3BFHA

Crystal structure of a pheromone binding protein from apis mellifera in complex with hexadecanoic acid
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
116
structure length
116
Chain Sequence
WVPPEVFDLVAEDKARCMSEHGTTQAQIDDVDKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone-binding protein ASP1
publication title Structural basis of the honey bee PBP pheromone and pH-induced conformational change
pubmed doi rcsb
source organism Apis mellifera
molecule tags Pheromone binding protein
total genus 44
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2007-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3bfhA00
3BFHA 3K1EA 1OW4A 3BFBA 2JPOA 2PQLA 3B86A 1QWVA 2QEBA 4INXA 2L2CA 2QDIA 3D75A 3D74A 2WCMA 3RZSA 3FE8A 1OOHA 3D77A 3DXLA 3R1VA 3VB1A 1C3YA 3R1OA 2WC6A 3DY9A 3S0AA 3B6XA 3S0GA 4FQTA 5EL2A 3NHTA 3S0DA 3N7HA 1T14A 4JD9A 2QEOA 3S0FA 3BFAA 3B87A 1OOGA 3DZTA 3PJIA 3L47A 3BJHA 3D73A 3V2LA 2WC5A 2ERBA 4PT1A 3L4LA 1ORGA 2WCLA 4OZDA 3D78A 3R1PA 3CZ1A 1DQEA 3DYEA 3L4AA 1OOIX 3CZ2A 2FJYA 1TWOA 3B7AA 3FE6A 1P28A 3R72A 1TUJA 2P70A 3OGNA 3Q8IA 2KPHA 3S0BA 1OOFA 1C3ZA 2GTEA 1XFRA 2WCJA 3S0EA 3NGVA 4INWA 3FE9A 3NHIA 3D76A 4F7FA 3CYZA 5DICA 1GM0A 3CDNA 1LS8A 2QEVA 2WCKA 2H8VA 2P71A 2WCHA 3CZ0A 2QEHA 3CABA 3B88A 3QMEA
chains in the Genus database with same CATH superfamily
1JF2A 2OPOA 4GBAA 1AK8A 3BFHA 1OZSA 2FOTA 2H61C 3PM2A 2KI4B 2F8PA 1AHRA 5I8NA 1QTXA 4YBHB 1DVIA 2JT3A 4GGFA 1DMOA 1JFKA 1TTXA 1NX0A 2JTZA 2LMUA 3JTDC 1J1EA 1B7TY 4IJ7A 3SG5A 2K2FA 1NWDA 1A75A 2WCMA 1F55A 4JKTA 4NQGA 2LMVA 3RZSA 3FS7A 4N5XA 4C0KA 4OR9B 2MHHA 2A4JA 3LL8B 1N65A 1QXPA 3D77A 3GK2A 3I5GC 4GNKB 4M2OA 1KWOB 2M97A 1B8CA 2WC6A 1TN4A 2PALA 1TIZA 1Y6WA 1K9UA 2OTGC 2CNPA 2L4IA 1C07A 2KQ6A 2E6WA 2K2AA 4GAOA 3O6BA 3EVVA 1LKJA 4ZCVA 4L9MA 1SCMC 2M49B 1QVIY 4HRGA 4JPZB 5I2LA 5HL1A 2NLNA 3S0FA 1WRKA 4KYNA 1N0YA 2HQ8A 3BFAA 1RJVA 3WHUB 5FI2A 1OOJA 5FI6A 1CM1A 3TUYB 4CIDA 3BOWA 3VRNA 1PRWA 1ZMZA 2PASA 3SS4A 1PALA 1ALWA 2LUCA 3PJIA 1DJXA 3TDUA 1EH2A 4YRUA 3I5IB 2PSRA 1Z2CB 3L4LA 1KK8B 1AUIB 3UO9A 1DF0A 3BUWB 3O4XA 1G8IA 2LUXA 2LAPA 1LINA 2LVIA 1IQ3A 5KU1A 1QJTA 2BKHB 1SY9A 1KFXL 2K7DA 5HLOA 1OMRA 1NCXA 1P28A 1A03A 3CS1A 1JUOA 3A8RA 1IJ6A 1SRAA 2BE4A 4PE4A 1IH0A 3A4UB 3HX4A 1C3ZA 1MQ1A 1TCFA 2FJUB 4XJKB 2PYQA 1RK9A 2ZNEA 2GTEA 4TNCA 1WRZA 1ZFSA 2LP3A 4MZJA 1SSEB 3EVRA 1BG1A 3ZWHA 3TDIA 1Y1XA 1DJZA 3BUXB 1KWOC 2PVBA 2E30A 2LE9B 1XK4A 3CR4X 3PFVA 2KFHA 1K96A 3DD4A 2M8UA 4GUKA 2KLDA 1SMGA 4INWA 1NUBA 2PMYA 3DVKA 4YI9A 3EK8A 2BBMA 1Q80A 3JTDB 2KFGA 4CFRA 2LNKA 1CTRA 5AFPA 1GJYA 1UHHA 5F6TA 1DEKA 3CYZA 1GM0A 4CPVA 2KGRA 3LK1A 2LANA 2WCEA 3CDNA 1L2OB 1TNPA 3TUYC 1ZACA 3UNWA 1C7WA 3M0WA 1QX7A 3I5GB 3OHMB 3PN7C 3PLFB 2SASA 3C1VA 1YX7A 3B88A 1M45A 3F45A 4OKHA 1CLLA 1PK0D 5JJGA 2LLUA 5K89A 1OSAA 4QJ3B 4PHKA 1J1DA 3BFBA 2BAPA 2I7AA 2JPOA 1DJIA 1BLQA 3DVEA 1F4OA 3DVJA 4XJKA 5D69A 2PQLA 1JC2A 2O5GA 3HCMA 1EL4A 2F3YA 2F33A 4E68A 3IF7A 1K9PA 1OE9B 5B8IB 2G2BA 3OX6A 5KTYA 1KFUS 3D75A 1JF0A 4ICBA 2ZN8A 2IS9A 2H61A 3FE8A 3BXKA 4OCIA 1YRTB 3CTNA 1K95A 1GGZA 4MVFA 2BKIB 1WLZA 1SPYA 2DOQA 2L50A 1F4QA 4PHNA 2K60A 3DXLA 4HRHA 3VB1A 1C3YA 3BUNB 4M2QA 3DY9A 3D10A 1A29A 4N1FA 1WY9A 1NX2A 2M9GA 4FQTA 4FQOA 4FTGA 1W7IB 2O60A 5FYXA 4CLNA 5I2OA 5ER5A 3VRPA 4QJ5B 1B4CA 2COLB 3I5FB 3S0DA 2LM5A 3N7HA 5BPJA 1IKUA 1F54A 3KF9A 5HYDA 1XYDA 1YURA 4ORAB 2NZ0A 1K9KA 2KSPA 2F2OA 2JNXA 1S1EA 1XVJA 1H4BA 4GPLB 2YGUA 5DKRA 1NYAA 1OOGA 1PULA 3DZTA 1L2OC 2KAXA 3L47A 3OB1B 1DJWA 1AJ4A 2LVJA 1TUZA 2WC5A 1Z4HA 2ERBA 2K7CA 1N2DA 1SW8A 1L7ZA 2LP2A 2G9BA 1MUXA 1ORGA 5DKNA 3D78A 1TOPA 2K7BA 1QX5B 3EKJA 1DQEA 1MHOA 1YTZC 1CMFA 1JWDA 2M0RA 2HF5A 3BYAA 4M2PA 2MRDA 2GGZA 3CR2A 3BUOB 1KSMA 1TWOA 2L0PA 1ZOTB 3EG5B 5AXIA 2P70A 2EGDA 2ZRSA 3ICBA 1V1FA 1TNWA 1XFXO 1V1GA 3S0BA 1OOFA 1AVSA 1S36A 2CBLA 1C7VA 2Y5IA 3PN7B 1B1GA 1QLSA 1XFRA 1FI5A 1QV1A 1Y0VH 2HPSA 1UUSA 1MXEA 1DGUA 2F2PA 1GQMA 3FWCA 4HREE 5PALA 1CFFA 4MN0A 1K2HA 4I5NB 4DIRA 1K90D 2M1KB 1FW4A 2BBNA 4PHMA 2LVKA 3AAKA 1JBAA 1UHJA 3VGOA 2WOSA 2I2RE 3FE9A 2LCPA 1F8HA 1FPWA 3I5FC 1BF5A 4WQ2A 5HKYA 3PATA 2GGMA 2Q4UA 2CXJA 1EG3A 2EHBA 1S6IA 4I5KA 5DICA 1G4YR 1NPQA 4ZCUA 4A4CA 2QEVA 1LA3A 2KHNA 1SK6D 2WCKA 2M1UA 3E3RA 4NDDA 1R6PA 1R2UA 2M29A 1XFVO 1QV0A 2WCHA 3CZ0A 1K8UA 2L4HA 1YX8A 2WCFA 2MLFC 1IGVA 1KQMC 2FCDA 3CABA 1QLKA 3KEVA 4YGBB 1IJ5A 5AANA 5IBWA 2AMIA 1CNPA 4OVNF 2P6BB 1BODA 3RLZA 1BOCA 2KBIA 2JZIA 1G33A 1UP5A 3K1EA 3SG6A 3TS5C 3DVMA 1SL8A 1U5IB 4ORBB 3B86A 2H2KA 1F70A 3PALA 1UURA 1CDNA 2L2CA 1MR8A 2QDIA 5AERA 2QPTA 2MAZA 2V53A 3LCPC 5KSZA 5ER4X 2KI6C 4OV2A 1QASA 2BL0B 1OOHA 3CGAA 5GQQC 2L98A 3CWGA 1J7PA 2CCMA 2ISDA 3H4SE 1PSRA 1WDCC 4N1GA 4WRIA 3RM1A 3SG3A 1FF1A 1B8LA 4AQIA 1CM4A 1OMVA 3R1VA 1XA5A 2PRUA 2WNDA 1E8AA 2Y4QA 3NSOA 2I94A 3R1OA 4IL1A 5CSIA 3VRRA 1PVBA 3S0GA 1QATA 2SCPA 5AEQA 4P2YB 2BCXA 2JULA 4DCKA 3NHTA 4ETOA 2ZNDA 1PSBA 1RWYA 1YRUB 1UHIA 3DF0B 1MXLC 3TDZA 2KYCA 4MRXA 4PE1A 1SL7A 1X02A 1OZOA 3FIAA 3PM8A 2JC2A 2KNEA 5G08A 4AQJA 3SS3A 2HQWA 1KSOA 1K94A 1CB1A 2EC6B 1WRLA 3OBVA 4UPGA 1CFPA 3BUMB 2MLEC 3OX5A 4PE0A 2BECA 2M3WA 3EK7A 4I5LB 3BJHA 3D73A 4GFTA 2JRFA 3D0YB 5TNCA 1FBVA 1DC1A 1SR6C 1EG4A 1J55A 1LXFC 4XYNA 1RFJA 4CFQA 1IRJA 2ZRTA 2K0JA 3DYEA 1NCZA 5FI7A 1S5GZ 1TNQA 2M7NA 3CZ2A 4PDZA 1W7JB 3NSKA 3FE6A 2K8MB 4U8DA 2Y1MA 2JWWA 1S5GY 2JXCA 2KI6D 3OGNA 3GK1A 2K61A 4A4BA 1VRKA 2ZKMX 1BJFA 4MRYA 2LLSA 3SJSA 5JOLA 1CKKA 3KPXA 4R1EA 1IQ5A 1NIWA 2BL0C 3DF0A 2AUCA 2ZFDA 1M31A 1KQMB 1DJHA 2LHIA 3LK0A 2JPTA 2WORA 2I18A 2ZN9A 1M63B 1EXRA 1XO5A 4JWQA 2KFFA 2QACA 4DS7A 3BOWB 2WCJA 1ZUZA 3IVTA 1DJGA 1XFYO 4MZLA 1B7TZ 3S0EA 3TS5B 4BY5A 1F71A 2NXQA 3ZNIA 1KK7Z 1CFDA 2KYFA 1BMOA 2K7OA 2L5XB 1W9ZA 2JT0A 1KQVA 3PSRA 1OQPA 5CSFA 3NHIA 3D0YA 1BR1B 3D76A 3FWBA 3SG2A 3TZ1A 2L2EA 2F3ZA 2JXLA 1DF0B 1KK7Y 2LHLA 2MA2A 4F7FA 2BCBA 2TN4A 1QS7A 2BE6A 3KHEA 2LMTA 5D7FA 1S6CA 2NCOA 5D3OA 2EC6C 3KO0A 1DGVA 1WDCB 1Y1AA 2H8VA 2KGBC 4ORCB 1M46A 3SG7A 1CMGA 4PE7A 1S26D 3NXAA 2CTNA 1H8BA 4USLA 4GGFC 1WLMA 5CSNA 4AOMA 1KCYA 4MSPA 3I5HC 2B1UA 2NCPA 1QVIZ 5HLVA 3JVTC 2OS8C 1A2XA 2WCBA 4BY4A 1OW4A 1QIVA 2JQ6A 2KQYA 4PHJA 4WQ3A 1JFJA 1NX3A 2LC5A 3IQQA 1J7OA 1AP4A 1QWVA 1J7RA 2QEBA 3NSLA 4MLWA 1TNXA 3AKBA 4INXA 3VRQA 5I94A 2RGIA 3GK4X 4YGCB 1NSHA 3EK4A 3D74A 4YGAA 2M7LA 2LLTA 4JQ0D 3WHTB 1Y1UA 3QRXA 4I5JA 1CLBA 4YI8A 1CLMA 1AJ5A 3SIAA 1CDPA 2BCAA 1FI6A 1DJYA 3SIBA 1SCVA 1D1OA 1OMDA 3WXAA 1SR6B 1QIWA 2R2IA 5HKWA 1MWNA 2HETA 4YGEB 4C0LA 3B6XA 3K21A 2FCEA 4D1EA 3S0AA 5CPVA 4MEWA 1IWQA 2GV5A 3CLNA 5EL2A 2KLEA 1EJ3A 3OP0A 2KBMA 1HQVA 1T14A 1UWOA 2JNFA 2KI4C 4JD9A 5HKZA 2QEOA 1QX2A 1MF8B 1SKTA 2KDHA 1YVHA 3AAJA 4DRWA 5I2QA 1KFXS 3OB2B 1YUSA 2JT8A 1LA0A 2Y1NA 1YUUA 2LVVA 4GGNA 3IQOA 1S6JA 1JSAA 3B87A 3O2PA 1S3PA 4F0ZB 3MSEB 1PVAA 1YVLA 1UHNA 3WNXB 4DUQA 1YR5A 1B47A 4HSZA 3V2LA 1TCOB 4PT1A 1XFUO 2AAOA 2JTTA 1IIOA 1BT6A 1NX1A 1DT7B 1GGWA 3AKAA 2MBXA 2WCLA 3BQ3A 3R1PA 4OZDA 3CZ1A 1HT9A 1A4PA 3O78A 3SG4A 3L4AA 1RECA 4NDCA 1OOIX 1NCYA 2L5YA 1SYMA 2FJYA 3B7AA 4NDBA 1BR4B 3GOFA 3R72A 3CZTX 1KFUL 1TUJA 3O4YA 3Q8IA 4QJ4B 1CDMA 2KPHA 1SNLA 1XK4C 5J3XA 4C0JA 4MZKA 2KOTA 1K93D 1IG5A 1SL9A 1ODBA 1ALVA 1U5IA 3I5IC 3EKHA 2BNXA 3CR5X 2L51A 1DTLA 3I5HB 5DKQA 1CFCA 1A75B 1UHKA 1KK8C 2OTGB 3JVTB 2OS8B 2LV7A 3NGVA 2KAVA 2WC8A 1BU3A 1CDLA 1NP8A 1YUTA 1SCMB 4YGDB 2VRGA 4PALA 1RTP1 2Q91A 4Q04A 1RROA 1LVCD 1B8RA 3EVUA 3VROA 2CT9A 4PCWA 1SBJA 1LS8A 1TRFA 1XFWO 2D8NA 5CSJA 1XFZO 2MJWB 3NSIA 4MBEA 1M39A 2KAYA 2P71A 4P5OE 1DELA 2JU0A 3LLEA 2QEHA 3SS5A 1J7QA 1B9AA 3QMEA 2JOJA
chains in the Genus database with same CATH topology
3BFHA 3K1EA 1OW4A 3BFBA 2JPOA 2PQLA 3B86A 1QWVA 2QEBA 4INXA 2L2CA 2QDIA 3D75A 3D74A 2WCMA 3RZSA 3FE8A 1OOHA 3D77A 3DXLA 3R1VA 3VB1A 1C3YA 3R1OA 2WC6A 3DY9A 3S0AA 3B6XA 3S0GA 4FQTA 5EL2A 3NHTA 3S0DA 3N7HA 1T14A 4JD9A 2QEOA 3S0FA 3BFAA 3B87A 1OOGA 3DZTA 3PJIA 3L47A 3BJHA 3D73A 3V2LA 2WC5A 2ERBA 4PT1A 3L4LA 1ORGA 2WCLA 4OZDA 3D78A 3R1PA 3CZ1A 1DQEA 3DYEA 3L4AA 1OOIX 3CZ2A 2FJYA 1TWOA 3B7AA 3FE6A 1P28A 3R72A 1TUJA 2P70A 3OGNA 3Q8IA 2KPHA 3S0BA 1OOFA 1C3ZA 2GTEA 1XFRA 2WCJA 3S0EA 3NGVA 4INWA 3FE9A 3NHIA 3D76A 4F7FA 3CYZA 5DICA 1GM0A 3CDNA 1LS8A 2QEVA 2WCKA 2H8VA 2P71A 2WCHA 3CZ0A 2QEHA 3CABA 3B88A 3QMEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BFH A;  3K1E A;  1OW4 A;  3BFB A;  2JPO A;  2PQL A;  3B86 A;  1QWV A;  2QEB A;  4INX A;  2L2C A;  2QDI A;  3D75 A;  3D74 A;  2WCM A;  3RZS A;  3FE8 A;  1OOH A;  3D77 A;  3DXL A;  3R1V A;  3VB1 A;  1C3Y A;  3R1O A;  2WC6 A;  3DY9 A;  3S0A A;  3B6X A;  3S0G A;  4FQT A;  5EL2 A;  3NHT A;  3S0D A;  3N7H A;  1T14 A;  4JD9 A;  2QEO A;  3S0F A;  3BFA A;  3B87 A;  1OOG A;  3DZT A;  3PJI A;  3L47 A;  3BJH A;  3D73 A;  3V2L A;  2WC5 A;  2ERB A;  4PT1 A;  3L4L A;  1ORG A;  2WCL A;  4OZD A;  3D78 A;  3R1P A;  3CZ1 A;  1DQE A;  3DYE A;  3L4A A;  1OOI X;  3CZ2 A;  2FJY A;  1TWO A;  3B7A A;  3FE6 A;  1P28 A;  3R72 A;  1TUJ A;  2P70 A;  3OGN A;  3Q8I A;  2KPH A;  3S0B A;  1OOF A;  1C3Z A;  2GTE A;  1XFR A;  2WCJ A;  3S0E A;  3NGV A;  4INW A;  3FE9 A;  3NHI A;  3D76 A;  4F7F A;  3CYZ A;  5DIC A;  1GM0 A;  3CDN A;  1LS8 A;  2QEV A;  2WCK A;  2H8V A;  2P71 A;  2WCH A;  3CZ0 A;  2QEH A;  3CAB A;  3B88 A;  3QME A; 
#chains in the Genus database with same CATH topology
 1JF2 A;  2OPO A;  4GBA A;  1AK8 A;  3BFH A;  1OZS A;  2FOT A;  2H61 C;  3PM2 A;  2KI4 B;  2F8P A;  1AHR A;  5I8N A;  1QTX A;  4YBH B;  1DVI A;  2JT3 A;  4GGF A;  1DMO A;  1JFK A;  1TTX A;  1NX0 A;  2JTZ A;  2LMU A;  3JTD C;  1J1E A;  1B7T Y;  4IJ7 A;  3SG5 A;  2K2F A;  1NWD A;  1A75 A;  2WCM A;  1F55 A;  4JKT A;  4NQG A;  2LMV A;  3RZS A;  3FS7 A;  4N5X A;  4C0K A;  4OR9 B;  2MHH A;  2A4J A;  3LL8 B;  1N65 A;  1QXP A;  3D77 A;  3GK2 A;  3I5G C;  4GNK B;  4M2O A;  1KWO B;  2M97 A;  1B8C A;  2WC6 A;  1TN4 A;  2PAL A;  1TIZ A;  1Y6W A;  1K9U A;  2OTG C;  2CNP A;  2L4I A;  1C07 A;  2KQ6 A;  2E6W A;  2K2A A;  4GAO A;  3O6B A;  3EVV A;  1LKJ A;  4ZCV A;  4L9M A;  1SCM C;  2M49 B;  1QVI Y;  4HRG A;  4JPZ B;  5I2L A;  5HL1 A;  2NLN A;  3S0F A;  1WRK A;  4KYN A;  1N0Y A;  2HQ8 A;  3BFA A;  1RJV A;  3WHU B;  5FI2 A;  1OOJ A;  5FI6 A;  1CM1 A;  3TUY B;  4CID A;  3BOW A;  3VRN A;  1PRW A;  1ZMZ A;  2PAS A;  3SS4 A;  1PAL A;  1ALW A;  2LUC A;  3PJI A;  1DJX A;  3TDU A;  1EH2 A;  4YRU A;  3I5I B;  2PSR A;  1Z2C B;  3L4L A;  1KK8 B;  1AUI B;  3UO9 A;  1DF0 A;  3BUW B;  3O4X A;  1G8I A;  2LUX A;  2LAP A;  1LIN A;  2LVI A;  1IQ3 A;  5KU1 A;  1QJT A;  2BKH B;  1SY9 A;  1KFX L;  2K7D A;  5HLO A;  1OMR A;  1NCX A;  1P28 A;  1A03 A;  3CS1 A;  1JUO A;  3A8R A;  1IJ6 A;  1SRA A;  2BE4 A;  4PE4 A;  1IH0 A;  3A4U B;  3HX4 A;  1C3Z A;  1MQ1 A;  1TCF A;  2FJU B;  4XJK B;  2PYQ A;  1RK9 A;  2ZNE A;  2GTE A;  4TNC A;  1WRZ A;  1ZFS A;  2LP3 A;  4MZJ A;  1SSE B;  3EVR A;  1BG1 A;  3ZWH A;  3TDI A;  1Y1X A;  1DJZ A;  3BUX B;  1KWO C;  2PVB A;  2E30 A;  2LE9 B;  1XK4 A;  3CR4 X;  3PFV A;  2KFH A;  1K96 A;  3DD4 A;  2M8U A;  4GUK A;  2KLD A;  1SMG A;  4INW A;  1NUB A;  2PMY A;  3DVK A;  4YI9 A;  3EK8 A;  2BBM A;  1Q80 A;  3JTD B;  2KFG A;  4CFR A;  2LNK A;  1CTR A;  5AFP A;  1GJY A;  1UHH A;  5F6T A;  1DEK A;  3CYZ A;  1GM0 A;  4CPV A;  2KGR A;  3LK1 A;  2LAN A;  2WCE A;  3CDN A;  1L2O B;  1TNP A;  3TUY C;  1ZAC A;  3UNW A;  1C7W A;  3M0W A;  1QX7 A;  3I5G B;  3OHM B;  3PN7 C;  3PLF B;  2SAS A;  3C1V A;  1YX7 A;  3B88 A;  1M45 A;  3F45 A;  4OKH A;  1CLL A;  1PK0 D;  5JJG A;  2LLU A;  5K89 A;  1OSA A;  4QJ3 B;  4PHK A;  1J1D A;  3BFB A;  2BAP A;  2I7A A;  2JPO A;  1DJI A;  1BLQ A;  3DVE A;  1F4O A;  3DVJ A;  4XJK A;  5D69 A;  2PQL A;  1JC2 A;  2O5G A;  3HCM A;  1EL4 A;  2F3Y A;  2F33 A;  4E68 A;  3IF7 A;  1K9P A;  1OE9 B;  5B8I B;  2G2B A;  3OX6 A;  5KTY A;  1KFU S;  3D75 A;  1JF0 A;  4ICB A;  2ZN8 A;  2IS9 A;  2H61 A;  3FE8 A;  3BXK A;  4OCI A;  1YRT B;  3CTN A;  1K95 A;  1GGZ A;  4MVF A;  2BKI B;  1WLZ A;  1SPY A;  2DOQ A;  2L50 A;  1F4Q A;  4PHN A;  2K60 A;  3DXL A;  4HRH A;  3VB1 A;  1C3Y A;  3BUN B;  4M2Q A;  3DY9 A;  3D10 A;  1A29 A;  4N1F A;  1WY9 A;  1NX2 A;  2M9G A;  4FQT A;  4FQO A;  4FTG A;  1W7I B;  2O60 A;  5FYX A;  4CLN A;  5I2O A;  5ER5 A;  3VRP A;  4QJ5 B;  1B4C A;  2COL B;  3I5F B;  3S0D A;  2LM5 A;  3N7H A;  5BPJ A;  1IKU A;  1F54 A;  3KF9 A;  5HYD A;  1XYD A;  1YUR A;  4ORA B;  2NZ0 A;  1K9K A;  2KSP A;  2F2O A;  2JNX A;  1S1E A;  1XVJ A;  1H4B A;  4GPL B;  2YGU A;  5DKR A;  1NYA A;  1OOG A;  1PUL A;  3DZT A;  1L2O C;  2KAX A;  3L47 A;  3OB1 B;  1DJW A;  1AJ4 A;  2LVJ A;  1TUZ A;  2WC5 A;  1Z4H A;  2ERB A;  2K7C A;  1N2D A;  1SW8 A;  1L7Z A;  2LP2 A;  2G9B A;  1MUX A;  1ORG A;  5DKN A;  3D78 A;  1TOP A;  2K7B A;  1QX5 B;  3EKJ A;  1DQE A;  1MHO A;  1YTZ C;  1CMF A;  1JWD A;  2M0R A;  2HF5 A;  3BYA A;  4M2P A;  2MRD A;  2GGZ A;  3CR2 A;  3BUO B;  1KSM A;  1TWO A;  2L0P A;  1ZOT B;  3EG5 B;  5AXI A;  2P70 A;  2EGD A;  2ZRS A;  3ICB A;  1V1F A;  1TNW A;  1XFX O;  1V1G A;  3S0B A;  1OOF A;  1AVS A;  1S36 A;  2CBL A;  1C7V A;  2Y5I A;  3PN7 B;  1B1G A;  1QLS A;  1XFR A;  1FI5 A;  1QV1 A;  1Y0V H;  2HPS A;  1UUS A;  1MXE A;  1DGU A;  2F2P A;  1GQM A;  3FWC A;  4HRE E;  5PAL A;  1CFF A;  4MN0 A;  1K2H A;  4I5N B;  4DIR A;  1K90 D;  2M1K B;  1FW4 A;  2BBN A;  4PHM A;  2LVK A;  3AAK A;  1JBA A;  1UHJ A;  3VGO A;  2WOS A;  2I2R E;  3FE9 A;  2LCP A;  1F8H A;  1FPW A;  3I5F C;  1BF5 A;  4WQ2 A;  5HKY A;  3PAT A;  2GGM A;  2Q4U A;  2CXJ A;  1EG3 A;  2EHB A;  1S6I A;  4I5K A;  5DIC A;  1G4Y R;  1NPQ A;  4ZCU A;  4A4C A;  2QEV A;  1LA3 A;  2KHN A;  1SK6 D;  2WCK A;  2M1U A;  3E3R A;  4NDD A;  1R6P A;  1R2U A;  2M29 A;  1XFV O;  1QV0 A;  2WCH A;  3CZ0 A;  1K8U A;  2L4H A;  1YX8 A;  2WCF A;  2MLF C;  1IGV A;  1KQM C;  2FCD A;  3CAB A;  1QLK A;  3KEV A;  4YGB B;  1IJ5 A;  5AAN A;  5IBW A;  2AMI A;  1CNP A;  4OVN F;  2P6B B;  1BOD A;  3RLZ A;  1BOC A;  2KBI A;  2JZI A;  1G33 A;  1UP5 A;  3K1E A;  3SG6 A;  3TS5 C;  3DVM A;  1SL8 A;  1U5I B;  4ORB B;  3B86 A;  2H2K A;  1F70 A;  3PAL A;  1UUR A;  1CDN A;  2L2C A;  1MR8 A;  2QDI A;  5AER A;  2QPT A;  2MAZ A;  2V53 A;  3LCP C;  5KSZ A;  5ER4 X;  2KI6 C;  4OV2 A;  1QAS A;  2BL0 B;  1OOH A;  3CGA A;  5GQQ C;  2L98 A;  3CWG A;  1J7P A;  2CCM A;  2ISD A;  3H4S E;  1PSR A;  1WDC C;  4N1G A;  4WRI A;  3RM1 A;  3SG3 A;  1FF1 A;  1B8L A;  4AQI A;  1CM4 A;  1OMV A;  3R1V A;  1XA5 A;  2PRU A;  2WND A;  1E8A A;  2Y4Q A;  3NSO A;  2I94 A;  3R1O A;  4IL1 A;  5CSI A;  3VRR A;  1PVB A;  3S0G A;  1QAT A;  2SCP A;  5AEQ A;  4P2Y B;  2BCX A;  2JUL A;  4DCK A;  3NHT A;  4ETO A;  2ZND A;  1PSB A;  1RWY A;  1YRU B;  1UHI A;  3DF0 B;  1MXL C;  3TDZ A;  2KYC A;  4MRX A;  4PE1 A;  1SL7 A;  1X02 A;  1OZO A;  3FIA A;  3PM8 A;  2JC2 A;  2KNE A;  5G08 A;  4AQJ A;  3SS3 A;  2HQW A;  1KSO A;  1K94 A;  1CB1 A;  2EC6 B;  1WRL A;  3OBV A;  4UPG A;  1CFP A;  3BUM B;  2MLE C;  3OX5 A;  4PE0 A;  2BEC A;  2M3W A;  3EK7 A;  4I5L B;  3BJH A;  3D73 A;  4GFT A;  2JRF A;  3D0Y B;  5TNC A;  1FBV A;  1DC1 A;  1SR6 C;  1EG4 A;  1J55 A;  1LXF C;  4XYN A;  1RFJ A;  4CFQ A;  1IRJ A;  2ZRT A;  2K0J A;  3DYE A;  1NCZ A;  5FI7 A;  1S5G Z;  1TNQ A;  2M7N A;  3CZ2 A;  4PDZ A;  1W7J B;  3NSK A;  3FE6 A;  2K8M B;  4U8D A;  2Y1M A;  2JWW A;  1S5G Y;  2JXC A;  2KI6 D;  3OGN A;  3GK1 A;  2K61 A;  4A4B A;  1VRK A;  2ZKM X;  1BJF A;  4MRY A;  2LLS A;  3SJS A;  5JOL A;  1CKK A;  3KPX A;  4R1E A;  1IQ5 A;  1NIW A;  2BL0 C;  3DF0 A;  2AUC A;  2ZFD A;  1M31 A;  1KQM B;  1DJH A;  2LHI A;  3LK0 A;  2JPT A;  2WOR A;  2I18 A;  2ZN9 A;  1M63 B;  1EXR A;  1XO5 A;  4JWQ A;  2KFF A;  2QAC A;  4DS7 A;  3BOW B;  2WCJ A;  1ZUZ A;  3IVT A;  1DJG A;  1XFY O;  4MZL A;  1B7T Z;  3S0E A;  3TS5 B;  4BY5 A;  1F71 A;  2NXQ A;  3ZNI A;  1KK7 Z;  1CFD A;  2KYF A;  1BMO A;  2K7O A;  2L5X B;  1W9Z A;  2JT0 A;  1KQV A;  3PSR A;  1OQP A;  5CSF A;  3NHI A;  3D0Y A;  1BR1 B;  3D76 A;  3FWB A;  3SG2 A;  3TZ1 A;  2L2E A;  2F3Z A;  2JXL A;  1DF0 B;  1KK7 Y;  2LHL A;  2MA2 A;  4F7F A;  2BCB A;  2TN4 A;  1QS7 A;  2BE6 A;  3KHE A;  2LMT A;  5D7F A;  1S6C A;  2NCO A;  5D3O A;  2EC6 C;  3KO0 A;  1DGV A;  1WDC B;  1Y1A A;  2H8V A;  2KGB C;  4ORC B;  1M46 A;  3SG7 A;  1CMG A;  4PE7 A;  1S26 D;  3NXA A;  2CTN A;  1H8B A;  4USL A;  4GGF C;  1WLM A;  5CSN A;  4AOM A;  1KCY A;  4MSP A;  3I5H C;  2B1U A;  2NCP A;  1QVI Z;  5HLV A;  3JVT C;  2OS8 C;  1A2X A;  2WCB A;  4BY4 A;  1OW4 A;  1QIV A;  2JQ6 A;  2KQY A;  4PHJ A;  4WQ3 A;  1JFJ A;  1NX3 A;  2LC5 A;  3IQQ A;  1J7O A;  1AP4 A;  1QWV A;  1J7R A;  2QEB A;  3NSL A;  4MLW A;  1TNX A;  3AKB A;  4INX A;  3VRQ A;  5I94 A;  2RGI A;  3GK4 X;  4YGC B;  1NSH A;  3EK4 A;  3D74 A;  4YGA A;  2M7L A;  2LLT A;  4JQ0 D;  3WHT B;  1Y1U A;  3QRX A;  4I5J A;  1CLB A;  4YI8 A;  1CLM A;  1AJ5 A;  3SIA A;  1CDP A;  2BCA A;  1FI6 A;  1DJY A;  3SIB A;  1SCV A;  1D1O A;  1OMD A;  3WXA A;  1SR6 B;  1QIW A;  2R2I A;  5HKW A;  1MWN A;  2HET A;  4YGE B;  4C0L A;  3B6X A;  3K21 A;  2FCE A;  4D1E A;  3S0A A;  5CPV A;  4MEW A;  1IWQ A;  2GV5 A;  3CLN A;  5EL2 A;  2KLE A;  1EJ3 A;  3OP0 A;  2KBM A;  1HQV A;  1T14 A;  1UWO A;  2JNF A;  2KI4 C;  4JD9 A;  5HKZ A;  2QEO A;  1QX2 A;  1MF8 B;  1SKT A;  2KDH A;  1YVH A;  3AAJ A;  4DRW A;  5I2Q A;  1KFX S;  3OB2 B;  1YUS A;  2JT8 A;  1LA0 A;  2Y1N A;  1YUU A;  2LVV A;  4GGN A;  3IQO A;  1S6J A;  1JSA A;  3B87 A;  3O2P A;  1S3P A;  4F0Z B;  3MSE B;  1PVA A;  1YVL A;  1UHN A;  3WNX B;  4DUQ A;  1YR5 A;  1B47 A;  4HSZ A;  3V2L A;  1TCO B;  4PT1 A;  1XFU O;  2AAO A;  2JTT A;  1IIO A;  1BT6 A;  1NX1 A;  1DT7 B;  1GGW A;  3AKA A;  2MBX A;  2WCL A;  3BQ3 A;  3R1P A;  4OZD A;  3CZ1 A;  1HT9 A;  1A4P A;  3O78 A;  3SG4 A;  3L4A A;  1REC A;  4NDC A;  1OOI X;  1NCY A;  2L5Y A;  1SYM A;  2FJY A;  3B7A A;  4NDB A;  1BR4 B;  3GOF A;  3R72 A;  3CZT X;  1KFU L;  1TUJ A;  3O4Y A;  3Q8I A;  4QJ4 B;  1CDM A;  2KPH A;  1SNL A;  1XK4 C;  5J3X A;  4C0J A;  4MZK A;  2KOT A;  1K93 D;  1IG5 A;  1SL9 A;  1ODB A;  1ALV A;  1U5I A;  3I5I C;  3EKH A;  2BNX A;  3CR5 X;  2L51 A;  1DTL A;  3I5H B;  5DKQ A;  1CFC A;  1A75 B;  1UHK A;  1KK8 C;  2OTG B;  3JVT B;  2OS8 B;  2LV7 A;  3NGV A;  2KAV A;  2WC8 A;  1BU3 A;  1CDL A;  1NP8 A;  1YUT A;  1SCM B;  4YGD B;  2VRG A;  4PAL A;  1RTP 1;  2Q91 A;  4Q04 A;  1RRO A;  1LVC D;  1B8R A;  3EVU A;  3VRO A;  2CT9 A;  4PCW A;  1SBJ A;  1LS8 A;  1TRF A;  1XFW O;  2D8N A;  5CSJ A;  1XFZ O;  2MJW B;  3NSI A;  4MBE A;  1M39 A;  2KAY A;  2P71 A;  4P5O E;  1DEL A;  2JU0 A;  3LLE A;  2QEH A;  3SS5 A;  1J7Q A;  1B9A A;  3QME A;  2JOJ A; 
#chains in the Genus database with same CATH homology
 3BFH A;  3K1E A;  1OW4 A;  3BFB A;  2JPO A;  2PQL A;  3B86 A;  1QWV A;  2QEB A;  4INX A;  2L2C A;  2QDI A;  3D75 A;  3D74 A;  2WCM A;  3RZS A;  3FE8 A;  1OOH A;  3D77 A;  3DXL A;  3R1V A;  3VB1 A;  1C3Y A;  3R1O A;  2WC6 A;  3DY9 A;  3S0A A;  3B6X A;  3S0G A;  4FQT A;  5EL2 A;  3NHT A;  3S0D A;  3N7H A;  1T14 A;  4JD9 A;  2QEO A;  3S0F A;  3BFA A;  3B87 A;  1OOG A;  3DZT A;  3PJI A;  3L47 A;  3BJH A;  3D73 A;  3V2L A;  2WC5 A;  2ERB A;  4PT1 A;  3L4L A;  1ORG A;  2WCL A;  4OZD A;  3D78 A;  3R1P A;  3CZ1 A;  1DQE A;  3DYE A;  3L4A A;  1OOI X;  3CZ2 A;  2FJY A;  1TWO A;  3B7A A;  3FE6 A;  1P28 A;  3R72 A;  1TUJ A;  2P70 A;  3OGN A;  3Q8I A;  2KPH A;  3S0B A;  1OOF A;  1C3Z A;  2GTE A;  1XFR A;  2WCJ A;  3S0E A;  3NGV A;  4INW A;  3FE9 A;  3NHI A;  3D76 A;  4F7F A;  3CYZ A;  5DIC A;  1GM0 A;  3CDN A;  1LS8 A;  2QEV A;  2WCK A;  2H8V A;  2P71 A;  2WCH A;  3CZ0 A;  2QEH A;  3CAB A;  3B88 A;  3QME A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...