1SNLA

Nmr solution structure of the calcium-binding domain of nucleobindin (calnuc)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
99
Chain Sequence
LKEVWEELDGLDPNRFNPKTFFILHDINSDGVLDEQELEALFTKELEKVYDPKNEEDDMREMEEERLRMREHVMKNVDTNQDRLVTLEEFLASTQRKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleobindin 1
publication title Structural Studies on the Ca(2+)-binding Domain of Human Nucleobindin (Calnuc).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 19
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2004-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1snlA00
3KF9A 4CFRA 1CDLA 1IGVA 4MVFA 2WCEA 5HKYA 1MHOA 2M1KB 3NSOA 1UHJA 2LUCA 1YR5A 2FJUB 2KSPA 1SK6D 4DCKA 1MXEA 2LMTA 4OKHA 1B7TY 1U5IB 3AKBA 3CWGA 4M2PA 4YI8A 5JJGA 2FCDA 2KGBC 4NDBA 1KFXL 3D10A 3DVMA 1NX1A 2SASA 1AJ4A 1E8AA 1KQMC 3O4YA 5BPJA 2BKHB 2KFGA 3SIBA 1JSAA 1WRZA 1DGVA 1M63B 1S6IA 2JC2A 2WNDA 2JNFA 1Y1AA 1SL7A 4PHNA 4MRYA 1CM4A 2KFFA 1WRKA 1QIVA 1SMGA 3IQQA 1FPWA 3SG3A 1ZACA 1IKUA 1TCOB 1QV0A 4U8DA 2BL0C 1WDCB 1XFVO 1A03A 4HSZA 4PE7A 3IQOA 1YRTB 3RLZA 2JT0A 2JWWA 1LKJA 3CS1A 1RJVA 4P2YB 4USLA 1B8LA 1JF2A 3FWCA 1EG4A 2K7OA 4M2QA 1CDPA 3BUWB 4YGCB 2JULA 2CNPA 2TN4A 1DJXA 2KOTA 2L4HA 4GGFC 1K2HA 4NDCA 1CKKA 2F8PA 1X02A 2HF5A 4P5OE 3GOFA 1KK7Y 1S26D 4HRHA 1S6JA 3OHMB 3MSEB 3VGOA 3I5HB 1TTXA 1KSOA 3I5GB 2K61A 2F3YA 4PDZA 2I18A 1FF1A 1J1DA 2O60A 1NCZA 4AOMA 1BU3A 2ZN9A 5KSZA 4CLNA 1LVCD 2BECA 2JTZA 5TNCA 1F55A 4I5LB 5AFPA 2F33A 1JBAA 4MRXA 1NX2A 1MXLC 1NCXA 2PSRA 2AAOA 1G33A 1XFUO 2I7AA 2JRFA 4ORBB 5G08A 2LCPA 2DOQA 1OZOA 2KAXA 1EL4A 1BR1B 2L0PA 3CZTX 3O78A 4PHJA 2D8NA 1R2UA 4ZCVA 4MZLA 3WHTB 2H61A 2LVJA 5JOLA 4YBHB 1NPQA 3JVTC 3KEVA 1KCYA 1TNXA 2MHHA 5I2LA 5AEQA 2M29A 3KPXA 5DKQA 5HYDA 1SYMA 2LLTA 2QACA 4MSPA 3SG5A 1QATA 1WY9A 1MQ1A 2NLNA 5HKWA 1WDCC 1MR8A 1M39A 1K95A 3CR5X 1ZFSA 1LA3A 2KQYA 5ER5A 1IH0A 4I5NB 2V53A 1SBJA 2M8UA 1FI6A 2LAPA 1L2OC 1KFUS 5DKNA 5AXIA 5HLOA 1C7VA 2I94A 1XFZO 3BQ3A 5B8IB 4PE1A 4ORCB 2L5XB 3E3RA 1NYAA 1RWYA 3VROA 1QV1A 3BYAA 1B1GA 2M0RA 2F2OA 5F6TA 4AQIA 1CNPA 2WCFA 2ZKMX 4FQOA 3KHEA 5D7FA 1FI5A 2LHLA 2BBMA 1BOCA 1SPYA 2ZNEA 4UPGA 1GJYA 2P6BB 1JF0A 2OS8B 2JPTA 2SCPA 3IF7A 1F4OA 1QX5B 2HQ8A 2H2KA 5ER4X 2LMVA 3VRPA 1BR4B 1IJ5A 1CFDA 1S6CA 1H4BA 1QIWA 1KK8B 5CSFA 2JNXA 3O2PA 2AUCA 3EVUA 1R6PA 1YUUA 1B7TZ 1ALVA 1DJHA 3LK0A 3BUMB 4PHMA 5IBWA 1KFUL 1A2XA 1A75A 1DTLA 2GGZA 4AQJA 1CDMA 4OVNF 2PVBA 4CIDA 4YGAA 3LL8B 4HREE 3I5FC 3TDIA 1CMGA 3JVTB 1BJFA 1PALA 1RK9A 2Q4UA 4DRWA 1IWQA 3TZ1A 3PM8A 1MF8B 1KQVA 1SL9A 2LC5A 2M1UA 2CTNA 1DJIA 2Y5IA 3ICBA 3PALA 4R1EA 3SJSA 1F70A 3O6BA 1XA5A 4WRIA 4C0LA 5KU1A 1LA0A 1NP8A 1RFJA 1M46A 1K9UA 3CTNA 2ZFDA 4BY4A 4MEWA 1B8CA 2LANA 2PRUA 2L51A 1DMOA 3SG6A 2NCOA 3EK7A 1L2OB 2KI6C 1BT6A 1QASA 1F8HA 1UP5A 2H61C 2NCPA 1CB1A 1YX7A 2RGIA 2IS9A 5K89A 3PLFB 2PMYA 1G8IA 2EGDA 1YUSA 4JWQA 1A75B 2OS8C 4GGNA 1B9AA 4OV2A 3TDZA 2MAZA 2BCBA 2LUXA 4XJKA 3WNXB 1KK8C 2Q91A 2JQ6A 2CBLA 3BXKA 2JT3A 2MLFC 1QS7A 3TS5B 3EK4A 1JWDA 4BY5A 5HLVA 3DVKA 3BUXB 1OZSA 2L98A 2LHIA 1IG5A 4D1EA 1PSRA 2LNKA 4ICBA 1NWDA 2KYCA 3BOWA 3VRRA 1Y1XA 1GGWA 1DGUA 1N65A 2CXJA 1K93D 3C1VA 2KFHA 4QJ5B 1DJGA 1IJ6A 2WC8A 2M97A 3GK4X 5CSJA 3PATA 1N0YA 3H4SE 2JU0A 1CLMA 1QVIY 2BKIB 1MUXA 3FWBA 1QTXA 1WRLA 2BBNA 2EHBA 3CLNA 3EKJA 1V1FA 4GFTA 1K9KA 1NX0A 1SW8A 3LK1A 2E30A 4NDDA 4A4CA 1QX7A 3GK2A 2MJWB 2E6WA 3OB1B 3OB2B 5CSNA 2KNEA 1TOPA 3GK1A 1LXFC 1S5GZ 1V1GA 2KBIA 2M7NA 3I5FB 2JXLA 2PASA 3FIAA 1TIZA 1CFCA 1B4CA 2L2EA 2JT8A 1CLLA 4CFQA 1XFYO 3VRQA 1J7QA 4PE4A 1RECA 2KI4B 1F54A 3EVRA 4MLWA 1ZUZA 4PCWA 4PHKA 2LLSA 3PN7B 2BCXA 4DIRA 2K0JA 1H8BA 1CFFA 1SCVA 1TCFA 4OR9B 2HQWA 1BF5A 1OE9B 4CPVA 1YTZC 1BODA 1TNWA 1QJTA 1UWOA 1WLMA 2LVKA 1NIWA 4GNKB 1JUOA 4L9MA 1ALWA 3BOWB 4HRGA 2HETA 3HCMA 2FOTA 1TNPA 1FBVA 1KWOB 2KAYA 1XK4A 1DJWA 1KSMA 1EG3A 4FTGA 2KBMA 2O5GA 2QPTA 2AMIA 1DJZA 1RROA 1NSHA 1S36A 1U5IA 2G9BA 1MWNA 1GQMA 1YURA 2KAVA 2EC6B 4I5JA 4I5KA 3TS5C 2K7CA 1EJ3A 1AVSA 3DVEA 2K2AA 3LLEA 2GV5A 1DJYA 4GBAA 3DD4A 3RM1A 1YUTA 3FS7A 4YI9A 1BLQA 1CFPA 3QRXA 5D69A 1QLKA 1C7WA 3EVVA 1A29A 1DVIA 1UHIA 1QXPA 1YVLA 3A8RA 1J55A 4NQGA 3M0WA 5AANA 1VRKA 2MBXA 1Y1UA 1PK0D 1J1EA 2L50A 1SRAA 3ZWHA 3OX5A 3DVJA 1CTRA 3TDUA 2LP3A 1PVAA 4OCIA 1K9PA 1W7JB 3WHUB 2Y1NA 1C07A 2B1UA 2VRGA 3TUYC 4M2OA 4YGEB 1F71A 2FCEA 2K2FA 1OMVA 1SNLA 4MBEA 2KI4C 1XYDA 3EKHA 2KHNA 2BCAA 1OMRA 2LP2A 1IQ5A 3PN7C 5I2QA 1NX3A 5CSIA 1UHHA 1QX2A 2LVIA 2OTGB 2CCMA 2LV7A 1OMDA 5AERA 1SCMC 4QJ3B 2COLB 5CPVA 5KTYA 2KI6D 3CR2A 3AKAA 4N5XA 4ZCUA 1SY9A 5J3XA 2ISDA 5HKZA 3AAJA 1YX8A 4MN0A 1WLZA 1SKTA 1HT9A 1AUIB 3BUNB 4GAOA 1KWOC 3WXAA 2BE6A 4XYNA 1SR6C 1AP4A 2A4JA 1EH2A 3JTDB 4QJ4B 1ZOTB 1BG1A 1KK7Z 1JFJA 4YGBB 5DKRA 3PSRA 1QLSA 2EC6C 3NSIA 4MZJA 2M9GA 2Y1MA 3VRNA 2JXCA 2LLUA 2G2BA 1BMOA 1ZMZA 4GPLB 1JFKA 1F4QA 2L4IA 5GQQC 3ZNIA 1L7ZA 2ZRTA 2JOJA 3I5IC 3NSKA 3LCPC 2WOSA 1UHNA 1AK8A 3OP0A 1XFWO 1M45A 1GGZA 1CMFA 2PALA 1B47A 1LINA 2F2PA 2LM5A 1B8RA 2GGMA 4ORAB 1N2DA 2LVVA 3D0YA 1K96A 5FYXA 1PULA 1IQ3A 1Q80A 1SL8A 4YGDB 1A4PA 1Y0VH 1NCYA 1ODBA 1QVIZ 2KYFA 2MRDA 1DF0A 4ETOA 3SG4A 4C0KA 1XVJA 1PVBA 2KDHA 2NZ0A 3KO0A 1XK4C 1XFXO 1J7OA 4IL1A 2K8MB 2KGRA 2LE9B 3OX6A 4WQ2A 3TUYB 2OTGC 1CLBA 1CM1A 1AJ5A 2WCBA 2K7DA 2CT9A 4DUQA 1XO5A 3DF0A 4GGFA 4XJKB 1CDNA 1UUSA 1YVHA 3BUOB 2ZN8A 2F3ZA 2K7BA 1NUBA 4JPZB 5PALA 1OSAA 1K90D 4F0ZB 1SCMB 2KQ6A 1UHKA 1PRWA 1KQMB 2M49B 3JTDC 4PE0A 2M3WA 3AAKA 1OQPA 3HX4A 1W7IB 3D0YB 1K8UA 4GUKA 1S5GY 4N1GA 3SIAA 1RTP1 1K94A 1YRUB 1G4YR 1EXRA 1M31A 1DF0B 1SR6B 4E68A 1AHRA 4JQ0D 3CR4X 2JTTA 2ZNDA 2R2IA 4Q04A 1UURA 1KFXS 3NXAA 2BL0B 2Y4QA 1TNQA 5I8NA 1J7PA 1DT7B 2LMUA 3A4UB 3K21A 3NSLA 1S3PA 3SG2A 2ZRSA 3CGAA 1FW4A 2MLEC 2BE4A 4TNCA 2OPOA 1PSBA 4WQ3A 1Y6WA 2I2RE 3I5IB 2M7LA 1S1EA 3I5HC 4MZKA 1IRJA 1TN4A 3F45A 1HQVA 4PALA 3I5GC 3DF0B 5I2OA 3SG7A 3EK8A 4DS7A 2HPSA 1TRFA 4N1FA 1OOJA 4A4BA 1J7RA 4YRUA 2JZIA 1JC2A 1D1OA 2MA2A 4C0JA 3PFVA 2NXQA 2WORA
chains in the Genus database with same CATH superfamily
3KF9A 4INXA 4CFRA 1CDLA 1IGVA 4MVFA 2QEVA 2WCEA 5HKYA 1MHOA 2M1KB 3NSOA 1UHJA 2LUCA 1YR5A 2FJUB 2KSPA 1SK6D 4DCKA 1MXEA 2LMTA 3IVTA 4OKHA 1B7TY 1U5IB 3AKBA 3CWGA 4M2PA 4YI8A 5JJGA 2FCDA 2KGBC 4NDBA 1KFXL 3D10A 3D76A 1NX1A 3DVMA 2SASA 1AJ4A 1E8AA 1KQMC 3D73A 3O4YA 5BPJA 2BKHB 2KFGA 3SIBA 1JSAA 1WRZA 1DGVA 3B88A 1M63B 1S6IA 2JC2A 2WNDA 2JNFA 1Y1AA 1SL7A 3R1VA 4PHNA 4MRYA 1CM4A 2KFFA 1WRKA 1QIVA 1SMGA 2PQLA 3IQQA 1FPWA 3SG3A 4F7FA 3R72A 1ZACA 2PYQA 1IKUA 1TCOB 1QV0A 4U8DA 2BL0C 1WDCB 1XFVO 1A03A 4HSZA 4PE7A 3IQOA 4INWA 1YRTB 3RLZA 2JT0A 2JWWA 1LKJA 3CS1A 1RJVA 4P2YB 4USLA 1B8LA 3QMEA 5FI7A 3S0EA 1JF2A 3FWCA 1EG4A 2K7OA 4M2QA 1CDPA 3BUWB 4YGCB 2JULA 2CNPA 2TN4A 1DJXA 2KOTA 2FJYA 2L4HA 4GGFC 1K2HA 4NDCA 3CYZA 1CKKA 2F8PA 1X02A 2H8VA 2HF5A 4P5OE 3GOFA 1KK7Y 1S26D 2YGUA 4HRHA 1S6JA 3OHMB 3MSEB 3VGOA 3I5HB 1TTXA 1TUZA 1KSOA 3I5GB 2K61A 2F3YA 4PDZA 1DQEA 2I18A 1FF1A 1J1DA 2O60A 1NCZA 4AOMA 1BU3A 2ZN9A 5KSZA 4CLNA 4JD9A 1LVCD 2BECA 2JTZA 5TNCA 1F55A 4I5LB 3PM2A 5AFPA 2F33A 1JBAA 4MRXA 1NX2A 1MXLC 1NCXA 2PSRA 2AAOA 1G33A 1XFUO 2I7AA 2JRFA 4ORBB 5G08A 2LCPA 2DOQA 1OZOA 2KAXA 1EL4A 1BR1B 2L0PA 3CZTX 3O78A 4PHJA 2D8NA 1R2UA 4ZCVA 4MZLA 3WHTB 2H61A 2LVJA 5JOLA 4YBHB 1NPQA 3JVTC 4IJ7A 3KEVA 1KCYA 1TNXA 2MHHA 5I2LA 5AEQA 3OBVA 2M29A 3KPXA 5DKQA 3BFHA 5HYDA 1SYMA 2LLTA 2QACA 4KYNA 4MSPA 4FQTA 3L47A 3EG5B 1T14A 3R1OA 3SG5A 1QATA 1WY9A 1MQ1A 2NLNA 5HKWA 1WDCC 1MR8A 1M39A 1C3ZA 3BFBA 1K95A 3CR5X 1ZFSA 1LA3A 2KQYA 5ER5A 1IH0A 3S0BA 1Z4HA 4I5NB 2V53A 1SBJA 1DC1A 2M8UA 1FI6A 3NGVA 2LAPA 1L2OC 1KFUS 2QEHA 2WCLA 5DKNA 5AXIA 5HLOA 1C7VA 2I94A 1XFZO 3BQ3A 5B8IB 4PE1A 4ORCB 2L5XB 3E3RA 1NYAA 1RWYA 3VROA 1QV1A 3BYAA 1B1GA 2M0RA 2F2OA 5F6TA 4AQIA 3D74A 1CNPA 2WCFA 1XFRA 2ZKMX 4FQOA 3KHEA 5D7FA 2QEOA 1FI5A 2LHLA 2BBMA 1BOCA 1SPYA 2ZNEA 4UPGA 1GJYA 2P6BB 1IIOA 1JF0A 2OS8B 2JPTA 2SCPA 3IF7A 1F4OA 2GTEA 1QX5B 2HQ8A 2H2KA 5ER4X 2LMVA 3VRPA 1BR4B 1IJ5A 1CFDA 1S6CA 1H4BA 1QIWA 1KK8B 5CSFA 2JNXA 3O2PA 2AUCA 3EVUA 3CZ2A 1R6PA 1YUUA 1B7TZ 1ALVA 1DJHA 3LK0A 3BUMB 4PHMA 5IBWA 1KFUL 1A2XA 3K1EA 1A75A 1DTLA 2GGZA 4AQJA 1CDMA 2WCJA 4OVNF 2PVBA 4CIDA 4YGAA 3LL8B 4HREE 3I5FC 3TDIA 1CMGA 3JVTB 1BJFA 1PALA 1RK9A 2Q4UA 4DRWA 1IWQA 3SS4A 3TZ1A 3PM8A 1MF8B 2ERBA 1KQVA 1SL9A 2LC5A 2M1UA 2CTNA 1DJIA 3NHIA 2Y5IA 3ICBA 3PALA 4R1EA 3SJSA 1F70A 3O6BA 1XA5A 4WRIA 3B6XA 1W9ZA 4C0LA 1LA0A 1NP8A 1RFJA 3FE9A 5KU1A 1M46A 1K9UA 3CTNA 1OOGA 2ZFDA 3CABA 4PT1A 4MEWA 1B8CA 2LANA 2PRUA 2L51A 4BY4A 1GM0A 1P28A 1DMOA 3SG6A 2NCOA 3EK7A 1L2OB 2KI6C 1BT6A 1QASA 1F8HA 1UP5A 2H61C 2NCPA 3B86A 1OOFA 1CB1A 1YX7A 2RGIA 2IS9A 5K89A 3PLFB 2PMYA 1G8IA 2EGDA 1YUSA 4JWQA 1A75B 2OS8C 4GGNA 1B9AA 4OV2A 2WCMA 2WCKA 3TDZA 2MAZA 2BCBA 2LUXA 4XJKA 3WNXB 1KK8C 2Q91A 2JQ6A 2CBLA 3BXKA 2JT3A 2MLFC 1QS7A 3TS5B 3EK4A 1JWDA 4BY5A 5HLVA 3DVKA 3BUXB 1OZSA 2L98A 2LHIA 1IG5A 4D1EA 1PSRA 2LNKA 2WC5A 4ICBA 1NWDA 2KYCA 3BOWA 3VRRA 1Y1XA 1GGWA 1DGUA 1N65A 2CXJA 1K93D 3C1VA 2KFHA 4QJ5B 1DJGA 1IJ6A 2WC8A 1Z2CB 2M97A 3GK4X 5CSJA 3PATA 3V2LA 1N0YA 1SSEB 3H4SE 2JU0A 1CLMA 1QVIY 2BKIB 1MUXA 3FWBA 4GFTA 1QTXA 1WRLA 2BBNA 2EHBA 3CLNA 3DYEA 1V1FA 2JPOA 1K9KA 1NX0A 3BFAA 1SW8A 3LK1A 1LS8A 2E30A 4NDDA 1OOIX 4A4CA 1QX7A 3GK2A 2MJWB 2E6WA 3OB1B 5FI2A 3CZ1A 3OB2B 5CSNA 2KLDA 2KNEA 1TOPA 3UO9A 3GK1A 1LXFC 1S5GZ 3SS3A 1V1GA 2KBIA 2M7NA 3I5FB 2JXLA 2PASA 3FIAA 1TIZA 1CFCA 1B4CA 3D77A 2K60A 2L2EA 2JT8A 1CLLA 4CFQA 1XFYO 3VRQA 1J7QA 4PE4A 1RECA 2KI4B 1F54A 3EVRA 4MLWA 1ZUZA 4PCWA 4PHKA 2LLSA 3FE6A 3PN7B 2BCXA 4DIRA 2K0JA 1H8BA 1CFFA 1SCVA 1TCFA 2P70A 2HQWA 4OR9B 1BF5A 1OE9B 4CPVA 1YTZC 1BODA 3PJIA 2L5YA 3S0FA 1TNWA 1QJTA 3EKJA 1UWOA 1WLMA 2LVKA 1DELA 1NIWA 4GNKB 1C3YA 1JUOA 4L9MA 1ALWA 3BOWB 4HRGA 2HETA 3HCMA 2FOTA 1TNPA 1FBVA 1KWOB 1OW4A 2KAYA 1XK4A 1DJWA 1KSMA 3B87A 1EG3A 4FTGA 2KBMA 2O5GA 3BJHA 5I94A 2QPTA 2AMIA 1OOHA 1DJZA 1RROA 1NSHA 1S36A 1U5IA 2G9BA 1MWNA 1GQMA 1YURA 2KAVA 2EC6B 4I5JA 4I5KA 3TS5C 2K7CA 1EJ3A 1AVSA 3DVEA 1DEKA 2K2AA 3LLEA 2GV5A 3CDNA 1DJYA 4GBAA 3DD4A 3RM1A 1YUTA 3FS7A 4YI9A 1BLQA 1CFPA 3QRXA 5D69A 1QLKA 1C7WA 1QWVA 3D78A 3EVVA 1A29A 1DVIA 1UHIA 1QXPA 1YVLA 3A8RA 1J55A 4NQGA 3RZSA 3M0WA 5AANA 1VRKA 2MBXA 1Y1UA 1PK0D 1J1EA 2L50A 1SRAA 3ZWHA 3OX5A 3DVJA 1CTRA 3TDUA 2L2CA 2LP3A 1PVAA 4OCIA 1K9PA 1W7JB 3WHUB 2Y1NA 1C07A 2KPHA 2QEBA 2B1UA 2VRGA 3TUYC 4M2OA 4YGEB 1F71A 2KLEA 2FCEA 2K2FA 1OMVA 1SNLA 4MBEA 2WCHA 2KI4C 1XYDA 3EKHA 2WC6A 2KHNA 2BCAA 5EL2A 1OMRA 2LP2A 1IQ5A 3PN7C 5I2QA 3S0GA 1NX3A 3DY9A 1UHHA 5CSIA 1QX2A 2LVIA 2OTGB 2CCMA 2LV7A 1OMDA 5AERA 1SCMC 4QJ3B 2COLB 5CPVA 5KTYA 2KI6D 3CR2A 3AKAA 4N5XA 4ZCUA 1SY9A 5J3XA 2ISDA 5HKZA 3SS5A 3AAJA 1YX8A 4MN0A 1WLZA 1SKTA 1HT9A 1AUIB 3BUNB 4GAOA 1KWOC 3WXAA 2BE6A 3O4XA 4JKTA 4XYNA 1SR6C 1AP4A 2A4JA 1EH2A 3VB1A 3JTDB 3OGNA 1ZOTB 4QJ4B 1KK7Z 1BG1A 1JFJA 4YGBB 5DKRA 1TWOA 3PSRA 1QLSA 2EC6C 3NSIA 4MZJA 2M9GA 2Y1MA 3VRNA 2JXCA 2LLUA 2G2BA 1BMOA 1ZMZA 4GPLB 1JFKA 3B7AA 1F4QA 2L4IA 5GQQC 3ZNIA 1L7ZA 2ZRTA 2JOJA 2QDIA 3I5IC 3NSKA 3LCPC 2WOSA 1UHNA 1AK8A 3OP0A 1XFWO 1M45A 1GGZA 1CMFA 2BAPA 2PALA 1B47A 1LINA 2F2PA 2LM5A 1B8RA 2GGMA 4ORAB 1N2DA 2LVVA 3D0YA 1K96A 5FYXA 1PULA 1IQ3A 1Q80A 1SL8A 4YGDB 1A4PA 1Y0VH 1NCYA 1ODBA 1QVIZ 2KYFA 2MRDA 1DF0A 3L4AA 5DICA 4ETOA 3SG4A 3UNWA 4C0KA 1XVJA 1PVBA 2KDHA 2NZ0A 3KO0A 1XK4C 1XFXO 1J7OA 4IL1A 4OZDA 2K8MB 2KGRA 2LE9B 3N7HA 3OX6A 4WQ2A 3TUYB 2OTGC 1CLBA 1CM1A 1AJ5A 2WCBA 2K7DA 2CT9A 4DUQA 3L4LA 1XO5A 3DF0A 3CZ0A 4GGFA 4XJKB 1CDNA 1UUSA 1YVHA 1ORGA 3BUOB 2ZN8A 2F3ZA 2K7BA 1NUBA 4JPZB 5PALA 1OSAA 1K90D 4F0ZB 1SCMB 2KQ6A 1UHKA 1PRWA 1KQMB 2M49B 3JTDC 4PE0A 3NHTA 2M3WA 3AAKA 1OQPA 3HX4A 1W7IB 3D0YB 1K8UA 4GUKA 1S5GY 4N1GA 2P71A 3SIAA 1RTP1 3S0AA 1K94A 1YRUB 1G4YR 1EXRA 1M31A 3R1PA 3S0DA 1DF0B 1SR6B 4E68A 1AHRA 4JQ0D 1TUJA 3Q8IA 3CR4X 2JTTA 2ZNDA 2R2IA 3DZTA 4Q04A 1UURA 1KFXS 3NXAA 2BL0B 2Y4QA 1TNQA 3FE8A 5I8NA 1J7PA 1DT7B 2LMUA 3A4UB 3K21A 3NSLA 1S3PA 3SG2A 2ZRSA 3CGAA 1FW4A 2MLEC 5D3OA 2BE4A 2BNXA 2OPOA 1PSBA 4TNCA 4WQ3A 1Y6WA 2I2RE 3I5IB 2M7LA 5HL1A 1S1EA 3I5HC 4MZKA 1IRJA 1TN4A 3F45A 1HQVA 3DXLA 4PALA 3I5GC 5FI6A 3DF0B 5I2OA 3SG7A 3EK8A 4DS7A 2HPSA 1TRFA 4N1FA 1OOJA 3D75A 4A4BA 1J7RA 4YRUA 2JZIA 1JC2A 1D1OA 2MA2A 4C0JA 3PFVA 2NXQA 2WORA
chains in the Genus database with same CATH topology
3KF9A 4CFRA 1CDLA 1IGVA 4MVFA 2WCEA 5HKYA 1MHOA 2M1KB 3NSOA 1UHJA 2LUCA 1YR5A 2FJUB 2KSPA 1SK6D 4DCKA 1MXEA 2LMTA 4OKHA 1B7TY 1U5IB 3AKBA 3CWGA 4M2PA 4YI8A 5JJGA 2FCDA 2KGBC 4NDBA 1KFXL 3D10A 3DVMA 1NX1A 2SASA 1AJ4A 1E8AA 1KQMC 3O4YA 5BPJA 2BKHB 2KFGA 3SIBA 1JSAA 1WRZA 1DGVA 1M63B 1S6IA 2JC2A 2WNDA 2JNFA 1Y1AA 1SL7A 4PHNA 4MRYA 1CM4A 2KFFA 1WRKA 1QIVA 1SMGA 3IQQA 1FPWA 3SG3A 1ZACA 1IKUA 1TCOB 1QV0A 4U8DA 2BL0C 1WDCB 1XFVO 1A03A 4HSZA 4PE7A 3IQOA 1YRTB 3RLZA 2JT0A 2JWWA 1LKJA 3CS1A 1RJVA 4P2YB 4USLA 1B8LA 1JF2A 3FWCA 1EG4A 2K7OA 4M2QA 1CDPA 3BUWB 4YGCB 2JULA 2CNPA 2TN4A 1DJXA 2KOTA 2L4HA 4GGFC 1K2HA 4NDCA 1CKKA 2F8PA 1X02A 2HF5A 4P5OE 3GOFA 1KK7Y 1S26D 4HRHA 1S6JA 3OHMB 3MSEB 3VGOA 3I5HB 1TTXA 1KSOA 3I5GB 2K61A 2F3YA 4PDZA 2I18A 1FF1A 1J1DA 2O60A 1NCZA 4AOMA 1BU3A 2ZN9A 5KSZA 4CLNA 1LVCD 2BECA 2JTZA 5TNCA 1F55A 4I5LB 5AFPA 2F33A 1JBAA 4MRXA 1NX2A 1MXLC 1NCXA 2PSRA 2AAOA 1G33A 1XFUO 2I7AA 2JRFA 4ORBB 5G08A 2LCPA 2DOQA 1OZOA 2KAXA 1EL4A 1BR1B 2L0PA 3CZTX 3O78A 4PHJA 2D8NA 1R2UA 4ZCVA 4MZLA 3WHTB 2H61A 2LVJA 5JOLA 4YBHB 1NPQA 3JVTC 3KEVA 1KCYA 1TNXA 2MHHA 5I2LA 5AEQA 2M29A 3KPXA 5DKQA 5HYDA 1SYMA 2LLTA 2QACA 4MSPA 3SG5A 1QATA 1WY9A 1MQ1A 2NLNA 5HKWA 1WDCC 1MR8A 1M39A 1K95A 3CR5X 1ZFSA 1LA3A 2KQYA 5ER5A 1IH0A 4I5NB 2V53A 1SBJA 2M8UA 1FI6A 2LAPA 1L2OC 1KFUS 5DKNA 5AXIA 5HLOA 1C7VA 2I94A 1XFZO 3BQ3A 5B8IB 4PE1A 4ORCB 2L5XB 3E3RA 1NYAA 1RWYA 3VROA 1QV1A 3BYAA 1B1GA 2M0RA 2F2OA 5F6TA 4AQIA 1CNPA 2WCFA 2ZKMX 4FQOA 3KHEA 5D7FA 1FI5A 2LHLA 2BBMA 1BOCA 1SPYA 2ZNEA 4UPGA 1GJYA 2P6BB 1JF0A 2OS8B 2JPTA 2SCPA 3IF7A 1F4OA 1QX5B 2HQ8A 2H2KA 5ER4X 2LMVA 3VRPA 1BR4B 1IJ5A 1CFDA 1S6CA 1H4BA 1QIWA 1KK8B 5CSFA 2JNXA 3O2PA 2AUCA 3EVUA 1R6PA 1YUUA 1B7TZ 1ALVA 1DJHA 3LK0A 3BUMB 4PHMA 5IBWA 1KFUL 1A2XA 1A75A 1DTLA 2GGZA 4AQJA 1CDMA 4OVNF 2PVBA 4CIDA 4YGAA 3LL8B 4HREE 3I5FC 3TDIA 1CMGA 3JVTB 1BJFA 1PALA 1RK9A 2Q4UA 4DRWA 1IWQA 3TZ1A 3PM8A 1MF8B 1KQVA 1SL9A 2LC5A 2M1UA 2CTNA 1DJIA 2Y5IA 3ICBA 3PALA 4R1EA 3SJSA 1F70A 3O6BA 1XA5A 4WRIA 4C0LA 5KU1A 1LA0A 1NP8A 1RFJA 1M46A 1K9UA 3CTNA 2ZFDA 4BY4A 4MEWA 1B8CA 2LANA 2PRUA 2L51A 1DMOA 3SG6A 2NCOA 3EK7A 1L2OB 2KI6C 1BT6A 1QASA 1F8HA 1UP5A 2H61C 2NCPA 1CB1A 1YX7A 2RGIA 2IS9A 5K89A 3PLFB 2PMYA 1G8IA 2EGDA 1YUSA 4JWQA 1A75B 2OS8C 4GGNA 1B9AA 4OV2A 3TDZA 2MAZA 2BCBA 2LUXA 4XJKA 3WNXB 1KK8C 2Q91A 2JQ6A 2CBLA 3BXKA 2JT3A 2MLFC 1QS7A 3TS5B 3EK4A 1JWDA 4BY5A 5HLVA 3DVKA 3BUXB 1OZSA 2L98A 2LHIA 1IG5A 4D1EA 1PSRA 2LNKA 4ICBA 1NWDA 2KYCA 3BOWA 3VRRA 1Y1XA 1GGWA 1DGUA 1N65A 2CXJA 1K93D 3C1VA 2KFHA 4QJ5B 1DJGA 1IJ6A 2WC8A 2M97A 3GK4X 5CSJA 3PATA 1N0YA 3H4SE 2JU0A 1CLMA 1QVIY 2BKIB 1MUXA 3FWBA 1QTXA 1WRLA 2BBNA 2EHBA 3CLNA 3EKJA 1V1FA 4GFTA 1K9KA 1NX0A 1SW8A 3LK1A 2E30A 4NDDA 4A4CA 1QX7A 3GK2A 2MJWB 2E6WA 3OB1B 3OB2B 5CSNA 2KNEA 1TOPA 3GK1A 1LXFC 1S5GZ 1V1GA 2KBIA 2M7NA 3I5FB 2JXLA 2PASA 3FIAA 1TIZA 1CFCA 1B4CA 2L2EA 2JT8A 1CLLA 4CFQA 1XFYO 3VRQA 1J7QA 4PE4A 1RECA 2KI4B 1F54A 3EVRA 4MLWA 1ZUZA 4PCWA 4PHKA 2LLSA 3PN7B 2BCXA 4DIRA 2K0JA 1H8BA 1CFFA 1SCVA 1TCFA 4OR9B 2HQWA 1BF5A 1OE9B 4CPVA 1YTZC 1BODA 1TNWA 1QJTA 1UWOA 1WLMA 2LVKA 1NIWA 4GNKB 1JUOA 4L9MA 1ALWA 3BOWB 4HRGA 2HETA 3HCMA 2FOTA 1TNPA 1FBVA 1KWOB 2KAYA 1XK4A 1DJWA 1KSMA 1EG3A 4FTGA 2KBMA 2O5GA 2QPTA 2AMIA 1DJZA 1RROA 1NSHA 1S36A 1U5IA 2G9BA 1MWNA 1GQMA 1YURA 2KAVA 2EC6B 4I5JA 4I5KA 3TS5C 2K7CA 1EJ3A 1AVSA 3DVEA 2K2AA 3LLEA 2GV5A 1DJYA 4GBAA 3DD4A 3RM1A 1YUTA 3FS7A 4YI9A 1BLQA 1CFPA 3QRXA 5D69A 1QLKA 1C7WA 3EVVA 1A29A 1DVIA 1UHIA 1QXPA 1YVLA 3A8RA 1J55A 4NQGA 3M0WA 5AANA 1VRKA 2MBXA 1Y1UA 1PK0D 1J1EA 2L50A 1SRAA 3ZWHA 3OX5A 3DVJA 1CTRA 3TDUA 2LP3A 1PVAA 4OCIA 1K9PA 1W7JB 3WHUB 2Y1NA 1C07A 2B1UA 2VRGA 3TUYC 4M2OA 4YGEB 1F71A 2FCEA 2K2FA 1OMVA 1SNLA 4MBEA 2KI4C 1XYDA 3EKHA 2KHNA 2BCAA 1OMRA 2LP2A 1IQ5A 3PN7C 5I2QA 1NX3A 5CSIA 1UHHA 1QX2A 2LVIA 2OTGB 2CCMA 2LV7A 1OMDA 5AERA 1SCMC 4QJ3B 2COLB 5CPVA 5KTYA 2KI6D 3CR2A 3AKAA 4N5XA 4ZCUA 1SY9A 5J3XA 2ISDA 5HKZA 3AAJA 1YX8A 4MN0A 1WLZA 1SKTA 1HT9A 1AUIB 3BUNB 4GAOA 1KWOC 3WXAA 2BE6A 4XYNA 1SR6C 1AP4A 2A4JA 1EH2A 3JTDB 4QJ4B 1ZOTB 1BG1A 1KK7Z 1JFJA 4YGBB 5DKRA 3PSRA 1QLSA 2EC6C 3NSIA 4MZJA 2M9GA 2Y1MA 3VRNA 2JXCA 2LLUA 2G2BA 1BMOA 1ZMZA 4GPLB 1JFKA 1F4QA 2L4IA 5GQQC 3ZNIA 1L7ZA 2ZRTA 2JOJA 3I5IC 3NSKA 3LCPC 2WOSA 1UHNA 1AK8A 3OP0A 1XFWO 1M45A 1GGZA 1CMFA 2PALA 1B47A 1LINA 2F2PA 2LM5A 1B8RA 2GGMA 4ORAB 1N2DA 2LVVA 3D0YA 1K96A 5FYXA 1PULA 1IQ3A 1Q80A 1SL8A 4YGDB 1A4PA 1Y0VH 1NCYA 1ODBA 1QVIZ 2KYFA 2MRDA 1DF0A 4ETOA 3SG4A 4C0KA 1XVJA 1PVBA 2KDHA 2NZ0A 3KO0A 1XK4C 1XFXO 1J7OA 4IL1A 2K8MB 2KGRA 2LE9B 3OX6A 4WQ2A 3TUYB 2OTGC 1CLBA 1CM1A 1AJ5A 2WCBA 2K7DA 2CT9A 4DUQA 1XO5A 3DF0A 4GGFA 4XJKB 1CDNA 1UUSA 1YVHA 3BUOB 2ZN8A 2F3ZA 2K7BA 1NUBA 4JPZB 5PALA 1OSAA 1K90D 4F0ZB 1SCMB 2KQ6A 1UHKA 1PRWA 1KQMB 2M49B 3JTDC 4PE0A 2M3WA 3AAKA 1OQPA 3HX4A 1W7IB 3D0YB 1K8UA 4GUKA 1S5GY 4N1GA 3SIAA 1RTP1 1K94A 1YRUB 1G4YR 1EXRA 1M31A 1DF0B 1SR6B 4E68A 1AHRA 4JQ0D 3CR4X 2JTTA 2ZNDA 2R2IA 4Q04A 1UURA 1KFXS 3NXAA 2BL0B 2Y4QA 1TNQA 5I8NA 1J7PA 1DT7B 2LMUA 3A4UB 3K21A 3NSLA 1S3PA 3SG2A 2ZRSA 3CGAA 1FW4A 2MLEC 2BE4A 4TNCA 2OPOA 1PSBA 4WQ3A 1Y6WA 2I2RE 3I5IB 2M7LA 1S1EA 3I5HC 4MZKA 1IRJA 1TN4A 3F45A 1HQVA 4PALA 3I5GC 3DF0B 5I2OA 3SG7A 3EK8A 4DS7A 2HPSA 1TRFA 4N1FA 1OOJA 4A4BA 1J7RA 4YRUA 2JZIA 1JC2A 1D1OA 2MA2A 4C0JA 3PFVA 2NXQA 2WORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KF9 A;  4CFR A;  1CDL A;  1IGV A;  4MVF A;  2WCE A;  5HKY A;  1MHO A;  2M1K B;  3NSO A;  1UHJ A;  2LUC A;  1YR5 A;  2FJU B;  2KSP A;  1SK6 D;  4DCK A;  1MXE A;  2LMT A;  4OKH A;  1B7T Y;  1U5I B;  3AKB A;  3CWG A;  4M2P A;  4YI8 A;  5JJG A;  2FCD A;  2KGB C;  4NDB A;  1KFX L;  3D10 A;  3DVM A;  1NX1 A;  2SAS A;  1AJ4 A;  1E8A A;  1KQM C;  3O4Y A;  5BPJ A;  2BKH B;  2KFG A;  3SIB A;  1JSA A;  1WRZ A;  1DGV A;  1M63 B;  1S6I A;  2JC2 A;  2WND A;  2JNF A;  1Y1A A;  1SL7 A;  4PHN A;  4MRY A;  1CM4 A;  2KFF A;  1WRK A;  1QIV A;  1SMG A;  3IQQ A;  1FPW A;  3SG3 A;  1ZAC A;  1IKU A;  1TCO B;  1QV0 A;  4U8D A;  2BL0 C;  1WDC B;  1XFV O;  1A03 A;  4HSZ A;  4PE7 A;  3IQO A;  1YRT B;  3RLZ A;  2JT0 A;  2JWW A;  1LKJ A;  3CS1 A;  1RJV A;  4P2Y B;  4USL A;  1B8L A;  1JF2 A;  3FWC A;  1EG4 A;  2K7O A;  4M2Q A;  1CDP A;  3BUW B;  4YGC B;  2JUL A;  2CNP A;  2TN4 A;  1DJX A;  2KOT A;  2L4H A;  4GGF C;  1K2H A;  4NDC A;  1CKK A;  2F8P A;  1X02 A;  2HF5 A;  4P5O E;  3GOF A;  1KK7 Y;  1S26 D;  4HRH A;  1S6J A;  3OHM B;  3MSE B;  3VGO A;  3I5H B;  1TTX A;  1KSO A;  3I5G B;  2K61 A;  2F3Y A;  4PDZ A;  2I18 A;  1FF1 A;  1J1D A;  2O60 A;  1NCZ A;  4AOM A;  1BU3 A;  2ZN9 A;  5KSZ A;  4CLN A;  1LVC D;  2BEC A;  2JTZ A;  5TNC A;  1F55 A;  4I5L B;  5AFP A;  2F33 A;  1JBA A;  4MRX A;  1NX2 A;  1MXL C;  1NCX A;  2PSR A;  2AAO A;  1G33 A;  1XFU O;  2I7A A;  2JRF A;  4ORB B;  5G08 A;  2LCP A;  2DOQ A;  1OZO A;  2KAX A;  1EL4 A;  1BR1 B;  2L0P A;  3CZT X;  3O78 A;  4PHJ A;  2D8N A;  1R2U A;  4ZCV A;  4MZL A;  3WHT B;  2H61 A;  2LVJ A;  5JOL A;  4YBH B;  1NPQ A;  3JVT C;  3KEV A;  1KCY A;  1TNX A;  2MHH A;  5I2L A;  5AEQ A;  2M29 A;  3KPX A;  5DKQ A;  5HYD A;  1SYM A;  2LLT A;  2QAC A;  4MSP A;  3SG5 A;  1QAT A;  1WY9 A;  1MQ1 A;  2NLN A;  5HKW A;  1WDC C;  1MR8 A;  1M39 A;  1K95 A;  3CR5 X;  1ZFS A;  1LA3 A;  2KQY A;  5ER5 A;  1IH0 A;  4I5N B;  2V53 A;  1SBJ A;  2M8U A;  1FI6 A;  2LAP A;  1L2O C;  1KFU S;  5DKN A;  5AXI A;  5HLO A;  1C7V A;  2I94 A;  1XFZ O;  3BQ3 A;  5B8I B;  4PE1 A;  4ORC B;  2L5X B;  3E3R A;  1NYA A;  1RWY A;  3VRO A;  1QV1 A;  3BYA A;  1B1G A;  2M0R A;  2F2O A;  5F6T A;  4AQI A;  1CNP A;  2WCF A;  2ZKM X;  4FQO A;  3KHE A;  5D7F A;  1FI5 A;  2LHL A;  2BBM A;  1BOC A;  1SPY A;  2ZNE A;  4UPG A;  1GJY A;  2P6B B;  1JF0 A;  2OS8 B;  2JPT A;  2SCP A;  3IF7 A;  1F4O A;  1QX5 B;  2HQ8 A;  2H2K A;  5ER4 X;  2LMV A;  3VRP A;  1BR4 B;  1IJ5 A;  1CFD A;  1S6C A;  1H4B A;  1QIW A;  1KK8 B;  5CSF A;  2JNX A;  3O2P A;  2AUC A;  3EVU A;  1R6P A;  1YUU A;  1B7T Z;  1ALV A;  1DJH A;  3LK0 A;  3BUM B;  4PHM A;  5IBW A;  1KFU L;  1A2X A;  1A75 A;  1DTL A;  2GGZ A;  4AQJ A;  1CDM A;  4OVN F;  2PVB A;  4CID A;  4YGA A;  3LL8 B;  4HRE E;  3I5F C;  3TDI A;  1CMG A;  3JVT B;  1BJF A;  1PAL A;  1RK9 A;  2Q4U A;  4DRW A;  1IWQ A;  3TZ1 A;  3PM8 A;  1MF8 B;  1KQV A;  1SL9 A;  2LC5 A;  2M1U A;  2CTN A;  1DJI A;  2Y5I A;  3ICB A;  3PAL A;  4R1E A;  3SJS A;  1F70 A;  3O6B A;  1XA5 A;  4WRI A;  4C0L A;  5KU1 A;  1LA0 A;  1NP8 A;  1RFJ A;  1M46 A;  1K9U A;  3CTN A;  2ZFD A;  4BY4 A;  4MEW A;  1B8C A;  2LAN A;  2PRU A;  2L51 A;  1DMO A;  3SG6 A;  2NCO A;  3EK7 A;  1L2O B;  2KI6 C;  1BT6 A;  1QAS A;  1F8H A;  1UP5 A;  2H61 C;  2NCP A;  1CB1 A;  1YX7 A;  2RGI A;  2IS9 A;  5K89 A;  3PLF B;  2PMY A;  1G8I A;  2EGD A;  1YUS A;  4JWQ A;  1A75 B;  2OS8 C;  4GGN A;  1B9A A;  4OV2 A;  3TDZ A;  2MAZ A;  2BCB A;  2LUX A;  4XJK A;  3WNX B;  1KK8 C;  2Q91 A;  2JQ6 A;  2CBL A;  3BXK A;  2JT3 A;  2MLF C;  1QS7 A;  3TS5 B;  3EK4 A;  1JWD A;  4BY5 A;  5HLV A;  3DVK A;  3BUX B;  1OZS A;  2L98 A;  2LHI A;  1IG5 A;  4D1E A;  1PSR A;  2LNK A;  4ICB A;  1NWD A;  2KYC A;  3BOW A;  3VRR A;  1Y1X A;  1GGW A;  1DGU A;  1N65 A;  2CXJ A;  1K93 D;  3C1V A;  2KFH A;  4QJ5 B;  1DJG A;  1IJ6 A;  2WC8 A;  2M97 A;  3GK4 X;  5CSJ A;  3PAT A;  1N0Y A;  3H4S E;  2JU0 A;  1CLM A;  1QVI Y;  2BKI B;  1MUX A;  3FWB A;  1QTX A;  1WRL A;  2BBN A;  2EHB A;  3CLN A;  3EKJ A;  1V1F A;  4GFT A;  1K9K A;  1NX0 A;  1SW8 A;  3LK1 A;  2E30 A;  4NDD A;  4A4C A;  1QX7 A;  3GK2 A;  2MJW B;  2E6W A;  3OB1 B;  3OB2 B;  5CSN A;  2KNE A;  1TOP A;  3GK1 A;  1LXF C;  1S5G Z;  1V1G A;  2KBI A;  2M7N A;  3I5F B;  2JXL A;  2PAS A;  3FIA A;  1TIZ A;  1CFC A;  1B4C A;  2L2E A;  2JT8 A;  1CLL A;  4CFQ A;  1XFY O;  3VRQ A;  1J7Q A;  4PE4 A;  1REC A;  2KI4 B;  1F54 A;  3EVR A;  4MLW A;  1ZUZ A;  4PCW A;  4PHK A;  2LLS A;  3PN7 B;  2BCX A;  4DIR A;  2K0J A;  1H8B A;  1CFF A;  1SCV A;  1TCF A;  4OR9 B;  2HQW A;  1BF5 A;  1OE9 B;  4CPV A;  1YTZ C;  1BOD A;  1TNW A;  1QJT A;  1UWO A;  1WLM A;  2LVK A;  1NIW A;  4GNK B;  1JUO A;  4L9M A;  1ALW A;  3BOW B;  4HRG A;  2HET A;  3HCM A;  2FOT A;  1TNP A;  1FBV A;  1KWO B;  2KAY A;  1XK4 A;  1DJW A;  1KSM A;  1EG3 A;  4FTG A;  2KBM A;  2O5G A;  2QPT A;  2AMI A;  1DJZ A;  1RRO A;  1NSH A;  1S36 A;  1U5I A;  2G9B A;  1MWN A;  1GQM A;  1YUR A;  2KAV A;  2EC6 B;  4I5J A;  4I5K A;  3TS5 C;  2K7C A;  1EJ3 A;  1AVS A;  3DVE A;  2K2A A;  3LLE A;  2GV5 A;  1DJY A;  4GBA A;  3DD4 A;  3RM1 A;  1YUT A;  3FS7 A;  4YI9 A;  1BLQ A;  1CFP A;  3QRX A;  5D69 A;  1QLK A;  1C7W A;  3EVV A;  1A29 A;  1DVI A;  1UHI A;  1QXP A;  1YVL A;  3A8R A;  1J55 A;  4NQG A;  3M0W A;  5AAN A;  1VRK A;  2MBX A;  1Y1U A;  1PK0 D;  1J1E A;  2L50 A;  1SRA A;  3ZWH A;  3OX5 A;  3DVJ A;  1CTR A;  3TDU A;  2LP3 A;  1PVA A;  4OCI A;  1K9P A;  1W7J B;  3WHU B;  2Y1N A;  1C07 A;  2B1U A;  2VRG A;  3TUY C;  4M2O A;  4YGE B;  1F71 A;  2FCE A;  2K2F A;  1OMV A;  1SNL A;  4MBE A;  2KI4 C;  1XYD A;  3EKH A;  2KHN A;  2BCA A;  1OMR A;  2LP2 A;  1IQ5 A;  3PN7 C;  5I2Q A;  1NX3 A;  5CSI A;  1UHH A;  1QX2 A;  2LVI A;  2OTG B;  2CCM A;  2LV7 A;  1OMD A;  5AER A;  1SCM C;  4QJ3 B;  2COL B;  5CPV A;  5KTY A;  2KI6 D;  3CR2 A;  3AKA A;  4N5X A;  4ZCU A;  1SY9 A;  5J3X A;  2ISD A;  5HKZ A;  3AAJ A;  1YX8 A;  4MN0 A;  1WLZ A;  1SKT A;  1HT9 A;  1AUI B;  3BUN B;  4GAO A;  1KWO C;  3WXA A;  2BE6 A;  4XYN A;  1SR6 C;  1AP4 A;  2A4J A;  1EH2 A;  3JTD B;  4QJ4 B;  1ZOT B;  1BG1 A;  1KK7 Z;  1JFJ A;  4YGB B;  5DKR A;  3PSR A;  1QLS A;  2EC6 C;  3NSI A;  4MZJ A;  2M9G A;  2Y1M A;  3VRN A;  2JXC A;  2LLU A;  2G2B A;  1BMO A;  1ZMZ A;  4GPL B;  1JFK A;  1F4Q A;  2L4I A;  5GQQ C;  3ZNI A;  1L7Z A;  2ZRT A;  2JOJ A;  3I5I C;  3NSK A;  3LCP C;  2WOS A;  1UHN A;  1AK8 A;  3OP0 A;  1XFW O;  1M45 A;  1GGZ A;  1CMF A;  2PAL A;  1B47 A;  1LIN A;  2F2P A;  2LM5 A;  1B8R A;  2GGM A;  4ORA B;  1N2D A;  2LVV A;  3D0Y A;  1K96 A;  5FYX A;  1PUL A;  1IQ3 A;  1Q80 A;  1SL8 A;  4YGD B;  1A4P A;  1Y0V H;  1NCY A;  1ODB A;  1QVI Z;  2KYF A;  2MRD A;  1DF0 A;  4ETO A;  3SG4 A;  4C0K A;  1XVJ A;  1PVB A;  2KDH A;  2NZ0 A;  3KO0 A;  1XK4 C;  1XFX O;  1J7O A;  4IL1 A;  2K8M B;  2KGR A;  2LE9 B;  3OX6 A;  4WQ2 A;  3TUY B;  2OTG C;  1CLB A;  1CM1 A;  1AJ5 A;  2WCB A;  2K7D A;  2CT9 A;  4DUQ A;  1XO5 A;  3DF0 A;  4GGF A;  4XJK B;  1CDN A;  1UUS A;  1YVH A;  3BUO B;  2ZN8 A;  2F3Z A;  2K7B A;  1NUB A;  4JPZ B;  5PAL A;  1OSA A;  1K90 D;  4F0Z B;  1SCM B;  2KQ6 A;  1UHK A;  1PRW A;  1KQM B;  2M49 B;  3JTD C;  4PE0 A;  2M3W A;  3AAK A;  1OQP A;  3HX4 A;  1W7I B;  3D0Y B;  1K8U A;  4GUK A;  1S5G Y;  4N1G A;  3SIA A;  1RTP 1;  1K94 A;  1YRU B;  1G4Y R;  1EXR A;  1M31 A;  1DF0 B;  1SR6 B;  4E68 A;  1AHR A;  4JQ0 D;  3CR4 X;  2JTT A;  2ZND A;  2R2I A;  4Q04 A;  1UUR A;  1KFX S;  3NXA A;  2BL0 B;  2Y4Q A;  1TNQ A;  5I8N A;  1J7P A;  1DT7 B;  2LMU A;  3A4U B;  3K21 A;  3NSL A;  1S3P A;  3SG2 A;  2ZRS A;  3CGA A;  1FW4 A;  2MLE C;  2BE4 A;  4TNC A;  2OPO A;  1PSB A;  4WQ3 A;  1Y6W A;  2I2R E;  3I5I B;  2M7L A;  1S1E A;  3I5H C;  4MZK A;  1IRJ A;  1TN4 A;  3F45 A;  1HQV A;  4PAL A;  3I5G C;  3DF0 B;  5I2O A;  3SG7 A;  3EK8 A;  4DS7 A;  2HPS A;  1TRF A;  4N1F A;  1OOJ A;  4A4B A;  1J7R A;  4YRU A;  2JZI A;  1JC2 A;  1D1O A;  2MA2 A;  4C0J A;  3PFV A;  2NXQ A;  2WOR A; 
#chains in the Genus database with same CATH topology
 3KF9 A;  4INX A;  4CFR A;  1CDL A;  1IGV A;  4MVF A;  2QEV A;  2WCE A;  5HKY A;  1MHO A;  2M1K B;  3NSO A;  1UHJ A;  2LUC A;  1YR5 A;  2FJU B;  2KSP A;  1SK6 D;  4DCK A;  1MXE A;  2LMT A;  3IVT A;  4OKH A;  1B7T Y;  1U5I B;  3AKB A;  3CWG A;  4M2P A;  4YI8 A;  5JJG A;  2FCD A;  2KGB C;  4NDB A;  1KFX L;  3D10 A;  3D76 A;  1NX1 A;  3DVM A;  2SAS A;  1AJ4 A;  1E8A A;  1KQM C;  3D73 A;  3O4Y A;  5BPJ A;  2BKH B;  2KFG A;  3SIB A;  1JSA A;  1WRZ A;  1DGV A;  3B88 A;  1M63 B;  1S6I A;  2JC2 A;  2WND A;  2JNF A;  1Y1A A;  1SL7 A;  3R1V A;  4PHN A;  4MRY A;  1CM4 A;  2KFF A;  1WRK A;  1QIV A;  1SMG A;  2PQL A;  3IQQ A;  1FPW A;  3SG3 A;  4F7F A;  3R72 A;  1ZAC A;  2PYQ A;  1IKU A;  1TCO B;  1QV0 A;  4U8D A;  2BL0 C;  1WDC B;  1XFV O;  1A03 A;  4HSZ A;  4PE7 A;  3IQO A;  4INW A;  1YRT B;  3RLZ A;  2JT0 A;  2JWW A;  1LKJ A;  3CS1 A;  1RJV A;  4P2Y B;  4USL A;  1B8L A;  3QME A;  5FI7 A;  3S0E A;  1JF2 A;  3FWC A;  1EG4 A;  2K7O A;  4M2Q A;  1CDP A;  3BUW B;  4YGC B;  2JUL A;  2CNP A;  2TN4 A;  1DJX A;  2KOT A;  2FJY A;  2L4H A;  4GGF C;  1K2H A;  4NDC A;  3CYZ A;  1CKK A;  2F8P A;  1X02 A;  2H8V A;  2HF5 A;  4P5O E;  3GOF A;  1KK7 Y;  1S26 D;  2YGU A;  4HRH A;  1S6J A;  3OHM B;  3MSE B;  3VGO A;  3I5H B;  1TTX A;  1TUZ A;  1KSO A;  3I5G B;  2K61 A;  2F3Y A;  4PDZ A;  1DQE A;  2I18 A;  1FF1 A;  1J1D A;  2O60 A;  1NCZ A;  4AOM A;  1BU3 A;  2ZN9 A;  5KSZ A;  4CLN A;  4JD9 A;  1LVC D;  2BEC A;  2JTZ A;  5TNC A;  1F55 A;  4I5L B;  3PM2 A;  5AFP A;  2F33 A;  1JBA A;  4MRX A;  1NX2 A;  1MXL C;  1NCX A;  2PSR A;  2AAO A;  1G33 A;  1XFU O;  2I7A A;  2JRF A;  4ORB B;  5G08 A;  2LCP A;  2DOQ A;  1OZO A;  2KAX A;  1EL4 A;  1BR1 B;  2L0P A;  3CZT X;  3O78 A;  4PHJ A;  2D8N A;  1R2U A;  4ZCV A;  4MZL A;  3WHT B;  2H61 A;  2LVJ A;  5JOL A;  4YBH B;  1NPQ A;  3JVT C;  4IJ7 A;  3KEV A;  1KCY A;  1TNX A;  2MHH A;  5I2L A;  5AEQ A;  3OBV A;  2M29 A;  3KPX A;  5DKQ A;  3BFH A;  5HYD A;  1SYM A;  2LLT A;  2QAC A;  4KYN A;  4MSP A;  4FQT A;  3L47 A;  3EG5 B;  1T14 A;  3R1O A;  3SG5 A;  1QAT A;  1WY9 A;  1MQ1 A;  2NLN A;  5HKW A;  1WDC C;  1MR8 A;  1M39 A;  1C3Z A;  3BFB A;  1K95 A;  3CR5 X;  1ZFS A;  1LA3 A;  2KQY A;  5ER5 A;  1IH0 A;  3S0B A;  1Z4H A;  4I5N B;  2V53 A;  1SBJ A;  1DC1 A;  2M8U A;  1FI6 A;  3NGV A;  2LAP A;  1L2O C;  1KFU S;  2QEH A;  2WCL A;  5DKN A;  5AXI A;  5HLO A;  1C7V A;  2I94 A;  1XFZ O;  3BQ3 A;  5B8I B;  4PE1 A;  4ORC B;  2L5X B;  3E3R A;  1NYA A;  1RWY A;  3VRO A;  1QV1 A;  3BYA A;  1B1G A;  2M0R A;  2F2O A;  5F6T A;  4AQI A;  3D74 A;  1CNP A;  2WCF A;  1XFR A;  2ZKM X;  4FQO A;  3KHE A;  5D7F A;  2QEO A;  1FI5 A;  2LHL A;  2BBM A;  1BOC A;  1SPY A;  2ZNE A;  4UPG A;  1GJY A;  2P6B B;  1IIO A;  1JF0 A;  2OS8 B;  2JPT A;  2SCP A;  3IF7 A;  1F4O A;  2GTE A;  1QX5 B;  2HQ8 A;  2H2K A;  5ER4 X;  2LMV A;  3VRP A;  1BR4 B;  1IJ5 A;  1CFD A;  1S6C A;  1H4B A;  1QIW A;  1KK8 B;  5CSF A;  2JNX A;  3O2P A;  2AUC A;  3EVU A;  3CZ2 A;  1R6P A;  1YUU A;  1B7T Z;  1ALV A;  1DJH A;  3LK0 A;  3BUM B;  4PHM A;  5IBW A;  1KFU L;  1A2X A;  3K1E A;  1A75 A;  1DTL A;  2GGZ A;  4AQJ A;  1CDM A;  2WCJ A;  4OVN F;  2PVB A;  4CID A;  4YGA A;  3LL8 B;  4HRE E;  3I5F C;  3TDI A;  1CMG A;  3JVT B;  1BJF A;  1PAL A;  1RK9 A;  2Q4U A;  4DRW A;  1IWQ A;  3SS4 A;  3TZ1 A;  3PM8 A;  1MF8 B;  2ERB A;  1KQV A;  1SL9 A;  2LC5 A;  2M1U A;  2CTN A;  1DJI A;  3NHI A;  2Y5I A;  3ICB A;  3PAL A;  4R1E A;  3SJS A;  1F70 A;  3O6B A;  1XA5 A;  4WRI A;  3B6X A;  1W9Z A;  4C0L A;  1LA0 A;  1NP8 A;  1RFJ A;  3FE9 A;  5KU1 A;  1M46 A;  1K9U A;  3CTN A;  1OOG A;  2ZFD A;  3CAB A;  4PT1 A;  4MEW A;  1B8C A;  2LAN A;  2PRU A;  2L51 A;  4BY4 A;  1GM0 A;  1P28 A;  1DMO A;  3SG6 A;  2NCO A;  3EK7 A;  1L2O B;  2KI6 C;  1BT6 A;  1QAS A;  1F8H A;  1UP5 A;  2H61 C;  2NCP A;  3B86 A;  1OOF A;  1CB1 A;  1YX7 A;  2RGI A;  2IS9 A;  5K89 A;  3PLF B;  2PMY A;  1G8I A;  2EGD A;  1YUS A;  4JWQ A;  1A75 B;  2OS8 C;  4GGN A;  1B9A A;  4OV2 A;  2WCM A;  2WCK A;  3TDZ A;  2MAZ A;  2BCB A;  2LUX A;  4XJK A;  3WNX B;  1KK8 C;  2Q91 A;  2JQ6 A;  2CBL A;  3BXK A;  2JT3 A;  2MLF C;  1QS7 A;  3TS5 B;  3EK4 A;  1JWD A;  4BY5 A;  5HLV A;  3DVK A;  3BUX B;  1OZS A;  2L98 A;  2LHI A;  1IG5 A;  4D1E A;  1PSR A;  2LNK A;  2WC5 A;  4ICB A;  1NWD A;  2KYC A;  3BOW A;  3VRR A;  1Y1X A;  1GGW A;  1DGU A;  1N65 A;  2CXJ A;  1K93 D;  3C1V A;  2KFH A;  4QJ5 B;  1DJG A;  1IJ6 A;  2WC8 A;  1Z2C B;  2M97 A;  3GK4 X;  5CSJ A;  3PAT A;  3V2L A;  1N0Y A;  1SSE B;  3H4S E;  2JU0 A;  1CLM A;  1QVI Y;  2BKI B;  1MUX A;  3FWB A;  4GFT A;  1QTX A;  1WRL A;  2BBN A;  2EHB A;  3CLN A;  3DYE A;  1V1F A;  2JPO A;  1K9K A;  1NX0 A;  3BFA A;  1SW8 A;  3LK1 A;  1LS8 A;  2E30 A;  4NDD A;  1OOI X;  4A4C A;  1QX7 A;  3GK2 A;  2MJW B;  2E6W A;  3OB1 B;  5FI2 A;  3CZ1 A;  3OB2 B;  5CSN A;  2KLD A;  2KNE A;  1TOP A;  3UO9 A;  3GK1 A;  1LXF C;  1S5G Z;  3SS3 A;  1V1G A;  2KBI A;  2M7N A;  3I5F B;  2JXL A;  2PAS A;  3FIA A;  1TIZ A;  1CFC A;  1B4C A;  3D77 A;  2K60 A;  2L2E A;  2JT8 A;  1CLL A;  4CFQ A;  1XFY O;  3VRQ A;  1J7Q A;  4PE4 A;  1REC A;  2KI4 B;  1F54 A;  3EVR A;  4MLW A;  1ZUZ A;  4PCW A;  4PHK A;  2LLS A;  3FE6 A;  3PN7 B;  2BCX A;  4DIR A;  2K0J A;  1H8B A;  1CFF A;  1SCV A;  1TCF A;  2P70 A;  2HQW A;  4OR9 B;  1BF5 A;  1OE9 B;  4CPV A;  1YTZ C;  1BOD A;  3PJI A;  2L5Y A;  3S0F A;  1TNW A;  1QJT A;  3EKJ A;  1UWO A;  1WLM A;  2LVK A;  1DEL A;  1NIW A;  4GNK B;  1C3Y A;  1JUO A;  4L9M A;  1ALW A;  3BOW B;  4HRG A;  2HET A;  3HCM A;  2FOT A;  1TNP A;  1FBV A;  1KWO B;  1OW4 A;  2KAY A;  1XK4 A;  1DJW A;  1KSM A;  3B87 A;  1EG3 A;  4FTG A;  2KBM A;  2O5G A;  3BJH A;  5I94 A;  2QPT A;  2AMI A;  1OOH A;  1DJZ A;  1RRO A;  1NSH A;  1S36 A;  1U5I A;  2G9B A;  1MWN A;  1GQM A;  1YUR A;  2KAV A;  2EC6 B;  4I5J A;  4I5K A;  3TS5 C;  2K7C A;  1EJ3 A;  1AVS A;  3DVE A;  1DEK A;  2K2A A;  3LLE A;  2GV5 A;  3CDN A;  1DJY A;  4GBA A;  3DD4 A;  3RM1 A;  1YUT A;  3FS7 A;  4YI9 A;  1BLQ A;  1CFP A;  3QRX A;  5D69 A;  1QLK A;  1C7W A;  1QWV A;  3D78 A;  3EVV A;  1A29 A;  1DVI A;  1UHI A;  1QXP A;  1YVL A;  3A8R A;  1J55 A;  4NQG A;  3RZS A;  3M0W A;  5AAN A;  1VRK A;  2MBX A;  1Y1U A;  1PK0 D;  1J1E A;  2L50 A;  1SRA A;  3ZWH A;  3OX5 A;  3DVJ A;  1CTR A;  3TDU A;  2L2C A;  2LP3 A;  1PVA A;  4OCI A;  1K9P A;  1W7J B;  3WHU B;  2Y1N A;  1C07 A;  2KPH A;  2QEB A;  2B1U A;  2VRG A;  3TUY C;  4M2O A;  4YGE B;  1F71 A;  2KLE A;  2FCE A;  2K2F A;  1OMV A;  1SNL A;  4MBE A;  2WCH A;  2KI4 C;  1XYD A;  3EKH A;  2WC6 A;  2KHN A;  2BCA A;  5EL2 A;  1OMR A;  2LP2 A;  1IQ5 A;  3PN7 C;  5I2Q A;  3S0G A;  1NX3 A;  3DY9 A;  1UHH A;  5CSI A;  1QX2 A;  2LVI A;  2OTG B;  2CCM A;  2LV7 A;  1OMD A;  5AER A;  1SCM C;  4QJ3 B;  2COL B;  5CPV A;  5KTY A;  2KI6 D;  3CR2 A;  3AKA A;  4N5X A;  4ZCU A;  1SY9 A;  5J3X A;  2ISD A;  5HKZ A;  3SS5 A;  3AAJ A;  1YX8 A;  4MN0 A;  1WLZ A;  1SKT A;  1HT9 A;  1AUI B;  3BUN B;  4GAO A;  1KWO C;  3WXA A;  2BE6 A;  3O4X A;  4JKT A;  4XYN A;  1SR6 C;  1AP4 A;  2A4J A;  1EH2 A;  3VB1 A;  3JTD B;  3OGN A;  1ZOT B;  4QJ4 B;  1KK7 Z;  1BG1 A;  1JFJ A;  4YGB B;  5DKR A;  1TWO A;  3PSR A;  1QLS A;  2EC6 C;  3NSI A;  4MZJ A;  2M9G A;  2Y1M A;  3VRN A;  2JXC A;  2LLU A;  2G2B A;  1BMO A;  1ZMZ A;  4GPL B;  1JFK A;  3B7A A;  1F4Q A;  2L4I A;  5GQQ C;  3ZNI A;  1L7Z A;  2ZRT A;  2JOJ A;  2QDI A;  3I5I C;  3NSK A;  3LCP C;  2WOS A;  1UHN A;  1AK8 A;  3OP0 A;  1XFW O;  1M45 A;  1GGZ A;  1CMF A;  2BAP A;  2PAL A;  1B47 A;  1LIN A;  2F2P A;  2LM5 A;  1B8R A;  2GGM A;  4ORA B;  1N2D A;  2LVV A;  3D0Y A;  1K96 A;  5FYX A;  1PUL A;  1IQ3 A;  1Q80 A;  1SL8 A;  4YGD B;  1A4P A;  1Y0V H;  1NCY A;  1ODB A;  1QVI Z;  2KYF A;  2MRD A;  1DF0 A;  3L4A A;  5DIC A;  4ETO A;  3SG4 A;  3UNW A;  4C0K A;  1XVJ A;  1PVB A;  2KDH A;  2NZ0 A;  3KO0 A;  1XK4 C;  1XFX O;  1J7O A;  4IL1 A;  4OZD A;  2K8M B;  2KGR A;  2LE9 B;  3N7H A;  3OX6 A;  4WQ2 A;  3TUY B;  2OTG C;  1CLB A;  1CM1 A;  1AJ5 A;  2WCB A;  2K7D A;  2CT9 A;  4DUQ A;  3L4L A;  1XO5 A;  3DF0 A;  3CZ0 A;  4GGF A;  4XJK B;  1CDN A;  1UUS A;  1YVH A;  1ORG A;  3BUO B;  2ZN8 A;  2F3Z A;  2K7B A;  1NUB A;  4JPZ B;  5PAL A;  1OSA A;  1K90 D;  4F0Z B;  1SCM B;  2KQ6 A;  1UHK A;  1PRW A;  1KQM B;  2M49 B;  3JTD C;  4PE0 A;  3NHT A;  2M3W A;  3AAK A;  1OQP A;  3HX4 A;  1W7I B;  3D0Y B;  1K8U A;  4GUK A;  1S5G Y;  4N1G A;  2P71 A;  3SIA A;  1RTP 1;  3S0A A;  1K94 A;  1YRU B;  1G4Y R;  1EXR A;  1M31 A;  3R1P A;  3S0D A;  1DF0 B;  1SR6 B;  4E68 A;  1AHR A;  4JQ0 D;  1TUJ A;  3Q8I A;  3CR4 X;  2JTT A;  2ZND A;  2R2I A;  3DZT A;  4Q04 A;  1UUR A;  1KFX S;  3NXA A;  2BL0 B;  2Y4Q A;  1TNQ A;  3FE8 A;  5I8N A;  1J7P A;  1DT7 B;  2LMU A;  3A4U B;  3K21 A;  3NSL A;  1S3P A;  3SG2 A;  2ZRS A;  3CGA A;  1FW4 A;  2MLE C;  5D3O A;  2BE4 A;  2BNX A;  2OPO A;  1PSB A;  4TNC A;  4WQ3 A;  1Y6W A;  2I2R E;  3I5I B;  2M7L A;  5HL1 A;  1S1E A;  3I5H C;  4MZK A;  1IRJ A;  1TN4 A;  3F45 A;  1HQV A;  3DXL A;  4PAL A;  3I5G C;  5FI6 A;  3DF0 B;  5I2O A;  3SG7 A;  3EK8 A;  4DS7 A;  2HPS A;  1TRF A;  4N1F A;  1OOJ A;  3D75 A;  4A4B A;  1J7R A;  4YRU A;  2JZI A;  1JC2 A;  1D1O A;  2MA2 A;  4C0J A;  3PFV A;  2NXQ A;  2WOR A; 
#chains in the Genus database with same CATH homology
 3KF9 A;  4CFR A;  1CDL A;  1IGV A;  4MVF A;  2WCE A;  5HKY A;  1MHO A;  2M1K B;  3NSO A;  1UHJ A;  2LUC A;  1YR5 A;  2FJU B;  2KSP A;  1SK6 D;  4DCK A;  1MXE A;  2LMT A;  4OKH A;  1B7T Y;  1U5I B;  3AKB A;  3CWG A;  4M2P A;  4YI8 A;  5JJG A;  2FCD A;  2KGB C;  4NDB A;  1KFX L;  3D10 A;  3DVM A;  1NX1 A;  2SAS A;  1AJ4 A;  1E8A A;  1KQM C;  3O4Y A;  5BPJ A;  2BKH B;  2KFG A;  3SIB A;  1JSA A;  1WRZ A;  1DGV A;  1M63 B;  1S6I A;  2JC2 A;  2WND A;  2JNF A;  1Y1A A;  1SL7 A;  4PHN A;  4MRY A;  1CM4 A;  2KFF A;  1WRK A;  1QIV A;  1SMG A;  3IQQ A;  1FPW A;  3SG3 A;  1ZAC A;  1IKU A;  1TCO B;  1QV0 A;  4U8D A;  2BL0 C;  1WDC B;  1XFV O;  1A03 A;  4HSZ A;  4PE7 A;  3IQO A;  1YRT B;  3RLZ A;  2JT0 A;  2JWW A;  1LKJ A;  3CS1 A;  1RJV A;  4P2Y B;  4USL A;  1B8L A;  1JF2 A;  3FWC A;  1EG4 A;  2K7O A;  4M2Q A;  1CDP A;  3BUW B;  4YGC B;  2JUL A;  2CNP A;  2TN4 A;  1DJX A;  2KOT A;  2L4H A;  4GGF C;  1K2H A;  4NDC A;  1CKK A;  2F8P A;  1X02 A;  2HF5 A;  4P5O E;  3GOF A;  1KK7 Y;  1S26 D;  4HRH A;  1S6J A;  3OHM B;  3MSE B;  3VGO A;  3I5H B;  1TTX A;  1KSO A;  3I5G B;  2K61 A;  2F3Y A;  4PDZ A;  2I18 A;  1FF1 A;  1J1D A;  2O60 A;  1NCZ A;  4AOM A;  1BU3 A;  2ZN9 A;  5KSZ A;  4CLN A;  1LVC D;  2BEC A;  2JTZ A;  5TNC A;  1F55 A;  4I5L B;  5AFP A;  2F33 A;  1JBA A;  4MRX A;  1NX2 A;  1MXL C;  1NCX A;  2PSR A;  2AAO A;  1G33 A;  1XFU O;  2I7A A;  2JRF A;  4ORB B;  5G08 A;  2LCP A;  2DOQ A;  1OZO A;  2KAX A;  1EL4 A;  1BR1 B;  2L0P A;  3CZT X;  3O78 A;  4PHJ A;  2D8N A;  1R2U A;  4ZCV A;  4MZL A;  3WHT B;  2H61 A;  2LVJ A;  5JOL A;  4YBH B;  1NPQ A;  3JVT C;  3KEV A;  1KCY A;  1TNX A;  2MHH A;  5I2L A;  5AEQ A;  2M29 A;  3KPX A;  5DKQ A;  5HYD A;  1SYM A;  2LLT A;  2QAC A;  4MSP A;  3SG5 A;  1QAT A;  1WY9 A;  1MQ1 A;  2NLN A;  5HKW A;  1WDC C;  1MR8 A;  1M39 A;  1K95 A;  3CR5 X;  1ZFS A;  1LA3 A;  2KQY A;  5ER5 A;  1IH0 A;  4I5N B;  2V53 A;  1SBJ A;  2M8U A;  1FI6 A;  2LAP A;  1L2O C;  1KFU S;  5DKN A;  5AXI A;  5HLO A;  1C7V A;  2I94 A;  1XFZ O;  3BQ3 A;  5B8I B;  4PE1 A;  4ORC B;  2L5X B;  3E3R A;  1NYA A;  1RWY A;  3VRO A;  1QV1 A;  3BYA A;  1B1G A;  2M0R A;  2F2O A;  5F6T A;  4AQI A;  1CNP A;  2WCF A;  2ZKM X;  4FQO A;  3KHE A;  5D7F A;  1FI5 A;  2LHL A;  2BBM A;  1BOC A;  1SPY A;  2ZNE A;  4UPG A;  1GJY A;  2P6B B;  1JF0 A;  2OS8 B;  2JPT A;  2SCP A;  3IF7 A;  1F4O A;  1QX5 B;  2HQ8 A;  2H2K A;  5ER4 X;  2LMV A;  3VRP A;  1BR4 B;  1IJ5 A;  1CFD A;  1S6C A;  1H4B A;  1QIW A;  1KK8 B;  5CSF A;  2JNX A;  3O2P A;  2AUC A;  3EVU A;  1R6P A;  1YUU A;  1B7T Z;  1ALV A;  1DJH A;  3LK0 A;  3BUM B;  4PHM A;  5IBW A;  1KFU L;  1A2X A;  1A75 A;  1DTL A;  2GGZ A;  4AQJ A;  1CDM A;  4OVN F;  2PVB A;  4CID A;  4YGA A;  3LL8 B;  4HRE E;  3I5F C;  3TDI A;  1CMG A;  3JVT B;  1BJF A;  1PAL A;  1RK9 A;  2Q4U A;  4DRW A;  1IWQ A;  3TZ1 A;  3PM8 A;  1MF8 B;  1KQV A;  1SL9 A;  2LC5 A;  2M1U A;  2CTN A;  1DJI A;  2Y5I A;  3ICB A;  3PAL A;  4R1E A;  3SJS A;  1F70 A;  3O6B A;  1XA5 A;  4WRI A;  4C0L A;  5KU1 A;  1LA0 A;  1NP8 A;  1RFJ A;  1M46 A;  1K9U A;  3CTN A;  2ZFD A;  4BY4 A;  4MEW A;  1B8C A;  2LAN A;  2PRU A;  2L51 A;  1DMO A;  3SG6 A;  2NCO A;  3EK7 A;  1L2O B;  2KI6 C;  1BT6 A;  1QAS A;  1F8H A;  1UP5 A;  2H61 C;  2NCP A;  1CB1 A;  1YX7 A;  2RGI A;  2IS9 A;  5K89 A;  3PLF B;  2PMY A;  1G8I A;  2EGD A;  1YUS A;  4JWQ A;  1A75 B;  2OS8 C;  4GGN A;  1B9A A;  4OV2 A;  3TDZ A;  2MAZ A;  2BCB A;  2LUX A;  4XJK A;  3WNX B;  1KK8 C;  2Q91 A;  2JQ6 A;  2CBL A;  3BXK A;  2JT3 A;  2MLF C;  1QS7 A;  3TS5 B;  3EK4 A;  1JWD A;  4BY5 A;  5HLV A;  3DVK A;  3BUX B;  1OZS A;  2L98 A;  2LHI A;  1IG5 A;  4D1E A;  1PSR A;  2LNK A;  4ICB A;  1NWD A;  2KYC A;  3BOW A;  3VRR A;  1Y1X A;  1GGW A;  1DGU A;  1N65 A;  2CXJ A;  1K93 D;  3C1V A;  2KFH A;  4QJ5 B;  1DJG A;  1IJ6 A;  2WC8 A;  2M97 A;  3GK4 X;  5CSJ A;  3PAT A;  1N0Y A;  3H4S E;  2JU0 A;  1CLM A;  1QVI Y;  2BKI B;  1MUX A;  3FWB A;  1QTX A;  1WRL A;  2BBN A;  2EHB A;  3CLN A;  3EKJ A;  1V1F A;  4GFT A;  1K9K A;  1NX0 A;  1SW8 A;  3LK1 A;  2E30 A;  4NDD A;  4A4C A;  1QX7 A;  3GK2 A;  2MJW B;  2E6W A;  3OB1 B;  3OB2 B;  5CSN A;  2KNE A;  1TOP A;  3GK1 A;  1LXF C;  1S5G Z;  1V1G A;  2KBI A;  2M7N A;  3I5F B;  2JXL A;  2PAS A;  3FIA A;  1TIZ A;  1CFC A;  1B4C A;  2L2E A;  2JT8 A;  1CLL A;  4CFQ A;  1XFY O;  3VRQ A;  1J7Q A;  4PE4 A;  1REC A;  2KI4 B;  1F54 A;  3EVR A;  4MLW A;  1ZUZ A;  4PCW A;  4PHK A;  2LLS A;  3PN7 B;  2BCX A;  4DIR A;  2K0J A;  1H8B A;  1CFF A;  1SCV A;  1TCF A;  4OR9 B;  2HQW A;  1BF5 A;  1OE9 B;  4CPV A;  1YTZ C;  1BOD A;  1TNW A;  1QJT A;  1UWO A;  1WLM A;  2LVK A;  1NIW A;  4GNK B;  1JUO A;  4L9M A;  1ALW A;  3BOW B;  4HRG A;  2HET A;  3HCM A;  2FOT A;  1TNP A;  1FBV A;  1KWO B;  2KAY A;  1XK4 A;  1DJW A;  1KSM A;  1EG3 A;  4FTG A;  2KBM A;  2O5G A;  2QPT A;  2AMI A;  1DJZ A;  1RRO A;  1NSH A;  1S36 A;  1U5I A;  2G9B A;  1MWN A;  1GQM A;  1YUR A;  2KAV A;  2EC6 B;  4I5J A;  4I5K A;  3TS5 C;  2K7C A;  1EJ3 A;  1AVS A;  3DVE A;  2K2A A;  3LLE A;  2GV5 A;  1DJY A;  4GBA A;  3DD4 A;  3RM1 A;  1YUT A;  3FS7 A;  4YI9 A;  1BLQ A;  1CFP A;  3QRX A;  5D69 A;  1QLK A;  1C7W A;  3EVV A;  1A29 A;  1DVI A;  1UHI A;  1QXP A;  1YVL A;  3A8R A;  1J55 A;  4NQG A;  3M0W A;  5AAN A;  1VRK A;  2MBX A;  1Y1U A;  1PK0 D;  1J1E A;  2L50 A;  1SRA A;  3ZWH A;  3OX5 A;  3DVJ A;  1CTR A;  3TDU A;  2LP3 A;  1PVA A;  4OCI A;  1K9P A;  1W7J B;  3WHU B;  2Y1N A;  1C07 A;  2B1U A;  2VRG A;  3TUY C;  4M2O A;  4YGE B;  1F71 A;  2FCE A;  2K2F A;  1OMV A;  1SNL A;  4MBE A;  2KI4 C;  1XYD A;  3EKH A;  2KHN A;  2BCA A;  1OMR A;  2LP2 A;  1IQ5 A;  3PN7 C;  5I2Q A;  1NX3 A;  5CSI A;  1UHH A;  1QX2 A;  2LVI A;  2OTG B;  2CCM A;  2LV7 A;  1OMD A;  5AER A;  1SCM C;  4QJ3 B;  2COL B;  5CPV A;  5KTY A;  2KI6 D;  3CR2 A;  3AKA A;  4N5X A;  4ZCU A;  1SY9 A;  5J3X A;  2ISD A;  5HKZ A;  3AAJ A;  1YX8 A;  4MN0 A;  1WLZ A;  1SKT A;  1HT9 A;  1AUI B;  3BUN B;  4GAO A;  1KWO C;  3WXA A;  2BE6 A;  4XYN A;  1SR6 C;  1AP4 A;  2A4J A;  1EH2 A;  3JTD B;  4QJ4 B;  1ZOT B;  1BG1 A;  1KK7 Z;  1JFJ A;  4YGB B;  5DKR A;  3PSR A;  1QLS A;  2EC6 C;  3NSI A;  4MZJ A;  2M9G A;  2Y1M A;  3VRN A;  2JXC A;  2LLU A;  2G2B A;  1BMO A;  1ZMZ A;  4GPL B;  1JFK A;  1F4Q A;  2L4I A;  5GQQ C;  3ZNI A;  1L7Z A;  2ZRT A;  2JOJ A;  3I5I C;  3NSK A;  3LCP C;  2WOS A;  1UHN A;  1AK8 A;  3OP0 A;  1XFW O;  1M45 A;  1GGZ A;  1CMF A;  2PAL A;  1B47 A;  1LIN A;  2F2P A;  2LM5 A;  1B8R A;  2GGM A;  4ORA B;  1N2D A;  2LVV A;  3D0Y A;  1K96 A;  5FYX A;  1PUL A;  1IQ3 A;  1Q80 A;  1SL8 A;  4YGD B;  1A4P A;  1Y0V H;  1NCY A;  1ODB A;  1QVI Z;  2KYF A;  2MRD A;  1DF0 A;  4ETO A;  3SG4 A;  4C0K A;  1XVJ A;  1PVB A;  2KDH A;  2NZ0 A;  3KO0 A;  1XK4 C;  1XFX O;  1J7O A;  4IL1 A;  2K8M B;  2KGR A;  2LE9 B;  3OX6 A;  4WQ2 A;  3TUY B;  2OTG C;  1CLB A;  1CM1 A;  1AJ5 A;  2WCB A;  2K7D A;  2CT9 A;  4DUQ A;  1XO5 A;  3DF0 A;  4GGF A;  4XJK B;  1CDN A;  1UUS A;  1YVH A;  3BUO B;  2ZN8 A;  2F3Z A;  2K7B A;  1NUB A;  4JPZ B;  5PAL A;  1OSA A;  1K90 D;  4F0Z B;  1SCM B;  2KQ6 A;  1UHK A;  1PRW A;  1KQM B;  2M49 B;  3JTD C;  4PE0 A;  2M3W A;  3AAK A;  1OQP A;  3HX4 A;  1W7I B;  3D0Y B;  1K8U A;  4GUK A;  1S5G Y;  4N1G A;  3SIA A;  1RTP 1;  1K94 A;  1YRU B;  1G4Y R;  1EXR A;  1M31 A;  1DF0 B;  1SR6 B;  4E68 A;  1AHR A;  4JQ0 D;  3CR4 X;  2JTT A;  2ZND A;  2R2I A;  4Q04 A;  1UUR A;  1KFX S;  3NXA A;  2BL0 B;  2Y4Q A;  1TNQ A;  5I8N A;  1J7P A;  1DT7 B;  2LMU A;  3A4U B;  3K21 A;  3NSL A;  1S3P A;  3SG2 A;  2ZRS A;  3CGA A;  1FW4 A;  2MLE C;  2BE4 A;  4TNC A;  2OPO A;  1PSB A;  4WQ3 A;  1Y6W A;  2I2R E;  3I5I B;  2M7L A;  1S1E A;  3I5H C;  4MZK A;  1IRJ A;  1TN4 A;  3F45 A;  1HQV A;  4PAL A;  3I5G C;  3DF0 B;  5I2O A;  3SG7 A;  3EK8 A;  4DS7 A;  2HPS A;  1TRF A;  4N1F A;  1OOJ A;  4A4B A;  1J7R A;  4YRU A;  2JZI A;  1JC2 A;  1D1O A;  2MA2 A;  4C0J A;  3PFV A;  2NXQ A;  2WOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...