2P70A

Bombyx mori pheromone binding protein bound to bell pepper odorant
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
132
structure length
132
Chain Sequence
SQEVMKNLSLNFGKALDECKKEMTLTDAINEDFYNFWKEGYEIKNRETGCAIMCLSTKLNMLDPEGNLHHGNAMEFAKKHGADETMAQQLIDIVHGCEKSTPANDDKCIWTLGVATCFKAEIHKLNWAPSMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Attractant
molecule keywords pheromone-binding protein
publication title Bombyx mori pheromone-binding protein binding nonpheromone ligands: implications for pheromone recognition.
pubmed doi rcsb
source organism Bombyx mori
total genus 51
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2007-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2p70A00
3L47A 3V2LA 1OOFA 2JPOA 2WC6A 2QEVA 2WCLA 3BFAA 2L2CA 1OOHA 3R1VA 3VB1A 2P70A 3N7HA 3QMEA 4INWA 3S0DA 1P28A 3FE6A 3CABA 2WCJA 3D73A 4F7FA 4OZDA 2WCMA 3BJHA 2WC5A 2P71A 3B87A 3B7AA 3Q8IA 1GM0A 2QDIA 2FJYA 3RZSA 1ORGA 1OOGA 5EL2A 3D75A 1C3YA 3DY9A 3DXLA 2QEBA 3DZTA 3L4AA 1OW4A 3CDNA 3FE9A 3L4LA 2WCHA 1C3ZA 3DYEA 3D74A 3B6XA 3CZ2A 3CZ0A 2KPHA 2GTEA 3FE8A 3OGNA 3BFHA 1TUJA 5DICA 4PT1A 3BFBA 4JD9A 3B88A 3K1EA 3B86A 1T14A 3PJIA 3NGVA 3D77A 1OOIX 3CZ1A 3D78A 4FQTA 3R1PA 2QEOA 3S0GA 3R72A 3NHIA 3S0AA 4INXA 1LS8A 2PQLA 3CYZA 3S0EA 1XFRA 1DQEA 2H8VA 3S0BA 1TWOA 2QEHA 3S0FA 2ERBA 3NHTA 3R1OA 1QWVA 2WCKA 3D76A
chains in the Genus database with same CATH superfamily
2O60A 5JJGA 5CPVA 4PDZA 1C7WA 1CM1A 1BU3A 1ZUZA 2JXCA 1KQMB 1QXPA 3FIAA 2LVIA 1SSEB 4TNCA 1Y6WA 2PALA 2WC6A 3I5GC 3FWCA 3SIAA 5HKYA 1QX7A 4MLWA 3CZTX 3GK2A 2K7CA 2PRUA 2QEVA 1A75A 2F2OA 3LL8B 1SW8A 2WCLA 4NQGA 1Y1AA 2F3ZA 1SK6D 1EXRA 1L2OC 1N65A 3IQOA 4JWQA 1A4PA 1OOHA 3WHTB 1FPWA 4U8DA 4WQ3A 1X02A 3S0DA 1CLBA 4CIDA 1C7VA 1ZMZA 1BODA 4XJKA 2Y4QA 1K9PA 3IF7A 3SS5A 1FI6A 2KI4B 1R2UA 4F7FA 2WC8A 1K93D 2OS8B 3TUYB 1GGWA 2JOJA 4PHMA 5AERA 3RLZA 1TNWA 2HPSA 2JNXA 2JC2A 2KAVA 1K96A 1IIOA 2I18A 3BUMB 3B87A 3PLFB 3I5HC 2M1UA 3OHMB 5B8IB 1F4QA 1XFWO 1V1GA 3OX6A 2HQ8A 1NIWA 2M3WA 1Y1XA 2OTGB 2LUCA 2PVBA 4YGCB 2LVJA 1KCYA 1SCMB 1J7QA 1Q80A 2KYCA 1OZOA 2LHLA 4CPVA 1SNLA 2M7NA 3SJSA 1QJTA 1BMOA 1S3PA 3DXLA 1QIWA 3L4AA 2ISDA 3CDNA 5I2QA 1AP4A 2JXLA 2WCHA 2HF5A 1NX0A 3AAKA 5FI6A 4YI8A 1XO5A 3OGNA 1SY9A 1IG5A 3BFHA 1YUTA 1TN4A 1SRAA 1JWDA 1BG1A 1F54A 3BFBA 4N1FA 1DTLA 1QVIZ 2K7DA 4QJ3B 3K1EA 3B86A 2M7LA 4DUQA 1NP8A 3PJIA 1AUIB 1G8IA 2O5GA 2CT9A 1OOIX 1YVLA 3CZ1A 3D78A 4I5KA 3SG7A 1JFJA 1UHJA 1NUBA 1HT9A 2QEOA 3I5IC 3DVKA 5FI7A 2JWWA 4BY4A 1YRUB 1LS8A 1XFYO 3KHEA 5ER5A 3JTDC 4ZCUA 5KU1A 2LLSA 3TS5B 1CFFA 1F70A 2LM5A 1SR6C 2JT0A 2L2EA 1JC2A 1F55A 1NCZA 1OMVA 3D0YA 1IJ5A 1U5IA 2COLB 3CYZA 2E6WA 3OX5A 1NSHA 5JOLA 2LE9B 3EKJA 1AK8A 1L7ZA 4WRIA 1WDCC 2BL0B 1DQEA 3BQ3A 5PALA 3S0BA 1CLMA 3ZNIA 1TWOA 2QEHA 1WRZA 3S0FA 4GBAA 1TTXA 1KWOB 5CSFA 3CGAA 2LP3A 2P6BB 2IS9A 4WQ2A 5TNCA 1KQMC 3GOFA 3HCMA 2BCBA 1CFDA 2QACA 3A4UB 3KPXA 2KHNA 3NXAA 1FI5A 1MF8B 2BCXA 1YUUA 1B9AA 3FS7A 2CBLA 3PFVA 1J1DA 2NCOA 5DKNA 1KQVA 1LINA 1MUXA 1ZOTB 1B7TZ 2MA2A 4ORCB 4PHJA 1K90D 2BKHB 3EG5B 1NX1A 5D69A 4OKHA 1UP5A 1DMOA 2JZIA 2M97A 3DF0A 1LXFC 2K7BA 2K2FA 4PHKA 3BFAA 3SG4A 1RK9A 3LCPC 1MXLC 5DKQA 1NPQA 1MHOA 3R1VA 1OE9B 2KI4C 2PASA 1JBAA 2I2RE 3RM1A 4OCIA 2OS8C 1PRWA 2R2IA 1BJFA 1DVIA 3BXKA 3KEVA 3N7HA 4FTGA 1G33A 1Y0VH 3VRPA 2LLUA 2F2PA 3O2PA 2BAPA 2KDHA 1M31A 1SL7A 1VRKA 1DGUA 1A29A 1DJXA 1RJVA 2BNXA 1R6PA 2I94A 4HRGA 3BUXB 2M1KB 2OTGC 1KSOA 2L50A 1NX2A 3EVVA 3NSIA 1YTZC 1NYAA 2EHBA 1Y1UA 4PE0A 1CDLA 1KFUS 4YGAA 1KK8C 1DC1A 1KSMA 1WRKA 2CXJA 2QDIA 3RZSA 1NWDA 5CSIA 2ZNDA 1IQ3A 1MQ1A 3UO9A 2L5XB 2KOTA 2DOQA 4HSZA 4CFRA 2BCAA 3DVMA 3EK4A 4ORBB 2KSPA 3SS3A 3CR4X 1C3YA 2M29A 4YGDB 4ORAB 1W9ZA 2L98A 1QATA 1TCFA 2F3YA 3WNXB 1K94A 2QEBA 5G08A 2BBMA 3DZTA 3FE9A 1EG3A 4M2OA 3D74A 1OOJA 1J1EA 4YRUA 3BUOB 3CZ2A 1BR4B 1KK7Z 2KQ6A 1B4CA 1DF0B 3C1VA 2PMYA 1S1EA 4UPGA 1OZSA 4L9MA 3I5FB 4JPZB 2LMTA 1CLLA 2AMIA 2GGMA 3CR5X 2LCPA 1YURA 4N5XA 2L4IA 4PE1A 4PT1A 1BF5A 2LNKA 3SG5A 2NZ0A 3TS5C 3GK4X 3D77A 1Z4HA 4Q04A 5DKRA 3EKHA 2CCMA 1IRJA 2AAOA 3PN7B 3MSEB 4OVNF 3R72A 1NX3A 1XA5A 3E3RA 4INXA 3S0AA 1ZACA 2LHIA 1OQPA 2LLTA 2PQLA 1M39A 4NDDA 2KBMA 3BYAA 1J7RA 1PSBA 1KWOC 1YX7A 1DJZA 2G9BA 4DRWA 1FF1A 4C0JA 1PULA 1SBJA 3K21A 2H8VA 1KK7Y 4MEWA 1W7JB 1A03A 2VRGA 3NHTA 3R1OA 1A2XA 3DVJA 1PSRA 4E68A 2Y5IA 2KNEA 4AQJA 5AFPA 1TNQA 4ZCVA 4MSPA 3F45A 1EJ3A 1WRLA 4JQ0D 3CWGA 1M63B 1PK0D 1GJYA 3JVTB 1BLQA 1JUOA 2BBNA 3EK7A 1A75B 3AAJA 3UNWA 2JTZA 1DJHA 2YGUA 2EC6B 1Z2CB 2JPTA 4GUKA 1S6CA 2I7AA 1K2HA 2MRDA 2BE4A 3CR2A 1G4YR 2JPOA 1D1OA 1CMFA 3TDIA 3VRNA 4A4BA 1S26D 3ZWHA 1QTXA 1EL4A 1XYDA 3VRQA 2LVVA 1QX5B 2OPOA 1AHRA 1E8AA 2KYFA 2L2CA 3LK0A 4MZLA 4C0KA 4HREE 2BKIB 1S6JA 3PN7C 4MZKA 2FOTA 2JU0A 3VB1A 1YRTB 1UHKA 1GGZA 1QVIY 2KBIA 1JF0A 3PM8A 4INWA 4IJ7A 1CM4A 1P28A 2QPTA 1S6IA 1QLSA 4ETOA 4R1EA 3CABA 2MLFC 2Q91A 1IH0A 3D73A 2M8UA 2PYQA 4OZDA 1PVBA 2H2KA 2WCMA 4DCKA 1CMGA 1DJGA 2KQYA 3TZ1A 1CDPA 1WLZA 1WY9A 5J3XA 1ODBA 2WC5A 2P71A 3NSLA 1KFXL 2L51A 4HRHA 1MWNA 3B7AA 1F8HA 5GQQC 3VRRA 1IGVA 3EVUA 2FJYA 1W7IB 5D7FA 1ORGA 1SL9A 2K61A 2ZN8A 1OSAA 2KAXA 5AEQA 5D3OA 2LMUA 1OOGA 1RECA 2MBXA 1DF0A 1AJ4A 2ZN9A 4C0LA 1UUSA 2ZRSA 2D8NA 1F71A 1JF2A 3TDZA 1IQ5A 2LAPA 1NCYA 5F6TA 2K8MB 1DJYA 2L0PA 1XFZO 2CNPA 2KFHA 1TRFA 3L4LA 3I5FC 3PATA 4QJ5B 1XVJA 3CS1A 1TIZA 3B6XA 5IBWA 1SKTA 1B7TY 1PVAA 2KLEA 3H4SE 2LANA 1LVCD 2BECA 3CZ0A 3JTDB 1TOPA 3FE8A 4M2PA 4YGBB 5HLVA 5HL1A 1SCMC 2Y1MA 1B1GA 4MN0A 1UHHA 1DELA 4PHNA 5DICA 2HETA 4I5NB 2JT8A 3B88A 4JD9A 1K8UA 1YUSA 1V1FA 1H8BA 2K2AA 4BY5A 5K89A 3D0YB 4MRXA 1U5IB 3NGVA 1N2DA 3BOWB 4FQTA 1FW4A 2ZKMX 2LVKA 4I5JA 4AQIA 1RTP1 4QJ4B 1K9KA 2JTTA 3NHIA 2KAYA 5I2LA 1EG4A 4MBEA 2FCEA 4XYNA 2LV7A 3SG3A 1AJ5A 1QV0A 2JT3A 4ICBA 1FBVA 2CTNA 5HKZA 4CLNA 3S0EA 1OMRA 2ZNEA 1ALVA 3OB2B 4GFTA 2EGDA 1MR8A 1CFPA 2MJWB 3NSKA 4GAOA 4JKTA 1SL8A 1DEKA 2ERBA 3AKBA 3JVTC 4NDCA 3KF9A 3TDUA 3PSRA 1BOCA 1B8CA 3SG6A 1CB1A 2EC6C 3DVEA 2LP2A 2JRFA 2KGBC 2WCKA 5I2OA 2WOSA 2MHHA 1J55A 3O78A 4PE7A 2M9GA 4MZJA 1CTRA 1M46A 3D76A 3PALA 3DF0B 2WNDA 3L47A 1IWQA 3V2LA 4KYNA 3BUWB 1OOFA 4M2QA 2BL0C 2Q4UA 3NSOA 3O4YA 1CFCA 2BE6A 4D1EA 4YBHB 3A8RA 2ZFDA 2WORA 1CDMA 1QS7A 4GGFA 2WCBA 3VROA 4DS7A 2F33A 1J7OA 1K9UA 3SIBA 1QV1A 2GGZA 4GGFC 2KI6C 3BUNB 1B47A 3I5GB 1MXEA 2SCPA 3KO0A 3OB1B 2G2BA 2GV5A 4NDBA 2P70A 3QMEA 5BPJA 4I5LB 5HYDA 1ALWA 1IJ6A 1KK8B 1S5GZ 1AVSA 4USLA 4AOMA 1L2OB 2WCEA 1TCOB 1YVHA 1RFJA 3FE6A 1QX2A 3OBVA 2FCDA 4YGEB 2WCJA 1WLMA 2L4HA 1XFUO 1DT7B 3O6BA 1BR1B 3LLEA 3BJHA 1DGVA 3TUYC 1RROA 4PALA 2K60A 1YR5A 2HQWA 5I8NA 3CTNA 4XJKB 2ZRTA 2K7OA 4DIRA 1ZFSA 3Q8IA 3D10A 2KI6D 3WHUB 1GM0A 1JFKA 3IVTA 2K0JA 3WXAA 3CLNA 1J7PA 1SMGA 3ICBA 1GQMA 1NCXA 1TNPA 1EH2A 1C07A 2FJUB 2LUXA 2WCFA 3O4XA 1SYMA 5EL2A 3DD4A 2MAZA 1S36A 3I5HB 4OV2A 3D75A 4PE4A 5HLOA 1B8RA 1SPYA 1TUZA 2KGRA 1LA3A 2JNFA 1LKJA 1S5GY 3DY9A 3LK1A 1CKKA 5HKWA 3EVRA 1CDNA 2LMVA 3M0WA 1OW4A 2L5YA 4P5OE 1HQVA 2KFFA 4PCWA 1C3ZA 1BT6A 3DYEA 1UHIA 5AXIA 3BOWA 1QLKA 2V53A 1DJWA 2KPHA 2RGIA 3SS4A 1K95A 2GTEA 2PSRA 1RWYA 1M45A 4GNKB 4MVFA 3OP0A 1LA0A 2JULA 4OR9B 1TUJA 5KTYA 1H4BA 5KSZA 2NCPA 1UWOA 2Y1NA 2TN4A 3AKAA 1F4OA 5FI2A 1T14A 2M0RA 3GK1A 1UHNA 4IL1A 1XFVO 1DJIA 3SG2A 5AANA 2M49B 2SASA 4YI9A 3R1PA 4F0ZB 2F8PA 2JQ6A 1PALA 3S0GA 1TNXA 3PM2A 2MLEC 3FWBA 4P2YB 5FYXA 1SCVA 2A4JA 3IQQA 3EK8A 3I5IB 3VGOA 5CSJA 2B1UA 4MRYA 4GGNA 1KFUL 1YX8A 1XFRA 2KLDA 2H61A 4N1GA 5ER4X 4A4CA 1XK4A 1JSAA 2AUCA 4GPLB 1QASA 1SR6B 3HX4A 1N0YA 1XFXO 2NLNA 2LC5A 5CSNA 2H61C 1KFXS 1QWVA 1XK4C 2E30A 1B8LA 2KFGA 4FQOA 1IKUA 1WDCB 1CNPA 5I94A 1UURA 4CFQA 1OMDA 2NXQA 3QRXA 1QIVA
chains in the Genus database with same CATH topology
3L47A 3V2LA 1OOFA 2JPOA 2WC6A 2QEVA 2WCLA 3BFAA 2L2CA 1OOHA 3R1VA 3VB1A 2P70A 3N7HA 3QMEA 4INWA 3S0DA 1P28A 3FE6A 3CABA 2WCJA 3D73A 4F7FA 4OZDA 2WCMA 3BJHA 2WC5A 2P71A 3B87A 3B7AA 3Q8IA 1GM0A 2QDIA 2FJYA 3RZSA 1ORGA 1OOGA 5EL2A 3D75A 1C3YA 3DY9A 3DXLA 2QEBA 3DZTA 3L4AA 1OW4A 3CDNA 3FE9A 3L4LA 2WCHA 1C3ZA 3DYEA 3D74A 3B6XA 3CZ2A 3CZ0A 2KPHA 2GTEA 3FE8A 3OGNA 3BFHA 1TUJA 5DICA 4PT1A 3BFBA 4JD9A 3B88A 3K1EA 3B86A 1T14A 3PJIA 3NGVA 3D77A 1OOIX 3CZ1A 3D78A 4FQTA 3R1PA 2QEOA 3S0GA 3R72A 3NHIA 3S0AA 4INXA 1LS8A 2PQLA 3CYZA 3S0EA 1XFRA 1DQEA 2H8VA 3S0BA 1TWOA 2QEHA 3S0FA 2ERBA 3NHTA 3R1OA 1QWVA 2WCKA 3D76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L47 A;  3V2L A;  1OOF A;  2JPO A;  2WC6 A;  2QEV A;  2WCL A;  3BFA A;  2L2C A;  1OOH A;  3R1V A;  3VB1 A;  2P70 A;  3N7H A;  3QME A;  4INW A;  3S0D A;  1P28 A;  3FE6 A;  3CAB A;  2WCJ A;  3D73 A;  4F7F A;  4OZD A;  2WCM A;  3BJH A;  2WC5 A;  2P71 A;  3B87 A;  3B7A A;  3Q8I A;  1GM0 A;  2QDI A;  2FJY A;  3RZS A;  1ORG A;  1OOG A;  5EL2 A;  3D75 A;  1C3Y A;  3DY9 A;  3DXL A;  2QEB A;  3DZT A;  3L4A A;  1OW4 A;  3CDN A;  3FE9 A;  3L4L A;  2WCH A;  1C3Z A;  3DYE A;  3D74 A;  3B6X A;  3CZ2 A;  3CZ0 A;  2KPH A;  2GTE A;  3FE8 A;  3OGN A;  3BFH A;  1TUJ A;  5DIC A;  4PT1 A;  3BFB A;  4JD9 A;  3B88 A;  3K1E A;  3B86 A;  1T14 A;  3PJI A;  3NGV A;  3D77 A;  1OOI X;  3CZ1 A;  3D78 A;  4FQT A;  3R1P A;  2QEO A;  3S0G A;  3R72 A;  3NHI A;  3S0A A;  4INX A;  1LS8 A;  2PQL A;  3CYZ A;  3S0E A;  1XFR A;  1DQE A;  2H8V A;  3S0B A;  1TWO A;  2QEH A;  3S0F A;  2ERB A;  3NHT A;  3R1O A;  1QWV A;  2WCK A;  3D76 A; 
#chains in the Genus database with same CATH topology
 2O60 A;  5JJG A;  5CPV A;  4PDZ A;  1C7W A;  1CM1 A;  1BU3 A;  1ZUZ A;  2JXC A;  1KQM B;  1QXP A;  3FIA A;  2LVI A;  1SSE B;  4TNC A;  1Y6W A;  2PAL A;  2WC6 A;  3I5G C;  3FWC A;  3SIA A;  5HKY A;  1QX7 A;  4MLW A;  3CZT X;  3GK2 A;  2K7C A;  2PRU A;  2QEV A;  1A75 A;  2F2O A;  3LL8 B;  1SW8 A;  2WCL A;  4NQG A;  1Y1A A;  2F3Z A;  1SK6 D;  1EXR A;  1L2O C;  1N65 A;  3IQO A;  4JWQ A;  1A4P A;  1OOH A;  3WHT B;  1FPW A;  4U8D A;  4WQ3 A;  1X02 A;  3S0D A;  1CLB A;  4CID A;  1C7V A;  1ZMZ A;  1BOD A;  4XJK A;  2Y4Q A;  1K9P A;  3IF7 A;  3SS5 A;  1FI6 A;  2KI4 B;  1R2U A;  4F7F A;  2WC8 A;  1K93 D;  2OS8 B;  3TUY B;  1GGW A;  2JOJ A;  4PHM A;  5AER A;  3RLZ A;  1TNW A;  2HPS A;  2JNX A;  2JC2 A;  2KAV A;  1K96 A;  1IIO A;  2I18 A;  3BUM B;  3B87 A;  3PLF B;  3I5H C;  2M1U A;  3OHM B;  5B8I B;  1F4Q A;  1XFW O;  1V1G A;  3OX6 A;  2HQ8 A;  1NIW A;  2M3W A;  1Y1X A;  2OTG B;  2LUC A;  2PVB A;  4YGC B;  2LVJ A;  1KCY A;  1SCM B;  1J7Q A;  1Q80 A;  2KYC A;  1OZO A;  2LHL A;  4CPV A;  1SNL A;  2M7N A;  3SJS A;  1QJT A;  1BMO A;  1S3P A;  3DXL A;  1QIW A;  3L4A A;  2ISD A;  3CDN A;  5I2Q A;  1AP4 A;  2JXL A;  2WCH A;  2HF5 A;  1NX0 A;  3AAK A;  5FI6 A;  4YI8 A;  1XO5 A;  3OGN A;  1SY9 A;  1IG5 A;  3BFH A;  1YUT A;  1TN4 A;  1SRA A;  1JWD A;  1BG1 A;  1F54 A;  3BFB A;  4N1F A;  1DTL A;  1QVI Z;  2K7D A;  4QJ3 B;  3K1E A;  3B86 A;  2M7L A;  4DUQ A;  1NP8 A;  3PJI A;  1AUI B;  1G8I A;  2O5G A;  2CT9 A;  1OOI X;  1YVL A;  3CZ1 A;  3D78 A;  4I5K A;  3SG7 A;  1JFJ A;  1UHJ A;  1NUB A;  1HT9 A;  2QEO A;  3I5I C;  3DVK A;  5FI7 A;  2JWW A;  4BY4 A;  1YRU B;  1LS8 A;  1XFY O;  3KHE A;  5ER5 A;  3JTD C;  4ZCU A;  5KU1 A;  2LLS A;  3TS5 B;  1CFF A;  1F70 A;  2LM5 A;  1SR6 C;  2JT0 A;  2L2E A;  1JC2 A;  1F55 A;  1NCZ A;  1OMV A;  3D0Y A;  1IJ5 A;  1U5I A;  2COL B;  3CYZ A;  2E6W A;  3OX5 A;  1NSH A;  5JOL A;  2LE9 B;  3EKJ A;  1AK8 A;  1L7Z A;  4WRI A;  1WDC C;  2BL0 B;  1DQE A;  3BQ3 A;  5PAL A;  3S0B A;  1CLM A;  3ZNI A;  1TWO A;  2QEH A;  1WRZ A;  3S0F A;  4GBA A;  1TTX A;  1KWO B;  5CSF A;  3CGA A;  2LP3 A;  2P6B B;  2IS9 A;  4WQ2 A;  5TNC A;  1KQM C;  3GOF A;  3HCM A;  2BCB A;  1CFD A;  2QAC A;  3A4U B;  3KPX A;  2KHN A;  3NXA A;  1FI5 A;  1MF8 B;  2BCX A;  1YUU A;  1B9A A;  3FS7 A;  2CBL A;  3PFV A;  1J1D A;  2NCO A;  5DKN A;  1KQV A;  1LIN A;  1MUX A;  1ZOT B;  1B7T Z;  2MA2 A;  4ORC B;  4PHJ A;  1K90 D;  2BKH B;  3EG5 B;  1NX1 A;  5D69 A;  4OKH A;  1UP5 A;  1DMO A;  2JZI A;  2M97 A;  3DF0 A;  1LXF C;  2K7B A;  2K2F A;  4PHK A;  3BFA A;  3SG4 A;  1RK9 A;  3LCP C;  1MXL C;  5DKQ A;  1NPQ A;  1MHO A;  3R1V A;  1OE9 B;  2KI4 C;  2PAS A;  1JBA A;  2I2R E;  3RM1 A;  4OCI A;  2OS8 C;  1PRW A;  2R2I A;  1BJF A;  1DVI A;  3BXK A;  3KEV A;  3N7H A;  4FTG A;  1G33 A;  1Y0V H;  3VRP A;  2LLU A;  2F2P A;  3O2P A;  2BAP A;  2KDH A;  1M31 A;  1SL7 A;  1VRK A;  1DGU A;  1A29 A;  1DJX A;  1RJV A;  2BNX A;  1R6P A;  2I94 A;  4HRG A;  3BUX B;  2M1K B;  2OTG C;  1KSO A;  2L50 A;  1NX2 A;  3EVV A;  3NSI A;  1YTZ C;  1NYA A;  2EHB A;  1Y1U A;  4PE0 A;  1CDL A;  1KFU S;  4YGA A;  1KK8 C;  1DC1 A;  1KSM A;  1WRK A;  2CXJ A;  2QDI A;  3RZS A;  1NWD A;  5CSI A;  2ZND A;  1IQ3 A;  1MQ1 A;  3UO9 A;  2L5X B;  2KOT A;  2DOQ A;  4HSZ A;  4CFR A;  2BCA A;  3DVM A;  3EK4 A;  4ORB B;  2KSP A;  3SS3 A;  3CR4 X;  1C3Y A;  2M29 A;  4YGD B;  4ORA B;  1W9Z A;  2L98 A;  1QAT A;  1TCF A;  2F3Y A;  3WNX B;  1K94 A;  2QEB A;  5G08 A;  2BBM A;  3DZT A;  3FE9 A;  1EG3 A;  4M2O A;  3D74 A;  1OOJ A;  1J1E A;  4YRU A;  3BUO B;  3CZ2 A;  1BR4 B;  1KK7 Z;  2KQ6 A;  1B4C A;  1DF0 B;  3C1V A;  2PMY A;  1S1E A;  4UPG A;  1OZS A;  4L9M A;  3I5F B;  4JPZ B;  2LMT A;  1CLL A;  2AMI A;  2GGM A;  3CR5 X;  2LCP A;  1YUR A;  4N5X A;  2L4I A;  4PE1 A;  4PT1 A;  1BF5 A;  2LNK A;  3SG5 A;  2NZ0 A;  3TS5 C;  3GK4 X;  3D77 A;  1Z4H A;  4Q04 A;  5DKR A;  3EKH A;  2CCM A;  1IRJ A;  2AAO A;  3PN7 B;  3MSE B;  4OVN F;  3R72 A;  1NX3 A;  1XA5 A;  3E3R A;  4INX A;  3S0A A;  1ZAC A;  2LHI A;  1OQP A;  2LLT A;  2PQL A;  1M39 A;  4NDD A;  2KBM A;  3BYA A;  1J7R A;  1PSB A;  1KWO C;  1YX7 A;  1DJZ A;  2G9B A;  4DRW A;  1FF1 A;  4C0J A;  1PUL A;  1SBJ A;  3K21 A;  2H8V A;  1KK7 Y;  4MEW A;  1W7J B;  1A03 A;  2VRG A;  3NHT A;  3R1O A;  1A2X A;  3DVJ A;  1PSR A;  4E68 A;  2Y5I A;  2KNE A;  4AQJ A;  5AFP A;  1TNQ A;  4ZCV A;  4MSP A;  3F45 A;  1EJ3 A;  1WRL A;  4JQ0 D;  3CWG A;  1M63 B;  1PK0 D;  1GJY A;  3JVT B;  1BLQ A;  1JUO A;  2BBN A;  3EK7 A;  1A75 B;  3AAJ A;  3UNW A;  2JTZ A;  1DJH A;  2YGU A;  2EC6 B;  1Z2C B;  2JPT A;  4GUK A;  1S6C A;  2I7A A;  1K2H A;  2MRD A;  2BE4 A;  3CR2 A;  1G4Y R;  2JPO A;  1D1O A;  1CMF A;  3TDI A;  3VRN A;  4A4B A;  1S26 D;  3ZWH A;  1QTX A;  1EL4 A;  1XYD A;  3VRQ A;  2LVV A;  1QX5 B;  2OPO A;  1AHR A;  1E8A A;  2KYF A;  2L2C A;  3LK0 A;  4MZL A;  4C0K A;  4HRE E;  2BKI B;  1S6J A;  3PN7 C;  4MZK A;  2FOT A;  2JU0 A;  3VB1 A;  1YRT B;  1UHK A;  1GGZ A;  1QVI Y;  2KBI A;  1JF0 A;  3PM8 A;  4INW A;  4IJ7 A;  1CM4 A;  1P28 A;  2QPT A;  1S6I A;  1QLS A;  4ETO A;  4R1E A;  3CAB A;  2MLF C;  2Q91 A;  1IH0 A;  3D73 A;  2M8U A;  2PYQ A;  4OZD A;  1PVB A;  2H2K A;  2WCM A;  4DCK A;  1CMG A;  1DJG A;  2KQY A;  3TZ1 A;  1CDP A;  1WLZ A;  1WY9 A;  5J3X A;  1ODB A;  2WC5 A;  2P71 A;  3NSL A;  1KFX L;  2L51 A;  4HRH A;  1MWN A;  3B7A A;  1F8H A;  5GQQ C;  3VRR A;  1IGV A;  3EVU A;  2FJY A;  1W7I B;  5D7F A;  1ORG A;  1SL9 A;  2K61 A;  2ZN8 A;  1OSA A;  2KAX A;  5AEQ A;  5D3O A;  2LMU A;  1OOG A;  1REC A;  2MBX A;  1DF0 A;  1AJ4 A;  2ZN9 A;  4C0L A;  1UUS A;  2ZRS A;  2D8N A;  1F71 A;  1JF2 A;  3TDZ A;  1IQ5 A;  2LAP A;  1NCY A;  5F6T A;  2K8M B;  1DJY A;  2L0P A;  1XFZ O;  2CNP A;  2KFH A;  1TRF A;  3L4L A;  3I5F C;  3PAT A;  4QJ5 B;  1XVJ A;  3CS1 A;  1TIZ A;  3B6X A;  5IBW A;  1SKT A;  1B7T Y;  1PVA A;  2KLE A;  3H4S E;  2LAN A;  1LVC D;  2BEC A;  3CZ0 A;  3JTD B;  1TOP A;  3FE8 A;  4M2P A;  4YGB B;  5HLV A;  5HL1 A;  1SCM C;  2Y1M A;  1B1G A;  4MN0 A;  1UHH A;  1DEL A;  4PHN A;  5DIC A;  2HET A;  4I5N B;  2JT8 A;  3B88 A;  4JD9 A;  1K8U A;  1YUS A;  1V1F A;  1H8B A;  2K2A A;  4BY5 A;  5K89 A;  3D0Y B;  4MRX A;  1U5I B;  3NGV A;  1N2D A;  3BOW B;  4FQT A;  1FW4 A;  2ZKM X;  2LVK A;  4I5J A;  4AQI A;  1RTP 1;  4QJ4 B;  1K9K A;  2JTT A;  3NHI A;  2KAY A;  5I2L A;  1EG4 A;  4MBE A;  2FCE A;  4XYN A;  2LV7 A;  3SG3 A;  1AJ5 A;  1QV0 A;  2JT3 A;  4ICB A;  1FBV A;  2CTN A;  5HKZ A;  4CLN A;  3S0E A;  1OMR A;  2ZNE A;  1ALV A;  3OB2 B;  4GFT A;  2EGD A;  1MR8 A;  1CFP A;  2MJW B;  3NSK A;  4GAO A;  4JKT A;  1SL8 A;  1DEK A;  2ERB A;  3AKB A;  3JVT C;  4NDC A;  3KF9 A;  3TDU A;  3PSR A;  1BOC A;  1B8C A;  3SG6 A;  1CB1 A;  2EC6 C;  3DVE A;  2LP2 A;  2JRF A;  2KGB C;  2WCK A;  5I2O A;  2WOS A;  2MHH A;  1J55 A;  3O78 A;  4PE7 A;  2M9G A;  4MZJ A;  1CTR A;  1M46 A;  3D76 A;  3PAL A;  3DF0 B;  2WND A;  3L47 A;  1IWQ A;  3V2L A;  4KYN A;  3BUW B;  1OOF A;  4M2Q A;  2BL0 C;  2Q4U A;  3NSO A;  3O4Y A;  1CFC A;  2BE6 A;  4D1E A;  4YBH B;  3A8R A;  2ZFD A;  2WOR A;  1CDM A;  1QS7 A;  4GGF A;  2WCB A;  3VRO A;  4DS7 A;  2F33 A;  1J7O A;  1K9U A;  3SIB A;  1QV1 A;  2GGZ A;  4GGF C;  2KI6 C;  3BUN B;  1B47 A;  3I5G B;  1MXE A;  2SCP A;  3KO0 A;  3OB1 B;  2G2B A;  2GV5 A;  4NDB A;  2P70 A;  3QME A;  5BPJ A;  4I5L B;  5HYD A;  1ALW A;  1IJ6 A;  1KK8 B;  1S5G Z;  1AVS A;  4USL A;  4AOM A;  1L2O B;  2WCE A;  1TCO B;  1YVH A;  1RFJ A;  3FE6 A;  1QX2 A;  3OBV A;  2FCD A;  4YGE B;  2WCJ A;  1WLM A;  2L4H A;  1XFU O;  1DT7 B;  3O6B A;  1BR1 B;  3LLE A;  3BJH A;  1DGV A;  3TUY C;  1RRO A;  4PAL A;  2K60 A;  1YR5 A;  2HQW A;  5I8N A;  3CTN A;  4XJK B;  2ZRT A;  2K7O A;  4DIR A;  1ZFS A;  3Q8I A;  3D10 A;  2KI6 D;  3WHU B;  1GM0 A;  1JFK A;  3IVT A;  2K0J A;  3WXA A;  3CLN A;  1J7P A;  1SMG A;  3ICB A;  1GQM A;  1NCX A;  1TNP A;  1EH2 A;  1C07 A;  2FJU B;  2LUX A;  2WCF A;  3O4X A;  1SYM A;  5EL2 A;  3DD4 A;  2MAZ A;  1S36 A;  3I5H B;  4OV2 A;  3D75 A;  4PE4 A;  5HLO A;  1B8R A;  1SPY A;  1TUZ A;  2KGR A;  1LA3 A;  2JNF A;  1LKJ A;  1S5G Y;  3DY9 A;  3LK1 A;  1CKK A;  5HKW A;  3EVR A;  1CDN A;  2LMV A;  3M0W A;  1OW4 A;  2L5Y A;  4P5O E;  1HQV A;  2KFF A;  4PCW A;  1C3Z A;  1BT6 A;  3DYE A;  1UHI A;  5AXI A;  3BOW A;  1QLK A;  2V53 A;  1DJW A;  2KPH A;  2RGI A;  3SS4 A;  1K95 A;  2GTE A;  2PSR A;  1RWY A;  1M45 A;  4GNK B;  4MVF A;  3OP0 A;  1LA0 A;  2JUL A;  4OR9 B;  1TUJ A;  5KTY A;  1H4B A;  5KSZ A;  2NCP A;  1UWO A;  2Y1N A;  2TN4 A;  3AKA A;  1F4O A;  5FI2 A;  1T14 A;  2M0R A;  3GK1 A;  1UHN A;  4IL1 A;  1XFV O;  1DJI A;  3SG2 A;  5AAN A;  2M49 B;  2SAS A;  4YI9 A;  3R1P A;  4F0Z B;  2F8P A;  2JQ6 A;  1PAL A;  3S0G A;  1TNX A;  3PM2 A;  2MLE C;  3FWB A;  4P2Y B;  5FYX A;  1SCV A;  2A4J A;  3IQQ A;  3EK8 A;  3I5I B;  3VGO A;  5CSJ A;  2B1U A;  4MRY A;  4GGN A;  1KFU L;  1YX8 A;  1XFR A;  2KLD A;  2H61 A;  4N1G A;  5ER4 X;  4A4C A;  1XK4 A;  1JSA A;  2AUC A;  4GPL B;  1QAS A;  1SR6 B;  3HX4 A;  1N0Y A;  1XFX O;  2NLN A;  2LC5 A;  5CSN A;  2H61 C;  1KFX S;  1QWV A;  1XK4 C;  2E30 A;  1B8L A;  2KFG A;  4FQO A;  1IKU A;  1WDC B;  1CNP A;  5I94 A;  1UUR A;  4CFQ A;  1OMD A;  2NXQ A;  3QRX A;  1QIV A; 
#chains in the Genus database with same CATH homology
 3L47 A;  3V2L A;  1OOF A;  2JPO A;  2WC6 A;  2QEV A;  2WCL A;  3BFA A;  2L2C A;  1OOH A;  3R1V A;  3VB1 A;  2P70 A;  3N7H A;  3QME A;  4INW A;  3S0D A;  1P28 A;  3FE6 A;  3CAB A;  2WCJ A;  3D73 A;  4F7F A;  4OZD A;  2WCM A;  3BJH A;  2WC5 A;  2P71 A;  3B87 A;  3B7A A;  3Q8I A;  1GM0 A;  2QDI A;  2FJY A;  3RZS A;  1ORG A;  1OOG A;  5EL2 A;  3D75 A;  1C3Y A;  3DY9 A;  3DXL A;  2QEB A;  3DZT A;  3L4A A;  1OW4 A;  3CDN A;  3FE9 A;  3L4L A;  2WCH A;  1C3Z A;  3DYE A;  3D74 A;  3B6X A;  3CZ2 A;  3CZ0 A;  2KPH A;  2GTE A;  3FE8 A;  3OGN A;  3BFH A;  1TUJ A;  5DIC A;  4PT1 A;  3BFB A;  4JD9 A;  3B88 A;  3K1E A;  3B86 A;  1T14 A;  3PJI A;  3NGV A;  3D77 A;  1OOI X;  3CZ1 A;  3D78 A;  4FQT A;  3R1P A;  2QEO A;  3S0G A;  3R72 A;  3NHI A;  3S0A A;  4INX A;  1LS8 A;  2PQL A;  3CYZ A;  3S0E A;  1XFR A;  1DQE A;  2H8V A;  3S0B A;  1TWO A;  2QEH A;  3S0F A;  2ERB A;  3NHT A;  3R1O A;  1QWV A;  2WCK A;  3D76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...