK A;  4M2O A;  1B4C A;  1CLB A;  2WOS A;  3A4U B;  1BF5 A;  1WDC B;  1WRL A;  3NHT A;  2SCP A;  3D78 A;  1QVI Y;  5KSZ A;  4PE1 A;  2KI4 B;  1JF2 A;  3DZT A;  1ORG A;  1SL8 A;  3BFA A;  2KAY A;  2LP3 A;  1XO5 A;  2BKH B;  1ZUZ A;  2JT8 A;  2BBN A;  1DGV A;  1KK7 Z;  2AUC A;  1GGZ A;  5CSJ A;  4CLN A;  3QME A;  4OKH A;  2KSP A;  2OPO A;  3VRR A;  2EC6 C;  1CFC A;  1B7T Y;  2MBX A;  2QPT A;  1KWO C;  2OS8 B;  2BE6 A;  1SK6 D;  4GGF C;  2LHL A;  5HKW A;  3S0D A;  1GJY A;  2L98 A;  1QJT A;  3S0B A;  4A4C A;  1DC1 A;  3R1P A;  3JTD B;  5KTY A;  1MHO A;  1F8H A;  3F45 A;  1UHN A;  2PAL A;  2ZN9 A;  3OX5 A;  1TTX A;  5D3O A;  1DEK A;  2KI4 C;  1K94 A;  2CT9 A;  4YI8 A;  3FWC A;  3TUY C;  1MQ1 A;  1OQP A;  2WC8 A;  1LXF C;  1MR8 A;  1TWO A;  1SL7 A;  4M2P A;  4MN0 A;  1AJ5 A;  3CDN A;  4GBA A;  1IKU A;  5AAN A;  1CTR A;  1OOJ A;  3SG7 A;  5HKY A;  2M49 B;  1QLS A;  1IQ5 A;  3TUY B;  1L2O C;  2M9G A;  3EVR A;  1F4Q A;  2LAN A;  3V2L A;  3VRQ A;  2F3Y A;  2PAS A;  4JKT A;  3S0A A;  4PHK A;  3O78 A;  4P2Y B;  4MZK A;  3PAL A;  1LVC D;  3D75 A;  1JWD A;  4GAO A;  1ZFS A;  1QIW A;  2ZKM X;  1J55 A;  2KHN A;  2MHH A;  1M45 A;  3D0Y B;  1A75 B;  1JF0 A;  3DY9 A;  3GK4 X;  1IRJ A;  4I5J A;  1QAT A;  5HL1 A;  2Y1M A;  2LMV A;  1IH0 A;  2BBM A;  1NX1 A;  3I5H C;  1EG4 A;  1S1E A;  2M0R A;  2LHI A;  4YI9 A;  5CPV A;  3D10 A;  1FF1 A;  1Y1A A;  4IJ7 A;  1QV0 A;  2F2P A;  1DJW A;  4NQG A;  1J7Q A;  4YGD B;  4OV2 A;  3FE6 A;  1XFX O;  1J7R A;  1SW8 A;  2PRU A;  1XVJ A;  1MUX A;  4GPL B;  1S3P A;  2OTG C;  1J1E A;  1V1G A;  1CM4 A;  4AQI A;  2LCP A;  1REC A;  1HQV A;  1PVB A;  2Y4Q A;  3TDU A;  4JWQ A;  5FI2 A;  3FE9 A;  1F4O A;  4OVN F;  1OZS A;  2VRG A;  1NX0 A;  1K8U A;  2DOQ A;  1TIZ A;  3CLN A;  4M2Q A;  1SY9 A;  2WCF A;  1RFJ A;  1DVI A;  1YUR A;  1GM0 A;  1LA0 A;  2BL0 B;  2M1U A;  4FQT A;  3WNX B;  1KFU L;  1SPY A;  4OCI A;  2L2E A;  4HSZ A;  3DVK A;  1C3Y A;  5J3X A;  2M3W A;  1JUO A;  1TCO B;  1UUS A;  1B1G A;  1MWN A;  2E6W A;  2ERB A;  3H4S E;  3SIB A;  2LLU A;  1M63 B;  2NXQ A;  2QEV A;  1DJX A;  2BCB A;  1SNL A;  1XK4 C;  2F8P A;  2WCM A;  3I5H B;  5HKZ A;  2JNX A;  3NSK A;  2LE9 B;  4CFQ A;  1SKT A;  3KF9 A;  1TUZ A;  1EL4 A;  1QIV A;  1J7P A;  1DJI A;  1Z4H A;  1YUT A;  3DVE A;  3EKJ A;  2LVI A;  3OHM B;  1KK8 B;  2JT3 A;  4YGE B;  2O5G A;  1OOH A;  2KYF A;  1K90 D;  1CFF A;  5I2O A;  4I5L B;  1PK0 D;  2BCX A;  3CYZ A;  1KFU S;  2AMI A;  2Y5I A;  1Z2C B;  1ZAC A;  1L2O B;  3FWB A;  2NCP A;  2ZFD A;  3DVJ A;  2PYQ A;  3CAB A;  2Y1N A;  3I5I B;  4N1F A;  1F54 A;  2K60 A;  2M29 A;  1TRF A;  2ZRT A;  2KFH A;  2KPH A;  2OTG B;  2PMY A;  2Q4U A;  3BUW B;  3GK1 A;  3CR2 A;  3PN7 B;  1KQV A;  3IQQ A;  1KQM C;  1WRZ A;  3R72 A;  3SS4 A;  2G9B A;  2JRF A;  5PAL A;  4C0K A;  1JFK A;  3CZT X;  1HT9 A;  1RWY A;  4QJ3 B;  3DF0 B;  1CLM A;  2H2K A;  1CMF A;  4MEW A;  2LP2 A;  3PAT A;  1IQ3 A;  2HQ8 A;  2LUX A;  1E8A A;  2JU0 A;  3RM1 A;  1KQM B;  2WND A;  2LVK A;  2QEO A;  3B88 A;  3EVV A;  2JT0 A;  5BPJ A;  4N1G A;  1DT7 B;  3D77 A;  1AP4 A;  1OMR A;  2LUC A;  1OOI X;  3M0W A;  2L4H A;  3BUO B;  1N0Y A;  1XYD A;  1CKK A;  1MXE A;  1A29 A;  1WLM A;  5I2Q A;  1FI6 A;  3I5I C;  3HCM A;  1NCY A;  3I5G B;  1TOP A;  3UNW A;  1CDN A;  1YVH A;  2WCB A;  1IG5 A;  4YBH B;  2JPT A;  2JOJ A;  5I2L A;  1FPW A;  3WHT B;  2KLE A;  3EVU A;  5AFP A;  1BG1 A;  2KYC A;  1SCM B;  1CNP A;  1KK7 Y;  2LAP A;  3GK2 A;  1XFR A;  2KI6 C;  1NCZ A;  1EXR A;  1K9U A;  4U8D A;  1CMG A;  1EJ3 A;  1M31 A;  2HPS A;  1K9K A;  3OB1 B;  2BAP A;  4OZD A;  1JSA A;  1FBV A;  2KOT A;  4YGC B;  4YRU A;  1TNQ A;  1CLL A;  4PE4 A;  1K95 A;  5JJG A;  1Y6W A;  2M7L A;  3E3R A;  1NYA A;  2KGR A;  5DKR A;  5CSI A;  2KFG A;  3OP0 A;  5HYD A;  2KDH A;  5JOL A;  3DF0 A;  3C1V A;  4IL1 A;  1UP5 A;  1H4B A;  4OR9 B;  1XFW O;  1SR6 B;  2CCM A;  3L4A A;  4E68 A;  4PHM A;  1YTZ C;  4FQO A;  2OS8 C;  2PSR A;  1AJ4 A;  1YVL A;  2K7C A;  1B8C A;  1PUL A;  4MVF A;  3S0G A;  3CR4 X;  4MRX A;  5GQQ C;  2KNE A;  2L5X B;  1OOF A;  2F33 A;  2M97 A;  3NHI A;  1SYM A;  3WXA A;  1R2U A;  3BUN B;  3O4X A;  3PM8 A;  2MRD A;  2Q91 A;  1DGU A;  1UWO A;  1C7W A;  1TN4 A;  2JWW A;  2K61 A;  1YRU B;  1P28 A;  1JFJ A;  2HET A;  1T14 A;  1Y0V H;  4DRW A;  3MSE B;  3OB2 B;  1N65 A;  1L7Z A;  1XK4 A;  2EHB A;  1JBA A;  1V1F A;  2WC5 A;  3LLE A;  3AKA A;  3PN7 C;  4NDB A;  4MSP A;  2L5Y A;  3TDI A;  1W9Z A;  4QJ4 B;  3VRO A;  1OMV A;  1CDL A;  2K7B A;  3BJH A;  3OGN A;  2NCO A;  4XJK B;  3SJS A;  2ISD A;  2BEC A;  2BL0 C;  2PQL A;  4GGN A;  5I8N A;  3I5G C;  2WOR A;  4KYN A;  3BQ3 A;  5AER A;  1YUS A;  4PE7 A;  2MJW B;  2P70 A;  1IJ5 A;  3CTN A;  2JUL A;  4NDC A;  1XFZ O;  1J7O A;  3WHU B;  4WQ2 A;  2K2A A;  3O6B A;  3NSO A;  2I2R E;  3EK8 A;  1WRK A;  1QXP A;  1S6I A;  1LKJ A;  1DJH A;  4BY4 A;  1A75 A;  1DF0 B;  2NLN A;  4R1E A;  1NP8 A;  1KSM A;  4P5O E;  4ZCU A;  2BKI B;  4GFT A;  3O4Y A;  1SSE B;  3ZNI A;  1JC2 A;  2ZN8 A;  1KCY A;  4ICB A;  4ORC B;  1RTP 1;  2JNF A;  3PLF B;  1S6C A;  1EG3 A;  4YGA A;  3JVT B;  3FIA A;  2ZNE A;  1Q80 A;  2CBL A;  3FS7 A;  1SR6 C;  3L47 A;  3LCP C;  4USL A;  2L0P A;  1YX7 A;  2FJY A;  3ICB A;  4MBE A;  2QDI A;  2EGD A;  3CS1 A;  1TNP A;  4WQ3 A;  2FCE A;  3RLZ A;  2L50 A;  1NSH A;  3SG2 A;  5FI7 A;  4I5K A;  5ER4 X;  1S26 D;  3AKB A;  1J1D A;  1QX5 B;  2KBM A;  3OX6 A;  4FTG A;  2JTZ A;  3NXA A;  4MLW A;  2B1U A;  5KU1 A;  1QAS A;  1K93 D;  5DIC A;  1XA5 A;  3A8R A;  3L4L A;  1F55 A;  2L51 A;  1OE9 B;  3R1V A;  3Q8I A;  1CFD A;  5AXI A;  2K7O A;  4MZL A;  1OMD A;  1UHJ A;  4DUQ A;  1A03 A;  2F3Z A;  1AK8 A;  3KPX A;  4ORA B;  3K1E A;  2WC6 A;  3D74 A;  4XYN A;  4AOM A;  4C0J A;  1S5G Z;  1KFX S;  1DQE A;  2KQY A;  1U5I A;  2KFF A;  2LLS A;  2WCE A;  5FI6 A;  1PSB A;  2MLE C;  1PRW A;  1UHI A;  1G4Y R;  2R2I A;  3AAJ A;  1B7T Z;  4Q04 A;  2YGU A;  1XFV O;  4JPZ B;  2LVJ A;  3EKH A;  1M39 A;  1C3Z A;  1CDM A;  3D76 A;  1QV1 A;  4JD9 A;  1QVI Z;  4QJ5 B;  3N7H A;  5G08 A;  2ZRS A;  3JTD C;  5D69 A;  2WCJ A;  2MA2 A;  1SBJ A;  2V53 A;  2WCL A;  4ZCV A;  4A4B A;  1IJ6 A;  1B47 A;  5F6T A;  1K2H A;  2MLF C;  1OSA A;  2LM5 A;  1NX3 A;  4AQJ A;  3KO0 A;  1ALV A;  3R1O A;  3D0Y A;  1QWV A;  3BFB A;  1TUJ A;  3GOF A;  1A2X A;  3KEV A;  1RJV A;  3KHE A;  1BR4 B;  4INW A;  3BUX B;  2LMU A;  4ETO A;  2D8N A;  1SCV A;  3IQO A;  1KSO A;  1WY9 A;  1LIN A;  1B9A A;  1DF0 A;  2M1K B;  2H61 A;  3SS5 A;  1PAL A;  1UHK A;  1SCM C;  1A4P A;  1PVA A;  2KQ6 A;  3JVT C;  3PJI A;  3SS3 A;  3SG5 A;  2RGI A;  4PCW A;  1W7I B;  1FI5 A;  1BOC A;  2I18 A;  3EK4 A;  4WRI A;  3VGO A;  2HF5 A;  2M7N A;  1DJZ A;  1D1O A;  1B8L A;  3SG4 A;  3EK7 A;  2NZ0 A;  4MRY A;  1NUB A;  3D73 A;  5HLO A;  3QRX A;  1WLZ A;  2K7D A;  1DJY A;  5ER5 A;  1RK9 A;  1K96 A;  1OOG A;  1DEL A;  2JQ6 A;  1FW4 A;  1U5I B;  2LMT A;  3LK0 A;  3NSI A;  1DJG A;  2QAC A;  1BMO A;  1G33 A;  3LK1 A;  4NDD A;  5HLV A;  1BLQ A;  3RZS A;  2KGB C;  2M8U A;  2CNP A;  3I5F B;  2GGM A;  2JXL A;  1OW4 A;  5D7F A;  1NIW A;  4MZJ A;  4DIR A;  4DS7 A;  3BOW A;  1XFU O;  1DTL A;  2MAZ A;  4GUK A;  3UO9 A;  2WCH A;  4TNC A;  4F0Z B;  3IVT A;  3CR5 X;  4PT1 A;  4GNK B;  2H8V A;  1KFX L;  3TS5 C;  4PE0 A;  1S36 A;  4GGF A;  1ZOT B;  4PAL A;  1QLK A;  2JXC A;  5B8I B;  1F71 A;  1CDP A;  2CXJ A;  2LV7 A;  3BYA A;  2K2F A;  1SRA A;  3NGV A;  5TNC A;  3SIA A;  2QEH A;  1YRT B;  2I7A A;  2IS9 A;  1OZO A;  3CGA A;  5FYX A;  3VRN A;  1UHH A;  4HRE E;  3SG6 A;  1ODB A;  1G8I A;  3TS5 B;  3PM2 A;  2JTT A;  3NSL A;  4YGB B;  1ALW A;  3CZ0 A;  1KK8 C;  1QTX A;  4PHN A;  5I94 A;  1DMO A;  3CWG A;  2F2O A;  3S0E A;  3BOW B;  4N5X A;  4PHJ A;  3DD4 A;  1MF8 B;  1LA3 A;  3O2P A;  1CM1 A;  1YUU A;  2K8M B;  2JC2 A;  3I5F C;  4I5N B;  1WDC C;  2BNX A;  4L9M A;  1N2D A;  3DYE A;  1UUR A;  1ZMZ A;  2A4J A;  3EG5 B;  1C07 A;  2SAS A;  1YX8 A;  1NPQ A;  2WCK A;  2LVV A;  2KAV A;  3HX4 A;  4C0L A;  1BT6 A;  1NWD A;  1NCX A;  2P71 A;  3DVM A;  4HRG A;  1CFP A;  1GGW A;  1SL9 A;  2KAX A;  2LLT A;  1X02 A;  3BXK A;  3K21 A;  3SG3 A;  3TDZ A;  2CTN A;  1S5G Y;  2LC5 A;  2TN4 A;  1AUI B;  1BJF A;  1VRK A;  2KBI A;  4INX A;  5AEQ A;  1R6P A;  1B8R A;  4JQ0 D;  4F7F A;  2L2C A;  2BE4 A;  1TCF A;  2O60 A;  3B7A A;  1QX7 A;  1TNW A;  2FJU B;  2PVB A;  4XJK A;  1IIO A;  1S6J A;  3PSR A;  1C7V A;  1AHR A;  1IGV A;  2HQW A;  1EH2 A;  1SMG A;  3B6X A;  1NX2 A; 
#chains in the Genus database with same CATH homology
 2KI6 D;  5K89 A;  2ZND A;  1Y1U A;  3IF7 A;  5DKQ A;  1YR5 A;  5IBW A;  4UPG A;  2I94 A;  3AAK A;  1M46 A;  1QX2 A;  1MXL C;  3PFV A;  5CSN A;  1TNX A;  1F70 A;  4CFR A;  2BCA A;  2GGZ A;  2GV5 A;  3TZ1 A;  4CPV A;  4HRH A;  1CB1 A;  4DCK A;  4ORB B;  2JZI A;  1W7J B;  5DKN A;  1IWQ A;  2COL B;  2P6B B;  1QS7 A;  1XFY O;  2EC6 B;  5CSF A;  2H61 C;  3LL8 B;  1RRO A;  2K0J A;  4PDZ A;  4BY5 A;  1Y1X A;  1H8B A;  1KWO B;  2G2B A;  2FCD A;  3BUM B;  4D1E A;  1GQM A;  1AVS A;  1BOD A;  2E30 A;  2FOT A;  1BR1 B;  2AAO A;  1PSR A;  1BU3 A;  3ZWH A;  4CID A;  2L4I A;  1K9P A;  3VRP A;  2LNK A;  4M2O A;  1B4C A;  1CLB A;  2WOS A;  3A4U B;  1BF5 A;  1WDC B;  1WRL A;  2SCP A;  5KSZ A;  1QVI Y;  4PE1 A;  2KI4 B;  1JF2 A;  1SL8 A;  2KAY A;  2LP3 A;  1XO5 A;  2BKH B;  1ZUZ A;  2JT8 A;  2BBN A;  1DGV A;  1KK7 Z;  2AUC A;  1GGZ A;  5CSJ A;  4CLN A;  3VRR A;  4OKH A;  2KSP A;  2OPO A;  2EC6 C;  1CFC A;  1B7T Y;  2MBX A;  2QPT A;  1KWO C;  2OS8 B;  2BE6 A;  1SK6 D;  4GGF C;  2LHL A;  5HKW A;  1GJY A;  2L98 A;  1QJT A;  4A4C A;  3JTD B;  5KTY A;  1MHO A;  1F8H A;  3F45 A;  1UHN A;  2PAL A;  2ZN9 A;  3OX5 A;  1TTX A;  2KI4 C;  1K94 A;  2CT9 A;  4YI8 A;  3FWC A;  3TUY C;  1MQ1 A;  1OQP A;  2WC8 A;  1LXF C;  1MR8 A;  1SL7 A;  4M2P A;  4MN0 A;  1AJ5 A;  4GBA A;  1IKU A;  5AAN A;  1CTR A;  1OOJ A;  3SG7 A;  5HKY A;  2M49 B;  1QLS A;  1IQ5 A;  3TUY B;  1L2O C;  2M9G A;  3EVR A;  1F4Q A;  2LAN A;  3VRQ A;  2F3Y A;  2PAS A;  4PHK A;  3O78 A;  4P2Y B;  4MZK A;  3PAL A;  1LVC D;  1JWD A;  4GAO A;  1ZFS A;  1QIW A;  2ZKM X;  1J55 A;  2KHN A;  2MHH A;  1M45 A;  3D0Y B;  1A75 B;  1JF0 A;  3GK4 X;  4I5J A;  1IRJ A;  1CFP A;  1QAT A;  2Y1M A;  2LMV A;  1IH0 A;  2BBM A;  1NX1 A;  3I5H C;  1EG4 A;  1S1E A;  2M0R A;  2LHI A;  4YI9 A;  5CPV A;  3D10 A;  1FF1 A;  1Y1A A;  1QV0 A;  2F2P A;  1DJW A;  4NQG A;  1J7Q A;  4YGD B;  4OV2 A;  1XFX O;  1J7R A;  1SW8 A;  2PRU A;  1XVJ A;  1MUX A;  4GPL B;  1S3P A;  2OTG C;  1J1E A;  1V1G A;  1CM4 A;  4AQI A;  2LCP A;  1REC A;  1HQV A;  1PVB A;  2Y4Q A;  3TDU A;  4JWQ A;  4OVN F;  1F4O A;  1OZS A;  2VRG A;  1NX0 A;  1K8U A;  2DOQ A;  1TIZ A;  3CLN A;  4M2Q A;  1SY9 A;  2WCF A;  1RFJ A;  1DVI A;  1YUR A;  1LA0 A;  2BL0 B;  2M1U A;  3WNX B;  1KFU L;  1SPY A;  4OCI A;  2L2E A;  4HSZ A;  3DVK A;  5J3X A;  2M3W A;  1JUO A;  1TCO B;  1UUS A;  1B1G A;  1MWN A;  2E6W A;  3SIB A;  3H4S E;  2LLU A;  1M63 B;  2NXQ A;  1DJX A;  2BCB A;  1SNL A;  1XK4 C;  2F8P A;  3I5H B;  5HKZ A;  2JNX A;  3NSK A;  2LE9 B;  4CFQ A;  1SKT A;  3KF9 A;  1EL4 A;  1QIV A;  1J7P A;  1DJI A;  3EKJ A;  1YUT A;  3DVE A;  2LVI A;  3OHM B;  1KK8 B;  2JT3 A;  4YGE B;  2O5G A;  1CFF A;  2KYF A;  1K90 D;  5I2O A;  4I5L B;  1PK0 D;  2BCX A;  1KFU S;  2AMI A;  2Y5I A;  1ZAC A;  1L2O B;  3FWB A;  2NCP A;  2ZFD A;  3DVJ A;  3I5I B;  2Y1N A;  1F54 A;  4N1F A;  2M29 A;  1TRF A;  2ZRT A;  2KFH A;  2OTG B;  2PMY A;  2Q4U A;  3BUW B;  3GK1 A;  3PN7 B;  3CR2 A;  1KQV A;  3IQQ A;  1KQM C;  1WRZ A;  2G9B A;  2JRF A;  5PAL A;  4C0K A;  1JFK A;  3CZT X;  1HT9 A;  1RWY A;  4QJ3 B;  3DF0 B;  1CLM A;  2H2K A;  1CMF A;  4MEW A;  2LP2 A;  3PAT A;  1IQ3 A;  2HQ8 A;  2LUX A;  1E8A A;  2JU0 A;  3RM1 A;  1KQM B;  2WND A;  2LVK A;  3EVV A;  2JT0 A;  5BPJ A;  4N1G A;  1DT7 B;  1AP4 A;  1OMR A;  2LUC A;  3M0W A;  2L4H A;  3BUO B;  1N0Y A;  1XYD A;  1CKK A;  1MXE A;  1A29 A;  1WLM A;  5I2Q A;  1FI6 A;  3I5I C;  3HCM A;  1NCY A;  3I5G B;  1TOP A;  1CDN A;  1YVH A;  2WCB A;  1IG5 A;  4YBH B;  2JPT A;  2JOJ A;  5I2L A;  1FPW A;  3WHT B;  3EVU A;  5AFP A;  1BG1 A;  2KYC A;  1SCM B;  1CNP A;  1KK7 Y;  2LAP A;  3GK2 A;  2KI6 C;  1NCZ A;  1EXR A;  1K9U A;  4U8D A;  1CMG A;  1EJ3 A;  2HPS A;  1M31 A;  1K9K A;  3OB1 B;  1JSA A;  1FBV A;  2KOT A;  4YGC B;  4YRU A;  1TNQ A;  1CLL A;  4PE4 A;  1K95 A;  5JJG A;  1Y6W A;  2M7L A;  3E3R A;  1NYA A;  2KGR A;  5DKR A;  5CSI A;  2KFG A;  3OP0 A;  5HYD A;  2KDH A;  5JOL A;  3DF0 A;  3C1V A;  4IL1 A;  1UP5 A;  1H4B A;  4OR9 B;  1XFW O;  1SR6 B;  2CCM A;  4E68 A;  4PHM A;  1YTZ C;  4FQO A;  2OS8 C;  2PSR A;  1AJ4 A;  1YVL A;  2K7C A;  1B8C A;  1PUL A;  4MVF A;  3CR4 X;  4MRX A;  5GQQ C;  2KNE A;  2L5X B;  2F33 A;  2M97 A;  1SYM A;  3WXA A;  1R2U A;  3BUN B;  3PM8 A;  2MRD A;  2Q91 A;  1DGU A;  1UWO A;  1C7W A;  1TN4 A;  2JWW A;  2K61 A;  1YRU B;  1JFJ A;  2HET A;  4DRW A;  1Y0V H;  3MSE B;  3OB2 B;  1N65 A;  1L7Z A;  1XK4 A;  2EHB A;  1JBA A;  1V1F A;  3LLE A;  3AKA A;  3PN7 C;  4NDB A;  4MSP A;  3TDI A;  4QJ4 B;  3VRO A;  1OMV A;  1CDL A;  2K7B A;  2NCO A;  4XJK B;  3SJS A;  2ISD A;  2BEC A;  2BL0 C;  4GGN A;  5I8N A;  3I5G C;  2WOR A;  5AER A;  3BQ3 A;  1YUS A;  4PE7 A;  2MJW B;  1IJ5 A;  3CTN A;  2JUL A;  4NDC A;  1XFZ O;  1J7O A;  3WHU B;  4WQ2 A;  2K2A A;  3O6B A;  3NSO A;  2I2R E;  3EK8 A;  1WRK A;  1QXP A;  1S6I A;  1LKJ A;  1DJH A;  4BY4 A;  1A75 A;  1DF0 B;  2NLN A;  4R1E A;  1NP8 A;  1KSM A;  4P5O E;  4ZCU A;  2BKI B;  4GFT A;  3O4Y A;  3ZNI A;  1JC2 A;  2ZN8 A;  1KCY A;  4ICB A;  4ORC B;  1RTP 1;  2JNF A;  3PLF B;  1S6C A;  1EG3 A;  4YGA A;  3JVT B;  3FIA A;  2ZNE A;  1Q80 A;  2CBL A;  3FS7 A;  1SR6 C;  3LCP C;  4USL A;  2L0P A;  1YX7 A;  3ICB A;  4MBE A;  2EGD A;  3CS1 A;  1TNP A;  4WQ3 A;  2FCE A;  3RLZ A;  2L50 A;  1NSH A;  3SG2 A;  4I5K A;  5ER4 X;  1S26 D;  3AKB A;  1J1D A;  1QX5 B;  2KBM A;  3OX6 A;  4FTG A;  2JTZ A;  3NXA A;  4MLW A;  2B1U A;  5KU1 A;  1QAS A;  1K93 D;  1XA5 A;  3A8R A;  1F55 A;  2L51 A;  1OE9 B;  1CFD A;  5AXI A;  2K7O A;  4MZL A;  1OMD A;  1UHJ A;  4DUQ A;  1A03 A;  2F3Z A;  1AK8 A;  3KPX A;  4ORA B;  4XYN A;  4AOM A;  4C0J A;  1S5G Z;  1KFX S;  2KQY A;  1U5I A;  2KFF A;  2LLS A;  2WCE A;  1PSB A;  2MLE C;  1PRW A;  1UHI A;  1G4Y R;  2R2I A;  3AAJ A;  1B7T Z;  4Q04 A;  1XFV O;  4JPZ B;  2LVJ A;  3EKH A;  1M39 A;  1CDM A;  1QV1 A;  1QVI Z;  4QJ5 B;  5G08 A;  2ZRS A;  3JTD C;  5D69 A;  2MA2 A;  1SBJ A;  2V53 A;  4ZCV A;  4A4B A;  1IJ6 A;  1B47 A;  5F6T A;  1K2H A;  2MLF C;  1OSA A;  2LM5 A;  1NX3 A;  4AQJ A;  3KO0 A;  1ALV A;  3D0Y A;  3GOF A;  3KEV A;  3KHE A;  1A2X A;  1RJV A;  1BR4 B;  4ETO A;  3BUX B;  2LMU A;  2D8N A;  1SCV A;  3IQO A;  1KSO A;  1WY9 A;  1LIN A;  1B9A A;  1DF0 A;  2M1K B;  2H61 A;  1PAL A;  1UHK A;  1SCM C;  1A4P A;  1PVA A;  2KQ6 A;  3JVT C;  3SG5 A;  2RGI A;  4PCW A;  1W7I B;  1FI5 A;  1BOC A;  2I18 A;  3EK4 A;  4WRI A;  3VGO A;  2HF5 A;  2M7N A;  1DJZ A;  1D1O A;  1B8L A;  3SG4 A;  3EK7 A;  2NZ0 A;  4MRY A;  1NUB A;  5HLO A;  3QRX A;  1WLZ A;  2K7D A;  1DJY A;  5ER5 A;  1RK9 A;  1K96 A;  2JQ6 A;  1FW4 A;  1U5I B;  2LMT A;  3LK0 A;  3NSI A;  1DJG A;  2QAC A;  1BMO A;  1G33 A;  3LK1 A;  4NDD A;  5HLV A;  1BLQ A;  2KGB C;  2M8U A;  2CNP A;  3I5F B;  2GGM A;  2JXL A;  5D7F A;  1NIW A;  4MZJ A;  4DIR A;  4DS7 A;  3BOW A;  1XFU O;  1DTL A;  2MAZ A;  4GUK A;  4TNC A;  4F0Z B;  3CR5 X;  4GNK B;  1KFX L;  3TS5 C;  4PE0 A;  1S36 A;  4GGF A;  1ZOT B;  4PAL A;  1QLK A;  2JXC A;  5B8I B;  1F71 A;  1CDP A;  2CXJ A;  2LV7 A;  3BYA A;  2K2F A;  1SRA A;  5TNC A;  3SIA A;  3CGA A;  1YRT B;  2I7A A;  2IS9 A;  1OZO A;  5FYX A;  3VRN A;  1UHH A;  4HRE E;  3SG6 A;  1ODB A;  1G8I A;  3TS5 B;  4YGB B;  2JTT A;  3NSL A;  1ALW A;  1DMO A;  1KK8 C;  1QTX A;  4PHN A;  3CWG A;  2F2O A;  3BOW B;  4N5X A;  4PHJ A;  3DD4 A;  1MF8 B;  1LA3 A;  3O2P A;  1CM1 A;  1YUU A;  2K8M B;  2JC2 A;  3I5F C;  4I5N B;  1WDC C;  4L9M A;  1N2D A;  1UUR A;  1ZMZ A;  2A4J A;  1C07 A;  2SAS A;  1YX8 A;  1NPQ A;  2LVV A;  2KAV A;  3HX4 A;  4C0L A;  1BT6 A;  1NWD A;  1NCX A;  3DVM A;  4HRG A;  1GGW A;  1SL9 A;  2KAX A;  2LLT A;  1X02 A;  3BXK A;  3K21 A;  3SG3 A;  3TDZ A;  2CTN A;  1S5G Y;  2LC5 A;  2TN4 A;  1AUI B;  1BJF A;  1VRK A;  2KBI A;  5AEQ A;  1R6P A;  1B8R A;  4JQ0 D;  2BE4 A;  1TCF A;  2O60 A;  4XJK A;  1QX7 A;  1TNW A;  2FJU B;  2PVB A;  1S6J A;  3PSR A;  1C7V A;  1AHR A;  1IGV A;  2HQW A;  1EH2 A;  1SMG A;  1NX2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...