1KQMC

Scallop myosin s1-amppnp in the actin-detached conformation
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
153
structure length
153
Chain Sequence
KLSQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords MYOSIN heavy chain
publication title Crystallographic findings on the internally uncoupled and near-rigor states of myosin: Further insights into the mechanics of the motor
pubmed doi rcsb
total genus 31
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2002-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kqmC01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kqmC02
2WOSA 4OCIA 1V1FA 2LV7A 2OTGC 1SKTA 4BY5A 1SCMC 2KBMA 1SR6B 2JT8A 2WORA 1EG4A 3VRRA 1SRAA 1ZOTB 1CDPA 1Y6WA 1BF5A 1LA3A 1NCYA 4A4CA 1JFJA 4DRWA 3ZNIA 5AXIA 1KK8B 1ODBA 1B8RA 1ZUZA 2JTZA 4ICBA 2GGMA 4C0JA 1JC2A 1S26D 2NCPA 1BOCA 2L4IA 3OB2B 2SCPA 2E30A 2LNKA 4IL1A 2F2PA 4MVFA 2NCOA 1YVHA 4R1EA 1W7JB 1CFFA 3TDZA 3I5FB 2LLTA 1DGVA 2LP3A 4DCKA 1N65A 3VRQA 1LVCD 2L98A 2K7BA 1KWOC 4GBAA 2O60A 1OMRA 4WQ2A 1IKUA 1L2OB 2M7NA 1QTXA 2K2AA 2LANA 2NZ0A 3ICBA 1SR6C 1A29A 2LLSA 1UHNA 2M29A 1PSBA 4YGDB 1N0YA 3JTDB 1M63B 1TN4A 3JVTB 3O78A 4PHKA 1SL9A 1KK7Y 1DF0A 4N5XA 4MSPA 4ORCB 2LVVA 4PDZA 2K0JA 3BUOB 2CT9A 3PALA 4N1GA 1OOJA 1H4BA 5D7FA 1CTRA 2LVIA 2OS8B 2KI6D 1CMFA 1G33A 3PM8A 1Q80A 1PRWA 1D1OA 4YRUA 2JQ6A 1K9KA 2F33A 5IBWA 2M8UA 1WDCB 4M2QA 3BQ3A 2AMIA 5B8IB 3H4SE 4JWQA 1TOPA 1LKJA 1QIVA 3TS5C 1BR1B 1L2OC 1TTXA 4E68A 1EXRA 4XJKB 1K9PA 2B1UA 1JF2A 2JNXA 2KOTA 1AJ4A 1TNPA 3JTDC 2L0PA 5D69A 2KYCA 1B8CA 2JT3A 3LK0A 1RJVA 4JPZB 2MRDA 5AFPA 1OQPA 2KFGA 1M31A 3EK7A 1QLSA 1KCYA 1IJ5A 1SNLA 4NDBA 5K89A 2AAOA 2PASA 3GK2A 1NYAA 5DKRA 5ER4X 4UPGA 1C07A 3EVUA 2Y1NA 3CWGA 2A4JA 1EJ3A 1DTLA 3KEVA 2KAYA 3SG2A 1RWYA 3FWCA 5CSJA 5DKQA 3VROA 2M0RA 2BL0B 3NSIA 1J7PA 1DMOA 1DJYA 4MLWA 2LLUA 2R2IA 3I5GB 1IGVA 1SL7A 2L5XB 1CM1A 4GFTA 4CLNA 4PE1A 3SG6A 2JNFA 1QXPA 2ZN9A 3TDIA 1DJZA 1LINA 3MSEB 3WHUB 3PN7B 2H2KA 5CSFA 2MHHA 3QRXA 2M49B 1SL8A 1CLMA 1SW8A 1IQ5A 1BODA 2F3ZA 4JQ0D 4WRIA 2OTGB 5ER5A 1QX5B 3VRPA 2LHIA 1JBAA 1SCMB 1W7IB 2EGDA 2V53A 4GAOA 5HKZA 5AANA 2OPOA 2MJWB 4OVNF 1S6CA 1UHKA 4HRHA 3OX6A 2JC2A 3IQQA 4ZCUA 1FPWA 2BL0C 4NDCA 1EG3A 2SASA 1K96A 5TNCA 2CBLA 1LA0A 1WLZA 5CSIA 1QLKA 2KBIA 2KGBC 1KK7Z 3AAJA 1F55A 1KFXS 2WC8A 2FCEA 3AAKA 3NXAA 2I18A 1CFDA 2KNEA 2KFHA 1BMOA 1KQMC 1HT9A 1SBJA 1V1GA 1YURA 2JXCA 1NSHA 1GJYA 1R2UA 1SYMA 2ZNDA 1UHHA 2BE6A 3FS7A 2BCBA 1S1EA 2JXLA 2LAPA 1QX2A 2E6WA 2PALA 3E3RA 3NSOA 1DJXA 1K8UA 1XFUO 3KHEA 2ISDA 4ORBB 1CFPA 4I5NB 3CLNA 1OZOA 3BUXB 1YRTB 1J1EA 3DF0A 4HREE 2LC5A 2RGIA 3TS5B 3D0YA 1SCVA 1RROA 1QV1A 2ZKMX 3DVJA 2I7AA 1E8AA 4GPLB 1B7TZ 1XA5A 1KFUL 4GGNA 1QIWA 2K8MB 4A4BA 3BXKA 4C0LA 3A4UB 4C0KA 1UHIA 2Q91A 2F2OA 1Y1XA 1CB1A 1YUUA 1PK0D 1UURA 4PE7A 2EC6C 4ZCVA 5KSZA 1R6PA 2COLB 2H61A 1CDNA 1FI6A 5HLVA 1MHOA 1G4YR 1OMVA 4GNKB 1CFCA 1QX7A 1BU3A 4OV2A 3LCPC 2LCPA 3LL8B 1C7WA 5DKNA 1NP8A 3CR4X 2Q4UA 1J7RA 2QPTA 1CM4A 4OR9B 1TCFA 2LMTA 1MXLC 2MA2A 1SY9A 1NX2A 4MEWA 4NQGA 1XFWO 2WCEA 4HSZA 2K7OA 4CFQA 1UP5A 3LLEA 4PE4A 5I2LA 2ZRSA 1K94A 1KFUS 1YVLA 1FBVA 2VRGA 3HCMA 4ORAB 1HQVA 4XYNA 5G08A 3O6BA 1ALWA 3BOWA 3TZ1A 1S6JA 2KAVA 2LM5A 1JF0A 1IJ6A 1QJTA 1QVIZ 1A75A 1S6IA 1YR5A 1F54A 1XO5A 1XK4A 2CNPA 4PCWA 1NX0A 5GQQC 2KAXA 1TIZA 2WCFA 1B7TY 5JJGA 2IS9A 2BKIB 2L50A 3AKAA 4DIRA 1J7OA 3O4YA 3OB1B 1NPQA 3M0WA 1VRKA 5KU1A 4YGEB 2LVJA 2JPTA 4GGFA 2G2BA 2KGRA 2BBNA 2FJUB 2QACA 1F71A 1JSAA 1QS7A 3PFVA 1YTZC 4CIDA 4PALA 4CFRA 3FWBA 3GK4X 2LMUA 3SG3A 3PSRA 3PLFB 1BR4B 1BLQA 2CCMA 3NSLA 4AQIA 1KQMB 1PULA 4FQOA 1B1GA 2ZFDA 3A8RA 2LHLA 2K7CA 3I5HC 2Y1MA 2PRUA 2Y5IA 2MAZA 4MZJA 1B9AA 3SG4A 3TDUA 1AJ5A 3VRNA 4PHNA 3WHTB 2L2EA 1DJIA 2LUCA 4QJ5B 1MF8B 1M45A 1NX3A 1B47A 4PE0A 1X02A 1S3PA 1WRZA 5BPJA 1DJGA 1AUIB 1WRLA 4GGFC 1QVIY 2TN4A 1Y0VH 1BT6A 1ZFSA 2JU0A 4USLA 2ZN8A 3CTNA 4DUQA 4AOMA 1CNPA 1A2XA 1BJFA 5I8NA 3FIAA 1ZMZA 2LE9B 1AVSA 1B4CA 1OSAA 3BUNB 3AKBA 1DJWA 4P2YB 1QATA 1MQ1A 4MZKA 4GUKA 1DJHA 3EVVA 3BUMB 1IQ3A 2KI4C 1ALVA 1IRJA 2LUXA 3HX4A 1CMGA 1XVJA 3EVRA 1U5IA 1UWOA 3EK4A 3SJSA 1CLBA 1RFJA 2KFFA 2JOJA 2MLEC 1DGUA 1YUTA 2M1KB 4M2OA 2EC6B 4CPVA 5HKWA 3IQOA 4YGBB 1RECA 4F0ZB 3ZWHA 1F4QA 2I94A 2LP2A 1Y1AA 1H8BA 4HRGA 4YBHB 1YRUB 1NCXA 2JZIA 1BG1A 1SPYA 1AHRA 2EHBA 3VGOA 3F45A 1PALA 1RK9A 1XYDA 2L4HA 1TRFA 3K21A 1AP4A 3OP0A 4FTGA 3RLZA 3DF0B 1DVIA 3D0YB 3KF9A 4YGCB 3SIAA 1LXFC 3I5IC 5CPVA 4WQ3A 1OE9B 2DOQA 2I2RE 1SK6D 1K2HA 2ZRTA 3SG7A 1OZSA 1J1DA 3LK1A 2GV5A 1DF0B 3NSKA 4I5KA 3GOFA 4Q04A 1J55A 1MWNA 4AQJA 4MN0A 5JOLA 2JWWA 1JUOA 2KQYA 4QJ4B 4PHMA 1QV0A 2JULA 1QASA 3CR2A 3DD4A 1S5GZ 3SG5A 4U8DA 4I5LB 2PMYA 4YI9A 2KSPA 2M1UA 2KHNA 3OHMB 5HLOA 1CDLA 2F8PA 2WNDA 2KYFA 4D1EA 4MRXA 1MUXA 4YGAA 3GK1A 3WXAA 1NX1A 2F3YA 1KK8C 2CXJA 2K7DA 1A03A 2JT0A 1KSOA 1XFZO 3CS1A 2KDHA 1CKKA 1GGWA 2G9BA 3D10A 1G8IA 4NDDA 1GQMA 1TNWA 1AK8A 1F70A 2BCXA 3CZTX 3BYAA 2MBXA 1IWQA 2M7LA 4M2PA 4P5OE 2H61C 3BOWB 5AERA 3I5FC 2BCAA 1C7VA 2HQ8A 1A75B 1MR8A 3I5HB 1EH2A 4I5JA 4MRYA 4YI8A 1YUSA 1CLLA 3CGAA 4XJKA 1PSRA 4BY4A 3EKJA 4TNCA 1K93D 2HQWA 2K61A 1FI5A 3JVTC 1UUSA 1TNXA 2FCDA 1NCZA 2JTTA 1A4PA 3DVMA 1PVBA 2K2FA 1IH0A 4MBEA 1FW4A 3TUYB 5HYDA 5KTYA 4MZLA 1NWDA 1GGZA 2OS8C 2HF5A 1M46A 1L7ZA 1S5GY 2M3WA 5PALA 1RTP1 1N2DA 2GGZA 1SMGA 1WDCC 2D8NA 1DT7B 1JWDA 2MLFC 2L51A 2NXQA 1F4OA 2KI4B 1ZACA 1XK4C 1OMDA 2PVBA 2ZNEA 3IF7A 1B8LA 1M39A 1MXEA 2Y4QA 3SIBA 1XFVO 1PVAA 2PSRA 1Y1UA 1JFKA 3C1VA 5HKYA 1K9UA 2BKHB 1K90D 1TCOB 1J7QA 1TNQA 4PHJA 2AUCA 4DS7A 3RM1A 4OKHA 1KFXL 1YX8A 1NIWA 3EK8A 1NUBA 4L9MA 3TUYC 4QJ3B 2KQ6A 5CSNA 5J3XA 1WLMA 1K95A 1KQVA 2KI6C 1YX7A 1F8HA 2BBMA 1KSMA 5F6TA 4N1FA 3DVKA 2HETA 3OX5A 2BE4A 3WNXB 2O5GA 2JRFA 1CDMA 2LMVA 3I5IB 2P6BB 2FOTA 1WY9A 3DVEA 4ETOA 1WRKA 3EKHA 3KPXA 3O2PA 2BECA 1U5IB 1FF1A 3CR5X 5I2OA 1UHJA 1IG5A 3I5GC 1S36A 2WCBA 2NLNA 5FYXA 3PATA 2CTNA 5I2QA 1XFXO 2LVKA 2M9GA 2HPSA 1EL4A 1XFYO 2M97A 3PN7C 3BUWB 5AEQA 3KO0A 1KWOB
chains in the Genus database with same CATH superfamily
2WOSA 4OCIA 3S0DA 1V1FA 2LV7A 2OTGC 5FI6A 1SKTA 1ORGA 4BY5A 1SCMC 2KBMA 1SR6B 2JT8A 3VB1A 2WORA 1EG4A 3VRRA 1SRAA 1ZOTB 1CDPA 4INWA 1Y6WA 4PT1A 1LA3A 1NCYA 4A4CA 1BF5A 1JFJA 4DRWA 3ZNIA 2WC5A 5AXIA 1KK8B 1ODBA 1B8RA 1ZUZA 2JTZA 4ICBA 2GGMA 4C0JA 1JC2A 2QEOA 1S26D 3EG5B 2NCPA 1BOCA 2L4IA 3OB2B 2SCPA 2E30A 2LNKA 1QWVA 4IL1A 2F2PA 4MVFA 2NCOA 1YVHA 4R1EA 1W7JB 1CFFA 3TDZA 3I5FB 2LLTA 1DGVA 2LP3A 4DCKA 1N65A 3VRQA 1LVCD 2L98A 2K7BA 1KWOC 4GBAA 2O60A 1OMRA 2WCJA 4WQ2A 1L2OB 1IKUA 2M7NA 1QTXA 2K2AA 2LANA 2NZ0A 3ICBA 1SR6C 1A29A 2LLSA 1UHNA 2M29A 3PM2A 1PSBA 4YGDB 3D77A 1N0YA 5EL2A 3JTDB 1M63B 1TN4A 3JVTB 3O78A 4PHKA 1SL9A 1KK7Y 1DF0A 4N5XA 4MSPA 4ORCB 2LVVA 4PDZA 2K0JA 3BUOB 2CT9A 3PALA 4N1GA 1OOJA 1H4BA 5D7FA 1CTRA 2LVIA 2OS8B 2KI6D 1CMFA 1G33A 3PM8A 1Q80A 1PRWA 2FJYA 1D1OA 1OOGA 2JQ6A 1K9KA 2P70A 2F33A 4YRUA 5IBWA 2M8UA 1WDCB 4M2QA 3BQ3A 2AMIA 5B8IB 3H4SE 4JWQA 1TOPA 4KYNA 1LKJA 1QIVA 3TS5C 1BR1B 1L2OC 1TTXA 2P71A 4E68A 1EXRA 4XJKB 1K9PA 2B1UA 1JF2A 3NGVA 2JNXA 2KOTA 1AJ4A 1P28A 1TNPA 3JTDC 2L0PA 5D69A 2KYCA 3SS5A 1B8CA 2JT3A 3LK0A 1RJVA 2YGUA 4JPZB 2MRDA 5AFPA 1OQPA 2L2CA 2KFGA 2KLDA 2BAPA 1M31A 3CZ0A 3EK7A 1QLSA 1T14A 1KCYA 1IJ5A 1SNLA 4NDBA 5K89A 2AAOA 2PASA 3B86A 3GK2A 1NYAA 3BFBA 5DKRA 2BNXA 5ER4X 4UPGA 1C07A 3EVUA 2Y1NA 3CWGA 2A4JA 1EJ3A 1DTLA 3KEVA 2KAYA 3SG2A 1RWYA 3FWCA 5CSJA 5DKQA 3VROA 2M0RA 2BL0B 3NSIA 1J7PA 1DMOA 1DJYA 3K1EA 4MLWA 2LLUA 2R2IA 3I5GB 1IGVA 1SL7A 2L5XB 1CM1A 3L4LA 4GFTA 4CLNA 4PE1A 3SG6A 2JNFA 1QXPA 2ZN9A 3TDIA 1DJZA 1LINA 3MSEB 3WHUB 3S0AA 3PN7B 2H2KA 5CSFA 2MHHA 3QRXA 2M49B 1SL8A 4F7FA 1CLMA 1SW8A 1IQ5A 4INXA 1BODA 2F3ZA 4JQ0D 4WRIA 2OTGB 5ER5A 1QX5B 3VRPA 2LHIA 1JBAA 1SCMB 1W7IB 2EGDA 2V53A 4GAOA 5HKZA 5AANA 2OPOA 2MJWB 4OVNF 1S6CA 1UHKA 4HRHA 3OX6A 2JC2A 3IQQA 4ZCUA 1FPWA 2BL0C 4NDCA 1EG3A 1OW4A 2SASA 1K96A 5TNCA 2CBLA 1LA0A 1WLZA 5CSIA 1QLKA 2KBIA 2KGBC 1KK7Z 3AAJA 1F55A 1OOIX 1KFXS 4JKTA 2WC8A 2FCEA 3AAKA 3NXAA 3D74A 2I18A 1CFDA 2KNEA 2QDIA 2KFHA 1BMOA 1KQMC 1HT9A 1SBJA 1V1GA 1YURA 2JXCA 5FI2A 1NSHA 1GJYA 3CABA 1R2UA 1SYMA 2ZNDA 1UHHA 2BE6A 3FS7A 1S1EA 2BCBA 2JXLA 2LAPA 1QX2A 2E6WA 2PALA 3E3RA 3BFHA 3NSOA 1DJXA 1K8UA 1XFUO 3NHIA 3KHEA 2ISDA 2PYQA 4ORBB 1CFPA 4I5NB 3CLNA 1OZOA 3BUXB 1YRTB 1J1EA 3DF0A 4HREE 2LC5A 2RGIA 3TS5B 3D0YA 3FE8A 1SCVA 1RROA 1QV1A 2ZKMX 3DVJA 1IIOA 2I7AA 1DELA 1E8AA 1B7TZ 3NHTA 1XA5A 1KFUL 4GPLB 4GGNA 1QIWA 2K8MB 4A4BA 3BXKA 4C0LA 3A4UB 4C0KA 1UHIA 2Q91A 2F2OA 3DZTA 1Y1XA 1CB1A 3IVTA 1YUUA 1PK0D 1UURA 4PE7A 2EC6C 4ZCVA 5KSZA 1R6PA 2COLB 2H61A 1CDNA 1FI6A 5HLVA 1MHOA 1G4YR 1OMVA 2KLEA 4GNKB 1Z4HA 1CFCA 1QX7A 1BU3A 4OV2A 3LCPC 2LCPA 3DXLA 1C7WA 3LL8B 5DKNA 1NP8A 3CR4X 2Q4UA 1J7RA 2QPTA 1CM4A 4JD9A 4OR9B 1TCFA 2LMTA 1MXLC 2MA2A 1SY9A 1NX2A 4MEWA 4NQGA 1XFWO 2WCEA 4HSZA 2K7OA 3B88A 4CFQA 1UP5A 3LLEA 4PE4A 5I2LA 2ZRSA 1K94A 1KFUS 1YVLA 1FBVA 2VRGA 3HCMA 2WCLA 3O4XA 4ORAB 1DC1A 3L47A 1HQVA 2KPHA 4XYNA 5G08A 3O6BA 1ALWA 2H8VA 3BOWA 3TZ1A 1S6JA 2QEHA 2KAVA 2LM5A 1JF0A 1IJ6A 1QJTA 1QVIZ 1A75A 1S6IA 1YR5A 1TUZA 1XO5A 1XK4A 1F54A 2CNPA 4PCWA 1NX0A 2PQLA 5GQQC 2KAXA 1TIZA 2WCFA 1B7TY 5JJGA 2IS9A 2BKIB 2L50A 3AKAA 4DIRA 3RZSA 1J7OA 3O4YA 3OB1B 1NPQA 3M0WA 1VRKA 5KU1A 3S0GA 4YGEB 2LVJA 2JPTA 4GGFA 2G2BA 5FI7A 2KGRA 2BBNA 2FJUB 2QACA 1F71A 1JSAA 2WCKA 1QS7A 3PFVA 1YTZC 3B87A 4CIDA 3N7HA 3CYZA 4PALA 5HL1A 4CFRA 3FWBA 3GK4X 2LMUA 3SG3A 3PSRA 3CZ2A 3PLFB 1BR4B 1BLQA 2CCMA 3CDNA 3NSLA 4AQIA 1KQMB 1PULA 4FQOA 1B1GA 2ZFDA 1DQEA 3A8RA 2LHLA 2K7CA 3I5HC 2JPOA 2Y1MA 2PRUA 2Y5IA 2MAZA 4MZJA 1B9AA 3SG4A 3TDUA 1AJ5A 3VRNA 4PHNA 3WHTB 2L2EA 2WC6A 1DJIA 2LUCA 4QJ5B 1MF8B 1DEKA 1M45A 1NX3A 1B47A 4PE0A 1X02A 1S3PA 3V2LA 1WRZA 5BPJA 1DJGA 1AUIB 1WRLA 4GGFC 1QVIY 3Q8IA 2TN4A 1Y0VH 1BT6A 1ZFSA 2JU0A 4USLA 2ZN8A 3CTNA 1OOHA 4DUQA 3S0FA 4AOMA 1LS8A 1CNPA 1A2XA 1BJFA 5I8NA 3FIAA 1ZMZA 2LE9B 1AVSA 1B4CA 1OSAA 3UNWA 3BUNB 3AKBA 1DJWA 4P2YB 1QATA 1MQ1A 4MZKA 3L4AA 4GUKA 1DJHA 3EVVA 3BUMB 1IQ3A 2KI4C 1ALVA 1IRJA 2LUXA 3HX4A 1CMGA 1XVJA 3EVRA 1U5IA 1UWOA 3EK4A 3SJSA 1CLBA 1RFJA 2KFFA 2JOJA 2MLEC 1DGUA 1YUTA 2M1KB 4M2OA 2EC6B 4CPVA 5HKWA 3IQOA 4YGBB 1RECA 4F0ZB 3ZWHA 1F4QA 2I94A 2LP2A 1Y1AA 1H8BA 3PJIA 4HRGA 4OZDA 4YBHB 3BFAA 1YRUB 1NCXA 2JZIA 1BG1A 3SS4A 1TWOA 1SPYA 1AHRA 1C3ZA 2EHBA 3VGOA 3F45A 1PALA 1RK9A 1XYDA 2L4HA 1TRFA 3S0BA 3K21A 2L5YA 3R1OA 1AP4A 3OP0A 4FTGA 5D3OA 3DF0B 3RLZA 1DVIA 3D0YB 3KF9A 4YGCB 3SIAA 1LXFC 3I5IC 5CPVA 4WQ3A 1OE9B 3B6XA 2DOQA 2I2RE 1SK6D 1K2HA 2ZRTA 3SG7A 1OZSA 1J1DA 3LK1A 2GV5A 1DF0B 3NSKA 4I5KA 3GOFA 4Q04A 1J55A 1MWNA 4AQJA 1GM0A 4MN0A 5JOLA 2JWWA 1JUOA 2KQYA 4QJ4B 4PHMA 1QV0A 2JULA 1QASA 3CR2A 3DD4A 1S5GZ 3SS3A 3SG5A 3R1PA 4U8DA 4I5LB 2PMYA 4YI9A 2KSPA 2M1UA 2KHNA 3OHMB 3R72A 5HLOA 1TUJA 1CDLA 2F8PA 2WNDA 1OOFA 2KYFA 4D1EA 4MRXA 1MUXA 4YGAA 3GK1A 3WXAA 1NX1A 2F3YA 1KK8C 2CXJA 2K7DA 2QEVA 2JT0A 1KSOA 1XFZO 3CS1A 2KDHA 1CKKA 1GGWA 2G9BA 3D10A 1G8IA 4NDDA 1GQMA 1TNWA 1AK8A 1F70A 2BCXA 3CZTX 3BYAA 2MBXA 1IWQA 1W9ZA 2M7LA 4M2PA 4P5OE 2H61C 3BOWB 5AERA 3I5FC 2BCAA 1C7VA 2HQ8A 1A75B 1MR8A 3I5HB 1EH2A 4I5JA 4MRYA 4YI8A 1YUSA 1CLLA 3CGAA 4XJKA 2QEBA 3FE6A 1PSRA 4FQTA 3EKJA 4TNCA 4BY4A 1K93D 1C3YA 2HQWA 2WCHA 2K61A 1FI5A 3FE9A 3JVTC 1UUSA 1TNXA 2FCDA 1NCZA 3R1VA 2JTTA 1A4PA 3DVMA 1PVBA 2GTEA 2K2FA 1IH0A 4MBEA 3CZ1A 3DYEA 3BJHA 1FW4A 3TUYB 5HYDA 5KTYA 1SSEB 4MZLA 1NWDA 1GGZA 2OS8C 5I94A 2HF5A 3D75A 1M46A 3DY9A 1L7ZA 1S5GY 2M3WA 5PALA 3OBVA 1RTP1 1N2DA 2GGZA 1SMGA 2WCMA 1WDCC 2D8NA 1DT7B 1JWDA 2MLFC 2L51A 2NXQA 1F4OA 2KI4B 1ZACA 1XK4C 1OMDA 2PVBA 1Z2CB 2ZNEA 3IF7A 1B8LA 1M39A 1MXEA 2Y4QA 3SIBA 1XFVO 1PVAA 3D78A 2PSRA 3B7AA 1Y1UA 1JFKA 3C1VA 5HKYA 5DICA 1K9UA 2BKHB 1K90D 1TCOB 1J7QA 1TNQA 4PHJA 2AUCA 4DS7A 3RM1A 4OKHA 1KFXL 1YX8A 1NIWA 3EK8A 1NUBA 4L9MA 3TUYC 4QJ3B 2KQ6A 5CSNA 5J3XA 1WLMA 2K60A 1K95A 1XFRA 3S0EA 3UO9A 1KQVA 2KI6C 1YX7A 3D73A 1F8HA 2BBMA 1KSMA 5F6TA 4N1FA 3DVKA 2HETA 2ERBA 3OX5A 2BE4A 1A03A 3WNXB 2O5GA 2JRFA 1CDMA 2LMVA 3I5IB 2P6BB 2FOTA 1WY9A 3DVEA 4ETOA 1WRKA 3EKHA 3D76A 3KPXA 3O2PA 2BECA 1U5IB 1FF1A 3CR5X 5I2OA 1UHJA 1IG5A 3I5GC 1S36A 2WCBA 2NLNA 3QMEA 5FYXA 3PATA 2CTNA 3OGNA 5I2QA 1XFXO 2LVKA 2M9GA 2HPSA 4IJ7A 1EL4A 1XFYO 2M97A 3PN7C 3BUWB 5AEQA 3KO0A 1KWOB
chains in the Genus database with same CATH topology
2WOSA 4OCIA 1V1FA 2LV7A 2OTGC 1SKTA 4BY5A 1SCMC 2KBMA 1SR6B 2JT8A 2WORA 1EG4A 3VRRA 1SRAA 1ZOTB 1CDPA 1Y6WA 1BF5A 1LA3A 1NCYA 4A4CA 1JFJA 4DRWA 3ZNIA 5AXIA 1KK8B 1ODBA 1B8RA 1ZUZA 2JTZA 4ICBA 2GGMA 4C0JA 1JC2A 1S26D 2NCPA 1BOCA 2L4IA 3OB2B 2SCPA 2E30A 2LNKA 4IL1A 2F2PA 4MVFA 2NCOA 1YVHA 4R1EA 1W7JB 1CFFA 3TDZA 3I5FB 2LLTA 1DGVA 2LP3A 4DCKA 1N65A 3VRQA 1LVCD 2L98A 2K7BA 1KWOC 4GBAA 2O60A 1OMRA 4WQ2A 1IKUA 1L2OB 2M7NA 1QTXA 2K2AA 2LANA 2NZ0A 3ICBA 1SR6C 1A29A 2LLSA 1UHNA 2M29A 1PSBA 4YGDB 1N0YA 3JTDB 1M63B 1TN4A 3JVTB 3O78A 4PHKA 1SL9A 1KK7Y 1DF0A 4N5XA 4MSPA 4ORCB 2LVVA 4PDZA 2K0JA 3BUOB 2CT9A 3PALA 4N1GA 1OOJA 1H4BA 5D7FA 1CTRA 2LVIA 2OS8B 2KI6D 1CMFA 1G33A 3PM8A 1Q80A 1PRWA 1D1OA 4YRUA 2JQ6A 1K9KA 2F33A 5IBWA 2M8UA 1WDCB 4M2QA 3BQ3A 2AMIA 5B8IB 3H4SE 4JWQA 1TOPA 1LKJA 1QIVA 3TS5C 1BR1B 1L2OC 1TTXA 4E68A 1EXRA 4XJKB 1K9PA 2B1UA 1JF2A 2JNXA 2KOTA 1AJ4A 1TNPA 3JTDC 2L0PA 5D69A 2KYCA 1B8CA 2JT3A 3LK0A 1RJVA 4JPZB 2MRDA 5AFPA 1OQPA 2KFGA 1M31A 3EK7A 1QLSA 1KCYA 1IJ5A 1SNLA 4NDBA 5K89A 2AAOA 2PASA 3GK2A 1NYAA 5DKRA 5ER4X 4UPGA 1C07A 3EVUA 2Y1NA 3CWGA 2A4JA 1EJ3A 1DTLA 3KEVA 2KAYA 3SG2A 1RWYA 3FWCA 5CSJA 5DKQA 3VROA 2M0RA 2BL0B 3NSIA 1J7PA 1DMOA 1DJYA 4MLWA 2LLUA 2R2IA 3I5GB 1IGVA 1SL7A 2L5XB 1CM1A 4GFTA 4CLNA 4PE1A 3SG6A 2JNFA 1QXPA 2ZN9A 3TDIA 1DJZA 1LINA 3MSEB 3WHUB 3PN7B 2H2KA 5CSFA 2MHHA 3QRXA 2M49B 1SL8A 1CLMA 1SW8A 1IQ5A 1BODA 2F3ZA 4JQ0D 4WRIA 2OTGB 5ER5A 1QX5B 3VRPA 2LHIA 1JBAA 1SCMB 1W7IB 2EGDA 2V53A 4GAOA 5HKZA 5AANA 2OPOA 2MJWB 4OVNF 1S6CA 1UHKA 4HRHA 3OX6A 2JC2A 3IQQA 4ZCUA 1FPWA 2BL0C 4NDCA 1EG3A 2SASA 1K96A 5TNCA 2CBLA 1LA0A 1WLZA 5CSIA 1QLKA 2KBIA 2KGBC 1KK7Z 3AAJA 1F55A 1KFXS 2WC8A 2FCEA 3AAKA 3NXAA 2I18A 1CFDA 2KNEA 2KFHA 1BMOA 1KQMC 1HT9A 1SBJA 1V1GA 1YURA 2JXCA 1NSHA 1GJYA 1R2UA 1SYMA 2ZNDA 1UHHA 2BE6A 3FS7A 2BCBA 1S1EA 2JXLA 2LAPA 1QX2A 2E6WA 2PALA 3E3RA 3NSOA 1DJXA 1K8UA 1XFUO 3KHEA 2ISDA 4ORBB 1CFPA 4I5NB 3CLNA 1OZOA 3BUXB 1YRTB 1J1EA 3DF0A 4HREE 2LC5A 2RGIA 3TS5B 3D0YA 1SCVA 1RROA 1QV1A 2ZKMX 3DVJA 2I7AA 1E8AA 4GPLB 1B7TZ 1XA5A 1KFUL 4GGNA 1QIWA 2K8MB 4A4BA 3BXKA 4C0LA 3A4UB 4C0KA 1UHIA 2Q91A 2F2OA 1Y1XA 1CB1A 1YUUA 1PK0D 1UURA 4PE7A 2EC6C 4ZCVA 5KSZA 1R6PA 2COLB 2H61A 1CDNA 1FI6A 5HLVA 1MHOA 1G4YR 1OMVA 4GNKB 1CFCA 1QX7A 1BU3A 4OV2A 3LCPC 2LCPA 3LL8B 1C7WA 5DKNA 1NP8A 3CR4X 2Q4UA 1J7RA 2QPTA 1CM4A 4OR9B 1TCFA 2LMTA 1MXLC 2MA2A 1SY9A 1NX2A 4MEWA 4NQGA 1XFWO 2WCEA 4HSZA 2K7OA 4CFQA 1UP5A 3LLEA 4PE4A 5I2LA 2ZRSA 1K94A 1KFUS 1YVLA 1FBVA 2VRGA 3HCMA 4ORAB 1HQVA 4XYNA 5G08A 3O6BA 1ALWA 3BOWA 3TZ1A 1S6JA 2KAVA 2LM5A 1JF0A 1IJ6A 1QJTA 1QVIZ 1A75A 1S6IA 1YR5A 1F54A 1XO5A 1XK4A 2CNPA 4PCWA 1NX0A 5GQQC 2KAXA 1TIZA 2WCFA 1B7TY 5JJGA 2IS9A 2BKIB 2L50A 3AKAA 4DIRA 1J7OA 3O4YA 3OB1B 1NPQA 3M0WA 1VRKA 5KU1A 4YGEB 2LVJA 2JPTA 4GGFA 2G2BA 2KGRA 2BBNA 2FJUB 2QACA 1F71A 1JSAA 1QS7A 3PFVA 1YTZC 4CIDA 4PALA 4CFRA 3FWBA 3GK4X 2LMUA 3SG3A 3PSRA 3PLFB 1BR4B 1BLQA 2CCMA 3NSLA 4AQIA 1KQMB 1PULA 4FQOA 1B1GA 2ZFDA 3A8RA 2LHLA 2K7CA 3I5HC 2Y1MA 2PRUA 2Y5IA 2MAZA 4MZJA 1B9AA 3SG4A 3TDUA 1AJ5A 3VRNA 4PHNA 3WHTB 2L2EA 1DJIA 2LUCA 4QJ5B 1MF8B 1M45A 1NX3A 1B47A 4PE0A 1X02A 1S3PA 1WRZA 5BPJA 1DJGA 1AUIB 1WRLA 4GGFC 1QVIY 2TN4A 1Y0VH 1BT6A 1ZFSA 2JU0A 4USLA 2ZN8A 3CTNA 4DUQA 4AOMA 1CNPA 1A2XA 1BJFA 5I8NA 3FIAA 1ZMZA 2LE9B 1AVSA 1B4CA 1OSAA 3BUNB 3AKBA 1DJWA 4P2YB 1QATA 1MQ1A 4MZKA 4GUKA 1DJHA 3EVVA 3BUMB 1IQ3A 2KI4C 1ALVA 1IRJA 2LUXA 3HX4A 1CMGA 1XVJA 3EVRA 1U5IA 1UWOA 3EK4A 3SJSA 1CLBA 1RFJA 2KFFA 2JOJA 2MLEC 1DGUA 1YUTA 2M1KB 4M2OA 2EC6B 4CPVA 5HKWA 3IQOA 4YGBB 1RECA 4F0ZB 3ZWHA 1F4QA 2I94A 2LP2A 1Y1AA 1H8BA 4HRGA 4YBHB 1YRUB 1NCXA 2JZIA 1BG1A 1SPYA 1AHRA 2EHBA 3VGOA 3F45A 1PALA 1RK9A 1XYDA 2L4HA 1TRFA 3K21A 1AP4A 3OP0A 4FTGA 3RLZA 3DF0B 1DVIA 3D0YB 3KF9A 4YGCB 3SIAA 1LXFC 3I5IC 5CPVA 4WQ3A 1OE9B 2DOQA 2I2RE 1SK6D 1K2HA 2ZRTA 3SG7A 1OZSA 1J1DA 3LK1A 2GV5A 1DF0B 3NSKA 4I5KA 3GOFA 4Q04A 1J55A 1MWNA 4AQJA 4MN0A 5JOLA 2JWWA 1JUOA 2KQYA 4QJ4B 4PHMA 1QV0A 2JULA 1QASA 3CR2A 3DD4A 1S5GZ 3SG5A 4U8DA 4I5LB 2PMYA 4YI9A 2KSPA 2M1UA 2KHNA 3OHMB 5HLOA 1CDLA 2F8PA 2WNDA 2KYFA 4D1EA 4MRXA 1MUXA 4YGAA 3GK1A 3WXAA 1NX1A 2F3YA 1KK8C 2CXJA 2K7DA 1A03A 2JT0A 1KSOA 1XFZO 3CS1A 2KDHA 1CKKA 1GGWA 2G9BA 3D10A 1G8IA 4NDDA 1GQMA 1TNWA 1AK8A 1F70A 2BCXA 3CZTX 3BYAA 2MBXA 1IWQA 2M7LA 4M2PA 4P5OE 2H61C 3BOWB 5AERA 3I5FC 2BCAA 1C7VA 2HQ8A 1A75B 1MR8A 3I5HB 1EH2A 4I5JA 4MRYA 4YI8A 1YUSA 1CLLA 3CGAA 4XJKA 1PSRA 4BY4A 3EKJA 4TNCA 1K93D 2HQWA 2K61A 1FI5A 3JVTC 1UUSA 1TNXA 2FCDA 1NCZA 2JTTA 1A4PA 3DVMA 1PVBA 2K2FA 1IH0A 4MBEA 1FW4A 3TUYB 5HYDA 5KTYA 4MZLA 1NWDA 1GGZA 2OS8C 2HF5A 1M46A 1L7ZA 1S5GY 2M3WA 5PALA 1RTP1 1N2DA 2GGZA 1SMGA 1WDCC 2D8NA 1DT7B 1JWDA 2MLFC 2L51A 2NXQA 1F4OA 2KI4B 1ZACA 1XK4C 1OMDA 2PVBA 2ZNEA 3IF7A 1B8LA 1M39A 1MXEA 2Y4QA 3SIBA 1XFVO 1PVAA 2PSRA 1Y1UA 1JFKA 3C1VA 5HKYA 1K9UA 2BKHB 1K90D 1TCOB 1J7QA 1TNQA 4PHJA 2AUCA 4DS7A 3RM1A 4OKHA 1KFXL 1YX8A 1NIWA 3EK8A 1NUBA 4L9MA 3TUYC 4QJ3B 2KQ6A 5CSNA 5J3XA 1WLMA 1K95A 1KQVA 2KI6C 1YX7A 1F8HA 2BBMA 1KSMA 5F6TA 4N1FA 3DVKA 2HETA 3OX5A 2BE4A 3WNXB 2O5GA 2JRFA 1CDMA 2LMVA 3I5IB 2P6BB 2FOTA 1WY9A 3DVEA 4ETOA 1WRKA 3EKHA 3KPXA 3O2PA 2BECA 1U5IB 1FF1A 3CR5X 5I2OA 1UHJA 1IG5A 3I5GC 1S36A 2WCBA 2NLNA 5FYXA 3PATA 2CTNA 5I2QA 1XFXO 2LVKA 2M9GA 2HPSA 1EL4A 1XFYO 2M97A 3PN7C 3BUWB 5AEQA 3KO0A 1KWOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WOS A;  4OCI A;  1V1F A;  2LV7 A;  2OTG C;  1SKT A;  4BY5 A;  1SCM C;  2KBM A;  1SR6 B;  2JT8 A;  2WOR A;  1EG4 A;  3VRR A;  1SRA A;  1ZOT B;  1CDP A;  1Y6W A;  1BF5 A;  1LA3 A;  1NCY A;  4A4C A;  1JFJ A;  4DRW A;  3ZNI A;  5AXI A;  1KK8 B;  1ODB A;  1B8R A;  1ZUZ A;  2JTZ A;  4ICB A;  2GGM A;  4C0J A;  1JC2 A;  1S26 D;  2NCP A;  1BOC A;  2L4I A;  3OB2 B;  2SCP A;  2E30 A;  2LNK A;  4IL1 A;  2F2P A;  4MVF A;  2NCO A;  1YVH A;  4R1E A;  1W7J B;  1CFF A;  3TDZ A;  3I5F B;  2LLT A;  1DGV A;  2LP3 A;  4DCK A;  1N65 A;  3VRQ A;  1LVC D;  2L98 A;  2K7B A;  1KWO C;  4GBA A;  2O60 A;  1OMR A;  4WQ2 A;  1IKU A;  1L2O B;  2M7N A;  1QTX A;  2K2A A;  2LAN A;  2NZ0 A;  3ICB A;  1SR6 C;  1A29 A;  2LLS A;  1UHN A;  2M29 A;  1PSB A;  4YGD B;  1N0Y A;  3JTD B;  1M63 B;  1TN4 A;  3JVT B;  3O78 A;  4PHK A;  1SL9 A;  1KK7 Y;  1DF0 A;  4N5X A;  4MSP A;  4ORC B;  2LVV A;  4PDZ A;  2K0J A;  3BUO B;  2CT9 A;  3PAL A;  4N1G A;  1OOJ A;  1H4B A;  5D7F A;  1CTR A;  2LVI A;  2OS8 B;  2KI6 D;  1CMF A;  1G33 A;  3PM8 A;  1Q80 A;  1PRW A;  1D1O A;  4YRU A;  2JQ6 A;  1K9K A;  2F33 A;  5IBW A;  2M8U A;  1WDC B;  4M2Q A;  3BQ3 A;  2AMI A;  5B8I B;  3H4S E;  4JWQ A;  1TOP A;  1LKJ A;  1QIV A;  3TS5 C;  1BR1 B;  1L2O C;  1TTX A;  4E68 A;  1EXR A;  4XJK B;  1K9P A;  2B1U A;  1JF2 A;  2JNX A;  2KOT A;  1AJ4 A;  1TNP A;  3JTD C;  2L0P A;  5D69 A;  2KYC A;  1B8C A;  2JT3 A;  3LK0 A;  1RJV A;  4JPZ B;  2MRD A;  5AFP A;  1OQP A;  2KFG A;  1M31 A;  3EK7 A;  1QLS A;  1KCY A;  1IJ5 A;  1SNL A;  4NDB A;  5K89 A;  2AAO A;  2PAS A;  3GK2 A;  1NYA A;  5DKR A;  5ER4 X;  4UPG A;  1C07 A;  3EVU A;  2Y1N A;  3CWG A;  2A4J A;  1EJ3 A;  1DTL A;  3KEV A;  2KAY A;  3SG2 A;  1RWY A;  3FWC A;  5CSJ A;  5DKQ A;  3VRO A;  2M0R A;  2BL0 B;  3NSI A;  1J7P A;  1DMO A;  1DJY A;  4MLW A;  2LLU A;  2R2I A;  3I5G B;  1IGV A;  1SL7 A;  2L5X B;  1CM1 A;  4GFT A;  4CLN A;  4PE1 A;  3SG6 A;  2JNF A;  1QXP A;  2ZN9 A;  3TDI A;  1DJZ A;  1LIN A;  3MSE B;  3WHU B;  3PN7 B;  2H2K A;  5CSF A;  2MHH A;  3QRX A;  2M49 B;  1SL8 A;  1CLM A;  1SW8 A;  1IQ5 A;  1BOD A;  2F3Z A;  4JQ0 D;  4WRI A;  2OTG B;  5ER5 A;  1QX5 B;  3VRP A;  2LHI A;  1JBA A;  1SCM B;  1W7I B;  2EGD A;  2V53 A;  4GAO A;  5HKZ A;  5AAN A;  2OPO A;  2MJW B;  4OVN F;  1S6C A;  1UHK A;  4HRH A;  3OX6 A;  2JC2 A;  3IQQ A;  4ZCU A;  1FPW A;  2BL0 C;  4NDC A;  1EG3 A;  2SAS A;  1K96 A;  5TNC A;  2CBL A;  1LA0 A;  1WLZ A;  5CSI A;  1QLK A;  2KBI A;  2KGB C;  1KK7 Z;  3AAJ A;  1F55 A;  1KFX S;  2WC8 A;  2FCE A;  3AAK A;  3NXA A;  2I18 A;  1CFD A;  2KNE A;  2KFH A;  1BMO A;  1KQM C;  1HT9 A;  1SBJ A;  1V1G A;  1YUR A;  2JXC A;  1NSH A;  1GJY A;  1R2U A;  1SYM A;  2ZND A;  1UHH A;  2BE6 A;  3FS7 A;  2BCB A;  1S1E A;  2JXL A;  2LAP A;  1QX2 A;  2E6W A;  2PAL A;  3E3R A;  3NSO A;  1DJX A;  1K8U A;  1XFU O;  3KHE A;  2ISD A;  4ORB B;  1CFP A;  4I5N B;  3CLN A;  1OZO A;  3BUX B;  1YRT B;  1J1E A;  3DF0 A;  4HRE E;  2LC5 A;  2RGI A;  3TS5 B;  3D0Y A;  1SCV A;  1RRO A;  1QV1 A;  2ZKM X;  3DVJ A;  2I7A A;  1E8A A;  4GPL B;  1B7T Z;  1XA5 A;  1KFU L;  4GGN A;  1QIW A;  2K8M B;  4A4B A;  3BXK A;  4C0L A;  3A4U B;  4C0K A;  1UHI A;  2Q91 A;  2F2O A;  1Y1X A;  1CB1 A;  1YUU A;  1PK0 D;  1UUR A;  4PE7 A;  2EC6 C;  4ZCV A;  5KSZ A;  1R6P A;  2COL B;  2H61 A;  1CDN A;  1FI6 A;  5HLV A;  1MHO A;  1G4Y R;  1OMV A;  4GNK B;  1CFC A;  1QX7 A;  1BU3 A;  4OV2 A;  3LCP C;  2LCP A;  3LL8 B;  1C7W A;  5DKN A;  1NP8 A;  3CR4 X;  2Q4U A;  1J7R A;  2QPT A;  1CM4 A;  4OR9 B;  1TCF A;  2LMT A;  1MXL C;  2MA2 A;  1SY9 A;  1NX2 A;  4MEW A;  4NQG A;  1XFW O;  2WCE A;  4HSZ A;  2K7O A;  4CFQ A;  1UP5 A;  3LLE A;  4PE4 A;  5I2L A;  2ZRS A;  1K94 A;  1KFU S;  1YVL A;  1FBV A;  2VRG A;  3HCM A;  4ORA B;  1HQV A;  4XYN A;  5G08 A;  3O6B A;  1ALW A;  3BOW A;  3TZ1 A;  1S6J A;  2KAV A;  2LM5 A;  1JF0 A;  1IJ6 A;  1QJT A;  1QVI Z;  1A75 A;  1S6I A;  1YR5 A;  1F54 A;  1XO5 A;  1XK4 A;  2CNP A;  4PCW A;  1NX0 A;  5GQQ C;  2KAX A;  1TIZ A;  2WCF A;  1B7T Y;  5JJG A;  2IS9 A;  2BKI B;  2L50 A;  3AKA A;  4DIR A;  1J7O A;  3O4Y A;  3OB1 B;  1NPQ A;  3M0W A;  1VRK A;  5KU1 A;  4YGE B;  2LVJ A;  2JPT A;  4GGF A;  2G2B A;  2KGR A;  2BBN A;  2FJU B;  2QAC A;  1F71 A;  1JSA A;  1QS7 A;  3PFV A;  1YTZ C;  4CID A;  4PAL A;  4CFR A;  3FWB A;  3GK4 X;  2LMU A;  3SG3 A;  3PSR A;  3PLF B;  1BR4 B;  1BLQ A;  2CCM A;  3NSL A;  4AQI A;  1KQM B;  1PUL A;  4FQO A;  1B1G A;  2ZFD A;  3A8R A;  2LHL A;  2K7C A;  3I5H C;  2Y1M A;  2PRU A;  2Y5I A;  2MAZ A;  4MZJ A;  1B9A A;  3SG4 A;  3TDU A;  1AJ5 A;  3VRN A;  4PHN A;  3WHT B;  2L2E A;  1DJI A;  2LUC A;  4QJ5 B;  1MF8 B;  1M45 A;  1NX3 A;  1B47 A;  4PE0 A;  1X02 A;  1S3P A;  1WRZ A;  5BPJ A;  1DJG A;  1AUI B;  1WRL A;  4GGF C;  1QVI Y;  2TN4 A;  1Y0V H;  1BT6 A;  1ZFS A;  2JU0 A;  4USL A;  2ZN8 A;  3CTN A;  4DUQ A;  4AOM A;  1CNP A;  1A2X A;  1BJF A;  5I8N A;  3FIA A;  1ZMZ A;  2LE9 B;  1AVS A;  1B4C A;  1OSA A;  3BUN B;  3AKB A;  1DJW A;  4P2Y B;  1QAT A;  1MQ1 A;  4MZK A;  4GUK A;  1DJH A;  3EVV A;  3BUM B;  1IQ3 A;  2KI4 C;  1ALV A;  1IRJ A;  2LUX A;  3HX4 A;  1CMG A;  1XVJ A;  3EVR A;  1U5I A;  1UWO A;  3EK4 A;  3SJS A;  1CLB A;  1RFJ A;  2KFF A;  2JOJ A;  2MLE C;  1DGU A;  1YUT A;  2M1K B;  4M2O A;  2EC6 B;  4CPV A;  5HKW A;  3IQO A;  4YGB B;  1REC A;  4F0Z B;  3ZWH A;  1F4Q A;  2I94 A;  2LP2 A;  1Y1A A;  1H8B A;  4HRG A;  4YBH B;  1YRU B;  1NCX A;  2JZI A;  1BG1 A;  1SPY A;  1AHR A;  2EHB A;  3VGO A;  3F45 A;  1PAL A;  1RK9 A;  1XYD A;  2L4H A;  1TRF A;  3K21 A;  1AP4 A;  3OP0 A;  4FTG A;  3RLZ A;  3DF0 B;  1DVI A;  3D0Y B;  3KF9 A;  4YGC B;  3SIA A;  1LXF C;  3I5I C;  5CPV A;  4WQ3 A;  1OE9 B;  2DOQ A;  2I2R E;  1SK6 D;  1K2H A;  2ZRT A;  3SG7 A;  1OZS A;  1J1D A;  3LK1 A;  2GV5 A;  1DF0 B;  3NSK A;  4I5K A;  3GOF A;  4Q04 A;  1J55 A;  1MWN A;  4AQJ A;  4MN0 A;  5JOL A;  2JWW A;  1JUO A;  2KQY A;  4QJ4 B;  4PHM A;  1QV0 A;  2JUL A;  1QAS A;  3CR2 A;  3DD4 A;  1S5G Z;  3SG5 A;  4U8D A;  4I5L B;  2PMY A;  4YI9 A;  2KSP A;  2M1U A;  2KHN A;  3OHM B;  5HLO A;  1CDL A;  2F8P A;  2WND A;  2KYF A;  4D1E A;  4MRX A;  1MUX A;  4YGA A;  3GK1 A;  3WXA A;  1NX1 A;  2F3Y A;  1KK8 C;  2CXJ A;  2K7D A;  1A03 A;  2JT0 A;  1KSO A;  1XFZ O;  3CS1 A;  2KDH A;  1CKK A;  1GGW A;  2G9B A;  3D10 A;  1G8I A;  4NDD A;  1GQM A;  1TNW A;  1AK8 A;  1F70 A;  2BCX A;  3CZT X;  3BYA A;  2MBX A;  1IWQ A;  2M7L A;  4M2P A;  4P5O E;  2H61 C;  3BOW B;  5AER A;  3I5F C;  2BCA A;  1C7V A;  2HQ8 A;  1A75 B;  1MR8 A;  3I5H B;  1EH2 A;  4I5J A;  4MRY A;  4YI8 A;  1YUS A;  1CLL A;  3CGA A;  4XJK A;  1PSR A;  4BY4 A;  3EKJ A;  4TNC A;  1K93 D;  2HQW A;  2K61 A;  1FI5 A;  3JVT C;  1UUS A;  1TNX A;  2FCD A;  1NCZ A;  2JTT A;  1A4P A;  3DVM A;  1PVB A;  2K2F A;  1IH0 A;  4MBE A;  1FW4 A;  3TUY B;  5HYD A;  5KTY A;  4MZL A;  1NWD A;  1GGZ A;  2OS8 C;  2HF5 A;  1M46 A;  1L7Z A;  1S5G Y;  2M3W A;  5PAL A;  1RTP 1;  1N2D A;  2GGZ A;  1SMG A;  1WDC C;  2D8N A;  1DT7 B;  1JWD A;  2MLF C;  2L51 A;  2NXQ A;  1F4O A;  2KI4 B;  1ZAC A;  1XK4 C;  1OMD A;  2PVB A;  2ZNE A;  3IF7 A;  1B8L A;  1M39 A;  1MXE A;  2Y4Q A;  3SIB A;  1XFV O;  1PVA A;  2PSR A;  1Y1U A;  1JFK A;  3C1V A;  5HKY A;  1K9U A;  2BKH B;  1K90 D;  1TCO B;  1J7Q A;  1TNQ A;  4PHJ A;  2AUC A;  4DS7 A;  3RM1 A;  4OKH A;  1KFX L;  1YX8 A;  1NIW A;  3EK8 A;  1NUB A;  4L9M A;  3TUY C;  4QJ3 B;  2KQ6 A;  5CSN A;  5J3X A;  1WLM A;  1K95 A;  1KQV A;  2KI6 C;  1YX7 A;  1F8H A;  2BBM A;  1KSM A;  5F6T A;  4N1F A;  3DVK A;  2HET A;  3OX5 A;  2BE4 A;  3WNX B;  2O5G A;  2JRF A;  1CDM A;  2LMV A;  3I5I B;  2P6B B;  2FOT A;  1WY9 A;  3DVE A;  4ETO A;  1WRK A;  3EKH A;  3KPX A;  3O2P A;  2BEC A;  1U5I B;  1FF1 A;  3CR5 X;  5I2O A;  1UHJ A;  1IG5 A;  3I5G C;  1S36 A;  2WCB A;  2NLN A;  5FYX A;  3PAT A;  2CTN A;  5I2Q A;  1XFX O;  2LVK A;  2M9G A;  2HPS A;  1EL4 A;  1XFY O;  2M97 A;  3PN7 C;  3BUW B;  5AEQ A;  3KO0 A;  1KWO B; 
#chains in the Genus database with same CATH topology
 2WOS A;  4OCI A;  3S0D A;  1V1F A;  2LV7 A;  2OTG C;  5FI6 A;  1SKT A;  1ORG A;  4BY5 A;  1SCM C;  2KBM A;  1SR6 B;  2JT8 A;  3VB1 A;  2WOR A;  1EG4 A;  3VRR A;  1SRA A;  1ZOT B;  1CDP A;  4INW A;  1Y6W A;  4PT1 A;  1LA3 A;  1NCY A;  4A4C A;  1BF5 A;  1JFJ A;  4DRW A;  3ZNI A;  2WC5 A;  5AXI A;  1KK8 B;  1ODB A;  1B8R A;  1ZUZ A;  2JTZ A;  4ICB A;  2GGM A;  4C0J A;  1JC2 A;  2QEO A;  1S26 D;  3EG5 B;  2NCP A;  1BOC A;  2L4I A;  3OB2 B;  2SCP A;  2E30 A;  2LNK A;  1QWV A;  4IL1 A;  2F2P A;  4MVF A;  2NCO A;  1YVH A;  4R1E A;  1W7J B;  1CFF A;  3TDZ A;  3I5F B;  2LLT A;  1DGV A;  2LP3 A;  4DCK A;  1N65 A;  3VRQ A;  1LVC D;  2L98 A;  2K7B A;  1KWO C;  4GBA A;  2O60 A;  1OMR A;  2WCJ A;  4WQ2 A;  1L2O B;  1IKU A;  2M7N A;  1QTX A;  2K2A A;  2LAN A;  2NZ0 A;  3ICB A;  1SR6 C;  1A29 A;  2LLS A;  1UHN A;  2M29 A;  3PM2 A;  1PSB A;  4YGD B;  3D77 A;  1N0Y A;  5EL2 A;  3JTD B;  1M63 B;  1TN4 A;  3JVT B;  3O78 A;  4PHK A;  1SL9 A;  1KK7 Y;  1DF0 A;  4N5X A;  4MSP A;  4ORC B;  2LVV A;  4PDZ A;  2K0J A;  3BUO B;  2CT9 A;  3PAL A;  4N1G A;  1OOJ A;  1H4B A;  5D7F A;  1CTR A;  2LVI A;  2OS8 B;  2KI6 D;  1CMF A;  1G33 A;  3PM8 A;  1Q80 A;  1PRW A;  2FJY A;  1D1O A;  1OOG A;  2JQ6 A;  1K9K A;  2P70 A;  2F33 A;  4YRU A;  5IBW A;  2M8U A;  1WDC B;  4M2Q A;  3BQ3 A;  2AMI A;  5B8I B;  3H4S E;  4JWQ A;  1TOP A;  4KYN A;  1LKJ A;  1QIV A;  3TS5 C;  1BR1 B;  1L2O C;  1TTX A;  2P71 A;  4E68 A;  1EXR A;  4XJK B;  1K9P A;  2B1U A;  1JF2 A;  3NGV A;  2JNX A;  2KOT A;  1AJ4 A;  1P28 A;  1TNP A;  3JTD C;  2L0P A;  5D69 A;  2KYC A;  3SS5 A;  1B8C A;  2JT3 A;  3LK0 A;  1RJV A;  2YGU A;  4JPZ B;  2MRD A;  5AFP A;  1OQP A;  2L2C A;  2KFG A;  2KLD A;  2BAP A;  1M31 A;  3CZ0 A;  3EK7 A;  1QLS A;  1T14 A;  1KCY A;  1IJ5 A;  1SNL A;  4NDB A;  5K89 A;  2AAO A;  2PAS A;  3B86 A;  3GK2 A;  1NYA A;  3BFB A;  5DKR A;  2BNX A;  5ER4 X;  4UPG A;  1C07 A;  3EVU A;  2Y1N A;  3CWG A;  2A4J A;  1EJ3 A;  1DTL A;  3KEV A;  2KAY A;  3SG2 A;  1RWY A;  3FWC A;  5CSJ A;  5DKQ A;  3VRO A;  2M0R A;  2BL0 B;  3NSI A;  1J7P A;  1DMO A;  1DJY A;  3K1E A;  4MLW A;  2LLU A;  2R2I A;  3I5G B;  1IGV A;  1SL7 A;  2L5X B;  1CM1 A;  3L4L A;  4GFT A;  4CLN A;  4PE1 A;  3SG6 A;  2JNF A;  1QXP A;  2ZN9 A;  3TDI A;  1DJZ A;  1LIN A;  3MSE B;  3WHU B;  3S0A A;  3PN7 B;  2H2K A;  5CSF A;  2MHH A;  3QRX A;  2M49 B;  1SL8 A;  4F7F A;  1CLM A;  1SW8 A;  1IQ5 A;  4INX A;  1BOD A;  2F3Z A;  4JQ0 D;  4WRI A;  2OTG B;  5ER5 A;  1QX5 B;  3VRP A;  2LHI A;  1JBA A;  1SCM B;  1W7I B;  2EGD A;  2V53 A;  4GAO A;  5HKZ A;  5AAN A;  2OPO A;  2MJW B;  4OVN F;  1S6C A;  1UHK A;  4HRH A;  3OX6 A;  2JC2 A;  3IQQ A;  4ZCU A;  1FPW A;  2BL0 C;  4NDC A;  1EG3 A;  1OW4 A;  2SAS A;  1K96 A;  5TNC A;  2CBL A;  1LA0 A;  1WLZ A;  5CSI A;  1QLK A;  2KBI A;  2KGB C;  1KK7 Z;  3AAJ A;  1F55 A;  1OOI X;  1KFX S;  4JKT A;  2WC8 A;  2FCE A;  3AAK A;  3NXA A;  3D74 A;  2I18 A;  1CFD A;  2KNE A;  2QDI A;  2KFH A;  1BMO A;  1KQM C;  1HT9 A;  1SBJ A;  1V1G A;  1YUR A;  2JXC A;  5FI2 A;  1NSH A;  1GJY A;  3CAB A;  1R2U A;  1SYM A;  2ZND A;  1UHH A;  2BE6 A;  3FS7 A;  1S1E A;  2BCB A;  2JXL A;  2LAP A;  1QX2 A;  2E6W A;  2PAL A;  3E3R A;  3BFH A;  3NSO A;  1DJX A;  1K8U A;  1XFU O;  3NHI A;  3KHE A;  2ISD A;  2PYQ A;  4ORB B;  1CFP A;  4I5N B;  3CLN A;  1OZO A;  3BUX B;  1YRT B;  1J1E A;  3DF0 A;  4HRE E;  2LC5 A;  2RGI A;  3TS5 B;  3D0Y A;  3FE8 A;  1SCV A;  1RRO A;  1QV1 A;  2ZKM X;  3DVJ A;  1IIO A;  2I7A A;  1DEL A;  1E8A A;  1B7T Z;  3NHT A;  1XA5 A;  1KFU L;  4GPL B;  4GGN A;  1QIW A;  2K8M B;  4A4B A;  3BXK A;  4C0L A;  3A4U B;  4C0K A;  1UHI A;  2Q91 A;  2F2O A;  3DZT A;  1Y1X A;  1CB1 A;  3IVT A;  1YUU A;  1PK0 D;  1UUR A;  4PE7 A;  2EC6 C;  4ZCV A;  5KSZ A;  1R6P A;  2COL B;  2H61 A;  1CDN A;  1FI6 A;  5HLV A;  1MHO A;  1G4Y R;  1OMV A;  2KLE A;  4GNK B;  1Z4H A;  1CFC A;  1QX7 A;  1BU3 A;  4OV2 A;  3LCP C;  2LCP A;  3DXL A;  1C7W A;  3LL8 B;  5DKN A;  1NP8 A;  3CR4 X;  2Q4U A;  1J7R A;  2QPT A;  1CM4 A;  4JD9 A;  4OR9 B;  1TCF A;  2LMT A;  1MXL C;  2MA2 A;  1SY9 A;  1NX2 A;  4MEW A;  4NQG A;  1XFW O;  2WCE A;  4HSZ A;  2K7O A;  3B88 A;  4CFQ A;  1UP5 A;  3LLE A;  4PE4 A;  5I2L A;  2ZRS A;  1K94 A;  1KFU S;  1YVL A;  1FBV A;  2VRG A;  3HCM A;  2WCL A;  3O4X A;  4ORA B;  1DC1 A;  3L47 A;  1HQV A;  2KPH A;  4XYN A;  5G08 A;  3O6B A;  1ALW A;  2H8V A;  3BOW A;  3TZ1 A;  1S6J A;  2QEH A;  2KAV A;  2LM5 A;  1JF0 A;  1IJ6 A;  1QJT A;  1QVI Z;  1A75 A;  1S6I A;  1YR5 A;  1TUZ A;  1XO5 A;  1XK4 A;  1F54 A;  2CNP A;  4PCW A;  1NX0 A;  2PQL A;  5GQQ C;  2KAX A;  1TIZ A;  2WCF A;  1B7T Y;  5JJG A;  2IS9 A;  2BKI B;  2L50 A;  3AKA A;  4DIR A;  3RZS A;  1J7O A;  3O4Y A;  3OB1 B;  1NPQ A;  3M0W A;  1VRK A;  5KU1 A;  3S0G A;  4YGE B;  2LVJ A;  2JPT A;  4GGF A;  2G2B A;  5FI7 A;  2KGR A;  2BBN A;  2FJU B;  2QAC A;  1F71 A;  1JSA A;  2WCK A;  1QS7 A;  3PFV A;  1YTZ C;  3B87 A;  4CID A;  3N7H A;  3CYZ A;  4PAL A;  5HL1 A;  4CFR A;  3FWB A;  3GK4 X;  2LMU A;  3SG3 A;  3PSR A;  3CZ2 A;  3PLF B;  1BR4 B;  1BLQ A;  2CCM A;  3CDN A;  3NSL A;  4AQI A;  1KQM B;  1PUL A;  4FQO A;  1B1G A;  2ZFD A;  1DQE A;  3A8R A;  2LHL A;  2K7C A;  3I5H C;  2JPO A;  2Y1M A;  2PRU A;  2Y5I A;  2MAZ A;  4MZJ A;  1B9A A;  3SG4 A;  3TDU A;  1AJ5 A;  3VRN A;  4PHN A;  3WHT B;  2L2E A;  2WC6 A;  1DJI A;  2LUC A;  4QJ5 B;  1MF8 B;  1DEK A;  1M45 A;  1NX3 A;  1B47 A;  4PE0 A;  1X02 A;  1S3P A;  3V2L A;  1WRZ A;  5BPJ A;  1DJG A;  1AUI B;  1WRL A;  4GGF C;  1QVI Y;  3Q8I A;  2TN4 A;  1Y0V H;  1BT6 A;  1ZFS A;  2JU0 A;  4USL A;  2ZN8 A;  3CTN A;  1OOH A;  4DUQ A;  3S0F A;  4AOM A;  1LS8 A;  1CNP A;  1A2X A;  1BJF A;  5I8N A;  3FIA A;  1ZMZ A;  2LE9 B;  1AVS A;  1B4C A;  1OSA A;  3UNW A;  3BUN B;  3AKB A;  1DJW A;  4P2Y B;  1QAT A;  1MQ1 A;  4MZK A;  3L4A A;  4GUK A;  1DJH A;  3EVV A;  3BUM B;  1IQ3 A;  2KI4 C;  1ALV A;  1IRJ A;  2LUX A;  3HX4 A;  1CMG A;  1XVJ A;  3EVR A;  1U5I A;  1UWO A;  3EK4 A;  3SJS A;  1CLB A;  1RFJ A;  2KFF A;  2JOJ A;  2MLE C;  1DGU A;  1YUT A;  2M1K B;  4M2O A;  2EC6 B;  4CPV A;  5HKW A;  3IQO A;  4YGB B;  1REC A;  4F0Z B;  3ZWH A;  1F4Q A;  2I94 A;  2LP2 A;  1Y1A A;  1H8B A;  3PJI A;  4HRG A;  4OZD A;  4YBH B;  3BFA A;  1YRU B;  1NCX A;  2JZI A;  1BG1 A;  3SS4 A;  1TWO A;  1SPY A;  1AHR A;  1C3Z A;  2EHB A;  3VGO A;  3F45 A;  1PAL A;  1RK9 A;  1XYD A;  2L4H A;  1TRF A;  3S0B A;  3K21 A;  2L5Y A;  3R1O A;  1AP4 A;  3OP0 A;  4FTG A;  5D3O A;  3DF0 B;  3RLZ A;  1DVI A;  3D0Y B;  3KF9 A;  4YGC B;  3SIA A;  1LXF C;  3I5I C;  5CPV A;  4WQ3 A;  1OE9 B;  3B6X A;  2DOQ A;  2I2R E;  1SK6 D;  1K2H A;  2ZRT A;  3SG7 A;  1OZS A;  1J1D A;  3LK1 A;  2GV5 A;  1DF0 B;  3NSK A;  4I5K A;  3GOF A;  4Q04 A;  1J55 A;  1MWN A;  4AQJ A;  1GM0 A;  4MN0 A;  5JOL A;  2JWW A;  1JUO A;  2KQY A;  4QJ4 B;  4PHM A;  1QV0 A;  2JUL A;  1QAS A;  3CR2 A;  3DD4 A;  1S5G Z;  3SS3 A;  3SG5 A;  3R1P A;  4U8D A;  4I5L B;  2PMY A;  4YI9 A;  2KSP A;  2M1U A;  2KHN A;  3OHM B;  3R72 A;  5HLO A;  1TUJ A;  1CDL A;  2F8P A;  2WND A;  1OOF A;  2KYF A;  4D1E A;  4MRX A;  1MUX A;  4YGA A;  3GK1 A;  3WXA A;  1NX1 A;  2F3Y A;  1KK8 C;  2CXJ A;  2K7D A;  2QEV A;  2JT0 A;  1KSO A;  1XFZ O;  3CS1 A;  2KDH A;  1CKK A;  1GGW A;  2G9B A;  3D10 A;  1G8I A;  4NDD A;  1GQM A;  1TNW A;  1AK8 A;  1F70 A;  2BCX A;  3CZT X;  3BYA A;  2MBX A;  1IWQ A;  1W9Z A;  2M7L A;  4M2P A;  4P5O E;  2H61 C;  3BOW B;  5AER A;  3I5F C;  2BCA A;  1C7V A;  2HQ8 A;  1A75 B;  1MR8 A;  3I5H B;  1EH2 A;  4I5J A;  4MRY A;  4YI8 A;  1YUS A;  1CLL A;  3CGA A;  4XJK A;  2QEB A;  3FE6 A;  1PSR A;  4FQT A;  3EKJ A;  4TNC A;  4BY4 A;  1K93 D;  1C3Y A;  2HQW A;  2WCH A;  2K61 A;  1FI5 A;  3FE9 A;  3JVT C;  1UUS A;  1TNX A;  2FCD A;  1NCZ A;  3R1V A;  2JTT A;  1A4P A;  3DVM A;  1PVB A;  2GTE A;  2K2F A;  1IH0 A;  4MBE A;  3CZ1 A;  3DYE A;  3BJH A;  1FW4 A;  3TUY B;  5HYD A;  5KTY A;  1SSE B;  4MZL A;  1NWD A;  1GGZ A;  2OS8 C;  5I94 A;  2HF5 A;  3D75 A;  1M46 A;  3DY9 A;  1L7Z A;  1S5G Y;  2M3W A;  5PAL A;  3OBV A;  1RTP 1;  1N2D A;  2GGZ A;  1SMG A;  2WCM A;  1WDC C;  2D8N A;  1DT7 B;  1JWD A;  2MLF C;  2L51 A;  2NXQ A;  1F4O A;  2KI4 B;  1ZAC A;  1XK4 C;  1OMD A;  2PVB A;  1Z2C B;  2ZNE A;  3IF7 A;  1B8L A;  1M39 A;  1MXE A;  2Y4Q A;  3SIB A;  1XFV O;  1PVA A;  3D78 A;  2PSR A;  3B7A A;  1Y1U A;  1JFK A;  3C1V A;  5HKY A;  5DIC A;  1K9U A;  2BKH B;  1K90 D;  1TCO B;  1J7Q A;  1TNQ A;  4PHJ A;  2AUC A;  4DS7 A;  3RM1 A;  4OKH A;  1KFX L;  1YX8 A;  1NIW A;  3EK8 A;  1NUB A;  4L9M A;  3TUY C;  4QJ3 B;  2KQ6 A;  5CSN A;  5J3X A;  1WLM A;  2K60 A;  1K95 A;  1XFR A;  3S0E A;  3UO9 A;  1KQV A;  2KI6 C;  1YX7 A;  3D73 A;  1F8H A;  2BBM A;  1KSM A;  5F6T A;  4N1F A;  3DVK A;  2HET A;  2ERB A;  3OX5 A;  2BE4 A;  1A03 A;  3WNX B;  2O5G A;  2JRF A;  1CDM A;  2LMV A;  3I5I B;  2P6B B;  2FOT A;  1WY9 A;  3DVE A;  4ETO A;  1WRK A;  3EKH A;  3D76 A;  3KPX A;  3O2P A;  2BEC A;  1U5I B;  1FF1 A;  3CR5 X;  5I2O A;  1UHJ A;  1IG5 A;  3I5G C;  1S36 A;  2WCB A;  2NLN A;  3QME A;  5FYX A;  3PAT A;  2CTN A;  3OGN A;  5I2Q A;  1XFX O;  2LVK A;  2M9G A;  2HPS A;  4IJ7 A;  1EL4 A;  1XFY O;  2M97 A;  3PN7 C;  3BUW B;  5AEQ A;  3KO0 A;  1KWO B; 
#chains in the Genus database with same CATH homology
 2WOS A;  4OCI A;  1V1F A;  2LV7 A;  2OTG C;  1SKT A;  4BY5 A;  1SCM C;  2KBM A;  1SR6 B;  2JT8 A;  2WOR A;  1EG4 A;  3VRR A;  1SRA A;  1ZOT B;  1CDP A;  1Y6W A;  1BF5 A;  1LA3 A;  1NCY A;  4A4C A;  1JFJ A;  4DRW A;  3ZNI A;  5AXI A;  1KK8 B;  1ODB A;  1B8R A;  1ZUZ A;  2JTZ A;  4ICB A;  2GGM A;  4C0J A;  1JC2 A;  1S26 D;  2NCP A;  1BOC A;  2L4I A;  3OB2 B;  2SCP A;  2E30 A;  2LNK A;  4IL1 A;  2F2P A;  4MVF A;  2NCO A;  1YVH A;  4R1E A;  1W7J B;  1CFF A;  3TDZ A;  3I5F B;  2LLT A;  1DGV A;  2LP3 A;  4DCK A;  1N65 A;  3VRQ A;  1LVC D;  2L98 A;  2K7B A;  1KWO C;  4GBA A;  2O60 A;  1OMR A;  4WQ2 A;  1IKU A;  1L2O B;  2M7N A;  1QTX A;  2K2A A;  2LAN A;  2NZ0 A;  3ICB A;  1SR6 C;  1A29 A;  2LLS A;  1UHN A;  2M29 A;  1PSB A;  4YGD B;  1N0Y A;  3JTD B;  1M63 B;  1TN4 A;  3JVT B;  3O78 A;  4PHK A;  1SL9 A;  1KK7 Y;  1DF0 A;  4N5X A;  4MSP A;  4ORC B;  2LVV A;  4PDZ A;  2K0J A;  3BUO B;  2CT9 A;  3PAL A;  4N1G A;  1OOJ A;  1H4B A;  5D7F A;  1CTR A;  2LVI A;  2OS8 B;  2KI6 D;  1CMF A;  1G33 A;  3PM8 A;  1Q80 A;  1PRW A;  1D1O A;  4YRU A;  2JQ6 A;  1K9K A;  2F33 A;  5IBW A;  2M8U A;  1WDC B;  4M2Q A;  3BQ3 A;  2AMI A;  5B8I B;  3H4S E;  4JWQ A;  1TOP A;  1LKJ A;  1QIV A;  3TS5 C;  1BR1 B;  1L2O C;  1TTX A;  4E68 A;  1EXR A;  4XJK B;  1K9P A;  2B1U A;  1JF2 A;  2JNX A;  2KOT A;  1AJ4 A;  1TNP A;  3JTD C;  2L0P A;  5D69 A;  2KYC A;  1B8C A;  2JT3 A;  3LK0 A;  1RJV A;  4JPZ B;  2MRD A;  5AFP A;  1OQP A;  2KFG A;  1M31 A;  3EK7 A;  1QLS A;  1KCY A;  1IJ5 A;  1SNL A;  4NDB A;  5K89 A;  2AAO A;  2PAS A;  3GK2 A;  1NYA A;  5DKR A;  5ER4 X;  4UPG A;  1C07 A;  3EVU A;  2Y1N A;  3CWG A;  2A4J A;  1EJ3 A;  1DTL A;  3KEV A;  2KAY A;  3SG2 A;  1RWY A;  3FWC A;  5CSJ A;  5DKQ A;  3VRO A;  2M0R A;  2BL0 B;  3NSI A;  1J7P A;  1DMO A;  1DJY A;  4MLW A;  2LLU A;  2R2I A;  3I5G B;  1IGV A;  1SL7 A;  2L5X B;  1CM1 A;  4GFT A;  4CLN A;  4PE1 A;  3SG6 A;  2JNF A;  1QXP A;  2ZN9 A;  3TDI A;  1DJZ A;  1LIN A;  3MSE B;  3WHU B;  3PN7 B;  2H2K A;  5CSF A;  2MHH A;  3QRX A;  2M49 B;  1SL8 A;  1CLM A;  1SW8 A;  1IQ5 A;  1BOD A;  2F3Z A;  4JQ0 D;  4WRI A;  2OTG B;  5ER5 A;  1QX5 B;  3VRP A;  2LHI A;  1JBA A;  1SCM B;  1W7I B;  2EGD A;  2V53 A;  4GAO A;  5HKZ A;  5AAN A;  2OPO A;  2MJW B;  4OVN F;  1S6C A;  1UHK A;  4HRH A;  3OX6 A;  2JC2 A;  3IQQ A;  4ZCU A;  1FPW A;  2BL0 C;  4NDC A;  1EG3 A;  2SAS A;  1K96 A;  5TNC A;  2CBL A;  1LA0 A;  1WLZ A;  5CSI A;  1QLK A;  2KBI A;  2KGB C;  1KK7 Z;  3AAJ A;  1F55 A;  1KFX S;  2WC8 A;  2FCE A;  3AAK A;  3NXA A;  2I18 A;  1CFD A;  2KNE A;  2KFH A;  1BMO A;  1KQM C;  1HT9 A;  1SBJ A;  1V1G A;  1YUR A;  2JXC A;  1NSH A;  1GJY A;  1R2U A;  1SYM A;  2ZND A;  1UHH A;  2BE6 A;  3FS7 A;  2BCB A;  1S1E A;  2JXL A;  2LAP A;  1QX2 A;  2E6W A;  2PAL A;  3E3R A;  3NSO A;  1DJX A;  1K8U A;  1XFU O;  3KHE A;  2ISD A;  4ORB B;  1CFP A;  4I5N B;  3CLN A;  1OZO A;  3BUX B;  1YRT B;  1J1E A;  3DF0 A;  4HRE E;  2LC5 A;  2RGI A;  3TS5 B;  3D0Y A;  1SCV A;  1RRO A;  1QV1 A;  2ZKM X;  3DVJ A;  2I7A A;  1E8A A;  4GPL B;  1B7T Z;  1XA5 A;  1KFU L;  4GGN A;  1QIW A;  2K8M B;  4A4B A;  3BXK A;  4C0L A;  3A4U B;  4C0K A;  1UHI A;  2Q91 A;  2F2O A;  1Y1X A;  1CB1 A;  1YUU A;  1PK0 D;  1UUR A;  4PE7 A;  2EC6 C;  4ZCV A;  5KSZ A;  1R6P A;  2COL B;  2H61 A;  1CDN A;  1FI6 A;  5HLV A;  1MHO A;  1G4Y R;  1OMV A;  4GNK B;  1CFC A;  1QX7 A;  1BU3 A;  4OV2 A;  3LCP C;  2LCP A;  3LL8 B;  1C7W A;  5DKN A;  1NP8 A;  3CR4 X;  2Q4U A;  1J7R A;  2QPT A;  1CM4 A;  4OR9 B;  1TCF A;  2LMT A;  1MXL C;  2MA2 A;  1SY9 A;  1NX2 A;  4MEW A;  4NQG A;  1XFW O;  2WCE A;  4HSZ A;  2K7O A;  4CFQ A;  1UP5 A;  3LLE A;  4PE4 A;  5I2L A;  2ZRS A;  1K94 A;  1KFU S;  1YVL A;  1FBV A;  2VRG A;  3HCM A;  4ORA B;  1HQV A;  4XYN A;  5G08 A;  3O6B A;  1ALW A;  3BOW A;  3TZ1 A;  1S6J A;  2KAV A;  2LM5 A;  1JF0 A;  1IJ6 A;  1QJT A;  1QVI Z;  1A75 A;  1S6I A;  1YR5 A;  1F54 A;  1XO5 A;  1XK4 A;  2CNP A;  4PCW A;  1NX0 A;  5GQQ C;  2KAX A;  1TIZ A;  2WCF A;  1B7T Y;  5JJG A;  2IS9 A;  2BKI B;  2L50 A;  3AKA A;  4DIR A;  1J7O A;  3O4Y A;  3OB1 B;  1NPQ A;  3M0W A;  1VRK A;  5KU1 A;  4YGE B;  2LVJ A;  2JPT A;  4GGF A;  2G2B A;  2KGR A;  2BBN A;  2FJU B;  2QAC A;  1F71 A;  1JSA A;  1QS7 A;  3PFV A;  1YTZ C;  4CID A;  4PAL A;  4CFR A;  3FWB A;  3GK4 X;  2LMU A;  3SG3 A;  3PSR A;  3PLF B;  1BR4 B;  1BLQ A;  2CCM A;  3NSL A;  4AQI A;  1KQM B;  1PUL A;  4FQO A;  1B1G A;  2ZFD A;  3A8R A;  2LHL A;  2K7C A;  3I5H C;  2Y1M A;  2PRU A;  2Y5I A;  2MAZ A;  4MZJ A;  1B9A A;  3SG4 A;  3TDU A;  1AJ5 A;  3VRN A;  4PHN A;  3WHT B;  2L2E A;  1DJI A;  2LUC A;  4QJ5 B;  1MF8 B;  1M45 A;  1NX3 A;  1B47 A;  4PE0 A;  1X02 A;  1S3P A;  1WRZ A;  5BPJ A;  1DJG A;  1AUI B;  1WRL A;  4GGF C;  1QVI Y;  2TN4 A;  1Y0V H;  1BT6 A;  1ZFS A;  2JU0 A;  4USL A;  2ZN8 A;  3CTN A;  4DUQ A;  4AOM A;  1CNP A;  1A2X A;  1BJF A;  5I8N A;  3FIA A;  1ZMZ A;  2LE9 B;  1AVS A;  1B4C A;  1OSA A;  3BUN B;  3AKB A;  1DJW A;  4P2Y B;  1QAT A;  1MQ1 A;  4MZK A;  4GUK A;  1DJH A;  3EVV A;  3BUM B;  1IQ3 A;  2KI4 C;  1ALV A;  1IRJ A;  2LUX A;  3HX4 A;  1CMG A;  1XVJ A;  3EVR A;  1U5I A;  1UWO A;  3EK4 A;  3SJS A;  1CLB A;  1RFJ A;  2KFF A;  2JOJ A;  2MLE C;  1DGU A;  1YUT A;  2M1K B;  4M2O A;  2EC6 B;  4CPV A;  5HKW A;  3IQO A;  4YGB B;  1REC A;  4F0Z B;  3ZWH A;  1F4Q A;  2I94 A;  2LP2 A;  1Y1A A;  1H8B A;  4HRG A;  4YBH B;  1YRU B;  1NCX A;  2JZI A;  1BG1 A;  1SPY A;  1AHR A;  2EHB A;  3VGO A;  3F45 A;  1PAL A;  1RK9 A;  1XYD A;  2L4H A;  1TRF A;  3K21 A;  1AP4 A;  3OP0 A;  4FTG A;  3RLZ A;  3DF0 B;  1DVI A;  3D0Y B;  3KF9 A;  4YGC B;  3SIA A;  1LXF C;  3I5I C;  5CPV A;  4WQ3 A;  1OE9 B;  2DOQ A;  2I2R E;  1SK6 D;  1K2H A;  2ZRT A;  3SG7 A;  1OZS A;  1J1D A;  3LK1 A;  2GV5 A;  1DF0 B;  3NSK A;  4I5K A;  3GOF A;  4Q04 A;  1J55 A;  1MWN A;  4AQJ A;  4MN0 A;  5JOL A;  2JWW A;  1JUO A;  2KQY A;  4QJ4 B;  4PHM A;  1QV0 A;  2JUL A;  1QAS A;  3CR2 A;  3DD4 A;  1S5G Z;  3SG5 A;  4U8D A;  4I5L B;  2PMY A;  4YI9 A;  2KSP A;  2M1U A;  2KHN A;  3OHM B;  5HLO A;  1CDL A;  2F8P A;  2WND A;  2KYF A;  4D1E A;  4MRX A;  1MUX A;  4YGA A;  3GK1 A;  3WXA A;  1NX1 A;  2F3Y A;  1KK8 C;  2CXJ A;  2K7D A;  1A03 A;  2JT0 A;  1KSO A;  1XFZ O;  3CS1 A;  2KDH A;  1CKK A;  1GGW A;  2G9B A;  3D10 A;  1G8I A;  4NDD A;  1GQM A;  1TNW A;  1AK8 A;  1F70 A;  2BCX A;  3CZT X;  3BYA A;  2MBX A;  1IWQ A;  2M7L A;  4M2P A;  4P5O E;  2H61 C;  3BOW B;  5AER A;  3I5F C;  2BCA A;  1C7V A;  2HQ8 A;  1A75 B;  1MR8 A;  3I5H B;  1EH2 A;  4I5J A;  4MRY A;  4YI8 A;  1YUS A;  1CLL A;  3CGA A;  4XJK A;  1PSR A;  4BY4 A;  3EKJ A;  4TNC A;  1K93 D;  2HQW A;  2K61 A;  1FI5 A;  3JVT C;  1UUS A;  1TNX A;  2FCD A;  1NCZ A;  2JTT A;  1A4P A;  3DVM A;  1PVB A;  2K2F A;  1IH0 A;  4MBE A;  1FW4 A;  3TUY B;  5HYD A;  5KTY A;  4MZL A;  1NWD A;  1GGZ A;  2OS8 C;  2HF5 A;  1M46 A;  1L7Z A;  1S5G Y;  2M3W A;  5PAL A;  1RTP 1;  1N2D A;  2GGZ A;  1SMG A;  1WDC C;  2D8N A;  1DT7 B;  1JWD A;  2MLF C;  2L51 A;  2NXQ A;  1F4O A;  2KI4 B;  1ZAC A;  1XK4 C;  1OMD A;  2PVB A;  2ZNE A;  3IF7 A;  1B8L A;  1M39 A;  1MXE A;  2Y4Q A;  3SIB A;  1XFV O;  1PVA A;  2PSR A;  1Y1U A;  1JFK A;  3C1V A;  5HKY A;  1K9U A;  2BKH B;  1K90 D;  1TCO B;  1J7Q A;  1TNQ A;  4PHJ A;  2AUC A;  4DS7 A;  3RM1 A;  4OKH A;  1KFX L;  1YX8 A;  1NIW A;  3EK8 A;  1NUB A;  4L9M A;  3TUY C;  4QJ3 B;  2KQ6 A;  5CSN A;  5J3X A;  1WLM A;  1K95 A;  1KQV A;  2KI6 C;  1YX7 A;  1F8H A;  2BBM A;  1KSM A;  5F6T A;  4N1F A;  3DVK A;  2HET A;  3OX5 A;  2BE4 A;  3WNX B;  2O5G A;  2JRF A;  1CDM A;  2LMV A;  3I5I B;  2P6B B;  2FOT A;  1WY9 A;  3DVE A;  4ETO A;  1WRK A;  3EKH A;  3KPX A;  3O2P A;  2BEC A;  1U5I B;  1FF1 A;  3CR5 X;  5I2O A;  1UHJ A;  1IG5 A;  3I5G C;  1S36 A;  2WCB A;  2NLN A;  5FYX A;  3PAT A;  2CTN A;  5I2Q A;  1XFX O;  2LVK A;  2M9G A;  2HPS A;  1EL4 A;  1XFY O;  2M97 A;  3PN7 C;  3BUW B;  5AEQ A;  3KO0 A;  1KWO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...