1SNLA

Nmr solution structure of the calcium-binding domain of nucleobindin (calnuc)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
99
Chain Sequence
LKEVWEELDGLDPNRFNPKTFFILHDINSDGVLDEQELEALFTKELEKVYDPKNEEDDMREMEEERLRMREHVMKNVDTNQDRLVTLEEFLASTQRKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Nucleobindin 1
publication title Structural Studies on the Ca(2+)-binding Domain of Human Nucleobindin (Calnuc).
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2004-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1snlA00
1LVCD 2CT9A 2KSPA 4XJKB 1MF8B 1K9UA 2EGDA 1WRKA 2BL0B 3KO0A 1BMOA 3OX6A 1NSHA 5AERA 1K9KA 3K21A 1Y6WA 3O6BA 1QX2A 4GGFC 5AEQA 1CB1A 1L2OB 3VRNA 2PRUA 3TZ1A 1BF5A 2L4HA 2LMVA 3LK1A 4MLWA 1FI5A 2KDHA 3FWBA 5CSIA 1SR6C 2WORA 4IL1A 4AQIA 2BECA 1KFUL 1RROA 3ZNIA 1CDMA 1KFXL 1YUSA 3EK7A 3SG2A 1BT6A 4OV2A 1IQ5A 2FCDA 5DKQA 5DKNA 1MWNA 1UHKA 2MLEC 1AUIB 3PLFB 1GGZA 4DS7A 3ICBA 2L5XB 1MXLC 1OZSA 1SMGA 2LVJA 5JJGA 2BKIB 1M63B 3GK2A 2TN4A 1KSOA 1XFWO 3OX5A 3DF0A 1LA3A 1SNLA 4GGFA 4GAOA 4P2YB 1UWOA 3WHTB 1SCMC 1DT7B 4YRUA 1LINA 1QX7A 2WCBA 2KGBC 1A75B 1PK0D 1JC2A 2KFHA 3EVRA 3GOFA 3NSLA 4PCWA 1SCVA 1NUBA 4MBEA 2ZNDA 3E3RA 2EHBA 2KI6D 3CGAA 2WCFA 1KK8B 3AAJA 4ORAB 1UHNA 2JZIA 2MLFC 2ZRTA 1QS7A 2G9BA 3LCPC 1BR1B 4I5KA 2LHIA 1PSRA 2JWWA 1G8IA 1FBVA 2F3YA 3I5IC 3BYAA 3SG5A 2JTZA 4PE0A 5JOLA 1SYMA 4MEWA 1DJZA 3PM8A 2LVIA 2F3ZA 2KAYA 5KU1A 1XVJA 5K89A 1J1DA 4N1GA 2FOTA 4YGAA 2HETA 1B7TZ 1RJVA 1X02A 1JF2A 1MUXA 2FCEA 1XFVO 1MXEA 1S1EA 1F4QA 1YTZC 5I2LA 3LK0A 3WXAA 1RTP1 1CMFA 2LANA 1PVBA 2JULA 1CFCA 2M29A 1TRFA 2LUXA 4OKHA 5B8IB 2KYCA 1A4PA 2KFFA 2MRDA 1A2XA 1OOJA 4M2PA 4PE4A 2CTNA 1RK9A 5HKZA 2LE9B 1IWQA 2G2BA 4GBAA 2M8UA 1AVSA 1QLKA 1M45A 2WCEA 3CWGA 4HREE 1H4BA 1N65A 1SPYA 1YVLA 4HRGA 4A4CA 1FPWA 4XJKA 1ZFSA 1IRJA 1TIZA 3OB2B 3GK4X 1YRTB 1HQVA 2Y1NA 1RWYA 2LVVA 3MSEB 3OP0A 4QJ5B 2JRFA 2JTTA 2L50A 4PDZA 1F70A 3BUMB 3BUWB 4WQ3A 3SJSA 3I5GB 3BOWB 2CXJA 3JTDB 1SRAA 2JPTA 2GGZA 2OTGC 1NCXA 1QTXA 2K8MB 1LKJA 2NCOA 1GGWA 1H8BA 4MRYA 5KSZA 2IS9A 1C7VA 2MBXA 2JC2A 2KNEA 1IKUA 3SG7A 2AUCA 2M49B 3BUXB 1KK7Y 3FWCA 4USLA 1UURA 2K7CA 2COLB 4BY4A 1IGVA 4C0JA 1B1GA 1JWDA 2K7DA 2BCBA 3CTNA 5HYDA 1ALVA 1KQMB 2F2OA 2QACA 5FYXA 1J55A 3TDIA 1DGUA 1S5GY 2WC8A 3RLZA 1D1OA 1OQPA 1VRKA 3TUYB 1EJ3A 1TCFA 3VRQA 3H4SE 2ZNEA 2M0RA 1IG5A 4I5LB 1V1FA 2MAZA 3D10A 3AAKA 4CPVA 5DKRA 1IQ3A 2BCAA 4L9MA 1SW8A 2PVBA 3I5FC 4M2QA 4PHKA 1EH2A 2M1UA 1CLBA 1DJWA 2K2FA 4AQJA 2V53A 3NSIA 1CDPA 2HPSA 2LCPA 1DJGA 2LP2A 2PMYA 3DVKA 1PALA 3CZTX 1YR5A 2A4JA 1A75A 4FTGA 3OB1B 1R6PA 2D8NA 3AKBA 1LXFC 2KQYA 1OMDA 4R1EA 2JXLA 3FS7A 3NSOA 2K7OA 2Q4UA 5HLVA 1BG1A 1YX8A 2PASA 1J7QA 1NIWA 1JUOA 1KSMA 1N0YA 4JPZB 1J1EA 2KAXA 3EVUA 1QIVA 1TNWA 2LC5A 1K8UA 1EL4A 1A29A 1QVIZ 1CLLA 4ZCVA 1V1GA 2OS8C 3I5HB 4BY5A 1WDCB 4I5NB 3PN7B 3GK1A 3VRRA 1W7IB 5CPVA 2NCPA 4QJ4B 4ICBA 1CM4A 5I8NA 1UP5A 4PHJA 1ALWA 1QJTA 1K96A 2MJWB 3SIAA 1QLSA 1CFDA 2LV7A 5BPJA 5GQQC 1QX5B 2PSRA 2KQ6A 2P6BB 1CFFA 4MVFA 3CS1A 4OR9B 5CSJA 1F55A 1TOPA 1NX1A 2EC6B 1SBJA 2LNKA 5J3XA 3JTDC 3AKAA 1AJ4A 2I2RE 1DJHA 1U5IB 2JT0A 2BKHB 1XK4C 2MA2A 5PALA 1F4OA 1OSAA 2E6WA 1DF0B 1M31A 2LHLA 2LUCA 2NZ0A 3LLEA 1CTRA 2BL0C 1B47A 1DJXA 2LLSA 1KFUS 1SK6D 4ORBB 1OE9B 4YGDB 3D0YB 1KFXS 2AAOA 4GUKA 4WQ2A 1JBAA 3C1VA 2LMUA 1S36A 4MRXA 3BQ3A 2KBMA 2L2EA 2ZKMX 3SIBA 1L2OC 5ER5A 3DVEA 1YURA 2O5GA 1Q80A 2BCXA 1S6JA 2Q91A 3CR5X 2BE4A 3PALA 1C7WA 1JFKA 3DD4A 3WHUB 1PULA 2F33A 1EXRA 1SR6B 2B1UA 2NLNA 2WNDA 1B8CA 1QXPA 2CNPA 3O78A 1B7TY 3BOWA 2KHNA 4F0ZB 1NWDA 1DJIA 1WRLA 2SCPA 1NYAA 1RECA 3DVJA 1SY9A 1XK4A 4PE1A 1XO5A 2LLUA 1MR8A 3NXAA 3VGOA 1BLQA 4A4BA 4FQOA 4YBHB 1S26D 2KFGA 3BXKA 4N1FA 1WLZA 2Y5IA 2JNXA 1K93D 4GNKB 3O2PA 1YUUA 4OVNF 1Y1XA 4DUQA 1CNPA 1QIWA 1OZOA 2ZN8A 3IQOA 2LM5A 1IJ5A 1GJYA 1YVHA 1G4YR 1BR4B 3M0WA 1XFUO 5HKYA 4DCKA 1TTXA 1F8HA 2GV5A 1MHOA 2KYFA 2LVKA 4CIDA 1K90D 1KK7Z 1TNQA 2VRGA 1SL9A 1J7RA 5TNCA 1CDLA 2F8PA 4NDDA 1S3PA 3PATA 4PALA 5IBWA 2QPTA 3DVMA 1KK8C 2KI4B 5AFPA 2ZN9A 1SL8A 2M97A 4CFQA 1KWOB 1CKKA 5KTYA 2SASA 3I5IB 3PSRA 1JFJA 4MZJA 1K94A 3EKJA 1KCYA 3LL8B 2BE6A 3TS5B 1QV0A 2BBNA 3QRXA 4JQ0D 3NSKA 4PE7A 1XFZO 4YGCB 4QJ3B 1EG4A 4I5JA 5CSNA 1Y1AA 2H61A 1CM1A 1TN4A 5F6TA 1FW4A 1J7OA 1JF0A 4N5XA 2F2PA 3IF7A 1NX3A 4MN0A 1OMRA 2JU0A 1BJFA 4AOMA 1Y0VH 2KAVA 1DVIA 4YI8A 1HT9A 1CDNA 3KHEA 1S6CA 1B9AA 2H2KA 1XYDA 2O60A 5D7FA 1J7PA 2NXQA 4Q04A 2K0JA 4NDCA 2K2AA 1CLMA 2WOSA 3EK4A 1QATA 2OPOA 1ZUZA 3JVTB 1U5IA 4GFTA 4NQGA 1C07A 1M46A 2M1KB 1IJ6A 1AHRA 1NCYA 5AANA 2KGRA 1NPQA 1GQMA 1S6IA 4C0KA 2ZFDA 3SG6A 5I2OA 1DF0A 1ZACA 1NX0A 1G33A 4DIRA 2LP3A 1Y1UA 4ORCB 3D0YA 2I94A 1QVIY 1BU3A 2LMTA 3I5GC 1TNXA 1TNPA 2OTGB 4WRIA 4TNCA 1QASA 3BUNB 3O4YA 2ZRSA 2JQ6A 1BODA 1QV1A 2KBIA 3SG3A 1XFXO 2M9GA 1IH0A 2DOQA 5HKWA 4ETOA 1B4CA 1N2DA 1K9PA 1A03A 2CBLA 1B8LA 5HLOA 3HX4A 4UPGA 2RGIA 1ZOTB 1YRUB 3FIAA 3DF0B 1NX2A 1F54A 1KQMC 2JOJA 3CR4X 1B8RA 4YGBB 2JT3A 4M2OA 2M3WA 1CFPA 4OCIA 3KEVA 3VRPA 1RFJA 2KI4C 3TUYC 5ER4X 2M7NA 3ZWHA 1K95A 4MZLA 1KWOC 4MZKA 4CLNA 2LAPA 1E8AA 1DGVA 3EVVA 4HSZA 3TS5C 4E68A 3I5FB 4U8DA 1XA5A 2M7LA 4XYNA 2FJUB 5CSFA 1BOCA 1ODBA 1NCZA 1MQ1A 1TCOB 4GPLB 1UUSA 1WLMA 2JXCA 4PHNA 1AK8A 2I7AA 1AP4A 2HF5A 2L51A 2L98A 4GGNA 1DJYA 4HRHA 3SG4A 1DMOA 2Y4QA 5AXIA 3OHMB 2KI6C 3CR2A 2HQ8A 3BUOB 1SL7A 2L4IA 3IQQA 4D1EA 1LA0A 2R2IA 2KOTA 1UHIA 3A4UB 1DTLA 3RM1A 2JNFA 3VROA 1SCMB 1EG3A 2L0PA 3EKHA 5D69A 1NP8A 2H61C 1KQVA 2Y1MA 2OS8B 1M39A 1UHHA 4C0LA 2HQWA 3TDZA 4DRWA 5G08A 3I5HC 4MSPA 1WDCC 4P5OE 2E30A 1K2HA 1AJ5A 3JVTC 2GGMA 1WY9A 3PN7C 1OMVA 3TDUA 1PVAA 3CLNA 1UHJA 1FI6A 2BBMA 4ZCUA 2I18A 2AMIA 2K61A 2K7BA 3EK8A 4YGEB 1YX7A 2LLTA 4YI9A 3WNXB 4NDBA 2MHHA 4JWQA 1SKTA 1YUTA 4CFRA 1L7ZA 1CMGA 1ZMZA 5I2QA 3F45A 3KF9A 1PSBA 1JSAA 1XFYO 1F71A 2JT8A 2EC6C 3PFVA 1S5GZ 1PRWA 1R2UA 1WRZA 2PALA 3A8RA 3HCMA 2CCMA 3KPXA 2ISDA 4PHMA 1FF1A 1W7JB
chains in the Genus database with same CATH superfamily
1LVCD 2CT9A 2KSPA 4XJKB 1MF8B 1K9UA 2EGDA 1WRKA 2BL0B 3KO0A 1BMOA 3OX6A 1NSHA 5AERA 1K9KA 3K21A 3SS5A 1Y6WA 3O6BA 1QX2A 2WCKA 3QMEA 4GGFC 5AEQA 1CB1A 1L2OB 5FI7A 3VRNA 2PRUA 3TZ1A 3RZSA 1BF5A 2L4HA 2LMVA 3LK1A 4MLWA 1FI5A 2KDHA 3FWBA 3DXLA 5CSIA 1SR6C 2WORA 4IL1A 4AQIA 2QEVA 3FE9A 4KYNA 2BECA 1KFUL 1RROA 3ZNIA 1CDMA 1KFXL 1YUSA 3EK7A 2QEHA 3SG2A 1TUJA 1BT6A 4OV2A 3EG5B 4FQTA 1IQ5A 2FCDA 5DKQA 1TUZA 5DKNA 1MWNA 1UHKA 2MLEC 1AUIB 3PLFB 5FI6A 1GGZA 4DS7A 3ICBA 2L5XB 1GM0A 1MXLC 1OZSA 1SMGA 2LVJA 5JJGA 2BKIB 1M63B 3GK2A 2TN4A 1KSOA 1XFWO 3OX5A 3DF0A 1LA3A 1SNLA 4GGFA 4GAOA 4P2YB 1UWOA 3WHTB 1SCMC 3CDNA 1DT7B 4YRUA 1LINA 1QX7A 2WCBA 2KGBC 3CZ1A 1A75B 1PK0D 1JC2A 2KFHA 3EVRA 3GOFA 3NSLA 4PCWA 2WCHA 1SCVA 1NUBA 4MBEA 2ZNDA 3E3RA 2EHBA 3R1VA 2KI6D 3CGAA 2WCFA 1KK8B 3AAJA 4ORAB 1UHNA 2JZIA 2MLFC 2ZRTA 1QS7A 2G9BA 3LCPC 1BR1B 4I5KA 2LHIA 1PSRA 2JWWA 1G8IA 1FBVA 2F3YA 3I5IC 3BYAA 3SG5A 2JTZA 4PE0A 5JOLA 1SYMA 4MEWA 1DJZA 3PM8A 2LVIA 2F3ZA 2KAYA 5KU1A 1XVJA 5K89A 1J1DA 1OOFA 4N1GA 2FOTA 4YGAA 2HETA 1B7TZ 1RJVA 1X02A 1JF2A 1MUXA 2FCEA 3L4LA 1XFVO 2YGUA 1MXEA 1S1EA 1OW4A 1F4QA 1YTZC 5I2LA 2KPHA 3LK0A 3B7AA 3WXAA 3Q8IA 1RTP1 1CMFA 4JD9A 2LANA 1PVBA 2JULA 1CFCA 2M29A 1TRFA 2LUXA 4OKHA 5B8IB 2KYCA 1A4PA 2KFFA 2MRDA 1A2XA 1OOJA 3B6XA 4M2PA 4PE4A 2CTNA 1RK9A 5HKZA 1ORGA 2LE9B 1Z4HA 3D77A 1IWQA 2PYQA 3CYZA 2G2BA 4GBAA 5EL2A 2M8UA 1AVSA 1QLKA 1M45A 2WCEA 3CWGA 4HREE 5HL1A 1H4BA 1N65A 1SPYA 1YVLA 3OGNA 4HRGA 4A4CA 4XJKA 1FPWA 1ZFSA 1IRJA 1TIZA 3OB2B 3GK4X 1YRTB 1HQVA 2Y1NA 1RWYA 2LVVA 3MSEB 3OP0A 3R72A 4QJ5B 2JRFA 2JTTA 2L50A 4PDZA 1F70A 3BUMB 3BUWB 4WQ3A 3SJSA 3I5GB 3BOWB 1T14A 2CXJA 3JTDB 1SRAA 2JPTA 2GGZA 2OTGC 1NCXA 1QTXA 2K8MB 1LKJA 2NCOA 2WC6A 1GGWA 1H8BA 4MRYA 5KSZA 2IS9A 1C7VA 2MBXA 2JC2A 2BNXA 1SSEB 2KNEA 1IKUA 3SG7A 2AUCA 2M49B 3BUXB 1DQEA 1KK7Y 1TWOA 3FWCA 4USLA 1UURA 2K7CA 2COLB 4BY4A 1IGVA 4C0JA 1B1GA 1JWDA 2K7DA 2BCBA 3CTNA 1DC1A 5HYDA 1ALVA 1KQMB 2F2OA 2QACA 3BJHA 1J55A 5FYXA 1DGUA 1S5GY 2WC8A 3RLZA 3TDIA 3S0FA 1D1OA 1OQPA 1VRKA 3TUYB 1EJ3A 1TCFA 3VRQA 2JPOA 3H4SE 2ZNEA 2M0RA 1IG5A 4I5LB 1V1FA 2MAZA 3D10A 3AAKA 4CPVA 5DKRA 1IQ3A 2BCAA 4L9MA 1SW8A 2PVBA 3I5FC 3CZ0A 4M2QA 4PHKA 1EH2A 3S0EA 2M1UA 1CLBA 1DJWA 2K2FA 4AQJA 2V53A 3NSIA 1CDPA 2HPSA 2LCPA 1DJGA 2LP2A 2PMYA 3DVKA 1PALA 3CZTX 1YR5A 3PM2A 2L2CA 1C3ZA 1A75A 2A4JA 4FTGA 3OB1B 1R6PA 2D8NA 3AKBA 1LXFC 2KQYA 1OMDA 4R1EA 2JXLA 1P28A 3FS7A 3NSOA 2K7OA 2Q4UA 5HLVA 4PT1A 1BG1A 1YX8A 2PASA 1J7QA 1NIWA 1JUOA 1KSMA 1N0YA 4JPZB 1J1EA 2KAXA 2P70A 1QIVA 3EVUA 1TNWA 2LC5A 1K8UA 1EL4A 1A29A 1QVIZ 3IVTA 1CLLA 4ZCVA 1V1GA 2OS8C 3I5HB 3NHIA 4BY5A 1WDCB 4I5NB 3PN7B 3GK1A 3VRRA 2P71A 1W7IB 5CPVA 2NCPA 4QJ4B 3D73A 4ICBA 1CM4A 2FJYA 2QEOA 5I8NA 1UP5A 4PHJA 1IIOA 1ALWA 1QJTA 2BAPA 3B87A 1K96A 2QEBA 3VB1A 2MJWB 3SIAA 1QLSA 1CFDA 2LV7A 5BPJA 5GQQC 4F7FA 1QX5B 2PSRA 2KQ6A 2P6BB 2WCJA 4MVFA 1CFFA 3CS1A 3N7HA 4OR9B 5CSJA 1TOPA 1NX1A 2EC6B 1SBJA 2LNKA 5J3XA 1F55A 3O4XA 3JTDC 3AKAA 1AJ4A 2I2RE 1DJHA 1U5IB 2JT0A 2BKHB 5I94A 1XK4C 2MA2A 5PALA 1F4OA 1OSAA 2E6WA 1DF0B 1M31A 2LHLA 2LUCA 2NZ0A 3LLEA 1CTRA 2BL0C 1B47A 1DJXA 2LLSA 1KFUS 1SK6D 4ORBB 1OE9B 4YGDB 3D0YB 1KFXS 2AAOA 4GUKA 4WQ2A 1JBAA 3C1VA 2LMUA 1S36A 1W9ZA 4MRXA 3BQ3A 2KBMA 2L2EA 2ZKMX 4JKTA 1L2OC 3SIBA 5ER5A 3DVEA 1YURA 2O5GA 1Q80A 2BCXA 1S6JA 2Q91A 3CR5X 1LS8A 2BE4A 2KLEA 3PALA 1C7WA 1JFKA 3B88A 3BFHA 3DD4A 3WHUB 1PULA 2F33A 1EXRA 1SR6B 2B1UA 2NLNA 2WNDA 1B8CA 1QXPA 2CNPA 3O78A 1B7TY 3BOWA 2KHNA 4F0ZB 1NWDA 1DJIA 1WRLA 2SCPA 1NYAA 1RECA 3DVJA 1SY9A 1XK4A 4PE1A 1XO5A 2LLUA 1MR8A 3NXAA 3R1OA 3VGOA 1BLQA 5FI2A 4FQOA 4A4BA 4YBHB 2WCLA 3S0DA 1S26D 2KFGA 3BXKA 4N1FA 1WLZA 2Y5IA 2JNXA 1K93D 4GNKB 3O2PA 1YUUA 4OVNF 1Y1XA 4DUQA 1CNPA 1QIWA 1OZOA 2ZN8A 3D74A 3L47A 3IQOA 2LM5A 1IJ5A 1GJYA 1DELA 2WC5A 1YVHA 1G4YR 1BR4B 3M0WA 1XFUO 5HKYA 4DCKA 1TTXA 1F8HA 2K60A 2GV5A 1MHOA 2KYFA 2LVKA 4CIDA 1K90D 1KK7Z 1TNQA 2VRGA 1SL9A 1J7RA 5TNCA 1CDLA 2L5YA 2F8PA 4NDDA 1S3PA 3PATA 4PALA 5IBWA 3S0AA 2QPTA 2QDIA 1KK8C 3DVMA 2KI4B 5AFPA 2ZN9A 1SL8A 2M97A 4CFQA 1KWOB 1CKKA 2H8VA 5KTYA 2SASA 3I5IB 3PSRA 3S0GA 1JFJA 3FE8A 1K94A 3EKJA 4MZJA 3LL8B 1KCYA 2BE6A 3TS5B 1QV0A 2BBNA 3QRXA 4JQ0D 3NSKA 4PE7A 1XFZO 4YGCB 4QJ3B 1EG4A 4I5JA 5CSNA 3K1EA 1Y1AA 2H61A 1CM1A 1TN4A 5F6TA 1FW4A 1C3YA 1J7OA 1JF0A 4N5XA 3SS4A 2F2PA 3BFAA 3IF7A 3NHTA 1NX3A 4MN0A 1OMRA 2JU0A 1BJFA 4AOMA 1Y0VH 2KAVA 1DVIA 4YI8A 1HT9A 1CDNA 3KHEA 1S6CA 1B9AA 2H2KA 3DYEA 1XYDA 2O60A 5D7FA 1J7PA 3PJIA 2NXQA 4Q04A 2K0JA 4NDCA 2K2AA 1CLMA 2KLDA 2WOSA 3UO9A 3EK4A 1QATA 2OPOA 1ZUZA 3JVTB 1U5IA 4GFTA 4NQGA 3UNWA 1C07A 1M46A 2M1KB 1IJ6A 1AHRA 1NCYA 5AANA 2KGRA 1NPQA 1GQMA 1S6IA 4C0KA 2ZFDA 3SG6A 5I2OA 1DF0A 1ZACA 3B86A 1NX0A 1G33A 4DIRA 2WCMA 2LP3A 1Y1UA 4ORCB 3D0YA 2I94A 1QVIY 1BU3A 2LMTA 3I5GC 1TNXA 1TNPA 2OTGB 4WRIA 4TNCA 3CZ2A 1QASA 3BUNB 3O4YA 2ZRSA 4INWA 2JQ6A 1BODA 1QV1A 3DY9A 2KBIA 3SG3A 1XFXO 2M9GA 1IH0A 3SS3A 2DOQA 5HKWA 3NGVA 4ETOA 1B4CA 1N2DA 1K9PA 1A03A 2CBLA 1B8LA 5D3OA 3HX4A 4INXA 5HLOA 4UPGA 2RGIA 1ZOTB 1YRUB 3FIAA 3DF0B 1NX2A 1F54A 1KQMC 2JOJA 3CR4X 1B8RA 4YGBB 2JT3A 4M2OA 2M3WA 1CFPA 4OCIA 4OZDA 3KEVA 3VRPA 1RFJA 2KI4C 3TUYC 5ER4X 2M7NA 3V2LA 3ZWHA 1K95A 4MZLA 1KWOC 4MZKA 4CLNA 2LAPA 1E8AA 1DGVA 3EVVA 3OBVA 4HSZA 3TS5C 4E68A 3I5FB 4U8DA 1XA5A 2M7LA 3D75A 4XYNA 2FJUB 5CSFA 1BOCA 1ODBA 1NCZA 2PQLA 1MQ1A 1TCOB 4GPLB 5DICA 1UUSA 1WLMA 2JXCA 4PHNA 1XFRA 2I7AA 1AK8A 1AP4A 2HF5A 2L51A 2L98A 4GGNA 1DJYA 4HRHA 3SG4A 1DMOA 3R1PA 2Y4QA 5AXIA 3OHMB 2KI6C 3CR2A 2HQ8A 3BUOB 1SL7A 2L4IA 3IQQA 4D1EA 1LA0A 2R2IA 2KOTA 1UHIA 3A4UB 1DTLA 3RM1A 3D78A 2JNFA 3VROA 1SCMB 1EG3A 2L0PA 3EKHA 5D69A 1NP8A 2H61C 1KQVA 3L4AA 2Y1MA 2OS8B 1M39A 1UHHA 4C0LA 2HQWA 1DEKA 3TDZA 4DRWA 5G08A 3I5HC 4MSPA 1WDCC 4P5OE 2E30A 1K2HA 1AJ5A 3JVTC 2GGMA 1WY9A 3PN7C 1OMVA 3TDUA 1PVAA 3CLNA 1UHJA 1FI6A 1OOGA 2BBMA 4ZCUA 2I18A 2AMIA 1Z2CB 2K61A 2K7BA 3EK8A 1QWVA 2GTEA 4YGEB 1YX7A 2LLTA 4YI9A 3WNXB 4NDBA 2MHHA 3BFBA 2ERBA 4JWQA 1SKTA 1YUTA 4CFRA 1L7ZA 1CMGA 1ZMZA 3D76A 3F45A 3KF9A 5I2QA 1PSBA 1OOHA 3FE6A 1JSAA 1XFYO 3S0BA 2JT8A 1F71A 2EC6C 3PFVA 3DZTA 1S5GZ 1PRWA 1R2UA 4IJ7A 1WRZA 2PALA 3A8RA 3HCMA 2CCMA 3KPXA 3CABA 2ISDA 4PHMA 1OOIX 1FF1A 1W7JB
chains in the Genus database with same CATH topology
1LVCD 2CT9A 2KSPA 4XJKB 1MF8B 1K9UA 2EGDA 1WRKA 2BL0B 3KO0A 1BMOA 3OX6A 1NSHA 5AERA 1K9KA 3K21A 1Y6WA 3O6BA 1QX2A 4GGFC 5AEQA 1CB1A 1L2OB 3VRNA 2PRUA 3TZ1A 1BF5A 2L4HA 2LMVA 3LK1A 4MLWA 1FI5A 2KDHA 3FWBA 5CSIA 1SR6C 2WORA 4IL1A 4AQIA 2BECA 1KFUL 1RROA 3ZNIA 1CDMA 1KFXL 1YUSA 3EK7A 3SG2A 1BT6A 4OV2A 1IQ5A 2FCDA 5DKQA 5DKNA 1MWNA 1UHKA 2MLEC 1AUIB 3PLFB 1GGZA 4DS7A 3ICBA 2L5XB 1MXLC 1OZSA 1SMGA 2LVJA 5JJGA 2BKIB 1M63B 3GK2A 2TN4A 1KSOA 1XFWO 3OX5A 3DF0A 1LA3A 1SNLA 4GGFA 4GAOA 4P2YB 1UWOA 3WHTB 1SCMC 1DT7B 4YRUA 1LINA 1QX7A 2WCBA 2KGBC 1A75B 1PK0D 1JC2A 2KFHA 3EVRA 3GOFA 3NSLA 4PCWA 1SCVA 1NUBA 4MBEA 2ZNDA 3E3RA 2EHBA 2KI6D 3CGAA 2WCFA 1KK8B 3AAJA 4ORAB 1UHNA 2JZIA 2MLFC 2ZRTA 1QS7A 2G9BA 3LCPC 1BR1B 4I5KA 2LHIA 1PSRA 2JWWA 1G8IA 1FBVA 2F3YA 3I5IC 3BYAA 3SG5A 2JTZA 4PE0A 5JOLA 1SYMA 4MEWA 1DJZA 3PM8A 2LVIA 2F3ZA 2KAYA 5KU1A 1XVJA 5K89A 1J1DA 4N1GA 2FOTA 4YGAA 2HETA 1B7TZ 1RJVA 1X02A 1JF2A 1MUXA 2FCEA 1XFVO 1MXEA 1S1EA 1F4QA 1YTZC 5I2LA 3LK0A 3WXAA 1RTP1 1CMFA 2LANA 1PVBA 2JULA 1CFCA 2M29A 1TRFA 2LUXA 4OKHA 5B8IB 2KYCA 1A4PA 2KFFA 2MRDA 1A2XA 1OOJA 4M2PA 4PE4A 2CTNA 1RK9A 5HKZA 2LE9B 1IWQA 2G2BA 4GBAA 2M8UA 1AVSA 1QLKA 1M45A 2WCEA 3CWGA 4HREE 1H4BA 1N65A 1SPYA 1YVLA 4HRGA 4A4CA 1FPWA 4XJKA 1ZFSA 1IRJA 1TIZA 3OB2B 3GK4X 1YRTB 1HQVA 2Y1NA 1RWYA 2LVVA 3MSEB 3OP0A 4QJ5B 2JRFA 2JTTA 2L50A 4PDZA 1F70A 3BUMB 3BUWB 4WQ3A 3SJSA 3I5GB 3BOWB 2CXJA 3JTDB 1SRAA 2JPTA 2GGZA 2OTGC 1NCXA 1QTXA 2K8MB 1LKJA 2NCOA 1GGWA 1H8BA 4MRYA 5KSZA 2IS9A 1C7VA 2MBXA 2JC2A 2KNEA 1IKUA 3SG7A 2AUCA 2M49B 3BUXB 1KK7Y 3FWCA 4USLA 1UURA 2K7CA 2COLB 4BY4A 1IGVA 4C0JA 1B1GA 1JWDA 2K7DA 2BCBA 3CTNA 5HYDA 1ALVA 1KQMB 2F2OA 2QACA 5FYXA 1J55A 3TDIA 1DGUA 1S5GY 2WC8A 3RLZA 1D1OA 1OQPA 1VRKA 3TUYB 1EJ3A 1TCFA 3VRQA 3H4SE 2ZNEA 2M0RA 1IG5A 4I5LB 1V1FA 2MAZA 3D10A 3AAKA 4CPVA 5DKRA 1IQ3A 2BCAA 4L9MA 1SW8A 2PVBA 3I5FC 4M2QA 4PHKA 1EH2A 2M1UA 1CLBA 1DJWA 2K2FA 4AQJA 2V53A 3NSIA 1CDPA 2HPSA 2LCPA 1DJGA 2LP2A 2PMYA 3DVKA 1PALA 3CZTX 1YR5A 2A4JA 1A75A 4FTGA 3OB1B 1R6PA 2D8NA 3AKBA 1LXFC 2KQYA 1OMDA 4R1EA 2JXLA 3FS7A 3NSOA 2K7OA 2Q4UA 5HLVA 1BG1A 1YX8A 2PASA 1J7QA 1NIWA 1JUOA 1KSMA 1N0YA 4JPZB 1J1EA 2KAXA 3EVUA 1QIVA 1TNWA 2LC5A 1K8UA 1EL4A 1A29A 1QVIZ 1CLLA 4ZCVA 1V1GA 2OS8C 3I5HB 4BY5A 1WDCB 4I5NB 3PN7B 3GK1A 3VRRA 1W7IB 5CPVA 2NCPA 4QJ4B 4ICBA 1CM4A 5I8NA 1UP5A 4PHJA 1ALWA 1QJTA 1K96A 2MJWB 3SIAA 1QLSA 1CFDA 2LV7A 5BPJA 5GQQC 1QX5B 2PSRA 2KQ6A 2P6BB 1CFFA 4MVFA 3CS1A 4OR9B 5CSJA 1F55A 1TOPA 1NX1A 2EC6B 1SBJA 2LNKA 5J3XA 3JTDC 3AKAA 1AJ4A 2I2RE 1DJHA 1U5IB 2JT0A 2BKHB 1XK4C 2MA2A 5PALA 1F4OA 1OSAA 2E6WA 1DF0B 1M31A 2LHLA 2LUCA 2NZ0A 3LLEA 1CTRA 2BL0C 1B47A 1DJXA 2LLSA 1KFUS 1SK6D 4ORBB 1OE9B 4YGDB 3D0YB 1KFXS 2AAOA 4GUKA 4WQ2A 1JBAA 3C1VA 2LMUA 1S36A 4MRXA 3BQ3A 2KBMA 2L2EA 2ZKMX 3SIBA 1L2OC 5ER5A 3DVEA 1YURA 2O5GA 1Q80A 2BCXA 1S6JA 2Q91A 3CR5X 2BE4A 3PALA 1C7WA 1JFKA 3DD4A 3WHUB 1PULA 2F33A 1EXRA 1SR6B 2B1UA 2NLNA 2WNDA 1B8CA 1QXPA 2CNPA 3O78A 1B7TY 3BOWA 2KHNA 4F0ZB 1NWDA 1DJIA 1WRLA 2SCPA 1NYAA 1RECA 3DVJA 1SY9A 1XK4A 4PE1A 1XO5A 2LLUA 1MR8A 3NXAA 3VGOA 1BLQA 4A4BA 4FQOA 4YBHB 1S26D 2KFGA 3BXKA 4N1FA 1WLZA 2Y5IA 2JNXA 1K93D 4GNKB 3O2PA 1YUUA 4OVNF 1Y1XA 4DUQA 1CNPA 1QIWA 1OZOA 2ZN8A 3IQOA 2LM5A 1IJ5A 1GJYA 1YVHA 1G4YR 1BR4B 3M0WA 1XFUO 5HKYA 4DCKA 1TTXA 1F8HA 2GV5A 1MHOA 2KYFA 2LVKA 4CIDA 1K90D 1KK7Z 1TNQA 2VRGA 1SL9A 1J7RA 5TNCA 1CDLA 2F8PA 4NDDA 1S3PA 3PATA 4PALA 5IBWA 2QPTA 3DVMA 1KK8C 2KI4B 5AFPA 2ZN9A 1SL8A 2M97A 4CFQA 1KWOB 1CKKA 5KTYA 2SASA 3I5IB 3PSRA 1JFJA 4MZJA 1K94A 3EKJA 1KCYA 3LL8B 2BE6A 3TS5B 1QV0A 2BBNA 3QRXA 4JQ0D 3NSKA 4PE7A 1XFZO 4YGCB 4QJ3B 1EG4A 4I5JA 5CSNA 1Y1AA 2H61A 1CM1A 1TN4A 5F6TA 1FW4A 1J7OA 1JF0A 4N5XA 2F2PA 3IF7A 1NX3A 4MN0A 1OMRA 2JU0A 1BJFA 4AOMA 1Y0VH 2KAVA 1DVIA 4YI8A 1HT9A 1CDNA 3KHEA 1S6CA 1B9AA 2H2KA 1XYDA 2O60A 5D7FA 1J7PA 2NXQA 4Q04A 2K0JA 4NDCA 2K2AA 1CLMA 2WOSA 3EK4A 1QATA 2OPOA 1ZUZA 3JVTB 1U5IA 4GFTA 4NQGA 1C07A 1M46A 2M1KB 1IJ6A 1AHRA 1NCYA 5AANA 2KGRA 1NPQA 1GQMA 1S6IA 4C0KA 2ZFDA 3SG6A 5I2OA 1DF0A 1ZACA 1NX0A 1G33A 4DIRA 2LP3A 1Y1UA 4ORCB 3D0YA 2I94A 1QVIY 1BU3A 2LMTA 3I5GC 1TNXA 1TNPA 2OTGB 4WRIA 4TNCA 1QASA 3BUNB 3O4YA 2ZRSA 2JQ6A 1BODA 1QV1A 2KBIA 3SG3A 1XFXO 2M9GA 1IH0A 2DOQA 5HKWA 4ETOA 1B4CA 1N2DA 1K9PA 1A03A 2CBLA 1B8LA 5HLOA 3HX4A 4UPGA 2RGIA 1ZOTB 1YRUB 3FIAA 3DF0B 1NX2A 1F54A 1KQMC 2JOJA 3CR4X 1B8RA 4YGBB 2JT3A 4M2OA 2M3WA 1CFPA 4OCIA 3KEVA 3VRPA 1RFJA 2KI4C 3TUYC 5ER4X 2M7NA 3ZWHA 1K95A 4MZLA 1KWOC 4MZKA 4CLNA 2LAPA 1E8AA 1DGVA 3EVVA 4HSZA 3TS5C 4E68A 3I5FB 4U8DA 1XA5A 2M7LA 4XYNA 2FJUB 5CSFA 1BOCA 1ODBA 1NCZA 1MQ1A 1TCOB 4GPLB 1UUSA 1WLMA 2JXCA 4PHNA 1AK8A 2I7AA 1AP4A 2HF5A 2L51A 2L98A 4GGNA 1DJYA 4HRHA 3SG4A 1DMOA 2Y4QA 5AXIA 3OHMB 2KI6C 3CR2A 2HQ8A 3BUOB 1SL7A 2L4IA 3IQQA 4D1EA 1LA0A 2R2IA 2KOTA 1UHIA 3A4UB 1DTLA 3RM1A 2JNFA 3VROA 1SCMB 1EG3A 2L0PA 3EKHA 5D69A 1NP8A 2H61C 1KQVA 2Y1MA 2OS8B 1M39A 1UHHA 4C0LA 2HQWA 3TDZA 4DRWA 5G08A 3I5HC 4MSPA 1WDCC 4P5OE 2E30A 1K2HA 1AJ5A 3JVTC 2GGMA 1WY9A 3PN7C 1OMVA 3TDUA 1PVAA 3CLNA 1UHJA 1FI6A 2BBMA 4ZCUA 2I18A 2AMIA 2K61A 2K7BA 3EK8A 4YGEB 1YX7A 2LLTA 4YI9A 3WNXB 4NDBA 2MHHA 4JWQA 1SKTA 1YUTA 4CFRA 1L7ZA 1CMGA 1ZMZA 5I2QA 3F45A 3KF9A 1PSBA 1JSAA 1XFYO 1F71A 2JT8A 2EC6C 3PFVA 1S5GZ 1PRWA 1R2UA 1WRZA 2PALA 3A8RA 3HCMA 2CCMA 3KPXA 2ISDA 4PHMA 1FF1A 1W7JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LVC D;  2CT9 A;  2KSP A;  4XJK B;  1MF8 B;  1K9U A;  2EGD A;  1WRK A;  2BL0 B;  3KO0 A;  1BMO A;  3OX6 A;  1NSH A;  5AER A;  1K9K A;  3K21 A;  1Y6W A;  3O6B A;  1QX2 A;  4GGF C;  5AEQ A;  1CB1 A;  1L2O B;  3VRN A;  2PRU A;  3TZ1 A;  1BF5 A;  2L4H A;  2LMV A;  3LK1 A;  4MLW A;  1FI5 A;  2KDH A;  3FWB A;  5CSI A;  1SR6 C;  2WOR A;  4IL1 A;  4AQI A;  2BEC A;  1KFU L;  1RRO A;  3ZNI A;  1CDM A;  1KFX L;  1YUS A;  3EK7 A;  3SG2 A;  1BT6 A;  4OV2 A;  1IQ5 A;  2FCD A;  5DKQ A;  5DKN A;  1MWN A;  1UHK A;  2MLE C;  1AUI B;  3PLF B;  1GGZ A;  4DS7 A;  3ICB A;  2L5X B;  1MXL C;  1OZS A;  1SMG A;  2LVJ A;  5JJG A;  2BKI B;  1M63 B;  3GK2 A;  2TN4 A;  1KSO A;  1XFW O;  3OX5 A;  3DF0 A;  1LA3 A;  1SNL A;  4GGF A;  4GAO A;  4P2Y B;  1UWO A;  3WHT B;  1SCM C;  1DT7 B;  4YRU A;  1LIN A;  1QX7 A;  2WCB A;  2KGB C;  1A75 B;  1PK0 D;  1JC2 A;  2KFH A;  3EVR A;  3GOF A;  3NSL A;  4PCW A;  1SCV A;  1NUB A;  4MBE A;  2ZND A;  3E3R A;  2EHB A;  2KI6 D;  3CGA A;  2WCF A;  1KK8 B;  3AAJ A;  4ORA B;  1UHN A;  2JZI A;  2MLF C;  2ZRT A;  1QS7 A;  2G9B A;  3LCP C;  1BR1 B;  4I5K A;  2LHI A;  1PSR A;  2JWW A;  1G8I A;  1FBV A;  2F3Y A;  3I5I C;  3BYA A;  3SG5 A;  2JTZ A;  4PE0 A;  5JOL A;  1SYM A;  4MEW A;  1DJZ A;  3PM8 A;  2LVI A;  2F3Z A;  2KAY A;  5KU1 A;  1XVJ A;  5K89 A;  1J1D A;  4N1G A;  2FOT A;  4YGA A;  2HET A;  1B7T Z;  1RJV A;  1X02 A;  1JF2 A;  1MUX A;  2FCE A;  1XFV O;  1MXE A;  1S1E A;  1F4Q A;  1YTZ C;  5I2L A;  3LK0 A;  3WXA A;  1RTP 1;  1CMF A;  2LAN A;  1PVB A;  2JUL A;  1CFC A;  2M29 A;  1TRF A;  2LUX A;  4OKH A;  5B8I B;  2KYC A;  1A4P A;  2KFF A;  2MRD A;  1A2X A;  1OOJ A;  4M2P A;  4PE4 A;  2CTN A;  1RK9 A;  5HKZ A;  2LE9 B;  1IWQ A;  2G2B A;  4GBA A;  2M8U A;  1AVS A;  1QLK A;  1M45 A;  2WCE A;  3CWG A;  4HRE E;  1H4B A;  1N65 A;  1SPY A;  1YVL A;  4HRG A;  4A4C A;  1FPW A;  4XJK A;  1ZFS A;  1IRJ A;  1TIZ A;  3OB2 B;  3GK4 X;  1YRT B;  1HQV A;  2Y1N A;  1RWY A;  2LVV A;  3MSE B;  3OP0 A;  4QJ5 B;  2JRF A;  2JTT A;  2L50 A;  4PDZ A;  1F70 A;  3BUM B;  3BUW B;  4WQ3 A;  3SJS A;  3I5G B;  3BOW B;  2CXJ A;  3JTD B;  1SRA A;  2JPT A;  2GGZ A;  2OTG C;  1NCX A;  1QTX A;  2K8M B;  1LKJ A;  2NCO A;  1GGW A;  1H8B A;  4MRY A;  5KSZ A;  2IS9 A;  1C7V A;  2MBX A;  2JC2 A;  2KNE A;  1IKU A;  3SG7 A;  2AUC A;  2M49 B;  3BUX B;  1KK7 Y;  3FWC A;  4USL A;  1UUR A;  2K7C A;  2COL B;  4BY4 A;  1IGV A;  4C0J A;  1B1G A;  1JWD A;  2K7D A;  2BCB A;  3CTN A;  5HYD A;  1ALV A;  1KQM B;  2F2O A;  2QAC A;  5FYX A;  1J55 A;  3TDI A;  1DGU A;  1S5G Y;  2WC8 A;  3RLZ A;  1D1O A;  1OQP A;  1VRK A;  3TUY B;  1EJ3 A;  1TCF A;  3VRQ A;  3H4S E;  2ZNE A;  2M0R A;  1IG5 A;  4I5L B;  1V1F A;  2MAZ A;  3D10 A;  3AAK A;  4CPV A;  5DKR A;  1IQ3 A;  2BCA A;  4L9M A;  1SW8 A;  2PVB A;  3I5F C;  4M2Q A;  4PHK A;  1EH2 A;  2M1U A;  1CLB A;  1DJW A;  2K2F A;  4AQJ A;  2V53 A;  3NSI A;  1CDP A;  2HPS A;  2LCP A;  1DJG A;  2LP2 A;  2PMY A;  3DVK A;  1PAL A;  3CZT X;  1YR5 A;  2A4J A;  1A75 A;  4FTG A;  3OB1 B;  1R6P A;  2D8N A;  3AKB A;  1LXF C;  2KQY A;  1OMD A;  4R1E A;  2JXL A;  3FS7 A;  3NSO A;  2K7O A;  2Q4U A;  5HLV A;  1BG1 A;  1YX8 A;  2PAS A;  1J7Q A;  1NIW A;  1JUO A;  1KSM A;  1N0Y A;  4JPZ B;  1J1E A;  2KAX A;  3EVU A;  1QIV A;  1TNW A;  2LC5 A;  1K8U A;  1EL4 A;  1A29 A;  1QVI Z;  1CLL A;  4ZCV A;  1V1G A;  2OS8 C;  3I5H B;  4BY5 A;  1WDC B;  4I5N B;  3PN7 B;  3GK1 A;  3VRR A;  1W7I B;  5CPV A;  2NCP A;  4QJ4 B;  4ICB A;  1CM4 A;  5I8N A;  1UP5 A;  4PHJ A;  1ALW A;  1QJT A;  1K96 A;  2MJW B;  3SIA A;  1QLS A;  1CFD A;  2LV7 A;  5BPJ A;  5GQQ C;  1QX5 B;  2PSR A;  2KQ6 A;  2P6B B;  1CFF A;  4MVF A;  3CS1 A;  4OR9 B;  5CSJ A;  1F55 A;  1TOP A;  1NX1 A;  2EC6 B;  1SBJ A;  2LNK A;  5J3X A;  3JTD C;  3AKA A;  1AJ4 A;  2I2R E;  1DJH A;  1U5I B;  2JT0 A;  2BKH B;  1XK4 C;  2MA2 A;  5PAL A;  1F4O A;  1OSA A;  2E6W A;  1DF0 B;  1M31 A;  2LHL A;  2LUC A;  2NZ0 A;  3LLE A;  1CTR A;  2BL0 C;  1B47 A;  1DJX A;  2LLS A;  1KFU S;  1SK6 D;  4ORB B;  1OE9 B;  4YGD B;  3D0Y B;  1KFX S;  2AAO A;  4GUK A;  4WQ2 A;  1JBA A;  3C1V A;  2LMU A;  1S36 A;  4MRX A;  3BQ3 A;  2KBM A;  2L2E A;  2ZKM X;  3SIB A;  1L2O C;  5ER5 A;  3DVE A;  1YUR A;  2O5G A;  1Q80 A;  2BCX A;  1S6J A;  2Q91 A;  3CR5 X;  2BE4 A;  3PAL A;  1C7W A;  1JFK A;  3DD4 A;  3WHU B;  1PUL A;  2F33 A;  1EXR A;  1SR6 B;  2B1U A;  2NLN A;  2WND A;  1B8C A;  1QXP A;  2CNP A;  3O78 A;  1B7T Y;  3BOW A;  2KHN A;  4F0Z B;  1NWD A;  1DJI A;  1WRL A;  2SCP A;  1NYA A;  1REC A;  3DVJ A;  1SY9 A;  1XK4 A;  4PE1 A;  1XO5 A;  2LLU A;  1MR8 A;  3NXA A;  3VGO A;  1BLQ A;  4A4B A;  4FQO A;  4YBH B;  1S26 D;  2KFG A;  3BXK A;  4N1F A;  1WLZ A;  2Y5I A;  2JNX A;  1K93 D;  4GNK B;  3O2P A;  1YUU A;  4OVN F;  1Y1X A;  4DUQ A;  1CNP A;  1QIW A;  1OZO A;  2ZN8 A;  3IQO A;  2LM5 A;  1IJ5 A;  1GJY A;  1YVH A;  1G4Y R;  1BR4 B;  3M0W A;  1XFU O;  5HKY A;  4DCK A;  1TTX A;  1F8H A;  2GV5 A;  1MHO A;  2KYF A;  2LVK A;  4CID A;  1K90 D;  1KK7 Z;  1TNQ A;  2VRG A;  1SL9 A;  1J7R A;  5TNC A;  1CDL A;  2F8P A;  4NDD A;  1S3P A;  3PAT A;  4PAL A;  5IBW A;  2QPT A;  3DVM A;  1KK8 C;  2KI4 B;  5AFP A;  2ZN9 A;  1SL8 A;  2M97 A;  4CFQ A;  1KWO B;  1CKK A;  5KTY A;  2SAS A;  3I5I B;  3PSR A;  1JFJ A;  4MZJ A;  1K94 A;  3EKJ A;  1KCY A;  3LL8 B;  2BE6 A;  3TS5 B;  1QV0 A;  2BBN A;  3QRX A;  4JQ0 D;  3NSK A;  4PE7 A;  1XFZ O;  4YGC B;  4QJ3 B;  1EG4 A;  4I5J A;  5CSN A;  1Y1A A;  2H61 A;  1CM1 A;  1TN4 A;  5F6T A;  1FW4 A;  1J7O A;  1JF0 A;  4N5X A;  2F2P A;  3IF7 A;  1NX3 A;  4MN0 A;  1OMR A;  2JU0 A;  1BJF A;  4AOM A;  1Y0V H;  2KAV A;  1DVI A;  4YI8 A;  1HT9 A;  1CDN A;  3KHE A;  1S6C A;  1B9A A;  2H2K A;  1XYD A;  2O60 A;  5D7F A;  1J7P A;  2NXQ A;  4Q04 A;  2K0J A;  4NDC A;  2K2A A;  1CLM A;  2WOS A;  3EK4 A;  1QAT A;  2OPO A;  1ZUZ A;  3JVT B;  1U5I A;  4GFT A;  4NQG A;  1C07 A;  1M46 A;  2M1K B;  1IJ6 A;  1AHR A;  1NCY A;  5AAN A;  2KGR A;  1NPQ A;  1GQM A;  1S6I A;  4C0K A;  2ZFD A;  3SG6 A;  5I2O A;  1DF0 A;  1ZAC A;  1NX0 A;  1G33 A;  4DIR A;  2LP3 A;  1Y1U A;  4ORC B;  3D0Y A;  2I94 A;  1QVI Y;  1BU3 A;  2LMT A;  3I5G C;  1TNX A;  1TNP A;  2OTG B;  4WRI A;  4TNC A;  1QAS A;  3BUN B;  3O4Y A;  2ZRS A;  2JQ6 A;  1BOD A;  1QV1 A;  2KBI A;  3SG3 A;  1XFX O;  2M9G A;  1IH0 A;  2DOQ A;  5HKW A;  4ETO A;  1B4C A;  1N2D A;  1K9P A;  1A03 A;  2CBL A;  1B8L A;  5HLO A;  3HX4 A;  4UPG A;  2RGI A;  1ZOT B;  1YRU B;  3FIA A;  3DF0 B;  1NX2 A;  1F54 A;  1KQM C;  2JOJ A;  3CR4 X;  1B8R A;  4YGB B;  2JT3 A;  4M2O A;  2M3W A;  1CFP A;  4OCI A;  3KEV A;  3VRP A;  1RFJ A;  2KI4 C;  3TUY C;  5ER4 X;  2M7N A;  3ZWH A;  1K95 A;  4MZL A;  1KWO C;  4MZK A;  4CLN A;  2LAP A;  1E8A A;  1DGV A;  3EVV A;  4HSZ A;  3TS5 C;  4E68 A;  3I5F B;  4U8D A;  1XA5 A;  2M7L A;  4XYN A;  2FJU B;  5CSF A;  1BOC A;  1ODB A;  1NCZ A;  1MQ1 A;  1TCO B;  4GPL B;  1UUS A;  1WLM A;  2JXC A;  4PHN A;  1AK8 A;  2I7A A;  1AP4 A;  2HF5 A;  2L51 A;  2L98 A;  4GGN A;  1DJY A;  4HRH A;  3SG4 A;  1DMO A;  2Y4Q A;  5AXI A;  3OHM B;  2KI6 C;  3CR2 A;  2HQ8 A;  3BUO B;  1SL7 A;  2L4I A;  3IQQ A;  4D1E A;  1LA0 A;  2R2I A;  2KOT A;  1UHI A;  3A4U B;  1DTL A;  3RM1 A;  2JNF A;  3VRO A;  1SCM B;  1EG3 A;  2L0P A;  3EKH A;  5D69 A;  1NP8 A;  2H61 C;  1KQV A;  2Y1M A;  2OS8 B;  1M39 A;  1UHH A;  4C0L A;  2HQW A;  3TDZ A;  4DRW A;  5G08 A;  3I5H C;  4MSP A;  1WDC C;  4P5O E;  2E30 A;  1K2H A;  1AJ5 A;  3JVT C;  2GGM A;  1WY9 A;  3PN7 C;  1OMV A;  3TDU A;  1PVA A;  3CLN A;  1UHJ A;  1FI6 A;  2BBM A;  4ZCU A;  2I18 A;  2AMI A;  2K61 A;  2K7B A;  3EK8 A;  4YGE B;  1YX7 A;  2LLT A;  4YI9 A;  3WNX B;  4NDB A;  2MHH A;  4JWQ A;  1SKT A;  1YUT A;  4CFR A;  1L7Z A;  1CMG A;  1ZMZ A;  5I2Q A;  3F45 A;  3KF9 A;  1PSB A;  1JSA A;  1XFY O;  1F71 A;  2JT8 A;  2EC6 C;  3PFV A;  1S5G Z;  1PRW A;  1R2U A;  1WRZ A;  2PAL A;  3A8R A;  3HCM A;  2CCM A;  3KPX A;  2ISD A;  4PHM A;  1FF1 A;  1W7J B; 
#chains in the Genus database with same CATH topology
 1LVC D;  2CT9 A;  2KSP A;  4XJK B;  1MF8 B;  1K9U A;  2EGD A;  1WRK A;  2BL0 B;  3KO0 A;  1BMO A;  3OX6 A;  1NSH A;  5AER A;  1K9K A;  3K21 A;  3SS5 A;  1Y6W A;  3O6B A;  1QX2 A;  2WCK A;  3QME A;  4GGF C;  5AEQ A;  1CB1 A;  1L2O B;  5FI7 A;  3VRN A;  2PRU A;  3TZ1 A;  3RZS A;  1BF5 A;  2L4H A;  2LMV A;  3LK1 A;  4MLW A;  1FI5 A;  2KDH A;  3FWB A;  3DXL A;  5CSI A;  1SR6 C;  2WOR A;  4IL1 A;  4AQI A;  2QEV A;  3FE9 A;  4KYN A;  2BEC A;  1KFU L;  1RRO A;  3ZNI A;  1CDM A;  1KFX L;  1YUS A;  3EK7 A;  2QEH A;  3SG2 A;  1TUJ A;  1BT6 A;  4OV2 A;  3EG5 B;  4FQT A;  1IQ5 A;  2FCD A;  5DKQ A;  1TUZ A;  5DKN A;  1MWN A;  1UHK A;  2MLE C;  1AUI B;  3PLF B;  5FI6 A;  1GGZ A;  4DS7 A;  3ICB A;  2L5X B;  1GM0 A;  1MXL C;  1OZS A;  1SMG A;  2LVJ A;  5JJG A;  2BKI B;  1M63 B;  3GK2 A;  2TN4 A;  1KSO A;  1XFW O;  3OX5 A;  3DF0 A;  1LA3 A;  1SNL A;  4GGF A;  4GAO A;  4P2Y B;  1UWO A;  3WHT B;  1SCM C;  3CDN A;  1DT7 B;  4YRU A;  1LIN A;  1QX7 A;  2WCB A;  2KGB C;  3CZ1 A;  1A75 B;  1PK0 D;  1JC2 A;  2KFH A;  3EVR A;  3GOF A;  3NSL A;  4PCW A;  2WCH A;  1SCV A;  1NUB A;  4MBE A;  2ZND A;  3E3R A;  2EHB A;  3R1V A;  2KI6 D;  3CGA A;  2WCF A;  1KK8 B;  3AAJ A;  4ORA B;  1UHN A;  2JZI A;  2MLF C;  2ZRT A;  1QS7 A;  2G9B A;  3LCP C;  1BR1 B;  4I5K A;  2LHI A;  1PSR A;  2JWW A;  1G8I A;  1FBV A;  2F3Y A;  3I5I C;  3BYA A;  3SG5 A;  2JTZ A;  4PE0 A;  5JOL A;  1SYM A;  4MEW A;  1DJZ A;  3PM8 A;  2LVI A;  2F3Z A;  2KAY A;  5KU1 A;  1XVJ A;  5K89 A;  1J1D A;  1OOF A;  4N1G A;  2FOT A;  4YGA A;  2HET A;  1B7T Z;  1RJV A;  1X02 A;  1JF2 A;  1MUX A;  2FCE A;  3L4L A;  1XFV O;  2YGU A;  1MXE A;  1S1E A;  1OW4 A;  1F4Q A;  1YTZ C;  5I2L A;  2KPH A;  3LK0 A;  3B7A A;  3WXA A;  3Q8I A;  1RTP 1;  1CMF A;  4JD9 A;  2LAN A;  1PVB A;  2JUL A;  1CFC A;  2M29 A;  1TRF A;  2LUX A;  4OKH A;  5B8I B;  2KYC A;  1A4P A;  2KFF A;  2MRD A;  1A2X A;  1OOJ A;  3B6X A;  4M2P A;  4PE4 A;  2CTN A;  1RK9 A;  5HKZ A;  1ORG A;  2LE9 B;  1Z4H A;  3D77 A;  1IWQ A;  2PYQ A;  3CYZ A;  2G2B A;  4GBA A;  5EL2 A;  2M8U A;  1AVS A;  1QLK A;  1M45 A;  2WCE A;  3CWG A;  4HRE E;  5HL1 A;  1H4B A;  1N65 A;  1SPY A;  1YVL A;  3OGN A;  4HRG A;  4A4C A;  4XJK A;  1FPW A;  1ZFS A;  1IRJ A;  1TIZ A;  3OB2 B;  3GK4 X;  1YRT B;  1HQV A;  2Y1N A;  1RWY A;  2LVV A;  3MSE B;  3OP0 A;  3R72 A;  4QJ5 B;  2JRF A;  2JTT A;  2L50 A;  4PDZ A;  1F70 A;  3BUM B;  3BUW B;  4WQ3 A;  3SJS A;  3I5G B;  3BOW B;  1T14 A;  2CXJ A;  3JTD B;  1SRA A;  2JPT A;  2GGZ A;  2OTG C;  1NCX A;  1QTX A;  2K8M B;  1LKJ A;  2NCO A;  2WC6 A;  1GGW A;  1H8B A;  4MRY A;  5KSZ A;  2IS9 A;  1C7V A;  2MBX A;  2JC2 A;  2BNX A;  1SSE B;  2KNE A;  1IKU A;  3SG7 A;  2AUC A;  2M49 B;  3BUX B;  1DQE A;  1KK7 Y;  1TWO A;  3FWC A;  4USL A;  1UUR A;  2K7C A;  2COL B;  4BY4 A;  1IGV A;  4C0J A;  1B1G A;  1JWD A;  2K7D A;  2BCB A;  3CTN A;  1DC1 A;  5HYD A;  1ALV A;  1KQM B;  2F2O A;  2QAC A;  3BJH A;  1J55 A;  5FYX A;  1DGU A;  1S5G Y;  2WC8 A;  3RLZ A;  3TDI A;  3S0F A;  1D1O A;  1OQP A;  1VRK A;  3TUY B;  1EJ3 A;  1TCF A;  3VRQ A;  2JPO A;  3H4S E;  2ZNE A;  2M0R A;  1IG5 A;  4I5L B;  1V1F A;  2MAZ A;  3D10 A;  3AAK A;  4CPV A;  5DKR A;  1IQ3 A;  2BCA A;  4L9M A;  1SW8 A;  2PVB A;  3I5F C;  3CZ0 A;  4M2Q A;  4PHK A;  1EH2 A;  3S0E A;  2M1U A;  1CLB A;  1DJW A;  2K2F A;  4AQJ A;  2V53 A;  3NSI A;  1CDP A;  2HPS A;  2LCP A;  1DJG A;  2LP2 A;  2PMY A;  3DVK A;  1PAL A;  3CZT X;  1YR5 A;  3PM2 A;  2L2C A;  1C3Z A;  1A75 A;  2A4J A;  4FTG A;  3OB1 B;  1R6P A;  2D8N A;  3AKB A;  1LXF C;  2KQY A;  1OMD A;  4R1E A;  2JXL A;  1P28 A;  3FS7 A;  3NSO A;  2K7O A;  2Q4U A;  5HLV A;  4PT1 A;  1BG1 A;  1YX8 A;  2PAS A;  1J7Q A;  1NIW A;  1JUO A;  1KSM A;  1N0Y A;  4JPZ B;  1J1E A;  2KAX A;  2P70 A;  1QIV A;  3EVU A;  1TNW A;  2LC5 A;  1K8U A;  1EL4 A;  1A29 A;  1QVI Z;  3IVT A;  1CLL A;  4ZCV A;  1V1G A;  2OS8 C;  3I5H B;  3NHI A;  4BY5 A;  1WDC B;  4I5N B;  3PN7 B;  3GK1 A;  3VRR A;  2P71 A;  1W7I B;  5CPV A;  2NCP A;  4QJ4 B;  3D73 A;  4ICB A;  1CM4 A;  2FJY A;  2QEO A;  5I8N A;  1UP5 A;  4PHJ A;  1IIO A;  1ALW A;  1QJT A;  2BAP A;  3B87 A;  1K96 A;  2QEB A;  3VB1 A;  2MJW B;  3SIA A;  1QLS A;  1CFD A;  2LV7 A;  5BPJ A;  5GQQ C;  4F7F A;  1QX5 B;  2PSR A;  2KQ6 A;  2P6B B;  2WCJ A;  4MVF A;  1CFF A;  3CS1 A;  3N7H A;  4OR9 B;  5CSJ A;  1TOP A;  1NX1 A;  2EC6 B;  1SBJ A;  2LNK A;  5J3X A;  1F55 A;  3O4X A;  3JTD C;  3AKA A;  1AJ4 A;  2I2R E;  1DJH A;  1U5I B;  2JT0 A;  2BKH B;  5I94 A;  1XK4 C;  2MA2 A;  5PAL A;  1F4O A;  1OSA A;  2E6W A;  1DF0 B;  1M31 A;  2LHL A;  2LUC A;  2NZ0 A;  3LLE A;  1CTR A;  2BL0 C;  1B47 A;  1DJX A;  2LLS A;  1KFU S;  1SK6 D;  4ORB B;  1OE9 B;  4YGD B;  3D0Y B;  1KFX S;  2AAO A;  4GUK A;  4WQ2 A;  1JBA A;  3C1V A;  2LMU A;  1S36 A;  1W9Z A;  4MRX A;  3BQ3 A;  2KBM A;  2L2E A;  2ZKM X;  4JKT A;  1L2O C;  3SIB A;  5ER5 A;  3DVE A;  1YUR A;  2O5G A;  1Q80 A;  2BCX A;  1S6J A;  2Q91 A;  3CR5 X;  1LS8 A;  2BE4 A;  2KLE A;  3PAL A;  1C7W A;  1JFK A;  3B88 A;  3BFH A;  3DD4 A;  3WHU B;  1PUL A;  2F33 A;  1EXR A;  1SR6 B;  2B1U A;  2NLN A;  2WND A;  1B8C A;  1QXP A;  2CNP A;  3O78 A;  1B7T Y;  3BOW A;  2KHN A;  4F0Z B;  1NWD A;  1DJI A;  1WRL A;  2SCP A;  1NYA A;  1REC A;  3DVJ A;  1SY9 A;  1XK4 A;  4PE1 A;  1XO5 A;  2LLU A;  1MR8 A;  3NXA A;  3R1O A;  3VGO A;  1BLQ A;  5FI2 A;  4FQO A;  4A4B A;  4YBH B;  2WCL A;  3S0D A;  1S26 D;  2KFG A;  3BXK A;  4N1F A;  1WLZ A;  2Y5I A;  2JNX A;  1K93 D;  4GNK B;  3O2P A;  1YUU A;  4OVN F;  1Y1X A;  4DUQ A;  1CNP A;  1QIW A;  1OZO A;  2ZN8 A;  3D74 A;  3L47 A;  3IQO A;  2LM5 A;  1IJ5 A;  1GJY A;  1DEL A;  2WC5 A;  1YVH A;  1G4Y R;  1BR4 B;  3M0W A;  1XFU O;  5HKY A;  4DCK A;  1TTX A;  1F8H A;  2K60 A;  2GV5 A;  1MHO A;  2KYF A;  2LVK A;  4CID A;  1K90 D;  1KK7 Z;  1TNQ A;  2VRG A;  1SL9 A;  1J7R A;  5TNC A;  1CDL A;  2L5Y A;  2F8P A;  4NDD A;  1S3P A;  3PAT A;  4PAL A;  5IBW A;  3S0A A;  2QPT A;  2QDI A;  1KK8 C;  3DVM A;  2KI4 B;  5AFP A;  2ZN9 A;  1SL8 A;  2M97 A;  4CFQ A;  1KWO B;  1CKK A;  2H8V A;  5KTY A;  2SAS A;  3I5I B;  3PSR A;  3S0G A;  1JFJ A;  3FE8 A;  1K94 A;  3EKJ A;  4MZJ A;  3LL8 B;  1KCY A;  2BE6 A;  3TS5 B;  1QV0 A;  2BBN A;  3QRX A;  4JQ0 D;  3NSK A;  4PE7 A;  1XFZ O;  4YGC B;  4QJ3 B;  1EG4 A;  4I5J A;  5CSN A;  3K1E A;  1Y1A A;  2H61 A;  1CM1 A;  1TN4 A;  5F6T A;  1FW4 A;  1C3Y A;  1J7O A;  1JF0 A;  4N5X A;  3SS4 A;  2F2P A;  3BFA A;  3IF7 A;  3NHT A;  1NX3 A;  4MN0 A;  1OMR A;  2JU0 A;  1BJF A;  4AOM A;  1Y0V H;  2KAV A;  1DVI A;  4YI8 A;  1HT9 A;  1CDN A;  3KHE A;  1S6C A;  1B9A A;  2H2K A;  3DYE A;  1XYD A;  2O60 A;  5D7F A;  1J7P A;  3PJI A;  2NXQ A;  4Q04 A;  2K0J A;  4NDC A;  2K2A A;  1CLM A;  2KLD A;  2WOS A;  3UO9 A;  3EK4 A;  1QAT A;  2OPO A;  1ZUZ A;  3JVT B;  1U5I A;  4GFT A;  4NQG A;  3UNW A;  1C07 A;  1M46 A;  2M1K B;  1IJ6 A;  1AHR A;  1NCY A;  5AAN A;  2KGR A;  1NPQ A;  1GQM A;  1S6I A;  4C0K A;  2ZFD A;  3SG6 A;  5I2O A;  1DF0 A;  1ZAC A;  3B86 A;  1NX0 A;  1G33 A;  4DIR A;  2WCM A;  2LP3 A;  1Y1U A;  4ORC B;  3D0Y A;  2I94 A;  1QVI Y;  1BU3 A;  2LMT A;  3I5G C;  1TNX A;  1TNP A;  2OTG B;  4WRI A;  4TNC A;  3CZ2 A;  1QAS A;  3BUN B;  3O4Y A;  2ZRS A;  4INW A;  2JQ6 A;  1BOD A;  1QV1 A;  3DY9 A;  2KBI A;  3SG3 A;  1XFX O;  2M9G A;  1IH0 A;  3SS3 A;  2DOQ A;  5HKW A;  3NGV A;  4ETO A;  1B4C A;  1N2D A;  1K9P A;  1A03 A;  2CBL A;  1B8L A;  5D3O A;  3HX4 A;  4INX A;  5HLO A;  4UPG A;  2RGI A;  1ZOT B;  1YRU B;  3FIA A;  3DF0 B;  1NX2 A;  1F54 A;  1KQM C;  2JOJ A;  3CR4 X;  1B8R A;  4YGB B;  2JT3 A;  4M2O A;  2M3W A;  1CFP A;  4OCI A;  4OZD A;  3KEV A;  3VRP A;  1RFJ A;  2KI4 C;  3TUY C;  5ER4 X;  2M7N A;  3V2L A;  3ZWH A;  1K95 A;  4MZL A;  1KWO C;  4MZK A;  4CLN A;  2LAP A;  1E8A A;  1DGV A;  3EVV A;  3OBV A;  4HSZ A;  3TS5 C;  4E68 A;  3I5F B;  4U8D A;  1XA5 A;  2M7L A;  3D75 A;  4XYN A;  2FJU B;  5CSF A;  1BOC A;  1ODB A;  1NCZ A;  2PQL A;  1MQ1 A;  1TCO B;  4GPL B;  5DIC A;  1UUS A;  1WLM A;  2JXC A;  4PHN A;  1XFR A;  2I7A A;  1AK8 A;  1AP4 A;  2HF5 A;  2L51 A;  2L98 A;  4GGN A;  1DJY A;  4HRH A;  3SG4 A;  1DMO A;  3R1P A;  2Y4Q A;  5AXI A;  3OHM B;  2KI6 C;  3CR2 A;  2HQ8 A;  3BUO B;  1SL7 A;  2L4I A;  3IQQ A;  4D1E A;  1LA0 A;  2R2I A;  2KOT A;  1UHI A;  3A4U B;  1DTL A;  3RM1 A;  3D78 A;  2JNF A;  3VRO A;  1SCM B;  1EG3 A;  2L0P A;  3EKH A;  5D69 A;  1NP8 A;  2H61 C;  1KQV A;  3L4A A;  2Y1M A;  2OS8 B;  1M39 A;  1UHH A;  4C0L A;  2HQW A;  1DEK A;  3TDZ A;  4DRW A;  5G08 A;  3I5H C;  4MSP A;  1WDC C;  4P5O E;  2E30 A;  1K2H A;  1AJ5 A;  3JVT C;  2GGM A;  1WY9 A;  3PN7 C;  1OMV A;  3TDU A;  1PVA A;  3CLN A;  1UHJ A;  1FI6 A;  1OOG A;  2BBM A;  4ZCU A;  2I18 A;  2AMI A;  1Z2C B;  2K61 A;  2K7B A;  3EK8 A;  1QWV A;  2GTE A;  4YGE B;  1YX7 A;  2LLT A;  4YI9 A;  3WNX B;  4NDB A;  2MHH A;  3BFB A;  2ERB A;  4JWQ A;  1SKT A;  1YUT A;  4CFR A;  1L7Z A;  1CMG A;  1ZMZ A;  3D76 A;  3F45 A;  3KF9 A;  5I2Q A;  1PSB A;  1OOH A;  3FE6 A;  1JSA A;  1XFY O;  3S0B A;  2JT8 A;  1F71 A;  2EC6 C;  3PFV A;  3DZT A;  1S5G Z;  1PRW A;  1R2U A;  4IJ7 A;  1WRZ A;  2PAL A;  3A8R A;  3HCM A;  2CCM A;  3KPX A;  3CAB A;  2ISD A;  4PHM A;  1OOI X;  1FF1 A;  1W7J B; 
#chains in the Genus database with same CATH homology
 1LVC D;  2CT9 A;  2KSP A;  4XJK B;  1MF8 B;  1K9U A;  2EGD A;  1WRK A;  2BL0 B;  3KO0 A;  1BMO A;  3OX6 A;  1NSH A;  5AER A;  1K9K A;  3K21 A;  1Y6W A;  3O6B A;  1QX2 A;  4GGF C;  5AEQ A;  1CB1 A;  1L2O B;  3VRN A;  2PRU A;  3TZ1 A;  1BF5 A;  2L4H A;  2LMV A;  3LK1 A;  4MLW A;  1FI5 A;  2KDH A;  3FWB A;  5CSI A;  1SR6 C;  2WOR A;  4IL1 A;  4AQI A;  2BEC A;  1KFU L;  1RRO A;  3ZNI A;  1CDM A;  1KFX L;  1YUS A;  3EK7 A;  3SG2 A;  1BT6 A;  4OV2 A;  1IQ5 A;  2FCD A;  5DKQ A;  5DKN A;  1MWN A;  1UHK A;  2MLE C;  1AUI B;  3PLF B;  1GGZ A;  4DS7 A;  3ICB A;  2L5X B;  1MXL C;  1OZS A;  1SMG A;  2LVJ A;  5JJG A;  2BKI B;  1M63 B;  3GK2 A;  2TN4 A;  1KSO A;  1XFW O;  3OX5 A;  3DF0 A;  1LA3 A;  1SNL A;  4GGF A;  4GAO A;  4P2Y B;  1UWO A;  3WHT B;  1SCM C;  1DT7 B;  4YRU A;  1LIN A;  1QX7 A;  2WCB A;  2KGB C;  1A75 B;  1PK0 D;  1JC2 A;  2KFH A;  3EVR A;  3GOF A;  3NSL A;  4PCW A;  1SCV A;  1NUB A;  4MBE A;  2ZND A;  3E3R A;  2EHB A;  2KI6 D;  3CGA A;  2WCF A;  1KK8 B;  3AAJ A;  4ORA B;  1UHN A;  2JZI A;  2MLF C;  2ZRT A;  1QS7 A;  2G9B A;  3LCP C;  1BR1 B;  4I5K A;  2LHI A;  1PSR A;  2JWW A;  1G8I A;  1FBV A;  2F3Y A;  3I5I C;  3BYA A;  3SG5 A;  2JTZ A;  4PE0 A;  5JOL A;  1SYM A;  4MEW A;  1DJZ A;  3PM8 A;  2LVI A;  2F3Z A;  2KAY A;  5KU1 A;  1XVJ A;  5K89 A;  1J1D A;  4N1G A;  2FOT A;  4YGA A;  2HET A;  1B7T Z;  1RJV A;  1X02 A;  1JF2 A;  1MUX A;  2FCE A;  1XFV O;  1MXE A;  1S1E A;  1F4Q A;  1YTZ C;  5I2L A;  3LK0 A;  3WXA A;  1RTP 1;  1CMF A;  2LAN A;  1PVB A;  2JUL A;  1CFC A;  2M29 A;  1TRF A;  2LUX A;  4OKH A;  5B8I B;  2KYC A;  1A4P A;  2KFF A;  2MRD A;  1A2X A;  1OOJ A;  4M2P A;  4PE4 A;  2CTN A;  1RK9 A;  5HKZ A;  2LE9 B;  1IWQ A;  2G2B A;  4GBA A;  2M8U A;  1AVS A;  1QLK A;  1M45 A;  2WCE A;  3CWG A;  4HRE E;  1H4B A;  1N65 A;  1SPY A;  1YVL A;  4HRG A;  4A4C A;  1FPW A;  4XJK A;  1ZFS A;  1IRJ A;  1TIZ A;  3OB2 B;  3GK4 X;  1YRT B;  1HQV A;  2Y1N A;  1RWY A;  2LVV A;  3MSE B;  3OP0 A;  4QJ5 B;  2JRF A;  2JTT A;  2L50 A;  4PDZ A;  1F70 A;  3BUM B;  3BUW B;  4WQ3 A;  3SJS A;  3I5G B;  3BOW B;  2CXJ A;  3JTD B;  1SRA A;  2JPT A;  2GGZ A;  2OTG C;  1NCX A;  1QTX A;  2K8M B;  1LKJ A;  2NCO A;  1GGW A;  1H8B A;  4MRY A;  5KSZ A;  2IS9 A;  1C7V A;  2MBX A;  2JC2 A;  2KNE A;  1IKU A;  3SG7 A;  2AUC A;  2M49 B;  3BUX B;  1KK7 Y;  3FWC A;  4USL A;  1UUR A;  2K7C A;  2COL B;  4BY4 A;  1IGV A;  4C0J A;  1B1G A;  1JWD A;  2K7D A;  2BCB A;  3CTN A;  5HYD A;  1ALV A;  1KQM B;  2F2O A;  2QAC A;  5FYX A;  1J55 A;  3TDI A;  1DGU A;  1S5G Y;  2WC8 A;  3RLZ A;  1D1O A;  1OQP A;  1VRK A;  3TUY B;  1EJ3 A;  1TCF A;  3VRQ A;  3H4S E;  2ZNE A;  2M0R A;  1IG5 A;  4I5L B;  1V1F A;  2MAZ A;  3D10 A;  3AAK A;  4CPV A;  5DKR A;  1IQ3 A;  2BCA A;  4L9M A;  1SW8 A;  2PVB A;  3I5F C;  4M2Q A;  4PHK A;  1EH2 A;  2M1U A;  1CLB A;  1DJW A;  2K2F A;  4AQJ A;  2V53 A;  3NSI A;  1CDP A;  2HPS A;  2LCP A;  1DJG A;  2LP2 A;  2PMY A;  3DVK A;  1PAL A;  3CZT X;  1YR5 A;  2A4J A;  1A75 A;  4FTG A;  3OB1 B;  1R6P A;  2D8N A;  3AKB A;  1LXF C;  2KQY A;  1OMD A;  4R1E A;  2JXL A;  3FS7 A;  3NSO A;  2K7O A;  2Q4U A;  5HLV A;  1BG1 A;  1YX8 A;  2PAS A;  1J7Q A;  1NIW A;  1JUO A;  1KSM A;  1N0Y A;  4JPZ B;  1J1E A;  2KAX A;  3EVU A;  1QIV A;  1TNW A;  2LC5 A;  1K8U A;  1EL4 A;  1A29 A;  1QVI Z;  1CLL A;  4ZCV A;  1V1G A;  2OS8 C;  3I5H B;  4BY5 A;  1WDC B;  4I5N B;  3PN7 B;  3GK1 A;  3VRR A;  1W7I B;  5CPV A;  2NCP A;  4QJ4 B;  4ICB A;  1CM4 A;  5I8N A;  1UP5 A;  4PHJ A;  1ALW A;  1QJT A;  1K96 A;  2MJW B;  3SIA A;  1QLS A;  1CFD A;  2LV7 A;  5BPJ A;  5GQQ C;  1QX5 B;  2PSR A;  2KQ6 A;  2P6B B;  1CFF A;  4MVF A;  3CS1 A;  4OR9 B;  5CSJ A;  1F55 A;  1TOP A;  1NX1 A;  2EC6 B;  1SBJ A;  2LNK A;  5J3X A;  3JTD C;  3AKA A;  1AJ4 A;  2I2R E;  1DJH A;  1U5I B;  2JT0 A;  2BKH B;  1XK4 C;  2MA2 A;  5PAL A;  1F4O A;  1OSA A;  2E6W A;  1DF0 B;  1M31 A;  2LHL A;  2LUC A;  2NZ0 A;  3LLE A;  1CTR A;  2BL0 C;  1B47 A;  1DJX A;  2LLS A;  1KFU S;  1SK6 D;  4ORB B;  1OE9 B;  4YGD B;  3D0Y B;  1KFX S;  2AAO A;  4GUK A;  4WQ2 A;  1JBA A;  3C1V A;  2LMU A;  1S36 A;  4MRX A;  3BQ3 A;  2KBM A;  2L2E A;  2ZKM X;  3SIB A;  1L2O C;  5ER5 A;  3DVE A;  1YUR A;  2O5G A;  1Q80 A;  2BCX A;  1S6J A;  2Q91 A;  3CR5 X;  2BE4 A;  3PAL A;  1C7W A;  1JFK A;  3DD4 A;  3WHU B;  1PUL A;  2F33 A;  1EXR A;  1SR6 B;  2B1U A;  2NLN A;  2WND A;  1B8C A;  1QXP A;  2CNP A;  3O78 A;  1B7T Y;  3BOW A;  2KHN A;  4F0Z B;  1NWD A;  1DJI A;  1WRL A;  2SCP A;  1NYA A;  1REC A;  3DVJ A;  1SY9 A;  1XK4 A;  4PE1 A;  1XO5 A;  2LLU A;  1MR8 A;  3NXA A;  3VGO A;  1BLQ A;  4A4B A;  4FQO A;  4YBH B;  1S26 D;  2KFG A;  3BXK A;  4N1F A;  1WLZ A;  2Y5I A;  2JNX A;  1K93 D;  4GNK B;  3O2P A;  1YUU A;  4OVN F;  1Y1X A;  4DUQ A;  1CNP A;  1QIW A;  1OZO A;  2ZN8 A;  3IQO A;  2LM5 A;  1IJ5 A;  1GJY A;  1YVH A;  1G4Y R;  1BR4 B;  3M0W A;  1XFU O;  5HKY A;  4DCK A;  1TTX A;  1F8H A;  2GV5 A;  1MHO A;  2KYF A;  2LVK A;  4CID A;  1K90 D;  1KK7 Z;  1TNQ A;  2VRG A;  1SL9 A;  1J7R A;  5TNC A;  1CDL A;  2F8P A;  4NDD A;  1S3P A;  3PAT A;  4PAL A;  5IBW A;  2QPT A;  3DVM A;  1KK8 C;  2KI4 B;  5AFP A;  2ZN9 A;  1SL8 A;  2M97 A;  4CFQ A;  1KWO B;  1CKK A;  5KTY A;  2SAS A;  3I5I B;  3PSR A;  1JFJ A;  4MZJ A;  1K94 A;  3EKJ A;  1KCY A;  3LL8 B;  2BE6 A;  3TS5 B;  1QV0 A;  2BBN A;  3QRX A;  4JQ0 D;  3NSK A;  4PE7 A;  1XFZ O;  4YGC B;  4QJ3 B;  1EG4 A;  4I5J A;  5CSN A;  1Y1A A;  2H61 A;  1CM1 A;  1TN4 A;  5F6T A;  1FW4 A;  1J7O A;  1JF0 A;  4N5X A;  2F2P A;  3IF7 A;  1NX3 A;  4MN0 A;  1OMR A;  2JU0 A;  1BJF A;  4AOM A;  1Y0V H;  2KAV A;  1DVI A;  4YI8 A;  1HT9 A;  1CDN A;  3KHE A;  1S6C A;  1B9A A;  2H2K A;  1XYD A;  2O60 A;  5D7F A;  1J7P A;  2NXQ A;  4Q04 A;  2K0J A;  4NDC A;  2K2A A;  1CLM A;  2WOS A;  3EK4 A;  1QAT A;  2OPO A;  1ZUZ A;  3JVT B;  1U5I A;  4GFT A;  4NQG A;  1C07 A;  1M46 A;  2M1K B;  1IJ6 A;  1AHR A;  1NCY A;  5AAN A;  2KGR A;  1NPQ A;  1GQM A;  1S6I A;  4C0K A;  2ZFD A;  3SG6 A;  5I2O A;  1DF0 A;  1ZAC A;  1NX0 A;  1G33 A;  4DIR A;  2LP3 A;  1Y1U A;  4ORC B;  3D0Y A;  2I94 A;  1QVI Y;  1BU3 A;  2LMT A;  3I5G C;  1TNX A;  1TNP A;  2OTG B;  4WRI A;  4TNC A;  1QAS A;  3BUN B;  3O4Y A;  2ZRS A;  2JQ6 A;  1BOD A;  1QV1 A;  2KBI A;  3SG3 A;  1XFX O;  2M9G A;  1IH0 A;  2DOQ A;  5HKW A;  4ETO A;  1B4C A;  1N2D A;  1K9P A;  1A03 A;  2CBL A;  1B8L A;  5HLO A;  3HX4 A;  4UPG A;  2RGI A;  1ZOT B;  1YRU B;  3FIA A;  3DF0 B;  1NX2 A;  1F54 A;  1KQM C;  2JOJ A;  3CR4 X;  1B8R A;  4YGB B;  2JT3 A;  4M2O A;  2M3W A;  1CFP A;  4OCI A;  3KEV A;  3VRP A;  1RFJ A;  2KI4 C;  3TUY C;  5ER4 X;  2M7N A;  3ZWH A;  1K95 A;  4MZL A;  1KWO C;  4MZK A;  4CLN A;  2LAP A;  1E8A A;  1DGV A;  3EVV A;  4HSZ A;  3TS5 C;  4E68 A;  3I5F B;  4U8D A;  1XA5 A;  2M7L A;  4XYN A;  2FJU B;  5CSF A;  1BOC A;  1ODB A;  1NCZ A;  1MQ1 A;  1TCO B;  4GPL B;  1UUS A;  1WLM A;  2JXC A;  4PHN A;  1AK8 A;  2I7A A;  1AP4 A;  2HF5 A;  2L51 A;  2L98 A;  4GGN A;  1DJY A;  4HRH A;  3SG4 A;  1DMO A;  2Y4Q A;  5AXI A;  3OHM B;  2KI6 C;  3CR2 A;  2HQ8 A;  3BUO B;  1SL7 A;  2L4I A;  3IQQ A;  4D1E A;  1LA0 A;  2R2I A;  2KOT A;  1UHI A;  3A4U B;  1DTL A;  3RM1 A;  2JNF A;  3VRO A;  1SCM B;  1EG3 A;  2L0P A;  3EKH A;  5D69 A;  1NP8 A;  2H61 C;  1KQV A;  2Y1M A;  2OS8 B;  1M39 A;  1UHH A;  4C0L A;  2HQW A;  3TDZ A;  4DRW A;  5G08 A;  3I5H C;  4MSP A;  1WDC C;  4P5O E;  2E30 A;  1K2H A;  1AJ5 A;  3JVT C;  2GGM A;  1WY9 A;  3PN7 C;  1OMV A;  3TDU A;  1PVA A;  3CLN A;  1UHJ A;  1FI6 A;  2BBM A;  4ZCU A;  2I18 A;  2AMI A;  2K61 A;  2K7B A;  3EK8 A;  4YGE B;  1YX7 A;  2LLT A;  4YI9 A;  3WNX B;  4NDB A;  2MHH A;  4JWQ A;  1SKT A;  1YUT A;  4CFR A;  1L7Z A;  1CMG A;  1ZMZ A;  5I2Q A;  3F45 A;  3KF9 A;  1PSB A;  1JSA A;  1XFY O;  1F71 A;  2JT8 A;  2EC6 C;  3PFV A;  1S5G Z;  1PRW A;  1R2U A;  1WRZ A;  2PAL A;  3A8R A;  3HCM A;  2CCM A;  3KPX A;  2ISD A;  4PHM A;  1FF1 A;  1W7J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...