3BFHA

Crystal structure of a pheromone binding protein from apis mellifera in complex with hexadecanoic acid
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
116
structure length
116
Chain Sequence
WVPPEVFDLVAEDKARCMSEHGTTQAQIDDVDKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone-binding protein ASP1
publication title Structural basis of the honey bee PBP pheromone and pH-induced conformational change
pubmed doi rcsb
source organism Apis mellifera
molecule tags Pheromone binding protein
total genus 44
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2007-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3bfhA00
1OOIX 4INWA 3CZ2A 2ERBA 2KPHA 4F7FA 3QMEA 1DQEA 3FE8A 3R1PA 2JPOA 2P71A 1LS8A 3V2LA 2L2CA 5DICA 2H8VA 3S0BA 3PJIA 3D73A 1TWOA 3L4LA 5EL2A 3DYEA 1ORGA 2WCMA 3DY9A 3L4AA 3FE9A 3B86A 3D74A 3OGNA 3S0AA 3BFAA 2QDIA 3CZ1A 3S0DA 3DXLA 3BJHA 4FQTA 2WCHA 3B88A 2WCLA 3B6XA 1QWVA 1XFRA 3S0EA 1T14A 3FE6A 3CABA 4JD9A 1C3ZA 3D75A 2P70A 1OOGA 4PT1A 2QEOA 3L47A 3RZSA 2QEVA 3S0GA 3D77A 3B7AA 4OZDA 1OOHA 2FJYA 3NHTA 3Q8IA 2QEBA 3R1OA 3CYZA 2QEHA 3BFHA 1GM0A 1OOFA 2WCKA 2WC6A 3N7HA 3DZTA 1P28A 3R1VA 2WCJA 1TUJA 3D76A 1OW4A 4INXA 1C3YA 3S0FA 3BFBA 3CDNA 3K1EA 2PQLA 2WC5A 3R72A 3D78A 3NGVA 2GTEA 3NHIA 3B87A 3VB1A 3CZ0A
chains in the Genus database with same CATH superfamily
1YR5A 1SK6D 2KSPA 5D7FA 4INWA 1ZUZA 1AHRA 2ERBA 2WCFA 2LLTA 3QMEA 1TTXA 2M9GA 2M7LA 4CPVA 3DVMA 2LC5A 1CFCA 1M39A 3I5IC 1QLKA 1LXFC 3R1PA 2KHNA 2F2OA 4GFTA 2JPOA 1YVLA 2LVJA 5PALA 3TS5B 1YX7A 1QVIY 1LS8A 4MRYA 1SY9A 1DJYA 1F55A 4PHNA 3SG4A 1TNPA 4PHMA 3LL8B 1UHKA 1DC1A 2H8VA 1ZMZA 1PSBA 3OBVA 2K2AA 2JULA 4MRXA 5B8IB 2K7DA 1TNWA 1PRWA 3SG7A 1XK4C 3BUOB 1DJXA 4IJ7A 2L98A 1UURA 1Z4HA 2BECA 1F71A 1ORGA 1HT9A 2F2PA 2WCMA 1TCOB 2LMUA 4YGBB 2MAZA 3WXAA 3D74A 2OPOA 4DRWA 1TOPA 2SASA 3OP0A 5ER5A 2M97A 3BYAA 2K7BA 1C7VA 4GPLB 1K95A 5I2LA 1G8IA 5DKRA 2KOTA 1MUXA 5FYXA 3BJHA 1NX1A 4GGFC 4FQTA 1DJIA 3KEVA 2ZRTA 3B6XA 1XFRA 4USLA 1FW4A 2LMTA 2JC2A 1DELA 1BU3A 1K93D 1LA3A 1Y1AA 1IG5A 1SL7A 5AXIA 1RECA 1M46A 2CNPA 4OKHA 3CLNA 1PVBA 1KSMA 1XYDA 1Y1UA 2AMIA 2L2EA 2ZKMX 2JNFA 3LK1A 5GQQC 3VRNA 2P70A 1OOGA 1NX0A 3D0YA 3VGOA 2JU0A 1CMGA 1SYMA 3L47A 2ZNEA 4WQ2A 1YUUA 1BOCA 1M63B 3EVRA 1F54A 2L5XB 1OOHA 1RJVA 2FJYA 3I5HC 1PALA 1N2DA 3WHTB 1JF0A 3PLFB 4AOMA 1J7PA 1FI5A 3NXAA 3R1OA 1TN4A 2K0JA 3DF0B 3CYZA 3FWCA 2G9BA 3HCMA 3DVEA 2Y5IA 1B8RA 2ZN9A 4DIRA 1GM0A 1ODBA 2LLSA 2WCKA 2Y1MA 1MQ1A 1AJ5A 3BXKA 1WLZA 1TUZA 1EG4A 3N7HA 1MHOA 1NWDA 1F4OA 3CTNA 5I94A 1YRTB 1M45A 1C07A 4BY4A 3DZTA 1BR1B 2LHLA 2Q91A 1CDMA 1TNQA 2LE9B 2JWWA 2PYQA 1DJZA 2SCPA 3H4SE 2I2RE 4YGDB 1SBJA 5JOLA 3AAJA 2LNKA 4YGEB 3D0YB 3IVTA 1WDCB 2K60A 2LVKA 1BG1A 4YI8A 1KSOA 1NX2A 3K1EA 3KHEA 3KO0A 4C0LA 2WC5A 2KQYA 3EKJA 3PN7B 3TUYC 1SRAA 2K7OA 2LCPA 1C7WA 1SSEB 3NGVA 2F33A 3A8RA 1JWDA 3TDZA 2A4JA 3VRRA 2K7CA 4DS7A 1RROA 1J7OA 2GTEA 3O4YA 1WY9A 3NHIA 4NQGA 1K9PA 1GQMA 1MXLC 1OMDA 1S5GY 3OHMB 2JNXA 4I5NB 3SS3A 3CZ0A 3VB1A 2R2IA 1B1GA 1J1EA 1OOIX 2WORA 3O2PA 2L50A 2KFHA 1WRZA 3AAKA 2MBXA 5I8NA 1B8LA 1KQMB 4F0ZB 1JFJA 3I5GC 4N5XA 2NLNA 1A03A 1DGUA 5BPJA 1CLLA 2WOSA 2JT0A 2KI6D 2WC8A 1DGVA 2P71A 2KI6C 4HREE 1YTZC 4FTGA 1KWOB 2L0PA 3GK4X 4GAOA 1VRKA 1NPQA 1EXRA 2I18A 4PHKA 1GGZA 2JXCA 1DF0A 4CLNA 5AFPA 2BE6A 1ALWA 1Y1XA 4M2OA 1PULA 1QATA 2GV5A 1QIVA 1OOJA 5EL2A 1OZOA 2E30A 3KPXA 3O78A 1QTXA 2PRUA 4XJKA 1IH0A 4KYNA 1U5IA 1IIOA 5CSJA 3L4AA 2KGBC 1JBAA 1W7IB 1S6JA 2BCBA 2OS8C 4XYNA 4MBEA 1K96A 4MZLA 1A29A 3BUWB 4E68A 1N0YA 2KNEA 5HLOA 2F3YA 1MXEA 1JFKA 3IQOA 2LV7A 1OE9B 3JTDC 1IKUA 5HL1A 2OTGB 3LLEA 2WCHA 1L7ZA 4NDBA 2H61C 2BAPA 1QXPA 3FIAA 1SPYA 2LVVA 4MZJA 4A4CA 2F8PA 3IQQA 3PFVA 1EG3A 4WRIA 1DF0B 3JVTC 1UHJA 2E6WA 2KAXA 4PT1A 3WHUB 2QEOA 1SL9A 1JC2A 4XJKB 2GGZA 1NIWA 1U5IB 1NUBA 2QEVA 1YX8A 2HETA 4DUQA 5HKYA 2LM5A 2ZFDA 3D77A 3EVVA 2LLUA 3ICBA 1KFUL 4HRHA 2HF5A 3DF0A 3TS5C 1NP8A 4JKTA 1F8HA 4NDCA 2Q4UA 2BCAA 2JTTA 1DVIA 2PASA 1IRJA 2QEHA 3O4XA 3OB2B 1TRFA 3BOWB 4YI9A 4TNCA 2BE4A 2HQ8A 1OOFA 2JRFA 2K8MB 1B7TZ 1XVJA 2WC6A 1XFWO 1S5GZ 4IL1A 1DJWA 1MF8B 4CFQA 1P28A 3TDIA 4L9MA 2M0RA 3EKHA 1OW4A 3SJSA 1NCZA 4I5JA 1OQPA 2L4IA 1B8CA 2JQ6A 2CXJA 2WCBA 1UWOA 1SCMB 1K94A 4ORAB 3CDNA 3BQ3A 4C0JA 1W9ZA 2FCDA 2M49B 1ALVA 2DOQA 3GOFA 2G2BA 2MJWB 1Z2CB 5D69A 3TDUA 2EC6B 3D10A 2LMVA 1CLMA 4PE0A 5CPVA 4ZCUA 5CSIA 1IQ5A 2COLB 3B87A 4I5LB 1R6PA 5DKNA 1FBVA 3GK1A 2K2FA 1SKTA 3CZ2A 1OMRA 1S3PA 3OB1B 1KQVA 4U8DA 1KFUS 2BL0C 1S26D 2KFFA 1L2OC 1CFDA 1DQEA 5CSNA 3FE8A 2KYFA 4PE4A 2CBLA 4I5KA 1AVSA 4M2QA 4D1EA 2KBIA 3O6BA 4MLWA 2HQWA 2ZRSA 2BCXA 2I7AA 2L5YA 2LHIA 3TUYB 4N1GA 2KLEA 1DJHA 4Q04A 5DICA 3S0BA 1CLBA 2O5GA 3D73A 4AQJA 5HYDA 1TWOA 1B7TY 3SIAA 1BT6A 3L4LA 2QACA 1A4PA 2M29A 3EK4A 1KK8B 3DYEA 1OZSA 2FOTA 1AUIB 2KAYA 4MVFA 4CFRA 2JT3A 1QV1A 1IWQA 3EK8A 3CGAA 3NSOA 3FE9A 1CNPA 2BKHB 2L4HA 4OCIA 4P2YB 1K8UA 1WDCC 5FI6A 3OGNA 1UHIA 3S0AA 5I2OA 2QDIA 2ISDA 1N65A 5KSZA 4R1EA 3RM1A 3BUMB 3C1VA 2M1UA 4MEWA 2FCEA 1BR4B 2M1KB 3PN7C 3S0DA 1JF2A 4HSZA 1SR6C 4PDZA 1G33A 3HX4A 1AJ4A 5CSFA 2WCLA 3ZNIA 3S0EA 1CTRA 5FI2A 2KI4C 1XK4A 3VROA 1T14A 4BY5A 1YVHA 3CABA 2B1UA 3FE6A 4JD9A 1C3ZA 1BF5A 3M0WA 1FI6A 5HLVA 2LUXA 3D75A 3CWGA 1V1FA 1XFUO 1KQMC 2LVIA 4OV2A 1QX7A 2MLFC 3RZSA 1QS7A 2OS8B 2ZN8A 3I5FC 3S0GA 1MWNA 3B7AA 3UO9A 4ORCB 2VRGA 4CIDA 4GGFA 5K89A 1KWOC 3I5IB 3BOWA 2QEBA 4JPZB 1EJ3A 2EHBA 4YGAA 1EL4A 1NYAA 3DVJA 5DKQA 2JOJA 1BLQA 2HPSA 5FI7A 1AK8A 4FQOA 2LAPA 2JZIA 1H8BA 1LVCD 1TIZA 1CM1A 2WNDA 3NSLA 3PALA 2KYCA 1CMFA 1S36A 3E3RA 3NSKA 3OX6A 5AERA 1J7QA 2JTZA 5JJGA 2CCMA 3JVTB 1RK9A 1RTP1 1WRKA 1XFZO 4ZCVA 2V53A 3R1VA 3AKBA 2BBNA 1WLMA 4C0KA 1UP5A 3CR5X 1J7RA 3ZWHA 1C3YA 4PHJA 5KTYA 2F3ZA 5J3XA 2LUCA 3VRPA 1KFXL 1JSAA 1M31A 4AQIA 2LANA 3BFBA 5G08A 1UUSA 2OTGC 2MA2A 2MRDA 1MR8A 1PSRA 1S6IA 1X02A 2L51A 2PQLA 1G4YR 1XFVO 4OVNF 3SG2A 3VRQA 1XA5A 2Y1NA 3SS4A 3CR4X 1DT7B 4QJ3B 3D78A 3KF9A 1BMOA 2WCEA 1B9AA 4GUKA 4ICBA 5I2QA 4ETOA 4PE1A 4WQ3A 2NCPA 5D3OA 2AUCA 1Q80A 2I94A 2CTNA 3CR2A 1YRUB 2KPHA 2AAOA 1SMGA 1UHNA 1YURA 5F6TA 1TNXA 2D8NA 2NZ0A 4F7FA 1XO5A 1CM4A 1ZACA 3UNWA 1Y6WA 1H4BA 3LK0A 2KFGA 1CFPA 1SL8A 1WRLA 1QIWA 3I5HB 4M2PA 2KDHA 2IS9A 3OX5A 3V2LA 2LP2A 3SS5A 3LCPC 2KQ6A 4PCWA 1FF1A 1R2UA 1OSAA 1PK0D 2L2CA 2H2KA 1K9UA 3PJIA 1FPWA 2MHHA 1F4QA 1CDLA 4P5OE 2KAVA 1RFJA 5KU1A 1NX3A 1CDPA 3SG5A 1DEKA 3AKAA 3DY9A 1HQVA 3B86A 2M3WA 1KFXS 3PM8A 1EH2A 1SCMC 1CFFA 3A4UB 2BL0B 1Y0VH 2JT8A 3BFAA 4GBAA 5AEQA 1L2OB 1OMVA 2ZNDA 3CZ1A 4DCKA 1DJGA 1ZOTB 3QRXA 1CKKA 4N1FA 1AP4A 3DXLA 2NXQA 4PALA 1KK7Z 1B47A 2JXLA 2PSRA 1BODA 1CB1A 3IF7A 3B88A 1SW8A 1QWVA 2EC6C 2MLEC 4A4BA 1LA0A 3BUNB 3DVKA 4HRGA 2FJUB 5TNCA 1W7JB 4JQ0D 1UHHA 1XFYO 3BUXB 2KBMA 2BKIB 1K2HA 5AANA 2KLDA 2PALA 5IBWA 2PVBA 1SNLA 1QLSA 3SG6A 1LKJA 2QPTA 1J1DA 4YBHB 1RWYA 1GJYA 4YRUA 4UPGA 1K90D 3PSRA 2JPTA 1QJTA 4OZDA 2M7NA 3I5GB 1QX2A 3PM2A 1QVIZ 2BBMA 5ER4X 3NHTA 1J55A 2O60A 3Q8IA 3TZ1A 1F70A 1A75A 1NSHA 1DTLA 3FS7A 1SR6B 2KGRA 4JWQA 2H61A 2M8UA 1LINA 1JUOA 1PVAA 3BFHA 4MZKA 4PE7A 4NDDA 3GK2A 1B4CA 3MSEB 1E8AA 3CZTX 1QASA 1YUTA 4OR9B 4GNKB 3FWBA 1CDNA 2RGIA 1KK8C 2KI4B 1D1OA 2P6BB 1NCXA 2PMYA 4GGNA 1SCVA 3DD4A 2WCJA 1TUJA 2K61A 3D76A 3EG5B 1GGWA 2NCOA 1A2XA 4INXA 1KCYA 3S0FA 1YUSA 1ZFSA 1IJ5A 2GGMA 4ORBB 4YGCB 3EVUA 3K21A 3SIBA 1IJ6A 3EK7A 3I5FB 3PATA 1S6CA 2Y4QA 5HKWA 2TN4A 3SG3A 4MSPA 2EGDA 2YGUA 3WNXB 3CS1A 1IGVA 1NCYA 1QV0A 3R72A 4MN0A 1KK7Y 3JTDB 2CT9A 4QJ5B 1IQ3A 3NSIA 1V1GA 1DMOA 4QJ4B 1A75B 3RLZA 1K9KA 1TCFA 1BJFA 1QX5B 2BNXA 3F45A 5HKZA 2LP3A 1XFXO 1S1EA
chains in the Genus database with same CATH topology
1OOIX 4INWA 3CZ2A 2ERBA 2KPHA 4F7FA 3QMEA 1DQEA 3FE8A 3R1PA 2JPOA 2P71A 1LS8A 3V2LA 2L2CA 5DICA 2H8VA 3S0BA 3PJIA 3D73A 1TWOA 3L4LA 5EL2A 3DYEA 1ORGA 2WCMA 3DY9A 3L4AA 3FE9A 3B86A 3D74A 3OGNA 3S0AA 3BFAA 2QDIA 3CZ1A 3S0DA 3DXLA 3BJHA 4FQTA 2WCHA 3B88A 2WCLA 3B6XA 1QWVA 1XFRA 3S0EA 1T14A 3FE6A 3CABA 4JD9A 1C3ZA 3D75A 2P70A 1OOGA 4PT1A 2QEOA 3L47A 3RZSA 2QEVA 3S0GA 3D77A 3B7AA 4OZDA 1OOHA 2FJYA 3NHTA 3Q8IA 2QEBA 3R1OA 3CYZA 2QEHA 3BFHA 1GM0A 1OOFA 2WCKA 2WC6A 3N7HA 3DZTA 1P28A 3R1VA 2WCJA 1TUJA 3D76A 1OW4A 4INXA 1C3YA 3S0FA 3BFBA 3CDNA 3K1EA 2PQLA 2WC5A 3R72A 3D78A 3NGVA 2GTEA 3NHIA 3B87A 3VB1A 3CZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OOI X;  4INW A;  3CZ2 A;  2ERB A;  2KPH A;  4F7F A;  3QME A;  1DQE A;  3FE8 A;  3R1P A;  2JPO A;  2P71 A;  1LS8 A;  3V2L A;  2L2C A;  5DIC A;  2H8V A;  3S0B A;  3PJI A;  3D73 A;  1TWO A;  3L4L A;  5EL2 A;  3DYE A;  1ORG A;  2WCM A;  3DY9 A;  3L4A A;  3FE9 A;  3B86 A;  3D74 A;  3OGN A;  3S0A A;  3BFA A;  2QDI A;  3CZ1 A;  3S0D A;  3DXL A;  3BJH A;  4FQT A;  2WCH A;  3B88 A;  2WCL A;  3B6X A;  1QWV A;  1XFR A;  3S0E A;  1T14 A;  3FE6 A;  3CAB A;  4JD9 A;  1C3Z A;  3D75 A;  2P70 A;  1OOG A;  4PT1 A;  2QEO A;  3L47 A;  3RZS A;  2QEV A;  3S0G A;  3D77 A;  3B7A A;  4OZD A;  1OOH A;  2FJY A;  3NHT A;  3Q8I A;  2QEB A;  3R1O A;  3CYZ A;  2QEH A;  3BFH A;  1GM0 A;  1OOF A;  2WCK A;  2WC6 A;  3N7H A;  3DZT A;  1P28 A;  3R1V A;  2WCJ A;  1TUJ A;  3D76 A;  1OW4 A;  4INX A;  1C3Y A;  3S0F A;  3BFB A;  3CDN A;  3K1E A;  2PQL A;  2WC5 A;  3R72 A;  3D78 A;  3NGV A;  2GTE A;  3NHI A;  3B87 A;  3VB1 A;  3CZ0 A; 
#chains in the Genus database with same CATH topology
 1YR5 A;  1SK6 D;  2KSP A;  5D7F A;  4INW A;  1ZUZ A;  1AHR A;  2ERB A;  2WCF A;  2LLT A;  3QME A;  1TTX A;  2M9G A;  2M7L A;  4CPV A;  3DVM A;  2LC5 A;  1CFC A;  1M39 A;  3I5I C;  1QLK A;  1LXF C;  3R1P A;  2KHN A;  2F2O A;  4GFT A;  2JPO A;  1YVL A;  2LVJ A;  5PAL A;  3TS5 B;  1YX7 A;  1QVI Y;  1LS8 A;  4MRY A;  1SY9 A;  1DJY A;  1F55 A;  4PHN A;  3SG4 A;  1TNP A;  4PHM A;  3LL8 B;  1UHK A;  1DC1 A;  2H8V A;  1ZMZ A;  1PSB A;  3OBV A;  2K2A A;  2JUL A;  4MRX A;  5B8I B;  2K7D A;  1TNW A;  1PRW A;  3SG7 A;  1XK4 C;  3BUO B;  1DJX A;  4IJ7 A;  2L98 A;  1UUR A;  1Z4H A;  2BEC A;  1F71 A;  1ORG A;  1HT9 A;  2F2P A;  2WCM A;  1TCO B;  2LMU A;  4YGB B;  2MAZ A;  3WXA A;  3D74 A;  2OPO A;  4DRW A;  1TOP A;  2SAS A;  3OP0 A;  5ER5 A;  2M97 A;  3BYA A;  2K7B A;  1C7V A;  4GPL B;  1K95 A;  5I2L A;  1G8I A;  5DKR A;  2KOT A;  1MUX A;  5FYX A;  3BJH A;  1NX1 A;  4GGF C;  4FQT A;  1DJI A;  3KEV A;  2ZRT A;  3B6X A;  1XFR A;  4USL A;  1FW4 A;  2LMT A;  2JC2 A;  1DEL A;  1BU3 A;  1K93 D;  1LA3 A;  1Y1A A;  1IG5 A;  1SL7 A;  5AXI A;  1REC A;  1M46 A;  2CNP A;  4OKH A;  3CLN A;  1PVB A;  1KSM A;  1XYD A;  1Y1U A;  2AMI A;  2L2E A;  2ZKM X;  2JNF A;  3LK1 A;  5GQQ C;  3VRN A;  2P70 A;  1OOG A;  1NX0 A;  3D0Y A;  3VGO A;  2JU0 A;  1CMG A;  1SYM A;  3L47 A;  2ZNE A;  4WQ2 A;  1YUU A;  1BOC A;  1M63 B;  3EVR A;  1F54 A;  2L5X B;  1OOH A;  1RJV A;  2FJY A;  3I5H C;  1PAL A;  1N2D A;  3WHT B;  1JF0 A;  3PLF B;  4AOM A;  1J7P A;  1FI5 A;  3NXA A;  3R1O A;  1TN4 A;  2K0J A;  3DF0 B;  3CYZ A;  3FWC A;  2G9B A;  3HCM A;  3DVE A;  2Y5I A;  1B8R A;  2ZN9 A;  4DIR A;  1GM0 A;  1ODB A;  2LLS A;  2WCK A;  2Y1M A;  1MQ1 A;  1AJ5 A;  3BXK A;  1WLZ A;  1TUZ A;  1EG4 A;  3N7H A;  1MHO A;  1NWD A;  1F4O A;  3CTN A;  5I94 A;  1YRT B;  1M45 A;  1C07 A;  4BY4 A;  3DZT A;  1BR1 B;  2LHL A;  2Q91 A;  1CDM A;  1TNQ A;  2LE9 B;  2JWW A;  2PYQ A;  1DJZ A;  2SCP A;  3H4S E;  2I2R E;  4YGD B;  1SBJ A;  5JOL A;  3AAJ A;  2LNK A;  4YGE B;  3D0Y B;  3IVT A;  1WDC B;  2K60 A;  2LVK A;  1BG1 A;  4YI8 A;  1KSO A;  1NX2 A;  3K1E A;  3KHE A;  3KO0 A;  4C0L A;  2WC5 A;  2KQY A;  3EKJ A;  3PN7 B;  3TUY C;  1SRA A;  2K7O A;  2LCP A;  1C7W A;  1SSE B;  3NGV A;  2F33 A;  3A8R A;  1JWD A;  3TDZ A;  2A4J A;  3VRR A;  2K7C A;  4DS7 A;  1RRO A;  1J7O A;  2GTE A;  3O4Y A;  1WY9 A;  3NHI A;  4NQG A;  1K9P A;  1GQM A;  1MXL C;  1OMD A;  1S5G Y;  3OHM B;  2JNX A;  4I5N B;  3SS3 A;  3CZ0 A;  3VB1 A;  2R2I A;  1B1G A;  1J1E A;  1OOI X;  2WOR A;  3O2P A;  2L50 A;  2KFH A;  1WRZ A;  3AAK A;  2MBX A;  5I8N A;  1B8L A;  1KQM B;  4F0Z B;  1JFJ A;  3I5G C;  4N5X A;  2NLN A;  1A03 A;  1DGU A;  5BPJ A;  1CLL A;  2WOS A;  2JT0 A;  2KI6 D;  2WC8 A;  1DGV A;  2P71 A;  2KI6 C;  4HRE E;  1YTZ C;  4FTG A;  1KWO B;  2L0P A;  3GK4 X;  4GAO A;  1VRK A;  1NPQ A;  1EXR A;  2I18 A;  4PHK A;  1GGZ A;  2JXC A;  1DF0 A;  4CLN A;  5AFP A;  2BE6 A;  1ALW A;  1Y1X A;  4M2O A;  1PUL A;  1QAT A;  2GV5 A;  1QIV A;  1OOJ A;  5EL2 A;  1OZO A;  2E30 A;  3KPX A;  3O78 A;  1QTX A;  2PRU A;  4XJK A;  1IH0 A;  4KYN A;  1U5I A;  1IIO A;  5CSJ A;  3L4A A;  2KGB C;  1JBA A;  1W7I B;  1S6J A;  2BCB A;  2OS8 C;  4XYN A;  4MBE A;  1K96 A;  4MZL A;  1A29 A;  3BUW B;  4E68 A;  1N0Y A;  2KNE A;  5HLO A;  2F3Y A;  1MXE A;  1JFK A;  3IQO A;  2LV7 A;  1OE9 B;  3JTD C;  1IKU A;  5HL1 A;  2OTG B;  3LLE A;  2WCH A;  1L7Z A;  4NDB A;  2H61 C;  2BAP A;  1QXP A;  3FIA A;  1SPY A;  2LVV A;  4MZJ A;  4A4C A;  2F8P A;  3IQQ A;  3PFV A;  1EG3 A;  4WRI A;  1DF0 B;  3JVT C;  1UHJ A;  2E6W A;  2KAX A;  4PT1 A;  3WHU B;  2QEO A;  1SL9 A;  1JC2 A;  4XJK B;  2GGZ A;  1NIW A;  1U5I B;  1NUB A;  2QEV A;  1YX8 A;  2HET A;  4DUQ A;  5HKY A;  2LM5 A;  2ZFD A;  3D77 A;  3EVV A;  2LLU A;  3ICB A;  1KFU L;  4HRH A;  2HF5 A;  3DF0 A;  3TS5 C;  1NP8 A;  4JKT A;  1F8H A;  4NDC A;  2Q4U A;  2BCA A;  2JTT A;  1DVI A;  2PAS A;  1IRJ A;  2QEH A;  3O4X A;  3OB2 B;  1TRF A;  3BOW B;  4YI9 A;  4TNC A;  2BE4 A;  2HQ8 A;  1OOF A;  2JRF A;  2K8M B;  1B7T Z;  1XVJ A;  2WC6 A;  1XFW O;  1S5G Z;  4IL1 A;  1DJW A;  1MF8 B;  4CFQ A;  1P28 A;  3TDI A;  4L9M A;  2M0R A;  3EKH A;  1OW4 A;  3SJS A;  1NCZ A;  4I5J A;  1OQP A;  2L4I A;  1B8C A;  2JQ6 A;  2CXJ A;  2WCB A;  1UWO A;  1SCM B;  1K94 A;  4ORA B;  3CDN A;  3BQ3 A;  4C0J A;  1W9Z A;  2FCD A;  2M49 B;  1ALV A;  2DOQ A;  3GOF A;  2G2B A;  2MJW B;  1Z2C B;  5D69 A;  3TDU A;  2EC6 B;  3D10 A;  2LMV A;  1CLM A;  4PE0 A;  5CPV A;  4ZCU A;  5CSI A;  1IQ5 A;  2COL B;  3B87 A;  4I5L B;  1R6P A;  5DKN A;  1FBV A;  3GK1 A;  2K2F A;  1SKT A;  3CZ2 A;  1OMR A;  1S3P A;  3OB1 B;  1KQV A;  4U8D A;  1KFU S;  2BL0 C;  1S26 D;  2KFF A;  1L2O C;  1CFD A;  1DQE A;  5CSN A;  3FE8 A;  2KYF A;  4PE4 A;  2CBL A;  4I5K A;  1AVS A;  4M2Q A;  4D1E A;  2KBI A;  3O6B A;  4MLW A;  2HQW A;  2ZRS A;  2BCX A;  2I7A A;  2L5Y A;  2LHI A;  3TUY B;  4N1G A;  2KLE A;  1DJH A;  4Q04 A;  5DIC A;  3S0B A;  1CLB A;  2O5G A;  3D73 A;  4AQJ A;  5HYD A;  1TWO A;  1B7T Y;  3SIA A;  1BT6 A;  3L4L A;  2QAC A;  1A4P A;  2M29 A;  3EK4 A;  1KK8 B;  3DYE A;  1OZS A;  2FOT A;  1AUI B;  2KAY A;  4MVF A;  4CFR A;  2JT3 A;  1QV1 A;  1IWQ A;  3EK8 A;  3CGA A;  3NSO A;  3FE9 A;  1CNP A;  2BKH B;  2L4H A;  4OCI A;  4P2Y B;  1K8U A;  1WDC C;  5FI6 A;  3OGN A;  1UHI A;  3S0A A;  5I2O A;  2QDI A;  2ISD A;  1N65 A;  5KSZ A;  4R1E A;  3RM1 A;  3BUM B;  3C1V A;  2M1U A;  4MEW A;  2FCE A;  1BR4 B;  2M1K B;  3PN7 C;  3S0D A;  1JF2 A;  4HSZ A;  1SR6 C;  4PDZ A;  1G33 A;  3HX4 A;  1AJ4 A;  5CSF A;  2WCL A;  3ZNI A;  3S0E A;  1CTR A;  5FI2 A;  2KI4 C;  1XK4 A;  3VRO A;  1T14 A;  4BY5 A;  1YVH A;  3CAB A;  2B1U A;  3FE6 A;  4JD9 A;  1C3Z A;  1BF5 A;  3M0W A;  1FI6 A;  5HLV A;  2LUX A;  3D75 A;  3CWG A;  1V1F A;  1XFU O;  1KQM C;  2LVI A;  4OV2 A;  1QX7 A;  2MLF C;  3RZS A;  1QS7 A;  2OS8 B;  2ZN8 A;  3I5F C;  3S0G A;  1MWN A;  3B7A A;  3UO9 A;  4ORC B;  2VRG A;  4CID A;  4GGF A;  5K89 A;  1KWO C;  3I5I B;  3BOW A;  2QEB A;  4JPZ B;  1EJ3 A;  2EHB A;  4YGA A;  1EL4 A;  1NYA A;  3DVJ A;  5DKQ A;  2JOJ A;  1BLQ A;  2HPS A;  5FI7 A;  1AK8 A;  4FQO A;  2LAP A;  2JZI A;  1H8B A;  1LVC D;  1TIZ A;  1CM1 A;  2WND A;  3NSL A;  3PAL A;  2KYC A;  1CMF A;  1S36 A;  3E3R A;  3NSK A;  3OX6 A;  5AER A;  1J7Q A;  2JTZ A;  5JJG A;  2CCM A;  3JVT B;  1RK9 A;  1RTP 1;  1WRK A;  1XFZ O;  4ZCV A;  2V53 A;  3R1V A;  3AKB A;  2BBN A;  1WLM A;  4C0K A;  1UP5 A;  3CR5 X;  1J7R A;  3ZWH A;  1C3Y A;  4PHJ A;  5KTY A;  2F3Z A;  5J3X A;  2LUC A;  3VRP A;  1KFX L;  1JSA A;  1M31 A;  4AQI A;  2LAN A;  3BFB A;  5G08 A;  1UUS A;  2OTG C;  2MA2 A;  2MRD A;  1MR8 A;  1PSR A;  1S6I A;  1X02 A;  2L51 A;  2PQL A;  1G4Y R;  1XFV O;  4OVN F;  3SG2 A;  3VRQ A;  1XA5 A;  2Y1N A;  3SS4 A;  3CR4 X;  1DT7 B;  4QJ3 B;  3D78 A;  3KF9 A;  1BMO A;  2WCE A;  1B9A A;  4GUK A;  4ICB A;  5I2Q A;  4ETO A;  4PE1 A;  4WQ3 A;  2NCP A;  5D3O A;  2AUC A;  1Q80 A;  2I94 A;  2CTN A;  3CR2 A;  1YRU B;  2KPH A;  2AAO A;  1SMG A;  1UHN A;  1YUR A;  5F6T A;  1TNX A;  2D8N A;  2NZ0 A;  4F7F A;  1XO5 A;  1CM4 A;  1ZAC A;  3UNW A;  1Y6W A;  1H4B A;  3LK0 A;  2KFG A;  1CFP A;  1SL8 A;  1WRL A;  1QIW A;  3I5H B;  4M2P A;  2KDH A;  2IS9 A;  3OX5 A;  3V2L A;  2LP2 A;  3SS5 A;  3LCP C;  2KQ6 A;  4PCW A;  1FF1 A;  1R2U A;  1OSA A;  1PK0 D;  2L2C A;  2H2K A;  1K9U A;  3PJI A;  1FPW A;  2MHH A;  1F4Q A;  1CDL A;  4P5O E;  2KAV A;  1RFJ A;  5KU1 A;  1NX3 A;  1CDP A;  3SG5 A;  1DEK A;  3AKA A;  3DY9 A;  1HQV A;  3B86 A;  2M3W A;  1KFX S;  3PM8 A;  1EH2 A;  1SCM C;  1CFF A;  3A4U B;  2BL0 B;  1Y0V H;  2JT8 A;  3BFA A;  4GBA A;  5AEQ A;  1L2O B;  1OMV A;  2ZND A;  3CZ1 A;  4DCK A;  1DJG A;  1ZOT B;  3QRX A;  1CKK A;  4N1F A;  1AP4 A;  3DXL A;  2NXQ A;  4PAL A;  1KK7 Z;  1B47 A;  2JXL A;  2PSR A;  1BOD A;  1CB1 A;  3IF7 A;  3B88 A;  1SW8 A;  1QWV A;  2EC6 C;  2MLE C;  4A4B A;  1LA0 A;  3BUN B;  3DVK A;  4HRG A;  2FJU B;  5TNC A;  1W7J B;  4JQ0 D;  1UHH A;  1XFY O;  3BUX B;  2KBM A;  2BKI B;  1K2H A;  5AAN A;  2KLD A;  2PAL A;  5IBW A;  2PVB A;  1SNL A;  1QLS A;  3SG6 A;  1LKJ A;  2QPT A;  1J1D A;  4YBH B;  1RWY A;  1GJY A;  4YRU A;  4UPG A;  1K90 D;  3PSR A;  2JPT A;  1QJT A;  4OZD A;  2M7N A;  3I5G B;  1QX2 A;  3PM2 A;  1QVI Z;  2BBM A;  5ER4 X;  3NHT A;  1J55 A;  2O60 A;  3Q8I A;  3TZ1 A;  1F70 A;  1A75 A;  1NSH A;  1DTL A;  3FS7 A;  1SR6 B;  2KGR A;  4JWQ A;  2H61 A;  2M8U A;  1LIN A;  1JUO A;  1PVA A;  3BFH A;  4MZK A;  4PE7 A;  4NDD A;  3GK2 A;  1B4C A;  3MSE B;  1E8A A;  3CZT X;  1QAS A;  1YUT A;  4OR9 B;  4GNK B;  3FWB A;  1CDN A;  2RGI A;  1KK8 C;  2KI4 B;  1D1O A;  2P6B B;  1NCX A;  2PMY A;  4GGN A;  1SCV A;  3DD4 A;  2WCJ A;  1TUJ A;  2K61 A;  3D76 A;  3EG5 B;  1GGW A;  2NCO A;  1A2X A;  4INX A;  1KCY A;  3S0F A;  1YUS A;  1ZFS A;  1IJ5 A;  2GGM A;  4ORB B;  4YGC B;  3EVU A;  3K21 A;  3SIB A;  1IJ6 A;  3EK7 A;  3I5F B;  3PAT A;  1S6C A;  2Y4Q A;  5HKW A;  2TN4 A;  3SG3 A;  4MSP A;  2EGD A;  2YGU A;  3WNX B;  3CS1 A;  1IGV A;  1NCY A;  1QV0 A;  3R72 A;  4MN0 A;  1KK7 Y;  3JTD B;  2CT9 A;  4QJ5 B;  1IQ3 A;  3NSI A;  1V1G A;  1DMO A;  4QJ4 B;  1A75 B;  3RLZ A;  1K9K A;  1TCF A;  1BJF A;  1QX5 B;  2BNX A;  3F45 A;  5HKZ A;  2LP3 A;  1XFX O;  1S1E A; 
#chains in the Genus database with same CATH homology
 1OOI X;  4INW A;  3CZ2 A;  2ERB A;  2KPH A;  4F7F A;  3QME A;  1DQE A;  3FE8 A;  3R1P A;  2JPO A;  2P71 A;  1LS8 A;  3V2L A;  2L2C A;  5DIC A;  2H8V A;  3S0B A;  3PJI A;  3D73 A;  1TWO A;  3L4L A;  5EL2 A;  3DYE A;  1ORG A;  2WCM A;  3DY9 A;  3L4A A;  3FE9 A;  3B86 A;  3D74 A;  3OGN A;  3S0A A;  3BFA A;  2QDI A;  3CZ1 A;  3S0D A;  3DXL A;  3BJH A;  4FQT A;  2WCH A;  3B88 A;  2WCL A;  3B6X A;  1QWV A;  1XFR A;  3S0E A;  1T14 A;  3FE6 A;  3CAB A;  4JD9 A;  1C3Z A;  3D75 A;  2P70 A;  1OOG A;  4PT1 A;  2QEO A;  3L47 A;  3RZS A;  2QEV A;  3S0G A;  3D77 A;  3B7A A;  4OZD A;  1OOH A;  2FJY A;  3NHT A;  3Q8I A;  2QEB A;  3R1O A;  3CYZ A;  2QEH A;  3BFH A;  1GM0 A;  1OOF A;  2WCK A;  2WC6 A;  3N7H A;  3DZT A;  1P28 A;  3R1V A;  2WCJ A;  1TUJ A;  3D76 A;  1OW4 A;  4INX A;  1C3Y A;  3S0F A;  3BFB A;  3CDN A;  3K1E A;  2PQL A;  2WC5 A;  3R72 A;  3D78 A;  3NGV A;  2GTE A;  3NHI A;  3B87 A;  3VB1 A;  3CZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...