1SNLA

Nmr solution structure of the calcium-binding domain of nucleobindin (calnuc)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
99
Chain Sequence
LKEVWEELDGLDPNRFNPKTFFILHDINSDGVLDEQELEALFTKELEKVYDPKNEEDDMREMEEERLRMREHVMKNVDTNQDRLVTLEEFLASTQRKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleobindin 1
publication title Structural Studies on the Ca(2+)-binding Domain of Human Nucleobindin (Calnuc).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 19
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2004-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1snlA00
2LAPA 3EK4A 3HX4A 1G33A 3LL8B 4JPZB 2BL0C 5CSIA 3FWCA 2MA2A 1AK8A 1PSBA 3C1VA 2EC6C 4WQ3A 4M2PA 3SG4A 1JF2A 1J1EA 1Y1UA 1IQ3A 1B1GA 2F2OA 1R6PA 4YGBB 1FI5A 1QV0A 1S6JA 4BY4A 4WQ2A 4ZCVA 3AKAA 1IGVA 2SASA 3CTNA 1BT6A 2K61A 1E8AA 2ZFDA 3BUMB 4M2QA 1NX3A 1TOPA 2LVKA 1TIZA 2PMYA 4OKHA 1J7PA 1YRTB 1S5GY 3SG3A 4DIRA 2AUCA 3BOWA 1PALA 3E3RA 2M49B 1FF1A 2JQ6A 3TS5C 4A4BA 2PSRA 1DJIA 2Q4UA 4C0JA 1JBAA 1Q80A 4GGFA 1QS7A 3AAJA 1KQVA 4D1EA 2NCOA 1FBVA 1CTRA 5CSJA 2JT0A 1ODBA 1J55A 3O4YA 4GBAA 4JWQA 3ZNIA 3TZ1A 1QV1A 1ALWA 1DGVA 1YUSA 2MJWB 3DVKA 2WNDA 1K94A 5B8IB 1S6CA 1OMVA 1TNQA 3H4SE 1DJZA 2KI4B 2PALA 1YX7A 1CDNA 2ZN8A 2NXQA 3NSIA 4HREE 1J7RA 3VRQA 3NSKA 1NX0A 4TNCA 1OSAA 2JULA 1DMOA 2D8NA 1K9PA 1JUOA 5IBWA 1QVIY 1KFUS 1LVCD 2CXJA 3AAKA 4PCWA 2K2FA 2BBMA 1F8HA 1QXPA 1JF0A 2LHIA 1U5IA 1DJWA 2LC5A 4MN0A 2E6WA 2O60A 4PHJA 5AFPA 1SMGA 3BYAA 1BMOA 1B8RA 1WRLA 3WNXB 1KK7Z 2LUXA 4WRIA 1K96A 2KDHA 2SCPA 1GGWA 5ER5A 3IF7A 5HLVA 4DUQA 4P5OE 1JC2A 2A4JA 3NXAA 4I5NB 5J3XA 3I5FB 1BR4B 1KK7Y 2RGIA 4OCIA 5BPJA 4DS7A 1UHNA 3GK4X 3ZWHA 1SNLA 3TUYC 1WLZA 1OQPA 1OZSA 2LMVA 3EVUA 3JVTC 1JFJA 1CFDA 1YTZC 1IRJA 4ZCUA 1M45A 3SIBA 2GGMA 1SL9A 1CMGA 1B47A 1K93D 4PHNA 1CLBA 4XYNA 1AP4A 4PE1A 1DJHA 1ALVA 3K21A 4CLNA 1DJYA 2KSPA 2EHBA 1OE9B 3CLNA 2M97A 1MXEA 1K9KA 1CM1A 1F70A 4MLWA 1PRWA 1RK9A 4UPGA 2BKIB 1B4CA 2OTGB 2Y5IA 2KQYA 1R2UA 2LM5A 4JQ0D 2KGBC 1QX5B 4GNKB 4N1GA 1KSOA 1S26D 1EXRA 1ZUZA 1CFFA 3MSEB 3CR5X 1FPWA 1SCMB 4N5XA 3D0YB 3DD4A 3KO0A 2CCMA 4PDZA 1BU3A 1K90D 1K9UA 4MZKA 2K2AA 3DF0B 4MRXA 1AHRA 3LK1A 1XO5A 2MHHA 1QX2A 1V1GA 3HCMA 3D10A 1IJ6A 2OPOA 1SL7A 1NSHA 3NSOA 3SJSA 2GGZA 2BKHB 2BECA 4L9MA 2AAOA 1SY9A 1S3PA 2LANA 4ICBA 1QLKA 1RECA 4QJ3B 1IH0A 1M39A 4YI9A 1YRUB 1U5IB 5KTYA 1HT9A 2LLUA 3CS1A 3I5GC 5D7FA 4BY5A 1KFXS 3I5HC 1KQMC 1TCOB 2G2BA 2LE9B 1CM4A 2ZNDA 3IQOA 2ZRTA 3BQ3A 1GJYA 1XFVO 2L2EA 4E68A 1XK4C 2WOSA 3FWBA 1J7QA 3BUNB 1RJVA 1Y6WA 1IJ5A 1KK8C 5K89A 2AMIA 1RTP1 2L4HA 2WCEA 2JWWA 4MSPA 4NQGA 2LHLA 1H4BA 2IS9A 1JFKA 1ZFSA 2K0JA 1OOJA 4USLA 1C7VA 1BODA 1CNPA 1QIWA 2PASA 2QPTA 1NYAA 4YBHB 2CBLA 1NCYA 2BL0B 2M9GA 4YI8A 2JZIA 1L7ZA 1EG3A 3OX5A 3GK2A 3LCPC 2EC6B 2I94A 2DOQA 1CLMA 2KNEA 2L51A 1MXLC 1UURA 2EGDA 5CSNA 5AXIA 1CMFA 1Y1XA 1JSAA 4P2YB 2HQ8A 2JXCA 1B8LA 3D0YA 2H2KA 1QATA 2LVVA 1XFWO 3DF0A 5I2OA 4Q04A 1XA5A 2M7LA 4HRGA 1TNXA 2O5GA 3TS5B 2PRUA 2LUCA 1N65A 1QLSA 2LP2A 1NPQA 3CR2A 1L2OC 2I7AA 4I5LB 1BOCA 2LV7A 3CZTX 3I5IC 4NDCA 4FTGA 5GQQC 2BCAA 4C0LA 2ZN9A 2TN4A 3VRNA 4MVFA 1BLQA 1YVHA 1F4QA 1MWNA 1MF8B 1DF0B 1OMDA 2BBNA 2OS8C 2M1KB 1CLLA 2WCBA 3A8RA 4YGEB 1SL8A 3KEVA 1B7TZ 1UP5A 1QTXA 1XFUO 2MLFC 5FYXA 1CDPA 1J1DA 3PM8A 4MBEA 5HLOA 4CFQA 1J7OA 1MUXA 1PVAA 4M2OA 2LMUA 1WY9A 4PE7A 2K7CA 2HQWA 1A75A 1Y1AA 1ZOTB 2L0PA 1MR8A 1AJ4A 3CR4X 3PN7C 3JTDC 2KYFA 1GGZA 1EL4A 4GAOA 3RM1A 2CNPA 1TNPA 2LMTA 3BUWB 3WXAA 1PULA 2WORA 2ZRSA 3PFVA 2KBMA 5KU1A 2LVIA 2KFGA 1NUBA 3FIAA 1NCZA 3LLEA 1M46A 1DVIA 3PALA 1AJ5A 3OHMB 5CPVA 1XK4A 2JC2A 3PSRA 1XFZO 1WDCC 4GGFC 4PALA 1KWOC 1XVJA 1KCYA 3F45A 1F71A 2F3ZA 1VRKA 3SG7A 2F3YA 2JTTA 3BUXB 5DKQA 1LA3A 3TUYB 2L4IA 3GOFA 4I5KA 2KGRA 4C0KA 2NCPA 3PATA 4QJ4B 3JVTB 1WRKA 2BE6A 1YR5A 3O78A 2BCXA 1B9AA 1EH2A 4DCKA 1SW8A 1G8IA 1A2XA 5I2LA 1AUIB 2JNFA 1PK0D 2M1UA 3BXKA 1LA0A 1SBJA 3DVJA 1FI6A 1S6IA 2JRFA 1CFPA 2JNXA 1EG4A 1XFXO 1K2HA 1DF0A 5I2QA 1HQVA 1KFUL 4XJKB 3SG5A 2FCDA 3NSLA 1DJXA 3KF9A 4CFRA 1QJTA 1SK6D 1X02A 1TN4A 3M0WA 4AQJA 3SG6A 4GUKA 1XFYO 3EVRA 2B1UA 2K8MB 1BF5A 5HYDA 2LLTA 3A4UB 1RWYA 1TCFA 3TDIA 1N0YA 3FS7A 3SG2A 1M31A 1NX2A 1CDMA 2BE4A 1BJFA 4GGNA 1YX8A 3VRRA 1NCXA 2KHNA 2KFHA 4A4CA 5HKYA 2H61C 1NP8A 3TDUA 2F33A 3BUOB 1JWDA 2MAZA 4ETOA 4OV2A 2M3WA 1PSRA 2WC8A 2JTZA 1DJGA 1A75B 1A03A 4OR9B 2F2PA 4HRHA 1UUSA 2M7NA 3GK1A 4GFTA 2LLSA 4MRYA 2MRDA 3VROA 1K8UA 5JJGA 4IL1A 3I5GB 1S5GZ 2I18A 3EK7A 3OB2B 3I5HB 1KQMB 1K95A 1A4PA 2KYCA 1M63B 3AKBA 5G08A 2CT9A 2JXLA 1G4YR 2KI6D 4AQIA 3VGOA 1QIVA 2KI4C 4PHMA 3EK8A 1GQMA 1OZOA 5HKWA 3WHTB 1S36A 2BCBA 2VRGA 1KK8B 2ZNEA 4GPLB 1LXFC 1OMRA 1UWOA 2HPSA 1IG5A 4N1FA 4OVNF 3KPXA 3SIAA 2FJUB 2L50A 4XJKA 3CWGA 2QACA 4YRUA 2JOJA 2G9BA 2Y1NA 2Y4QA 4HSZA 3EKJA 2V53A 5D69A 5PALA 1NWDA 1KSMA 2MBXA 2JT8A 1Y0VH 2M0RA 1CKKA 1ZACA 3OB1B 4YGAA 1QVIZ 1QASA 1A29A 1UHIA 3VRPA 1MQ1A 3CGAA 1YUUA 2JPTA 2KAXA 4ORBB 2I2RE 2L5XB 1EJ3A 1F54A 1DGUA 1C07A 1WLMA 3I5FC 5CSFA 2FOTA 3WHUB 4FQOA 1CDLA 2L98A 2Q91A 3OX6A 4MZJA 2P6BB 3OP0A 2LCPA 5DKNA 1YUTA 1S1EA 1KFXL 1SRAA 3IQQA 1SCVA 2NLNA 1L2OB 1H8BA 1B7TY 1BR1B 2LNKA 1PVBA 3DVEA 1CFCA 1NX1A 3I5IB 5JOLA 2JU0A 5DKRA 2KAVA 4ORAB 1YVLA 4NDDA 1C7WA 5F6TA 2HETA 2HF5A 1SR6C 1V1FA 2KI6C 4CIDA 1TNWA 2KFFA 1ZMZA 1TTXA 2OS8B 2CTNA 2NZ0A 3LK0A 4R1EA 1LINA 2H61A 2LP3A 2MLEC 2OTGC 4NDBA 2JT3A 4F0ZB 1UHJA 1N2DA 2GV5A 4YGCB 1DTLA 4YGDB 3EVVA 2KOTA 5TNCA 2WCFA 2K7OA 2R2IA 1XYDA 2KQ6A 4PE4A 3PN7B 3JTDB 1SCMC 1IQ5A 4DRWA 2K7BA 1SPYA 2LVJA 1F55A 5HKZA 2F8PA 4QJ5B 3DVMA 1FW4A 3BOWB 3RLZA 1W7IB 1TRFA 1SR6B 3KHEA 1W7JB 1BG1A 1RFJA 2PVBA 5ER4X 1B8CA 1IKUA 3O6BA 1WDCB 2KAYA 2KBIA 4MEWA 4ORCB 1KWOB 4PE0A 3QRXA 1F4OA 5KSZA 5AEQA 1DT7B 1YURA 2FCEA 5AANA 1WRZA 2ZKMX 1SKTA 2Y1MA 1UHHA 4CPVA 1CB1A 1QX7A 3PLFB 5I8NA 1SYMA 3TDZA 1NIWA 3O2PA 2M29A 3EKHA 4U8DA 2ISDA 4MZLA 4AOMA 1LKJA 1D1OA 2K7DA 1MHOA 2E30A 4I5JA 1UHKA 2COLB 5AERA 1RROA 1IWQA 3ICBA 2M8UA 1AVSA 4PHKA
chains in the Genus database with same CATH superfamily
2LAPA 1TUZA 3EK4A 3HX4A 3V2LA 1G33A 3LL8B 4JPZB 3SS4A 2BL0C 5CSIA 3FWCA 2MA2A 1AK8A 1PSBA 3C1VA 2EC6C 4WQ3A 4M2PA 3SG4A 1JF2A 1J1EA 1Y1UA 1IQ3A 2KLEA 2F2OA 1R6PA 4YGBB 1FI5A 1QV0A 1S6JA 4BY4A 4WQ2A 4ZCVA 3AKAA 1IGVA 3R1OA 2SASA 1IIOA 3CTNA 1BT6A 2K61A 1E8AA 2ZFDA 3BUMB 4M2QA 1NX3A 1TOPA 2LVKA 1TIZA 2PMYA 4OKHA 1J7PA 1YRTB 1S5GY 3SG3A 4DIRA 2AUCA 3BOWA 1OOGA 1PALA 3E3RA 3S0EA 2M49B 1FF1A 2JQ6A 3TS5C 4A4BA 2PSRA 4IJ7A 1DJIA 2Q4UA 4C0JA 1JBAA 1Q80A 2JPOA 3CYZA 4GGFA 1QS7A 3AAJA 1KQVA 4D1EA 2NCOA 3NGVA 1FBVA 1CTRA 5CSJA 2JT0A 1ODBA 1J55A 3O4YA 4GBAA 4JWQA 3ZNIA 3TZ1A 1QV1A 1ALWA 1DGVA 1YUSA 2MJWB 3DVKA 2WNDA 1K94A 1OOHA 1S6CA 1OMVA 3NHIA 5B8IB 1TNQA 3H4SE 1DJZA 2KI4B 2PALA 1YX7A 3S0AA 1CDNA 2ZN8A 2NXQA 3NSIA 4HREE 1J7RA 3SS3A 3VRQA 3NSKA 1NX0A 4TNCA 1OSAA 2JULA 1DMOA 3B88A 2D8NA 1K9PA 1JUOA 5IBWA 1QVIY 3D73A 1KFUS 1LVCD 2CXJA 3AAKA 4PCWA 2K2FA 2BBMA 1F8HA 1QXPA 1JF0A 2LHIA 1U5IA 5FI6A 1DQEA 1DJWA 2LC5A 4MN0A 2E6WA 2O60A 4PHJA 2QEBA 5AFPA 3PM2A 1SMGA 5I94A 3BYAA 1BMOA 1B8RA 1WRLA 3WNXB 1KK7Z 2LUXA 4WRIA 1K96A 2KDHA 2SCPA 1GGWA 5ER5A 3IF7A 5HLVA 1P28A 2H8VA 4DUQA 4P5OE 1JC2A 2A4JA 3NXAA 4I5NB 5J3XA 3I5FB 1BR4B 1KK7Y 2KPHA 2RGIA 4OCIA 5BPJA 4DS7A 1UHNA 3GK4X 3ZWHA 1SNLA 3TUYC 1WLZA 2WCJA 1OQPA 1OZSA 2LMVA 3EVUA 3JVTC 1JFJA 1CFDA 1YTZC 1IRJA 4ZCUA 1M45A 3SIBA 2GGMA 1SL9A 1CMGA 1B47A 1K93D 4PHNA 1CLBA 4XYNA 3N7HA 3PJIA 1AP4A 4PE1A 1DJHA 1ALVA 3K21A 3DY9A 3OBVA 4CLNA 1DJYA 2KSPA 2EHBA 1OE9B 3CLNA 2M97A 1MXEA 1K9KA 1CM1A 1F70A 3OGNA 4MLWA 1PRWA 1RK9A 4UPGA 2BKIB 1B4CA 2OTGB 2Y5IA 2KQYA 3NHTA 1R2UA 2LM5A 4JQ0D 2KGBC 1QX5B 4GNKB 4N1GA 1KSOA 3CZ1A 1LS8A 1S26D 1EXRA 1ZUZA 1CFFA 2BNXA 3MSEB 3CR5X 1FPWA 1SCMB 4N5XA 3D0YB 3DD4A 3KO0A 2CCMA 1ORGA 4PDZA 1BU3A 1K90D 1K9UA 4MZKA 2K2AA 3DF0B 4MRXA 1AHRA 3LK1A 1XO5A 2MHHA 1QX2A 1V1GA 3HCMA 3D10A 1IJ6A 2OPOA 1SL7A 1NSHA 3B7AA 3BFHA 3NSOA 3SJSA 2GGZA 2BKHB 2BECA 4L9MA 2AAOA 1SY9A 1S3PA 2LANA 4ICBA 1QLKA 1RECA 4QJ3B 1Z4HA 1IH0A 1M39A 4YI9A 1YRUB 1U5IB 5KTYA 1HT9A 2LLUA 3DZTA 3CS1A 3I5GC 5D7FA 4BY5A 1KFXS 3I5HC 1KQMC 1TCOB 2G2BA 2BAPA 2LE9B 1CM4A 2ZNDA 3IQOA 2ZRTA 3BQ3A 1GJYA 1XFVO 2L2EA 2WC6A 4E68A 1XK4C 2WOSA 3FWBA 1J7QA 3BUNB 1RJVA 3CZ2A 1Y6WA 1IJ5A 1KK8C 5K89A 2AMIA 1RTP1 2L4HA 2WCEA 2JWWA 4MSPA 4NQGA 2LHLA 1H4BA 2IS9A 1JFKA 2L5YA 1ZFSA 3R72A 2K0JA 1OOJA 4USLA 1C7VA 1BODA 1CNPA 1QIWA 2PASA 2QPTA 1NYAA 4YBHB 2CBLA 5HL1A 1NCYA 2BL0B 2M9GA 4YI8A 2JZIA 1L7ZA 1EG3A 3OX5A 3S0DA 3GK2A 3LCPC 2EC6B 2I94A 3BFBA 2DOQA 1CLMA 3CABA 2KNEA 2L51A 1MXLC 1UURA 2EGDA 5CSNA 5AXIA 1CMFA 1Y1XA 1JSAA 4P2YB 2HQ8A 2JXCA 1B8LA 3D0YA 2H2KA 1QATA 3QMEA 2LVVA 1XFWO 2GTEA 3DF0A 5I2OA 4Q04A 1SSEB 1XA5A 2P71A 2M7LA 4HRGA 1TNXA 2O5GA 3TS5B 2PRUA 2LUCA 5FI2A 1N65A 1QLSA 2LP2A 1NPQA 3CR2A 1L2OC 2I7AA 4I5LB 1BOCA 2LV7A 3CZTX 3I5IC 4NDCA 4FTGA 5GQQC 2BCAA 4C0LA 2ZN9A 2TN4A 3VRNA 2WCKA 3FE6A 3IVTA 4MVFA 1BLQA 2K60A 1YVHA 1F4QA 1Z2CB 1MWNA 1MF8B 1DF0B 3S0BA 1OMDA 1OOIX 2BBNA 2OS8C 2M1KB 1CLLA 3O4XA 2WCBA 3D75A 3A8RA 4YGEB 1SL8A 3KEVA 1B7TZ 1UP5A 1QTXA 1XFUO 2MLFC 3D76A 1CDPA 1J1DA 3K1EA 3PM8A 4MBEA 5FYXA 5HLOA 1MUXA 1PVAA 4CFQA 1J7OA 4M2OA 2LMUA 1WY9A 4PE7A 2K7CA 2HQWA 1A75A 1Y1AA 1ZOTB 2WCLA 2L0PA 1MR8A 1AJ4A 3CR4X 3BFAA 3PN7C 3JTDC 2KYFA 1GGZA 1EL4A 4OZDA 4GAOA 3RM1A 2CNPA 1TNPA 2LMTA 2P70A 2WCMA 2QDIA 3BUWB 1PULA 2WORA 2ZRSA 3PFVA 3BJHA 3WXAA 2KBMA 5KU1A 3DYEA 2LVIA 2KFGA 1NUBA 3FIAA 1NCZA 3LLEA 1M46A 1DVIA 3PALA 1AJ5A 3OHMB 3L4LA 1XK4A 5CPVA 2JC2A 3PSRA 1XFZO 1WDCC 4GGFC 4FQTA 4PALA 1KWOC 1B1GA 1XVJA 1KCYA 3F45A 1F71A 2F3ZA 1VRKA 3SG7A 2F3YA 2JTTA 3BUXB 5DKQA 1LA3A 3TUYB 2KLDA 2L4IA 3GOFA 2KGRA 4I5KA 2NCPA 4C0KA 3PATA 3EG5B 4QJ4B 3JVTB 1WRKA 2BE6A 1YR5A 3O78A 2BCXA 1B9AA 1EH2A 4DCKA 4F7FA 1SW8A 1G8IA 1A2XA 3L4AA 1AUIB 2JNFA 1PK0D 2M1UA 3BXKA 1LA0A 5I2LA 1SBJA 5D3OA 3DVJA 1FI6A 1S6IA 2JRFA 1DELA 1CFPA 2JNXA 1EG4A 3B6XA 1XFXO 1K2HA 1DF0A 5I2QA 1HQVA 1KFUL 4XJKB 3SG5A 2FCDA 3DXLA 1DJXA 3KF9A 3NSLA 4CFRA 1QJTA 1SK6D 1X02A 1TN4A 1XFRA 3M0WA 4AQJA 3SG6A 4GUKA 1T14A 1XFYO 3EVRA 2B1UA 2K8MB 1BF5A 5HYDA 2LLTA 3A4UB 1RWYA 1TCFA 3TDIA 1N0YA 3FS7A 3SG2A 1M31A 1NX2A 4JD9A 1CDMA 2BE4A 1BJFA 3S0GA 4GGNA 1YX8A 3VRRA 1NCXA 2KHNA 2KFHA 4A4CA 5HKYA 2H61C 1NP8A 3TDUA 2F33A 3BUOB 4PT1A 1JWDA 2MAZA 4ETOA 4OV2A 2M3WA 4JKTA 1PSRA 2WC8A 2JTZA 1DJGA 1A75B 1A03A 4OR9B 2F2PA 4HRHA 1UUSA 2M7NA 3GK1A 4KYNA 4GFTA 2LLSA 4MRYA 2MRDA 3VROA 1K8UA 5JJGA 4IL1A 3I5GB 1S5GZ 2I18A 3EK7A 3OB2B 3I5HB 1KQMB 1K95A 2PYQA 1A4PA 2KYCA 1M63B 3AKBA 5G08A 2CT9A 2JXLA 1G4YR 2QEVA 2KI6D 4AQIA 3VGOA 1QIVA 2KI4C 4PHMA 1OW4A 3EK8A 3SS5A 1GQMA 1OZOA 3FE8A 5HKWA 1S36A 2BCBA 2VRGA 1KK8B 2ZNEA 4GPLB 4INWA 3WHTB 3R1VA 4INXA 1LXFC 1OMRA 1UWOA 2HPSA 1IG5A 4N1FA 4OVNF 3KPXA 3SIAA 2FJUB 2L2CA 2L50A 4XJKA 3CWGA 2QACA 4YRUA 3UNWA 2JOJA 2G9BA 2Y1NA 1OOFA 2Y4QA 4HSZA 5DICA 3EKJA 2V53A 5D69A 2WCHA 1NWDA 1KSMA 5PALA 2JT8A 2MBXA 1GM0A 2WC5A 1Y0VH 2M0RA 3D74A 1CKKA 1ZACA 3OB1B 4YGAA 1QVIZ 1QASA 1A29A 1UHIA 3VRPA 1MQ1A 3CGAA 1YUUA 5FI7A 2JPTA 2KAXA 4ORBB 2I2RE 1DEKA 1EJ3A 2L5XB 1DGUA 1F54A 1C07A 1WLMA 2QEHA 3I5FC 5CSFA 2FOTA 3WHUB 4FQOA 1CDLA 2L98A 2Q91A 3OX6A 4MZJA 2P6BB 3OP0A 2LCPA 5DKNA 1YUTA 3CDNA 1S1EA 1KFXL 3R1PA 1SRAA 3IQQA 1SCVA 2NLNA 1L2OB 5EL2A 1B7TY 1BR1B 1H8BA 2LNKA 1PVBA 3DVEA 1CFCA 2FJYA 1NX1A 3I5IB 5JOLA 2JU0A 5DKRA 2KAVA 4ORAB 1YVLA 4NDDA 1C7WA 5F6TA 2HETA 2HF5A 1SR6C 1V1FA 2KI6C 4CIDA 1TNWA 1W9ZA 2KFFA 3CZ0A 1ZMZA 1TTXA 2OS8B 2CTNA 2NZ0A 3LK0A 4R1EA 1LINA 2H61A 2LP3A 2MLEC 2OTGC 4NDBA 2JT3A 4F0ZB 1UHJA 1N2DA 2GV5A 4YGCB 1DTLA 4YGDB 3EVVA 2KOTA 5TNCA 2WCFA 3D78A 2K7OA 2R2IA 1XYDA 2KQ6A 4PE4A 3PN7B 3JTDB 3UO9A 1SCMC 1IQ5A 4DRWA 2K7BA 1SPYA 2LVJA 1C3ZA 1F55A 5HKZA 2F8PA 4QJ5B 3DVMA 1FW4A 3BOWB 3RLZA 1W7IB 1QWVA 1TRFA 1SR6B 3FE9A 3KHEA 1W7JB 1TWOA 1BG1A 1RFJA 2PVBA 5ER4X 1DC1A 3D77A 1B8CA 1IKUA 3O6BA 1WDCB 2YGUA 2KAYA 2KBIA 4MEWA 4ORCB 1KWOB 4PE0A 2ERBA 3QRXA 1F4OA 2QEOA 1TUJA 3VB1A 5AEQA 5KSZA 1YURA 1DT7B 2FCEA 5AANA 1WRZA 2ZKMX 3B86A 1SKTA 2Y1MA 1UHHA 4CPVA 1CB1A 1QX7A 3PLFB 5I8NA 1SYMA 3TDZA 1NIWA 3O2PA 2M29A 3EKHA 4U8DA 2ISDA 4MZLA 4AOMA 1LKJA 1D1OA 2K7DA 1MHOA 2E30A 3Q8IA 4I5JA 1UHKA 3RZSA 3S0FA 2COLB 5AERA 1RROA 1IWQA 3ICBA 3B87A 2M8UA 1C3YA 1AVSA 3L47A 4PHKA 2PQLA
chains in the Genus database with same CATH topology
2LAPA 3EK4A 3HX4A 1G33A 3LL8B 4JPZB 2BL0C 5CSIA 3FWCA 2MA2A 1AK8A 1PSBA 3C1VA 2EC6C 4WQ3A 4M2PA 3SG4A 1JF2A 1J1EA 1Y1UA 1IQ3A 1B1GA 2F2OA 1R6PA 4YGBB 1FI5A 1QV0A 1S6JA 4BY4A 4WQ2A 4ZCVA 3AKAA 1IGVA 2SASA 3CTNA 1BT6A 2K61A 1E8AA 2ZFDA 3BUMB 4M2QA 1NX3A 1TOPA 2LVKA 1TIZA 2PMYA 4OKHA 1J7PA 1YRTB 1S5GY 3SG3A 4DIRA 2AUCA 3BOWA 1PALA 3E3RA 2M49B 1FF1A 2JQ6A 3TS5C 4A4BA 2PSRA 1DJIA 2Q4UA 4C0JA 1JBAA 1Q80A 4GGFA 1QS7A 3AAJA 1KQVA 4D1EA 2NCOA 1FBVA 1CTRA 5CSJA 2JT0A 1ODBA 1J55A 3O4YA 4GBAA 4JWQA 3ZNIA 3TZ1A 1QV1A 1ALWA 1DGVA 1YUSA 2MJWB 3DVKA 2WNDA 1K94A 5B8IB 1S6CA 1OMVA 1TNQA 3H4SE 1DJZA 2KI4B 2PALA 1YX7A 1CDNA 2ZN8A 2NXQA 3NSIA 4HREE 1J7RA 3VRQA 3NSKA 1NX0A 4TNCA 1OSAA 2JULA 1DMOA 2D8NA 1K9PA 1JUOA 5IBWA 1QVIY 1KFUS 1LVCD 2CXJA 3AAKA 4PCWA 2K2FA 2BBMA 1F8HA 1QXPA 1JF0A 2LHIA 1U5IA 1DJWA 2LC5A 4MN0A 2E6WA 2O60A 4PHJA 5AFPA 1SMGA 3BYAA 1BMOA 1B8RA 1WRLA 3WNXB 1KK7Z 2LUXA 4WRIA 1K96A 2KDHA 2SCPA 1GGWA 5ER5A 3IF7A 5HLVA 4DUQA 4P5OE 1JC2A 2A4JA 3NXAA 4I5NB 5J3XA 3I5FB 1BR4B 1KK7Y 2RGIA 4OCIA 5BPJA 4DS7A 1UHNA 3GK4X 3ZWHA 1SNLA 3TUYC 1WLZA 1OQPA 1OZSA 2LMVA 3EVUA 3JVTC 1JFJA 1CFDA 1YTZC 1IRJA 4ZCUA 1M45A 3SIBA 2GGMA 1SL9A 1CMGA 1B47A 1K93D 4PHNA 1CLBA 4XYNA 1AP4A 4PE1A 1DJHA 1ALVA 3K21A 4CLNA 1DJYA 2KSPA 2EHBA 1OE9B 3CLNA 2M97A 1MXEA 1K9KA 1CM1A 1F70A 4MLWA 1PRWA 1RK9A 4UPGA 2BKIB 1B4CA 2OTGB 2Y5IA 2KQYA 1R2UA 2LM5A 4JQ0D 2KGBC 1QX5B 4GNKB 4N1GA 1KSOA 1S26D 1EXRA 1ZUZA 1CFFA 3MSEB 3CR5X 1FPWA 1SCMB 4N5XA 3D0YB 3DD4A 3KO0A 2CCMA 4PDZA 1BU3A 1K90D 1K9UA 4MZKA 2K2AA 3DF0B 4MRXA 1AHRA 3LK1A 1XO5A 2MHHA 1QX2A 1V1GA 3HCMA 3D10A 1IJ6A 2OPOA 1SL7A 1NSHA 3NSOA 3SJSA 2GGZA 2BKHB 2BECA 4L9MA 2AAOA 1SY9A 1S3PA 2LANA 4ICBA 1QLKA 1RECA 4QJ3B 1IH0A 1M39A 4YI9A 1YRUB 1U5IB 5KTYA 1HT9A 2LLUA 3CS1A 3I5GC 5D7FA 4BY5A 1KFXS 3I5HC 1KQMC 1TCOB 2G2BA 2LE9B 1CM4A 2ZNDA 3IQOA 2ZRTA 3BQ3A 1GJYA 1XFVO 2L2EA 4E68A 1XK4C 2WOSA 3FWBA 1J7QA 3BUNB 1RJVA 1Y6WA 1IJ5A 1KK8C 5K89A 2AMIA 1RTP1 2L4HA 2WCEA 2JWWA 4MSPA 4NQGA 2LHLA 1H4BA 2IS9A 1JFKA 1ZFSA 2K0JA 1OOJA 4USLA 1C7VA 1BODA 1CNPA 1QIWA 2PASA 2QPTA 1NYAA 4YBHB 2CBLA 1NCYA 2BL0B 2M9GA 4YI8A 2JZIA 1L7ZA 1EG3A 3OX5A 3GK2A 3LCPC 2EC6B 2I94A 2DOQA 1CLMA 2KNEA 2L51A 1MXLC 1UURA 2EGDA 5CSNA 5AXIA 1CMFA 1Y1XA 1JSAA 4P2YB 2HQ8A 2JXCA 1B8LA 3D0YA 2H2KA 1QATA 2LVVA 1XFWO 3DF0A 5I2OA 4Q04A 1XA5A 2M7LA 4HRGA 1TNXA 2O5GA 3TS5B 2PRUA 2LUCA 1N65A 1QLSA 2LP2A 1NPQA 3CR2A 1L2OC 2I7AA 4I5LB 1BOCA 2LV7A 3CZTX 3I5IC 4NDCA 4FTGA 5GQQC 2BCAA 4C0LA 2ZN9A 2TN4A 3VRNA 4MVFA 1BLQA 1YVHA 1F4QA 1MWNA 1MF8B 1DF0B 1OMDA 2BBNA 2OS8C 2M1KB 1CLLA 2WCBA 3A8RA 4YGEB 1SL8A 3KEVA 1B7TZ 1UP5A 1QTXA 1XFUO 2MLFC 5FYXA 1CDPA 1J1DA 3PM8A 4MBEA 5HLOA 4CFQA 1J7OA 1MUXA 1PVAA 4M2OA 2LMUA 1WY9A 4PE7A 2K7CA 2HQWA 1A75A 1Y1AA 1ZOTB 2L0PA 1MR8A 1AJ4A 3CR4X 3PN7C 3JTDC 2KYFA 1GGZA 1EL4A 4GAOA 3RM1A 2CNPA 1TNPA 2LMTA 3BUWB 3WXAA 1PULA 2WORA 2ZRSA 3PFVA 2KBMA 5KU1A 2LVIA 2KFGA 1NUBA 3FIAA 1NCZA 3LLEA 1M46A 1DVIA 3PALA 1AJ5A 3OHMB 5CPVA 1XK4A 2JC2A 3PSRA 1XFZO 1WDCC 4GGFC 4PALA 1KWOC 1XVJA 1KCYA 3F45A 1F71A 2F3ZA 1VRKA 3SG7A 2F3YA 2JTTA 3BUXB 5DKQA 1LA3A 3TUYB 2L4IA 3GOFA 4I5KA 2KGRA 4C0KA 2NCPA 3PATA 4QJ4B 3JVTB 1WRKA 2BE6A 1YR5A 3O78A 2BCXA 1B9AA 1EH2A 4DCKA 1SW8A 1G8IA 1A2XA 5I2LA 1AUIB 2JNFA 1PK0D 2M1UA 3BXKA 1LA0A 1SBJA 3DVJA 1FI6A 1S6IA 2JRFA 1CFPA 2JNXA 1EG4A 1XFXO 1K2HA 1DF0A 5I2QA 1HQVA 1KFUL 4XJKB 3SG5A 2FCDA 3NSLA 1DJXA 3KF9A 4CFRA 1QJTA 1SK6D 1X02A 1TN4A 3M0WA 4AQJA 3SG6A 4GUKA 1XFYO 3EVRA 2B1UA 2K8MB 1BF5A 5HYDA 2LLTA 3A4UB 1RWYA 1TCFA 3TDIA 1N0YA 3FS7A 3SG2A 1M31A 1NX2A 1CDMA 2BE4A 1BJFA 4GGNA 1YX8A 3VRRA 1NCXA 2KHNA 2KFHA 4A4CA 5HKYA 2H61C 1NP8A 3TDUA 2F33A 3BUOB 1JWDA 2MAZA 4ETOA 4OV2A 2M3WA 1PSRA 2WC8A 2JTZA 1DJGA 1A75B 1A03A 4OR9B 2F2PA 4HRHA 1UUSA 2M7NA 3GK1A 4GFTA 2LLSA 4MRYA 2MRDA 3VROA 1K8UA 5JJGA 4IL1A 3I5GB 1S5GZ 2I18A 3EK7A 3OB2B 3I5HB 1KQMB 1K95A 1A4PA 2KYCA 1M63B 3AKBA 5G08A 2CT9A 2JXLA 1G4YR 2KI6D 4AQIA 3VGOA 1QIVA 2KI4C 4PHMA 3EK8A 1GQMA 1OZOA 5HKWA 3WHTB 1S36A 2BCBA 2VRGA 1KK8B 2ZNEA 4GPLB 1LXFC 1OMRA 1UWOA 2HPSA 1IG5A 4N1FA 4OVNF 3KPXA 3SIAA 2FJUB 2L50A 4XJKA 3CWGA 2QACA 4YRUA 2JOJA 2G9BA 2Y1NA 2Y4QA 4HSZA 3EKJA 2V53A 5D69A 5PALA 1NWDA 1KSMA 2MBXA 2JT8A 1Y0VH 2M0RA 1CKKA 1ZACA 3OB1B 4YGAA 1QVIZ 1QASA 1A29A 1UHIA 3VRPA 1MQ1A 3CGAA 1YUUA 2JPTA 2KAXA 4ORBB 2I2RE 2L5XB 1EJ3A 1F54A 1DGUA 1C07A 1WLMA 3I5FC 5CSFA 2FOTA 3WHUB 4FQOA 1CDLA 2L98A 2Q91A 3OX6A 4MZJA 2P6BB 3OP0A 2LCPA 5DKNA 1YUTA 1S1EA 1KFXL 1SRAA 3IQQA 1SCVA 2NLNA 1L2OB 1H8BA 1B7TY 1BR1B 2LNKA 1PVBA 3DVEA 1CFCA 1NX1A 3I5IB 5JOLA 2JU0A 5DKRA 2KAVA 4ORAB 1YVLA 4NDDA 1C7WA 5F6TA 2HETA 2HF5A 1SR6C 1V1FA 2KI6C 4CIDA 1TNWA 2KFFA 1ZMZA 1TTXA 2OS8B 2CTNA 2NZ0A 3LK0A 4R1EA 1LINA 2H61A 2LP3A 2MLEC 2OTGC 4NDBA 2JT3A 4F0ZB 1UHJA 1N2DA 2GV5A 4YGCB 1DTLA 4YGDB 3EVVA 2KOTA 5TNCA 2WCFA 2K7OA 2R2IA 1XYDA 2KQ6A 4PE4A 3PN7B 3JTDB 1SCMC 1IQ5A 4DRWA 2K7BA 1SPYA 2LVJA 1F55A 5HKZA 2F8PA 4QJ5B 3DVMA 1FW4A 3BOWB 3RLZA 1W7IB 1TRFA 1SR6B 3KHEA 1W7JB 1BG1A 1RFJA 2PVBA 5ER4X 1B8CA 1IKUA 3O6BA 1WDCB 2KAYA 2KBIA 4MEWA 4ORCB 1KWOB 4PE0A 3QRXA 1F4OA 5KSZA 5AEQA 1DT7B 1YURA 2FCEA 5AANA 1WRZA 2ZKMX 1SKTA 2Y1MA 1UHHA 4CPVA 1CB1A 1QX7A 3PLFB 5I8NA 1SYMA 3TDZA 1NIWA 3O2PA 2M29A 3EKHA 4U8DA 2ISDA 4MZLA 4AOMA 1LKJA 1D1OA 2K7DA 1MHOA 2E30A 4I5JA 1UHKA 2COLB 5AERA 1RROA 1IWQA 3ICBA 2M8UA 1AVSA 4PHKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LAP A;  3EK4 A;  3HX4 A;  1G33 A;  3LL8 B;  4JPZ B;  2BL0 C;  5CSI A;  3FWC A;  2MA2 A;  1AK8 A;  1PSB A;  3C1V A;  2EC6 C;  4WQ3 A;  4M2P A;  3SG4 A;  1JF2 A;  1J1E A;  1Y1U A;  1IQ3 A;  1B1G A;  2F2O A;  1R6P A;  4YGB B;  1FI5 A;  1QV0 A;  1S6J A;  4BY4 A;  4WQ2 A;  4ZCV A;  3AKA A;  1IGV A;  2SAS A;  3CTN A;  1BT6 A;  2K61 A;  1E8A A;  2ZFD A;  3BUM B;  4M2Q A;  1NX3 A;  1TOP A;  2LVK A;  1TIZ A;  2PMY A;  4OKH A;  1J7P A;  1YRT B;  1S5G Y;  3SG3 A;  4DIR A;  2AUC A;  3BOW A;  1PAL A;  3E3R A;  2M49 B;  1FF1 A;  2JQ6 A;  3TS5 C;  4A4B A;  2PSR A;  1DJI A;  2Q4U A;  4C0J A;  1JBA A;  1Q80 A;  4GGF A;  1QS7 A;  3AAJ A;  1KQV A;  4D1E A;  2NCO A;  1FBV A;  1CTR A;  5CSJ A;  2JT0 A;  1ODB A;  1J55 A;  3O4Y A;  4GBA A;  4JWQ A;  3ZNI A;  3TZ1 A;  1QV1 A;  1ALW A;  1DGV A;  1YUS A;  2MJW B;  3DVK A;  2WND A;  1K94 A;  5B8I B;  1S6C A;  1OMV A;  1TNQ A;  3H4S E;  1DJZ A;  2KI4 B;  2PAL A;  1YX7 A;  1CDN A;  2ZN8 A;  2NXQ A;  3NSI A;  4HRE E;  1J7R A;  3VRQ A;  3NSK A;  1NX0 A;  4TNC A;  1OSA A;  2JUL A;  1DMO A;  2D8N A;  1K9P A;  1JUO A;  5IBW A;  1QVI Y;  1KFU S;  1LVC D;  2CXJ A;  3AAK A;  4PCW A;  2K2F A;  2BBM A;  1F8H A;  1QXP A;  1JF0 A;  2LHI A;  1U5I A;  1DJW A;  2LC5 A;  4MN0 A;  2E6W A;  2O60 A;  4PHJ A;  5AFP A;  1SMG A;  3BYA A;  1BMO A;  1B8R A;  1WRL A;  3WNX B;  1KK7 Z;  2LUX A;  4WRI A;  1K96 A;  2KDH A;  2SCP A;  1GGW A;  5ER5 A;  3IF7 A;  5HLV A;  4DUQ A;  4P5O E;  1JC2 A;  2A4J A;  3NXA A;  4I5N B;  5J3X A;  3I5F B;  1BR4 B;  1KK7 Y;  2RGI A;  4OCI A;  5BPJ A;  4DS7 A;  1UHN A;  3GK4 X;  3ZWH A;  1SNL A;  3TUY C;  1WLZ A;  1OQP A;  1OZS A;  2LMV A;  3EVU A;  3JVT C;  1JFJ A;  1CFD A;  1YTZ C;  1IRJ A;  4ZCU A;  1M45 A;  3SIB A;  2GGM A;  1SL9 A;  1CMG A;  1B47 A;  1K93 D;  4PHN A;  1CLB A;  4XYN A;  1AP4 A;  4PE1 A;  1DJH A;  1ALV A;  3K21 A;  4CLN A;  1DJY A;  2KSP A;  2EHB A;  1OE9 B;  3CLN A;  2M97 A;  1MXE A;  1K9K A;  1CM1 A;  1F70 A;  4MLW A;  1PRW A;  1RK9 A;  4UPG A;  2BKI B;  1B4C A;  2OTG B;  2Y5I A;  2KQY A;  1R2U A;  2LM5 A;  4JQ0 D;  2KGB C;  1QX5 B;  4GNK B;  4N1G A;  1KSO A;  1S26 D;  1EXR A;  1ZUZ A;  1CFF A;  3MSE B;  3CR5 X;  1FPW A;  1SCM B;  4N5X A;  3D0Y B;  3DD4 A;  3KO0 A;  2CCM A;  4PDZ A;  1BU3 A;  1K90 D;  1K9U A;  4MZK A;  2K2A A;  3DF0 B;  4MRX A;  1AHR A;  3LK1 A;  1XO5 A;  2MHH A;  1QX2 A;  1V1G A;  3HCM A;  3D10 A;  1IJ6 A;  2OPO A;  1SL7 A;  1NSH A;  3NSO A;  3SJS A;  2GGZ A;  2BKH B;  2BEC A;  4L9M A;  2AAO A;  1SY9 A;  1S3P A;  2LAN A;  4ICB A;  1QLK A;  1REC A;  4QJ3 B;  1IH0 A;  1M39 A;  4YI9 A;  1YRU B;  1U5I B;  5KTY A;  1HT9 A;  2LLU A;  3CS1 A;  3I5G C;  5D7F A;  4BY5 A;  1KFX S;  3I5H C;  1KQM C;  1TCO B;  2G2B A;  2LE9 B;  1CM4 A;  2ZND A;  3IQO A;  2ZRT A;  3BQ3 A;  1GJY A;  1XFV O;  2L2E A;  4E68 A;  1XK4 C;  2WOS A;  3FWB A;  1J7Q A;  3BUN B;  1RJV A;  1Y6W A;  1IJ5 A;  1KK8 C;  5K89 A;  2AMI A;  1RTP 1;  2L4H A;  2WCE A;  2JWW A;  4MSP A;  4NQG A;  2LHL A;  1H4B A;  2IS9 A;  1JFK A;  1ZFS A;  2K0J A;  1OOJ A;  4USL A;  1C7V A;  1BOD A;  1CNP A;  1QIW A;  2PAS A;  2QPT A;  1NYA A;  4YBH B;  2CBL A;  1NCY A;  2BL0 B;  2M9G A;  4YI8 A;  2JZI A;  1L7Z A;  1EG3 A;  3OX5 A;  3GK2 A;  3LCP C;  2EC6 B;  2I94 A;  2DOQ A;  1CLM A;  2KNE A;  2L51 A;  1MXL C;  1UUR A;  2EGD A;  5CSN A;  5AXI A;  1CMF A;  1Y1X A;  1JSA A;  4P2Y B;  2HQ8 A;  2JXC A;  1B8L A;  3D0Y A;  2H2K A;  1QAT A;  2LVV A;  1XFW O;  3DF0 A;  5I2O A;  4Q04 A;  1XA5 A;  2M7L A;  4HRG A;  1TNX A;  2O5G A;  3TS5 B;  2PRU A;  2LUC A;  1N65 A;  1QLS A;  2LP2 A;  1NPQ A;  3CR2 A;  1L2O C;  2I7A A;  4I5L B;  1BOC A;  2LV7 A;  3CZT X;  3I5I C;  4NDC A;  4FTG A;  5GQQ C;  2BCA A;  4C0L A;  2ZN9 A;  2TN4 A;  3VRN A;  4MVF A;  1BLQ A;  1YVH A;  1F4Q A;  1MWN A;  1MF8 B;  1DF0 B;  1OMD A;  2BBN A;  2OS8 C;  2M1K B;  1CLL A;  2WCB A;  3A8R A;  4YGE B;  1SL8 A;  3KEV A;  1B7T Z;  1UP5 A;  1QTX A;  1XFU O;  2MLF C;  5FYX A;  1CDP A;  1J1D A;  3PM8 A;  4MBE A;  5HLO A;  4CFQ A;  1J7O A;  1MUX A;  1PVA A;  4M2O A;  2LMU A;  1WY9 A;  4PE7 A;  2K7C A;  2HQW A;  1A75 A;  1Y1A A;  1ZOT B;  2L0P A;  1MR8 A;  1AJ4 A;  3CR4 X;  3PN7 C;  3JTD C;  2KYF A;  1GGZ A;  1EL4 A;  4GAO A;  3RM1 A;  2CNP A;  1TNP A;  2LMT A;  3BUW B;  3WXA A;  1PUL A;  2WOR A;  2ZRS A;  3PFV A;  2KBM A;  5KU1 A;  2LVI A;  2KFG A;  1NUB A;  3FIA A;  1NCZ A;  3LLE A;  1M46 A;  1DVI A;  3PAL A;  1AJ5 A;  3OHM B;  5CPV A;  1XK4 A;  2JC2 A;  3PSR A;  1XFZ O;  1WDC C;  4GGF C;  4PAL A;  1KWO C;  1XVJ A;  1KCY A;  3F45 A;  1F71 A;  2F3Z A;  1VRK A;  3SG7 A;  2F3Y A;  2JTT A;  3BUX B;  5DKQ A;  1LA3 A;  3TUY B;  2L4I A;  3GOF A;  4I5K A;  2KGR A;  4C0K A;  2NCP A;  3PAT A;  4QJ4 B;  3JVT B;  1WRK A;  2BE6 A;  1YR5 A;  3O78 A;  2BCX A;  1B9A A;  1EH2 A;  4DCK A;  1SW8 A;  1G8I A;  1A2X A;  5I2L A;  1AUI B;  2JNF A;  1PK0 D;  2M1U A;  3BXK A;  1LA0 A;  1SBJ A;  3DVJ A;  1FI6 A;  1S6I A;  2JRF A;  1CFP A;  2JNX A;  1EG4 A;  1XFX O;  1K2H A;  1DF0 A;  5I2Q A;  1HQV A;  1KFU L;  4XJK B;  3SG5 A;  2FCD A;  3NSL A;  1DJX A;  3KF9 A;  4CFR A;  1QJT A;  1SK6 D;  1X02 A;  1TN4 A;  3M0W A;  4AQJ A;  3SG6 A;  4GUK A;  1XFY O;  3EVR A;  2B1U A;  2K8M B;  1BF5 A;  5HYD A;  2LLT A;  3A4U B;  1RWY A;  1TCF A;  3TDI A;  1N0Y A;  3FS7 A;  3SG2 A;  1M31 A;  1NX2 A;  1CDM A;  2BE4 A;  1BJF A;  4GGN A;  1YX8 A;  3VRR A;  1NCX A;  2KHN A;  2KFH A;  4A4C A;  5HKY A;  2H61 C;  1NP8 A;  3TDU A;  2F33 A;  3BUO B;  1JWD A;  2MAZ A;  4ETO A;  4OV2 A;  2M3W A;  1PSR A;  2WC8 A;  2JTZ A;  1DJG A;  1A75 B;  1A03 A;  4OR9 B;  2F2P A;  4HRH A;  1UUS A;  2M7N A;  3GK1 A;  4GFT A;  2LLS A;  4MRY A;  2MRD A;  3VRO A;  1K8U A;  5JJG A;  4IL1 A;  3I5G B;  1S5G Z;  2I18 A;  3EK7 A;  3OB2 B;  3I5H B;  1KQM B;  1K95 A;  1A4P A;  2KYC A;  1M63 B;  3AKB A;  5G08 A;  2CT9 A;  2JXL A;  1G4Y R;  2KI6 D;  4AQI A;  3VGO A;  1QIV A;  2KI4 C;  4PHM A;  3EK8 A;  1GQM A;  1OZO A;  5HKW A;  3WHT B;  1S36 A;  2BCB A;  2VRG A;  1KK8 B;  2ZNE A;  4GPL B;  1LXF C;  1OMR A;  1UWO A;  2HPS A;  1IG5 A;  4N1F A;  4OVN F;  3KPX A;  3SIA A;  2FJU B;  2L50 A;  4XJK A;  3CWG A;  2QAC A;  4YRU A;  2JOJ A;  2G9B A;  2Y1N A;  2Y4Q A;  4HSZ A;  3EKJ A;  2V53 A;  5D69 A;  5PAL A;  1NWD A;  1KSM A;  2MBX A;  2JT8 A;  1Y0V H;  2M0R A;  1CKK A;  1ZAC A;  3OB1 B;  4YGA A;  1QVI Z;  1QAS A;  1A29 A;  1UHI A;  3VRP A;  1MQ1 A;  3CGA A;  1YUU A;  2JPT A;  2KAX A;  4ORB B;  2I2R E;  2L5X B;  1EJ3 A;  1F54 A;  1DGU A;  1C07 A;  1WLM A;  3I5F C;  5CSF A;  2FOT A;  3WHU B;  4FQO A;  1CDL A;  2L98 A;  2Q91 A;  3OX6 A;  4MZJ A;  2P6B B;  3OP0 A;  2LCP A;  5DKN A;  1YUT A;  1S1E A;  1KFX L;  1SRA A;  3IQQ A;  1SCV A;  2NLN A;  1L2O B;  1H8B A;  1B7T Y;  1BR1 B;  2LNK A;  1PVB A;  3DVE A;  1CFC A;  1NX1 A;  3I5I B;  5JOL A;  2JU0 A;  5DKR A;  2KAV A;  4ORA B;  1YVL A;  4NDD A;  1C7W A;  5F6T A;  2HET A;  2HF5 A;  1SR6 C;  1V1F A;  2KI6 C;  4CID A;  1TNW A;  2KFF A;  1ZMZ A;  1TTX A;  2OS8 B;  2CTN A;  2NZ0 A;  3LK0 A;  4R1E A;  1LIN A;  2H61 A;  2LP3 A;  2MLE C;  2OTG C;  4NDB A;  2JT3 A;  4F0Z B;  1UHJ A;  1N2D A;  2GV5 A;  4YGC B;  1DTL A;  4YGD B;  3EVV A;  2KOT A;  5TNC A;  2WCF A;  2K7O A;  2R2I A;  1XYD A;  2KQ6 A;  4PE4 A;  3PN7 B;  3JTD B;  1SCM C;  1IQ5 A;  4DRW A;  2K7B A;  1SPY A;  2LVJ A;  1F55 A;  5HKZ A;  2F8P A;  4QJ5 B;  3DVM A;  1FW4 A;  3BOW B;  3RLZ A;  1W7I B;  1TRF A;  1SR6 B;  3KHE A;  1W7J B;  1BG1 A;  1RFJ A;  2PVB A;  5ER4 X;  1B8C A;  1IKU A;  3O6B A;  1WDC B;  2KAY A;  2KBI A;  4MEW A;  4ORC B;  1KWO B;  4PE0 A;  3QRX A;  1F4O A;  5KSZ A;  5AEQ A;  1DT7 B;  1YUR A;  2FCE A;  5AAN A;  1WRZ A;  2ZKM X;  1SKT A;  2Y1M A;  1UHH A;  4CPV A;  1CB1 A;  1QX7 A;  3PLF B;  5I8N A;  1SYM A;  3TDZ A;  1NIW A;  3O2P A;  2M29 A;  3EKH A;  4U8D A;  2ISD A;  4MZL A;  4AOM A;  1LKJ A;  1D1O A;  2K7D A;  1MHO A;  2E30 A;  4I5J A;  1UHK A;  2COL B;  5AER A;  1RRO A;  1IWQ A;  3ICB A;  2M8U A;  1AVS A;  4PHK A; 
#chains in the Genus database with same CATH topology
 2LAP A;  1TUZ A;  3EK4 A;  3HX4 A;  3V2L A;  1G33 A;  3LL8 B;  4JPZ B;  3SS4 A;  2BL0 C;  5CSI A;  3FWC A;  2MA2 A;  1AK8 A;  1PSB A;  3C1V A;  2EC6 C;  4WQ3 A;  4M2P A;  3SG4 A;  1JF2 A;  1J1E A;  1Y1U A;  1IQ3 A;  2KLE A;  2F2O A;  1R6P A;  4YGB B;  1FI5 A;  1QV0 A;  1S6J A;  4BY4 A;  4WQ2 A;  4ZCV A;  3AKA A;  1IGV A;  3R1O A;  2SAS A;  1IIO A;  3CTN A;  1BT6 A;  2K61 A;  1E8A A;  2ZFD A;  3BUM B;  4M2Q A;  1NX3 A;  1TOP A;  2LVK A;  1TIZ A;  2PMY A;  4OKH A;  1J7P A;  1YRT B;  1S5G Y;  3SG3 A;  4DIR A;  2AUC A;  3BOW A;  1OOG A;  1PAL A;  3E3R A;  3S0E A;  2M49 B;  1FF1 A;  2JQ6 A;  3TS5 C;  4A4B A;  2PSR A;  4IJ7 A;  1DJI A;  2Q4U A;  4C0J A;  1JBA A;  1Q80 A;  2JPO A;  3CYZ A;  4GGF A;  1QS7 A;  3AAJ A;  1KQV A;  4D1E A;  2NCO A;  3NGV A;  1FBV A;  1CTR A;  5CSJ A;  2JT0 A;  1ODB A;  1J55 A;  3O4Y A;  4GBA A;  4JWQ A;  3ZNI A;  3TZ1 A;  1QV1 A;  1ALW A;  1DGV A;  1YUS A;  2MJW B;  3DVK A;  2WND A;  1K94 A;  1OOH A;  1S6C A;  1OMV A;  3NHI A;  5B8I B;  1TNQ A;  3H4S E;  1DJZ A;  2KI4 B;  2PAL A;  1YX7 A;  3S0A A;  1CDN A;  2ZN8 A;  2NXQ A;  3NSI A;  4HRE E;  1J7R A;  3SS3 A;  3VRQ A;  3NSK A;  1NX0 A;  4TNC A;  1OSA A;  2JUL A;  1DMO A;  3B88 A;  2D8N A;  1K9P A;  1JUO A;  5IBW A;  1QVI Y;  3D73 A;  1KFU S;  1LVC D;  2CXJ A;  3AAK A;  4PCW A;  2K2F A;  2BBM A;  1F8H A;  1QXP A;  1JF0 A;  2LHI A;  1U5I A;  5FI6 A;  1DQE A;  1DJW A;  2LC5 A;  4MN0 A;  2E6W A;  2O60 A;  4PHJ A;  2QEB A;  5AFP A;  3PM2 A;  1SMG A;  5I94 A;  3BYA A;  1BMO A;  1B8R A;  1WRL A;  3WNX B;  1KK7 Z;  2LUX A;  4WRI A;  1K96 A;  2KDH A;  2SCP A;  1GGW A;  5ER5 A;  3IF7 A;  5HLV A;  1P28 A;  2H8V A;  4DUQ A;  4P5O E;  1JC2 A;  2A4J A;  3NXA A;  4I5N B;  5J3X A;  3I5F B;  1BR4 B;  1KK7 Y;  2KPH A;  2RGI A;  4OCI A;  5BPJ A;  4DS7 A;  1UHN A;  3GK4 X;  3ZWH A;  1SNL A;  3TUY C;  1WLZ A;  2WCJ A;  1OQP A;  1OZS A;  2LMV A;  3EVU A;  3JVT C;  1JFJ A;  1CFD A;  1YTZ C;  1IRJ A;  4ZCU A;  1M45 A;  3SIB A;  2GGM A;  1SL9 A;  1CMG A;  1B47 A;  1K93 D;  4PHN A;  1CLB A;  4XYN A;  3N7H A;  3PJI A;  1AP4 A;  4PE1 A;  1DJH A;  1ALV A;  3K21 A;  3DY9 A;  3OBV A;  4CLN A;  1DJY A;  2KSP A;  2EHB A;  1OE9 B;  3CLN A;  2M97 A;  1MXE A;  1K9K A;  1CM1 A;  1F70 A;  3OGN A;  4MLW A;  1PRW A;  1RK9 A;  4UPG A;  2BKI B;  1B4C A;  2OTG B;  2Y5I A;  2KQY A;  3NHT A;  1R2U A;  2LM5 A;  4JQ0 D;  2KGB C;  1QX5 B;  4GNK B;  4N1G A;  1KSO A;  3CZ1 A;  1LS8 A;  1S26 D;  1EXR A;  1ZUZ A;  1CFF A;  2BNX A;  3MSE B;  3CR5 X;  1FPW A;  1SCM B;  4N5X A;  3D0Y B;  3DD4 A;  3KO0 A;  2CCM A;  1ORG A;  4PDZ A;  1BU3 A;  1K90 D;  1K9U A;  4MZK A;  2K2A A;  3DF0 B;  4MRX A;  1AHR A;  3LK1 A;  1XO5 A;  2MHH A;  1QX2 A;  1V1G A;  3HCM A;  3D10 A;  1IJ6 A;  2OPO A;  1SL7 A;  1NSH A;  3B7A A;  3BFH A;  3NSO A;  3SJS A;  2GGZ A;  2BKH B;  2BEC A;  4L9M A;  2AAO A;  1SY9 A;  1S3P A;  2LAN A;  4ICB A;  1QLK A;  1REC A;  4QJ3 B;  1Z4H A;  1IH0 A;  1M39 A;  4YI9 A;  1YRU B;  1U5I B;  5KTY A;  1HT9 A;  2LLU A;  3DZT A;  3CS1 A;  3I5G C;  5D7F A;  4BY5 A;  1KFX S;  3I5H C;  1KQM C;  1TCO B;  2G2B A;  2BAP A;  2LE9 B;  1CM4 A;  2ZND A;  3IQO A;  2ZRT A;  3BQ3 A;  1GJY A;  1XFV O;  2L2E A;  2WC6 A;  4E68 A;  1XK4 C;  2WOS A;  3FWB A;  1J7Q A;  3BUN B;  1RJV A;  3CZ2 A;  1Y6W A;  1IJ5 A;  1KK8 C;  5K89 A;  2AMI A;  1RTP 1;  2L4H A;  2WCE A;  2JWW A;  4MSP A;  4NQG A;  2LHL A;  1H4B A;  2IS9 A;  1JFK A;  2L5Y A;  1ZFS A;  3R72 A;  2K0J A;  1OOJ A;  4USL A;  1C7V A;  1BOD A;  1CNP A;  1QIW A;  2PAS A;  2QPT A;  1NYA A;  4YBH B;  2CBL A;  5HL1 A;  1NCY A;  2BL0 B;  2M9G A;  4YI8 A;  2JZI A;  1L7Z A;  1EG3 A;  3OX5 A;  3S0D A;  3GK2 A;  3LCP C;  2EC6 B;  2I94 A;  3BFB A;  2DOQ A;  1CLM A;  3CAB A;  2KNE A;  2L51 A;  1MXL C;  1UUR A;  2EGD A;  5CSN A;  5AXI A;  1CMF A;  1Y1X A;  1JSA A;  4P2Y B;  2HQ8 A;  2JXC A;  1B8L A;  3D0Y A;  2H2K A;  1QAT A;  3QME A;  2LVV A;  1XFW O;  2GTE A;  3DF0 A;  5I2O A;  4Q04 A;  1SSE B;  1XA5 A;  2P71 A;  2M7L A;  4HRG A;  1TNX A;  2O5G A;  3TS5 B;  2PRU A;  2LUC A;  5FI2 A;  1N65 A;  1QLS A;  2LP2 A;  1NPQ A;  3CR2 A;  1L2O C;  2I7A A;  4I5L B;  1BOC A;  2LV7 A;  3CZT X;  3I5I C;  4NDC A;  4FTG A;  5GQQ C;  2BCA A;  4C0L A;  2ZN9 A;  2TN4 A;  3VRN A;  2WCK A;  3FE6 A;  3IVT A;  4MVF A;  1BLQ A;  2K60 A;  1YVH A;  1F4Q A;  1Z2C B;  1MWN A;  1MF8 B;  1DF0 B;  3S0B A;  1OMD A;  1OOI X;  2BBN A;  2OS8 C;  2M1K B;  1CLL A;  3O4X A;  2WCB A;  3D75 A;  3A8R A;  4YGE B;  1SL8 A;  3KEV A;  1B7T Z;  1UP5 A;  1QTX A;  1XFU O;  2MLF C;  3D76 A;  1CDP A;  1J1D A;  3K1E A;  3PM8 A;  4MBE A;  5FYX A;  5HLO A;  1MUX A;  1PVA A;  4CFQ A;  1J7O A;  4M2O A;  2LMU A;  1WY9 A;  4PE7 A;  2K7C A;  2HQW A;  1A75 A;  1Y1A A;  1ZOT B;  2WCL A;  2L0P A;  1MR8 A;  1AJ4 A;  3CR4 X;  3BFA A;  3PN7 C;  3JTD C;  2KYF A;  1GGZ A;  1EL4 A;  4OZD A;  4GAO A;  3RM1 A;  2CNP A;  1TNP A;  2LMT A;  2P70 A;  2WCM A;  2QDI A;  3BUW B;  1PUL A;  2WOR A;  2ZRS A;  3PFV A;  3BJH A;  3WXA A;  2KBM A;  5KU1 A;  3DYE A;  2LVI A;  2KFG A;  1NUB A;  3FIA A;  1NCZ A;  3LLE A;  1M46 A;  1DVI A;  3PAL A;  1AJ5 A;  3OHM B;  3L4L A;  1XK4 A;  5CPV A;  2JC2 A;  3PSR A;  1XFZ O;  1WDC C;  4GGF C;  4FQT A;  4PAL A;  1KWO C;  1B1G A;  1XVJ A;  1KCY A;  3F45 A;  1F71 A;  2F3Z A;  1VRK A;  3SG7 A;  2F3Y A;  2JTT A;  3BUX B;  5DKQ A;  1LA3 A;  3TUY B;  2KLD A;  2L4I A;  3GOF A;  2KGR A;  4I5K A;  2NCP A;  4C0K A;  3PAT A;  3EG5 B;  4QJ4 B;  3JVT B;  1WRK A;  2BE6 A;  1YR5 A;  3O78 A;  2BCX A;  1B9A A;  1EH2 A;  4DCK A;  4F7F A;  1SW8 A;  1G8I A;  1A2X A;  3L4A A;  1AUI B;  2JNF A;  1PK0 D;  2M1U A;  3BXK A;  1LA0 A;  5I2L A;  1SBJ A;  5D3O A;  3DVJ A;  1FI6 A;  1S6I A;  2JRF A;  1DEL A;  1CFP A;  2JNX A;  1EG4 A;  3B6X A;  1XFX O;  1K2H A;  1DF0 A;  5I2Q A;  1HQV A;  1KFU L;  4XJK B;  3SG5 A;  2FCD A;  3DXL A;  1DJX A;  3KF9 A;  3NSL A;  4CFR A;  1QJT A;  1SK6 D;  1X02 A;  1TN4 A;  1XFR A;  3M0W A;  4AQJ A;  3SG6 A;  4GUK A;  1T14 A;  1XFY O;  3EVR A;  2B1U A;  2K8M B;  1BF5 A;  5HYD A;  2LLT A;  3A4U B;  1RWY A;  1TCF A;  3TDI A;  1N0Y A;  3FS7 A;  3SG2 A;  1M31 A;  1NX2 A;  4JD9 A;  1CDM A;  2BE4 A;  1BJF A;  3S0G A;  4GGN A;  1YX8 A;  3VRR A;  1NCX A;  2KHN A;  2KFH A;  4A4C A;  5HKY A;  2H61 C;  1NP8 A;  3TDU A;  2F33 A;  3BUO B;  4PT1 A;  1JWD A;  2MAZ A;  4ETO A;  4OV2 A;  2M3W A;  4JKT A;  1PSR A;  2WC8 A;  2JTZ A;  1DJG A;  1A75 B;  1A03 A;  4OR9 B;  2F2P A;  4HRH A;  1UUS A;  2M7N A;  3GK1 A;  4KYN A;  4GFT A;  2LLS A;  4MRY A;  2MRD A;  3VRO A;  1K8U A;  5JJG A;  4IL1 A;  3I5G B;  1S5G Z;  2I18 A;  3EK7 A;  3OB2 B;  3I5H B;  1KQM B;  1K95 A;  2PYQ A;  1A4P A;  2KYC A;  1M63 B;  3AKB A;  5G08 A;  2CT9 A;  2JXL A;  1G4Y R;  2QEV A;  2KI6 D;  4AQI A;  3VGO A;  1QIV A;  2KI4 C;  4PHM A;  1OW4 A;  3EK8 A;  3SS5 A;  1GQM A;  1OZO A;  3FE8 A;  5HKW A;  1S36 A;  2BCB A;  2VRG A;  1KK8 B;  2ZNE A;  4GPL B;  4INW A;  3WHT B;  3R1V A;  4INX A;  1LXF C;  1OMR A;  1UWO A;  2HPS A;  1IG5 A;  4N1F A;  4OVN F;  3KPX A;  3SIA A;  2FJU B;  2L2C A;  2L50 A;  4XJK A;  3CWG A;  2QAC A;  4YRU A;  3UNW A;  2JOJ A;  2G9B A;  2Y1N A;  1OOF A;  2Y4Q A;  4HSZ A;  5DIC A;  3EKJ A;  2V53 A;  5D69 A;  2WCH A;  1NWD A;  1KSM A;  5PAL A;  2JT8 A;  2MBX A;  1GM0 A;  2WC5 A;  1Y0V H;  2M0R A;  3D74 A;  1CKK A;  1ZAC A;  3OB1 B;  4YGA A;  1QVI Z;  1QAS A;  1A29 A;  1UHI A;  3VRP A;  1MQ1 A;  3CGA A;  1YUU A;  5FI7 A;  2JPT A;  2KAX A;  4ORB B;  2I2R E;  1DEK A;  1EJ3 A;  2L5X B;  1DGU A;  1F54 A;  1C07 A;  1WLM A;  2QEH A;  3I5F C;  5CSF A;  2FOT A;  3WHU B;  4FQO A;  1CDL A;  2L98 A;  2Q91 A;  3OX6 A;  4MZJ A;  2P6B B;  3OP0 A;  2LCP A;  5DKN A;  1YUT A;  3CDN A;  1S1E A;  1KFX L;  3R1P A;  1SRA A;  3IQQ A;  1SCV A;  2NLN A;  1L2O B;  5EL2 A;  1B7T Y;  1BR1 B;  1H8B A;  2LNK A;  1PVB A;  3DVE A;  1CFC A;  2FJY A;  1NX1 A;  3I5I B;  5JOL A;  2JU0 A;  5DKR A;  2KAV A;  4ORA B;  1YVL A;  4NDD A;  1C7W A;  5F6T A;  2HET A;  2HF5 A;  1SR6 C;  1V1F A;  2KI6 C;  4CID A;  1TNW A;  1W9Z A;  2KFF A;  3CZ0 A;  1ZMZ A;  1TTX A;  2OS8 B;  2CTN A;  2NZ0 A;  3LK0 A;  4R1E A;  1LIN A;  2H61 A;  2LP3 A;  2MLE C;  2OTG C;  4NDB A;  2JT3 A;  4F0Z B;  1UHJ A;  1N2D A;  2GV5 A;  4YGC B;  1DTL A;  4YGD B;  3EVV A;  2KOT A;  5TNC A;  2WCF A;  3D78 A;  2K7O A;  2R2I A;  1XYD A;  2KQ6 A;  4PE4 A;  3PN7 B;  3JTD B;  3UO9 A;  1SCM C;  1IQ5 A;  4DRW A;  2K7B A;  1SPY A;  2LVJ A;  1C3Z A;  1F55 A;  5HKZ A;  2F8P A;  4QJ5 B;  3DVM A;  1FW4 A;  3BOW B;  3RLZ A;  1W7I B;  1QWV A;  1TRF A;  1SR6 B;  3FE9 A;  3KHE A;  1W7J B;  1TWO A;  1BG1 A;  1RFJ A;  2PVB A;  5ER4 X;  1DC1 A;  3D77 A;  1B8C A;  1IKU A;  3O6B A;  1WDC B;  2YGU A;  2KAY A;  2KBI A;  4MEW A;  4ORC B;  1KWO B;  4PE0 A;  2ERB A;  3QRX A;  1F4O A;  2QEO A;  1TUJ A;  3VB1 A;  5AEQ A;  5KSZ A;  1YUR A;  1DT7 B;  2FCE A;  5AAN A;  1WRZ A;  2ZKM X;  3B86 A;  1SKT A;  2Y1M A;  1UHH A;  4CPV A;  1CB1 A;  1QX7 A;  3PLF B;  5I8N A;  1SYM A;  3TDZ A;  1NIW A;  3O2P A;  2M29 A;  3EKH A;  4U8D A;  2ISD A;  4MZL A;  4AOM A;  1LKJ A;  1D1O A;  2K7D A;  1MHO A;  2E30 A;  3Q8I A;  4I5J A;  1UHK A;  3RZS A;  3S0F A;  2COL B;  5AER A;  1RRO A;  1IWQ A;  3ICB A;  3B87 A;  2M8U A;  1C3Y A;  1AVS A;  3L47 A;  4PHK A;  2PQL A; 
#chains in the Genus database with same CATH homology
 2LAP A;  3EK4 A;  3HX4 A;  1G33 A;  3LL8 B;  4JPZ B;  2BL0 C;  5CSI A;  3FWC A;  2MA2 A;  1AK8 A;  1PSB A;  3C1V A;  2EC6 C;  4WQ3 A;  4M2P A;  3SG4 A;  1JF2 A;  1J1E A;  1Y1U A;  1IQ3 A;  1B1G A;  2F2O A;  1R6P A;  4YGB B;  1FI5 A;  1QV0 A;  1S6J A;  4BY4 A;  4WQ2 A;  4ZCV A;  3AKA A;  1IGV A;  2SAS A;  3CTN A;  1BT6 A;  2K61 A;  1E8A A;  2ZFD A;  3BUM B;  4M2Q A;  1NX3 A;  1TOP A;  2LVK A;  1TIZ A;  2PMY A;  4OKH A;  1J7P A;  1YRT B;  1S5G Y;  3SG3 A;  4DIR A;  2AUC A;  3BOW A;  1PAL A;  3E3R A;  2M49 B;  1FF1 A;  2JQ6 A;  3TS5 C;  4A4B A;  2PSR A;  1DJI A;  2Q4U A;  4C0J A;  1JBA A;  1Q80 A;  4GGF A;  1QS7 A;  3AAJ A;  1KQV A;  4D1E A;  2NCO A;  1FBV A;  1CTR A;  5CSJ A;  2JT0 A;  1ODB A;  1J55 A;  3O4Y A;  4GBA A;  4JWQ A;  3ZNI A;  3TZ1 A;  1QV1 A;  1ALW A;  1DGV A;  1YUS A;  2MJW B;  3DVK A;  2WND A;  1K94 A;  5B8I B;  1S6C A;  1OMV A;  1TNQ A;  3H4S E;  1DJZ A;  2KI4 B;  2PAL A;  1YX7 A;  1CDN A;  2ZN8 A;  2NXQ A;  3NSI A;  4HRE E;  1J7R A;  3VRQ A;  3NSK A;  1NX0 A;  4TNC A;  1OSA A;  2JUL A;  1DMO A;  2D8N A;  1K9P A;  1JUO A;  5IBW A;  1QVI Y;  1KFU S;  1LVC D;  2CXJ A;  3AAK A;  4PCW A;  2K2F A;  2BBM A;  1F8H A;  1QXP A;  1JF0 A;  2LHI A;  1U5I A;  1DJW A;  2LC5 A;  4MN0 A;  2E6W A;  2O60 A;  4PHJ A;  5AFP A;  1SMG A;  3BYA A;  1BMO A;  1B8R A;  1WRL A;  3WNX B;  1KK7 Z;  2LUX A;  4WRI A;  1K96 A;  2KDH A;  2SCP A;  1GGW A;  5ER5 A;  3IF7 A;  5HLV A;  4DUQ A;  4P5O E;  1JC2 A;  2A4J A;  3NXA A;  4I5N B;  5J3X A;  3I5F B;  1BR4 B;  1KK7 Y;  2RGI A;  4OCI A;  5BPJ A;  4DS7 A;  1UHN A;  3GK4 X;  3ZWH A;  1SNL A;  3TUY C;  1WLZ A;  1OQP A;  1OZS A;  2LMV A;  3EVU A;  3JVT C;  1JFJ A;  1CFD A;  1YTZ C;  1IRJ A;  4ZCU A;  1M45 A;  3SIB A;  2GGM A;  1SL9 A;  1CMG A;  1B47 A;  1K93 D;  4PHN A;  1CLB A;  4XYN A;  1AP4 A;  4PE1 A;  1DJH A;  1ALV A;  3K21 A;  4CLN A;  1DJY A;  2KSP A;  2EHB A;  1OE9 B;  3CLN A;  2M97 A;  1MXE A;  1K9K A;  1CM1 A;  1F70 A;  4MLW A;  1PRW A;  1RK9 A;  4UPG A;  2BKI B;  1B4C A;  2OTG B;  2Y5I A;  2KQY A;  1R2U A;  2LM5 A;  4JQ0 D;  2KGB C;  1QX5 B;  4GNK B;  4N1G A;  1KSO A;  1S26 D;  1EXR A;  1ZUZ A;  1CFF A;  3MSE B;  3CR5 X;  1FPW A;  1SCM B;  4N5X A;  3D0Y B;  3DD4 A;  3KO0 A;  2CCM A;  4PDZ A;  1BU3 A;  1K90 D;  1K9U A;  4MZK A;  2K2A A;  3DF0 B;  4MRX A;  1AHR A;  3LK1 A;  1XO5 A;  2MHH A;  1QX2 A;  1V1G A;  3HCM A;  3D10 A;  1IJ6 A;  2OPO A;  1SL7 A;  1NSH A;  3NSO A;  3SJS A;  2GGZ A;  2BKH B;  2BEC A;  4L9M A;  2AAO A;  1SY9 A;  1S3P A;  2LAN A;  4ICB A;  1QLK A;  1REC A;  4QJ3 B;  1IH0 A;  1M39 A;  4YI9 A;  1YRU B;  1U5I B;  5KTY A;  1HT9 A;  2LLU A;  3CS1 A;  3I5G C;  5D7F A;  4BY5 A;  1KFX S;  3I5H C;  1KQM C;  1TCO B;  2G2B A;  2LE9 B;  1CM4 A;  2ZND A;  3IQO A;  2ZRT A;  3BQ3 A;  1GJY A;  1XFV O;  2L2E A;  4E68 A;  1XK4 C;  2WOS A;  3FWB A;  1J7Q A;  3BUN B;  1RJV A;  1Y6W A;  1IJ5 A;  1KK8 C;  5K89 A;  2AMI A;  1RTP 1;  2L4H A;  2WCE A;  2JWW A;  4MSP A;  4NQG A;  2LHL A;  1H4B A;  2IS9 A;  1JFK A;  1ZFS A;  2K0J A;  1OOJ A;  4USL A;  1C7V A;  1BOD A;  1CNP A;  1QIW A;  2PAS A;  2QPT A;  1NYA A;  4YBH B;  2CBL A;  1NCY A;  2BL0 B;  2M9G A;  4YI8 A;  2JZI A;  1L7Z A;  1EG3 A;  3OX5 A;  3GK2 A;  3LCP C;  2EC6 B;  2I94 A;  2DOQ A;  1CLM A;  2KNE A;  2L51 A;  1MXL C;  1UUR A;  2EGD A;  5CSN A;  5AXI A;  1CMF A;  1Y1X A;  1JSA A;  4P2Y B;  2HQ8 A;  2JXC A;  1B8L A;  3D0Y A;  2H2K A;  1QAT A;  2LVV A;  1XFW O;  3DF0 A;  5I2O A;  4Q04 A;  1XA5 A;  2M7L A;  4HRG A;  1TNX A;  2O5G A;  3TS5 B;  2PRU A;  2LUC A;  1N65 A;  1QLS A;  2LP2 A;  1NPQ A;  3CR2 A;  1L2O C;  2I7A A;  4I5L B;  1BOC A;  2LV7 A;  3CZT X;  3I5I C;  4NDC A;  4FTG A;  5GQQ C;  2BCA A;  4C0L A;  2ZN9 A;  2TN4 A;  3VRN A;  4MVF A;  1BLQ A;  1YVH A;  1F4Q A;  1MWN A;  1MF8 B;  1DF0 B;  1OMD A;  2BBN A;  2OS8 C;  2M1K B;  1CLL A;  2WCB A;  3A8R A;  4YGE B;  1SL8 A;  3KEV A;  1B7T Z;  1UP5 A;  1QTX A;  1XFU O;  2MLF C;  5FYX A;  1CDP A;  1J1D A;  3PM8 A;  4MBE A;  5HLO A;  4CFQ A;  1J7O A;  1MUX A;  1PVA A;  4M2O A;  2LMU A;  1WY9 A;  4PE7 A;  2K7C A;  2HQW A;  1A75 A;  1Y1A A;  1ZOT B;  2L0P A;  1MR8 A;  1AJ4 A;  3CR4 X;  3PN7 C;  3JTD C;  2KYF A;  1GGZ A;  1EL4 A;  4GAO A;  3RM1 A;  2CNP A;  1TNP A;  2LMT A;  3BUW B;  3WXA A;  1PUL A;  2WOR A;  2ZRS A;  3PFV A;  2KBM A;  5KU1 A;  2LVI A;  2KFG A;  1NUB A;  3FIA A;  1NCZ A;  3LLE A;  1M46 A;  1DVI A;  3PAL A;  1AJ5 A;  3OHM B;  5CPV A;  1XK4 A;  2JC2 A;  3PSR A;  1XFZ O;  1WDC C;  4GGF C;  4PAL A;  1KWO C;  1XVJ A;  1KCY A;  3F45 A;  1F71 A;  2F3Z A;  1VRK A;  3SG7 A;  2F3Y A;  2JTT A;  3BUX B;  5DKQ A;  1LA3 A;  3TUY B;  2L4I A;  3GOF A;  4I5K A;  2KGR A;  4C0K A;  2NCP A;  3PAT A;  4QJ4 B;  3JVT B;  1WRK A;  2BE6 A;  1YR5 A;  3O78 A;  2BCX A;  1B9A A;  1EH2 A;  4DCK A;  1SW8 A;  1G8I A;  1A2X A;  5I2L A;  1AUI B;  2JNF A;  1PK0 D;  2M1U A;  3BXK A;  1LA0 A;  1SBJ A;  3DVJ A;  1FI6 A;  1S6I A;  2JRF A;  1CFP A;  2JNX A;  1EG4 A;  1XFX O;  1K2H A;  1DF0 A;  5I2Q A;  1HQV A;  1KFU L;  4XJK B;  3SG5 A;  2FCD A;  3NSL A;  1DJX A;  3KF9 A;  4CFR A;  1QJT A;  1SK6 D;  1X02 A;  1TN4 A;  3M0W A;  4AQJ A;  3SG6 A;  4GUK A;  1XFY O;  3EVR A;  2B1U A;  2K8M B;  1BF5 A;  5HYD A;  2LLT A;  3A4U B;  1RWY A;  1TCF A;  3TDI A;  1N0Y A;  3FS7 A;  3SG2 A;  1M31 A;  1NX2 A;  1CDM A;  2BE4 A;  1BJF A;  4GGN A;  1YX8 A;  3VRR A;  1NCX A;  2KHN A;  2KFH A;  4A4C A;  5HKY A;  2H61 C;  1NP8 A;  3TDU A;  2F33 A;  3BUO B;  1JWD A;  2MAZ A;  4ETO A;  4OV2 A;  2M3W A;  1PSR A;  2WC8 A;  2JTZ A;  1DJG A;  1A75 B;  1A03 A;  4OR9 B;  2F2P A;  4HRH A;  1UUS A;  2M7N A;  3GK1 A;  4GFT A;  2LLS A;  4MRY A;  2MRD A;  3VRO A;  1K8U A;  5JJG A;  4IL1 A;  3I5G B;  1S5G Z;  2I18 A;  3EK7 A;  3OB2 B;  3I5H B;  1KQM B;  1K95 A;  1A4P A;  2KYC A;  1M63 B;  3AKB A;  5G08 A;  2CT9 A;  2JXL A;  1G4Y R;  2KI6 D;  4AQI A;  3VGO A;  1QIV A;  2KI4 C;  4PHM A;  3EK8 A;  1GQM A;  1OZO A;  5HKW A;  3WHT B;  1S36 A;  2BCB A;  2VRG A;  1KK8 B;  2ZNE A;  4GPL B;  1LXF C;  1OMR A;  1UWO A;  2HPS A;  1IG5 A;  4N1F A;  4OVN F;  3KPX A;  3SIA A;  2FJU B;  2L50 A;  4XJK A;  3CWG A;  2QAC A;  4YRU A;  2JOJ A;  2G9B A;  2Y1N A;  2Y4Q A;  4HSZ A;  3EKJ A;  2V53 A;  5D69 A;  5PAL A;  1NWD A;  1KSM A;  2MBX A;  2JT8 A;  1Y0V H;  2M0R A;  1CKK A;  1ZAC A;  3OB1 B;  4YGA A;  1QVI Z;  1QAS A;  1A29 A;  1UHI A;  3VRP A;  1MQ1 A;  3CGA A;  1YUU A;  2JPT A;  2KAX A;  4ORB B;  2I2R E;  2L5X B;  1EJ3 A;  1F54 A;  1DGU A;  1C07 A;  1WLM A;  3I5F C;  5CSF A;  2FOT A;  3WHU B;  4FQO A;  1CDL A;  2L98 A;  2Q91 A;  3OX6 A;  4MZJ A;  2P6B B;  3OP0 A;  2LCP A;  5DKN A;  1YUT A;  1S1E A;  1KFX L;  1SRA A;  3IQQ A;  1SCV A;  2NLN A;  1L2O B;  1H8B A;  1B7T Y;  1BR1 B;  2LNK A;  1PVB A;  3DVE A;  1CFC A;  1NX1 A;  3I5I B;  5JOL A;  2JU0 A;  5DKR A;  2KAV A;  4ORA B;  1YVL A;  4NDD A;  1C7W A;  5F6T A;  2HET A;  2HF5 A;  1SR6 C;  1V1F A;  2KI6 C;  4CID A;  1TNW A;  2KFF A;  1ZMZ A;  1TTX A;  2OS8 B;  2CTN A;  2NZ0 A;  3LK0 A;  4R1E A;  1LIN A;  2H61 A;  2LP3 A;  2MLE C;  2OTG C;  4NDB A;  2JT3 A;  4F0Z B;  1UHJ A;  1N2D A;  2GV5 A;  4YGC B;  1DTL A;  4YGD B;  3EVV A;  2KOT A;  5TNC A;  2WCF A;  2K7O A;  2R2I A;  1XYD A;  2KQ6 A;  4PE4 A;  3PN7 B;  3JTD B;  1SCM C;  1IQ5 A;  4DRW A;  2K7B A;  1SPY A;  2LVJ A;  1F55 A;  5HKZ A;  2F8P A;  4QJ5 B;  3DVM A;  1FW4 A;  3BOW B;  3RLZ A;  1W7I B;  1TRF A;  1SR6 B;  3KHE A;  1W7J B;  1BG1 A;  1RFJ A;  2PVB A;  5ER4 X;  1B8C A;  1IKU A;  3O6B A;  1WDC B;  2KAY A;  2KBI A;  4MEW A;  4ORC B;  1KWO B;  4PE0 A;  3QRX A;  1F4O A;  5KSZ A;  5AEQ A;  1DT7 B;  1YUR A;  2FCE A;  5AAN A;  1WRZ A;  2ZKM X;  1SKT A;  2Y1M A;  1UHH A;  4CPV A;  1CB1 A;  1QX7 A;  3PLF B;  5I8N A;  1SYM A;  3TDZ A;  1NIW A;  3O2P A;  2M29 A;  3EKH A;  4U8D A;  2ISD A;  4MZL A;  4AOM A;  1LKJ A;  1D1O A;  2K7D A;  1MHO A;  2E30 A;  4I5J A;  1UHK A;  2COL B;  5AER A;  1RRO A;  1IWQ A;  3ICB A;  2M8U A;  1AVS A;  4PHK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...