2P70A

Bombyx mori pheromone binding protein bound to bell pepper odorant
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
132
structure length
132
Chain Sequence
SQEVMKNLSLNFGKALDECKKEMTLTDAINEDFYNFWKEGYEIKNRETGCAIMCLSTKLNMLDPEGNLHHGNAMEFAKKHGADETMAQQLIDIVHGCEKSTPANDDKCIWTLGVATCFKAEIHKLNWAPSMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pheromone-binding protein
publication title Bombyx mori pheromone-binding protein binding nonpheromone ligands: implications for pheromone recognition.
pubmed doi rcsb
source organism Bombyx mori
molecule tags Attractant
total genus 51
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2007-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2p70A00
3Q8IA 3DXLA 3S0BA 3DY9A 3L47A 3CABA 4JD9A 1OW4A 1P28A 3R72A 3D73A 4F7FA 2GTEA 2QEHA 3B87A 3K1EA 3D76A 3BFAA 1XFRA 3CYZA 3D74A 3FE9A 3CDNA 1TWOA 3BFHA 2ERBA 1C3ZA 1DQEA 1GM0A 3S0EA 1C3YA 4FQTA 4INWA 3B88A 3S0AA 4OZDA 1OOFA 1OOIX 2WC5A 2WC6A 3R1OA 1TUJA 2WCLA 3R1PA 2H8VA 2QEBA 1OOGA 3BFBA 2P71A 2WCHA 3NGVA 2QEVA 4PT1A 3CZ1A 2L2CA 2QEOA 3B7AA 3NHTA 1QWVA 5DICA 2P70A 3OGNA 4INXA 3V2LA 3L4LA 3B86A 2WCJA 5EL2A 3FE8A 3VB1A 1OOHA 3S0DA 3FE6A 2QDIA 2FJYA 3L4AA 1ORGA 2WCKA 3B6XA 3DZTA 1T14A 3QMEA 3PJIA 3D77A 3NHIA 3BJHA 3D75A 3R1VA 3S0FA 3CZ2A 3D78A 3RZSA 2PQLA 3CZ0A 3S0GA 1LS8A 2JPOA 2WCMA 3N7HA 3DYEA 2KPHA
chains in the Genus database with same CATH superfamily
1SR6C 2KI6C 3EK4A 3DXLA 5KU1A 1LINA 2O60A 3DY9A 2ZFDA 1UWOA 3BQ3A 4ORAB 3ICBA 2G2BA 1DJYA 1OW4A 3KF9A 4CFQA 2BE6A 1CLBA 1H4BA 1EL4A 3CR2A 4YGDB 1IJ6A 5CSNA 1UUSA 1KQVA 3WXAA 1DMOA 3KEVA 4GGFA 1A75B 1YUSA 3I5GB 2F2PA 2KQYA 3BUXB 1DC1A 1QLKA 3CDNA 2H61A 3I5IB 2WNDA 3BUNB 3VRNA 2JNXA 2Y5IA 1B7TZ 1DEKA 2EHBA 4WQ3A 2MAZA 2JPTA 2LP3A 2KI4B 1C3ZA 2M0RA 1SL9A 2MHHA 4AOMA 5K89A 2AUCA 4HSZA 2SCPA 2JU0A 2ZKMX 1GM0A 2YGUA 1YVHA 2JXLA 1CFDA 1NX1A 3NSKA 4INWA 3SIAA 4QJ3B 1YVLA 2WOSA 4NDBA 1SYMA 5JJGA 3JTDB 1BR1B 1AJ5A 3AAJA 1ZACA 1R2UA 1OOFA 4M2QA 1K9KA 2MLFC 1WRLA 1RECA 2PMYA 1XVJA 2TN4A 2JTTA 2H8VA 1CM1A 1DGVA 2QEBA 4XYNA 1XYDA 2I7AA 5G08A 2E30A 5AANA 4AQJA 1XA5A 2EC6C 3CTNA 4TNCA 2K2AA 1S26D 1TUZA 4JKTA 2P71A 1KCYA 4NDDA 2OS8C 1CDPA 1TN4A 1K9UA 3OBVA 2G9BA 3ZWHA 4DUQA 2JC2A 2GV5A 1DJZA 1LKJA 1Y6WA 2KDHA 2QEOA 2ZRTA 3SG4A 3VRRA 1CKKA 3AKBA 4AQIA 2BAPA 1MUXA 1XFYO 1NX3A 1Y1XA 2FOTA 4NDCA 3UO9A 4QJ5B 1KSMA 1PRWA 1SW8A 3PSRA 4INXA 1HT9A 2EGDA 1KK8B 1FF1A 2OTGC 1M31A 2F33A 3FE8A 4YI9A 2MA2A 5AERA 1EG4A 2JTZA 4PE1A 2KAXA 2L98A 3SS5A 1F71A 3HCMA 2BKHB 2K2FA 3E3RA 2L5XB 2LVKA 1J1DA 1LXFC 1MXLC 1TRFA 2CXJA 3K21A 3TDZA 3WHUB 1K96A 2K0JA 2LANA 2M49B 3EG5B 1S5GZ 2F3ZA 1Y0VH 2KHNA 5I94A 1SCMB 1PVBA 1Z4HA 4JWQA 3D77A 1C7WA 3SG5A 1QVIZ 2FJUB 2L51A 4MBEA 3EK8A 4GGNA 1F8HA 1OE9B 3S0FA 4GBAA 1SK6D 3IQQA 4NQGA 3PFVA 1IKUA 2K7CA 3D78A 4YGBB 1ZUZA 1BG1A 1AP4A 1GGWA 2LHLA 1SCVA 2IS9A 1QIVA 1UHHA 2B1UA 3PLFB 1SKTA 1DVIA 1M63B 2F2OA 3CR4X 4P5OE 3I5GC 2M9GA 3S0GA 1QX7A 1F4OA 1QS7A 4U8DA 1SL7A 1NCXA 3I5IC 4GFTA 1W9ZA 1UHJA 2M8UA 1A4PA 5DKRA 1NUBA 1J7RA 4M2OA 5HKWA 1OSAA 2KI4C 3N7HA 3O4XA 3OP0A 2JT8A 1IG5A 1RTP1 2KFGA 4XJKA 1IGVA 1CLMA 2F3YA 3Q8IA 1B9AA 1TTXA 3TZ1A 2LVJA 2ZRSA 3CLNA 3SG2A 1CDLA 3JTDC 4ZCVA 1BJFA 1R6PA 3A8RA 3CABA 1UHNA 3OB1B 1P28A 1J1EA 4OCIA 3I5FB 2ISDA 1KQMB 2SASA 3D73A 4GGFC 4PE0A 2GTEA 3VRPA 1B1GA 4USLA 3B87A 3CGAA 1BMOA 2JQ6A 1GQMA 1IQ5A 2H61C 2OTGB 1S6CA 3PN7B 2KGBC 3QRXA 4C0JA 2AMIA 1XFRA 3BUOB 1X02A 1V1GA 1QV1A 2BCXA 3D74A 2A4JA 3FE9A 1K94A 1TNPA 3DVKA 1DF0A 4IJ7A 2JXCA 3BFHA 2LC5A 1KK7Y 1QJTA 1SMGA 1YRTB 1IH0A 2L4IA 1DJHA 4PDZA 1K8UA 3RLZA 1XO5A 3VRQA 2QACA 5GQQC 2KNEA 5HL1A 1QX5B 1RROA 1CMFA 1OQPA 2BE4A 2M7NA 4JPZB 4ETOA 2M97A 1ALVA 1NIWA 3A4UB 4CLNA 2MBXA 2Y1MA 1NP8A 2LP2A 2NZ0A 3CWGA 3IQOA 1KK8C 2WC5A 1PVAA 4OZDA 5FI2A 2M7LA 1TUJA 2I94A 2I2RE 2ZN8A 1OZSA 4N5XA 2BBMA 4M2PA 2Q4UA 4ORBB 2LM5A 1DJIA 1DF0B 3DF0A 1LVCD 1FBVA 1AUIB 4DCKA 2ZNDA 3AAKA 1KFXL 2LNKA 1SCMC 4FTGA 1RFJA 3NGVA 2QEVA 1LA0A 1SPYA 3CZ1A 1DGUA 3ZNIA 1FPWA 3O78A 4N1FA 4GUKA 1U5IA 1MXEA 1YUUA 1N0YA 1QWVA 5DICA 1F54A 5HLOA 1G4YR 1KFUL 1HQVA 1Q80A 5J3XA 1F70A 4MEWA 3GK1A 1JFJA 2E6WA 1M45A 3S0DA 1XFVO 3DF0B 3SS4A 1NX2A 1XFUO 1NPQA 2FJYA 4MZJA 1QV0A 2L2EA 2RGIA 1ORGA 2BKIB 2LV7A 5F6TA 3BUWB 2KAVA 2M1KB 1T14A 2AAOA 4PHMA 2H2KA 3GOFA 3QMEA 5HKYA 1ZOTB 4QJ4B 1MHOA 1NSHA 2I18A 1OZOA 1B8LA 3BJHA 4MVFA 2LCPA 2BBNA 1Z2CB 3IVTA 4YBHB 2NCPA 2HQ8A 2MRDA 3I5FC 1Y1UA 1KQMC 1L7ZA 2F8PA 2LHIA 1BT6A 4DS7A 4MZKA 1CNPA 3OX5A 1JF0A 2WCFA 5AFPA 3PN7C 1N65A 2LE9B 3EKJA 1GGZA 2LMUA 2K61A 1LS8A 2JPOA 2PVBA 2KAYA 1K93D 4ZCUA 1C7VA 3NSOA 1PK0D 1ZFSA 4I5JA 1J7QA 4DRWA 1BLQA 1YRUB 3KO0A 4C0KA 1PSBA 1B7TY 3SJSA 3D10A 2Y1NA 3PATA 4MZLA 4OVNF 2M3WA 1S6IA 4JD9A 5HKZA 3KPXA 2PALA 4ORCB 3R72A 2L0PA 1TNQA 3O6BA 4PE4A 3LK0A 1J7OA 2KBMA 4BY5A 2PRUA 3CS1A 2KYCA 3M0WA 1QATA 3JVTB 4GAOA 5D69A 4PHNA 3D76A 3FS7A 1A29A 3LLEA 2GGZA 3CYZA 1L2OB 4MRYA 4P2YB 5D3OA 1S1EA 1TWOA 1CFCA 1F4QA 2PASA 2ERBA 5AXIA 2WORA 3FIAA 4MSPA 2KLDA 1DQEA 1JFKA 1V1FA 1FI6A 2JRFA 3GK4X 4FQTA 1M46A 1BF5A 1SL8A 4FQOA 1SBJA 2JWWA 2KYFA 2WC6A 3R1OA 3WNXB 2WCLA 1WY9A 3RM1A 2Q91A 4MLWA 2BECA 1KWOB 1W7JB 2KOTA 3TS5B 5BPJA 2BCAA 5FI7A 1OOGA 2VRGA 4L9MA 1QASA 3FWCA 2JOJA 4JQ0D 2LVVA 1EXRA 4HRHA 1PSRA 1IQ3A 1ODBA 1DJXA 1SSEB 2JZIA 2BCBA 3LCPC 1XFZO 1B47A 2WCHA 2M1UA 3OX6A 4XJKB 1NX0A 5I2QA 1S5GY 3B7AA 3AKAA 3DVEA 4F0ZB 3EK7A 3NHTA 1QX2A 1WDCB 3TDUA 1YTZC 1QVIY 1YR5A 5JOLA 2BL0B 1JBAA 4PHKA 1EG3A 3V2LA 3O4YA 2OPOA 1QXPA 2CNPA 2WCJA 3B86A 3L4LA 5EL2A 4DIRA 1J7PA 3VB1A 1EH2A 4PHJA 1BODA 2NXQA 1N2DA 3NSLA 1WRZA 5ER5A 1JC2A 2K7DA 3L4AA 1EJ3A 5DKNA 1A03A 4I5LB 3EVUA 1QLSA 2KFHA 3UNWA 1B8RA 1K9PA 1YX8A 2LMVA 3B6XA 1K2HA 2JNFA 3DZTA 1QIWA 4C0LA 4R1EA 5AEQA 2LMTA 4CIDA 1ZMZA 2KGRA 3PJIA 5CSIA 5I2LA 5HYDA 3D75A 4GPLB 2PYQA 5CPVA 5FI6A 1A2XA 5B8IB 2Y4QA 3PALA 1XK4A 3F45A 3KHEA 5HLVA 3RZSA 5TNCA 1BOCA 1SNLA 1WLZA 2HQWA 2PQLA 2K8MB 2KFFA 3JVTC 4MN0A 2D8NA 1KFXS 2P6BB 4PE7A 4Q04A 2CTNA 1WRKA 4PALA 1DT7B 1AJ4A 1G33A 1L2OC 4OKHA 2BNXA 2WCMA 2CCMA 2NLNA 4N1GA 4BY4A 1MWNA 3IF7A 2GGMA 5I8NA 1CDMA 2KI6D 2O5GA 4CFRA 1JWDA 2JT3A 1KFUS 1S6JA 1CTRA 1U5IB 2K60A 2LUXA 3TUYC 4WRIA 4HRGA 1TNWA 5D7FA 3S0BA 1S3PA 3L47A 1RK9A 1DJGA 1OMVA 1UP5A 5CSFA 3GK2A 3D0YA 2ZNEA 3I5HB 5CSJA 1OOJA 1Y1AA 2NCOA 4F7FA 4GNKB 1KWOC 3TS5C 2QEHA 1W7IB 3K1EA 3PM8A 1IIOA 1AVSA 1FW4A 2LLSA 4YGCB 1TCFA 3BFAA 2MJWB 3BYAA 3CZTX 2WC8A 1S36A 1IRJA 4YGEB 2R2IA 3SS3A 3H4SE 1TCOB 1JSAA 4PCWA 2QPTA 1E8AA 2KQ6A 1BR4B 3S0EA 1B8CA 3EKHA 5I2OA 1KSOA 1C3YA 1SR6B 1WDCC 4I5KA 1XFXO 1YUTA 2LUCA 2BL0C 3D0YB 1H8BA 2M29A 1MQ1A 3B88A 1LA3A 3S0AA 4KYNA 3NSIA 2HETA 1CFPA 1OOIX 1YX7A 3BOWA 1TIZA 2LVIA 1AK8A 3R1PA 2ZN9A 1ALWA 1NWDA 1VRKA 1MF8B 3WHTB 4ICBA 5KSZA 2LAPA 1G8IA 1AHRA 3MSEB 3BFBA 2CT9A 3C1VA 1KK7Z 1XFWO 3PM2A 4WQ2A 3VROA 4IL1A 3SG6A 2L4HA 1BU3A 4I5NB 2KLEA 1CB1A 4HREE 1DTLA 3NXAA 2L5YA 3CR5X 4PT1A 4YRUA 1OMDA 2L2CA 3BUMB 1FI5A 3TUYB 1NCZA 3BOWB 3SG7A 1SRAA 3SG3A 1CFFA 1F55A 2P70A 2DOQA 3OGNA 1PULA 1GJYA 5DKQA 1RWYA 1UHKA 1B4CA 1D1OA 1PALA 1OOHA 1WLMA 3HX4A 1CM4A 1TOPA 4D1EA 3FE6A 2FCDA 1IJ5A 5ER4X 2QDIA 2LLTA 1CDNA 1QTXA 4E68A 1YURA 2CBLA 2JULA 2WCKA 1DELA 3FWBA 2EC6B 1DJWA 2V53A 2FCEA 2HF5A 2OS8B 2KSPA 1RJVA 1IWQA 3OHMB 1UHIA 3LK1A 2PSRA 1UURA 1TNXA 1XK4C 3NHIA 2K7OA 1NCYA 2LLUA 3R1VA 1MR8A 1M39A 3CZ2A 5FYXA 4A4CA 5KTYA 2WCEA 3I5HC 3SIBA 1JF2A 3O2PA 5PALA 4A4BA 4MRXA 1CLLA 1OMRA 2MLEC 1CMGA 3DVMA 2L50A 1JUOA 1K95A 2K7BA 3CZ0A 3DD4A 3EVRA 3OB2B 2WCBA 4YGAA 2KBIA 1J55A 3LL8B 4CPVA 2HPSA 1SY9A 2JT0A 4YI8A 1A75A 2COLB 1K90D 4OV2A 1NYAA 3DYEA 3BXKA 4OR9B 4UPGA 1C07A 3EVVA 3VGOA 2KPHA 3DVJA 3TDIA 5IBWA
chains in the Genus database with same CATH topology
3Q8IA 3DXLA 3S0BA 3DY9A 3L47A 3CABA 4JD9A 1OW4A 1P28A 3R72A 3D73A 4F7FA 2GTEA 2QEHA 3B87A 3K1EA 3D76A 3BFAA 1XFRA 3CYZA 3D74A 3FE9A 3CDNA 1TWOA 3BFHA 2ERBA 1C3ZA 1DQEA 1GM0A 3S0EA 1C3YA 4FQTA 4INWA 3B88A 3S0AA 4OZDA 1OOFA 1OOIX 2WC5A 2WC6A 3R1OA 1TUJA 2WCLA 3R1PA 2H8VA 2QEBA 1OOGA 3BFBA 2P71A 2WCHA 3NGVA 2QEVA 4PT1A 3CZ1A 2L2CA 2QEOA 3B7AA 3NHTA 1QWVA 5DICA 2P70A 3OGNA 4INXA 3V2LA 3L4LA 3B86A 2WCJA 5EL2A 3FE8A 3VB1A 1OOHA 3S0DA 3FE6A 2QDIA 2FJYA 3L4AA 1ORGA 2WCKA 3B6XA 3DZTA 1T14A 3QMEA 3PJIA 3D77A 3NHIA 3BJHA 3D75A 3R1VA 3S0FA 3CZ2A 3D78A 3RZSA 2PQLA 3CZ0A 3S0GA 1LS8A 2JPOA 2WCMA 3N7HA 3DYEA 2KPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q8I A;  3DXL A;  3S0B A;  3DY9 A;  3L47 A;  3CAB A;  4JD9 A;  1OW4 A;  1P28 A;  3R72 A;  3D73 A;  4F7F A;  2GTE A;  2QEH A;  3B87 A;  3K1E A;  3D76 A;  3BFA A;  1XFR A;  3CYZ A;  3D74 A;  3FE9 A;  3CDN A;  1TWO A;  3BFH A;  2ERB A;  1C3Z A;  1DQE A;  1GM0 A;  3S0E A;  1C3Y A;  4FQT A;  4INW A;  3B88 A;  3S0A A;  4OZD A;  1OOF A;  1OOI X;  2WC5 A;  2WC6 A;  3R1O A;  1TUJ A;  2WCL A;  3R1P A;  2H8V A;  2QEB A;  1OOG A;  3BFB A;  2P71 A;  2WCH A;  3NGV A;  2QEV A;  4PT1 A;  3CZ1 A;  2L2C A;  2QEO A;  3B7A A;  3NHT A;  1QWV A;  5DIC A;  2P70 A;  3OGN A;  4INX A;  3V2L A;  3L4L A;  3B86 A;  2WCJ A;  5EL2 A;  3FE8 A;  3VB1 A;  1OOH A;  3S0D A;  3FE6 A;  2QDI A;  2FJY A;  3L4A A;  1ORG A;  2WCK A;  3B6X A;  3DZT A;  1T14 A;  3QME A;  3PJI A;  3D77 A;  3NHI A;  3BJH A;  3D75 A;  3R1V A;  3S0F A;  3CZ2 A;  3D78 A;  3RZS A;  2PQL A;  3CZ0 A;  3S0G A;  1LS8 A;  2JPO A;  2WCM A;  3N7H A;  3DYE A;  2KPH A; 
#chains in the Genus database with same CATH topology
 1SR6 C;  2KI6 C;  3EK4 A;  3DXL A;  5KU1 A;  1LIN A;  2O60 A;  3DY9 A;  2ZFD A;  1UWO A;  3BQ3 A;  4ORA B;  3ICB A;  2G2B A;  1DJY A;  1OW4 A;  3KF9 A;  4CFQ A;  2BE6 A;  1CLB A;  1H4B A;  1EL4 A;  3CR2 A;  4YGD B;  1IJ6 A;  5CSN A;  1UUS A;  1KQV A;  3WXA A;  1DMO A;  3KEV A;  4GGF A;  1A75 B;  1YUS A;  3I5G B;  2F2P A;  2KQY A;  3BUX B;  1DC1 A;  1QLK A;  3CDN A;  2H61 A;  3I5I B;  2WND A;  3BUN B;  3VRN A;  2JNX A;  2Y5I A;  1B7T Z;  1DEK A;  2EHB A;  4WQ3 A;  2MAZ A;  2JPT A;  2LP3 A;  2KI4 B;  1C3Z A;  2M0R A;  1SL9 A;  2MHH A;  4AOM A;  5K89 A;  2AUC A;  4HSZ A;  2SCP A;  2JU0 A;  2ZKM X;  1GM0 A;  2YGU A;  1YVH A;  2JXL A;  1CFD A;  1NX1 A;  3NSK A;  4INW A;  3SIA A;  4QJ3 B;  1YVL A;  2WOS A;  4NDB A;  1SYM A;  5JJG A;  3JTD B;  1BR1 B;  1AJ5 A;  3AAJ A;  1ZAC A;  1R2U A;  1OOF A;  4M2Q A;  1K9K A;  2MLF C;  1WRL A;  1REC A;  2PMY A;  1XVJ A;  2TN4 A;  2JTT A;  2H8V A;  1CM1 A;  1DGV A;  2QEB A;  4XYN A;  1XYD A;  2I7A A;  5G08 A;  2E30 A;  5AAN A;  4AQJ A;  1XA5 A;  2EC6 C;  3CTN A;  4TNC A;  2K2A A;  1S26 D;  1TUZ A;  4JKT A;  2P71 A;  1KCY A;  4NDD A;  2OS8 C;  1CDP A;  1TN4 A;  1K9U A;  3OBV A;  2G9B A;  3ZWH A;  4DUQ A;  2JC2 A;  2GV5 A;  1DJZ A;  1LKJ A;  1Y6W A;  2KDH A;  2QEO A;  2ZRT A;  3SG4 A;  3VRR A;  1CKK A;  3AKB A;  4AQI A;  2BAP A;  1MUX A;  1XFY O;  1NX3 A;  1Y1X A;  2FOT A;  4NDC A;  3UO9 A;  4QJ5 B;  1KSM A;  1PRW A;  1SW8 A;  3PSR A;  4INX A;  1HT9 A;  2EGD A;  1KK8 B;  1FF1 A;  2OTG C;  1M31 A;  2F33 A;  3FE8 A;  4YI9 A;  2MA2 A;  5AER A;  1EG4 A;  2JTZ A;  4PE1 A;  2KAX A;  2L98 A;  3SS5 A;  1F71 A;  3HCM A;  2BKH B;  2K2F A;  3E3R A;  2L5X B;  2LVK A;  1J1D A;  1LXF C;  1MXL C;  1TRF A;  2CXJ A;  3K21 A;  3TDZ A;  3WHU B;  1K96 A;  2K0J A;  2LAN A;  2M49 B;  3EG5 B;  1S5G Z;  2F3Z A;  1Y0V H;  2KHN A;  5I94 A;  1SCM B;  1PVB A;  1Z4H A;  4JWQ A;  3D77 A;  1C7W A;  3SG5 A;  1QVI Z;  2FJU B;  2L51 A;  4MBE A;  3EK8 A;  4GGN A;  1F8H A;  1OE9 B;  3S0F A;  4GBA A;  1SK6 D;  3IQQ A;  4NQG A;  3PFV A;  1IKU A;  2K7C A;  3D78 A;  4YGB B;  1ZUZ A;  1BG1 A;  1AP4 A;  1GGW A;  2LHL A;  1SCV A;  2IS9 A;  1QIV A;  1UHH A;  2B1U A;  3PLF B;  1SKT A;  1DVI A;  1M63 B;  2F2O A;  3CR4 X;  4P5O E;  3I5G C;  2M9G A;  3S0G A;  1QX7 A;  1F4O A;  1QS7 A;  4U8D A;  1SL7 A;  1NCX A;  3I5I C;  4GFT A;  1W9Z A;  1UHJ A;  2M8U A;  1A4P A;  5DKR A;  1NUB A;  1J7R A;  4M2O A;  5HKW A;  1OSA A;  2KI4 C;  3N7H A;  3O4X A;  3OP0 A;  2JT8 A;  1IG5 A;  1RTP 1;  2KFG A;  4XJK A;  1IGV A;  1CLM A;  2F3Y A;  3Q8I A;  1B9A A;  1TTX A;  3TZ1 A;  2LVJ A;  2ZRS A;  3CLN A;  3SG2 A;  1CDL A;  3JTD C;  4ZCV A;  1BJF A;  1R6P A;  3A8R A;  3CAB A;  1UHN A;  3OB1 B;  1P28 A;  1J1E A;  4OCI A;  3I5F B;  2ISD A;  1KQM B;  2SAS A;  3D73 A;  4GGF C;  4PE0 A;  2GTE A;  3VRP A;  1B1G A;  4USL A;  3B87 A;  3CGA A;  1BMO A;  2JQ6 A;  1GQM A;  1IQ5 A;  2H61 C;  2OTG B;  1S6C A;  3PN7 B;  2KGB C;  3QRX A;  4C0J A;  2AMI A;  1XFR A;  3BUO B;  1X02 A;  1V1G A;  1QV1 A;  2BCX A;  3D74 A;  2A4J A;  3FE9 A;  1K94 A;  1TNP A;  3DVK A;  1DF0 A;  4IJ7 A;  2JXC A;  3BFH A;  2LC5 A;  1KK7 Y;  1QJT A;  1SMG A;  1YRT B;  1IH0 A;  2L4I A;  1DJH A;  4PDZ A;  1K8U A;  3RLZ A;  1XO5 A;  3VRQ A;  2QAC A;  5GQQ C;  2KNE A;  5HL1 A;  1QX5 B;  1RRO A;  1CMF A;  1OQP A;  2BE4 A;  2M7N A;  4JPZ B;  4ETO A;  2M97 A;  1ALV A;  1NIW A;  3A4U B;  4CLN A;  2MBX A;  2Y1M A;  1NP8 A;  2LP2 A;  2NZ0 A;  3CWG A;  3IQO A;  1KK8 C;  2WC5 A;  1PVA A;  4OZD A;  5FI2 A;  2M7L A;  1TUJ A;  2I94 A;  2I2R E;  2ZN8 A;  1OZS A;  4N5X A;  2BBM A;  4M2P A;  2Q4U A;  4ORB B;  2LM5 A;  1DJI A;  1DF0 B;  3DF0 A;  1LVC D;  1FBV A;  1AUI B;  4DCK A;  2ZND A;  3AAK A;  1KFX L;  2LNK A;  1SCM C;  4FTG A;  1RFJ A;  3NGV A;  2QEV A;  1LA0 A;  1SPY A;  3CZ1 A;  1DGU A;  3ZNI A;  1FPW A;  3O78 A;  4N1F A;  4GUK A;  1U5I A;  1MXE A;  1YUU A;  1N0Y A;  1QWV A;  5DIC A;  1F54 A;  5HLO A;  1G4Y R;  1KFU L;  1HQV A;  1Q80 A;  5J3X A;  1F70 A;  4MEW A;  3GK1 A;  1JFJ A;  2E6W A;  1M45 A;  3S0D A;  1XFV O;  3DF0 B;  3SS4 A;  1NX2 A;  1XFU O;  1NPQ A;  2FJY A;  4MZJ A;  1QV0 A;  2L2E A;  2RGI A;  1ORG A;  2BKI B;  2LV7 A;  5F6T A;  3BUW B;  2KAV A;  2M1K B;  1T14 A;  2AAO A;  4PHM A;  2H2K A;  3GOF A;  3QME A;  5HKY A;  1ZOT B;  4QJ4 B;  1MHO A;  1NSH A;  2I18 A;  1OZO A;  1B8L A;  3BJH A;  4MVF A;  2LCP A;  2BBN A;  1Z2C B;  3IVT A;  4YBH B;  2NCP A;  2HQ8 A;  2MRD A;  3I5F C;  1Y1U A;  1KQM C;  1L7Z A;  2F8P A;  2LHI A;  1BT6 A;  4DS7 A;  4MZK A;  1CNP A;  3OX5 A;  1JF0 A;  2WCF A;  5AFP A;  3PN7 C;  1N65 A;  2LE9 B;  3EKJ A;  1GGZ A;  2LMU A;  2K61 A;  1LS8 A;  2JPO A;  2PVB A;  2KAY A;  1K93 D;  4ZCU A;  1C7V A;  3NSO A;  1PK0 D;  1ZFS A;  4I5J A;  1J7Q A;  4DRW A;  1BLQ A;  1YRU B;  3KO0 A;  4C0K A;  1PSB A;  1B7T Y;  3SJS A;  3D10 A;  2Y1N A;  3PAT A;  4MZL A;  4OVN F;  2M3W A;  1S6I A;  4JD9 A;  5HKZ A;  3KPX A;  2PAL A;  4ORC B;  3R72 A;  2L0P A;  1TNQ A;  3O6B A;  4PE4 A;  3LK0 A;  1J7O A;  2KBM A;  4BY5 A;  2PRU A;  3CS1 A;  2KYC A;  3M0W A;  1QAT A;  3JVT B;  4GAO A;  5D69 A;  4PHN A;  3D76 A;  3FS7 A;  1A29 A;  3LLE A;  2GGZ A;  3CYZ A;  1L2O B;  4MRY A;  4P2Y B;  5D3O A;  1S1E A;  1TWO A;  1CFC A;  1F4Q A;  2PAS A;  2ERB A;  5AXI A;  2WOR A;  3FIA A;  4MSP A;  2KLD A;  1DQE A;  1JFK A;  1V1F A;  1FI6 A;  2JRF A;  3GK4 X;  4FQT A;  1M46 A;  1BF5 A;  1SL8 A;  4FQO A;  1SBJ A;  2JWW A;  2KYF A;  2WC6 A;  3R1O A;  3WNX B;  2WCL A;  1WY9 A;  3RM1 A;  2Q91 A;  4MLW A;  2BEC A;  1KWO B;  1W7J B;  2KOT A;  3TS5 B;  5BPJ A;  2BCA A;  5FI7 A;  1OOG A;  2VRG A;  4L9M A;  1QAS A;  3FWC A;  2JOJ A;  4JQ0 D;  2LVV A;  1EXR A;  4HRH A;  1PSR A;  1IQ3 A;  1ODB A;  1DJX A;  1SSE B;  2JZI A;  2BCB A;  3LCP C;  1XFZ O;  1B47 A;  2WCH A;  2M1U A;  3OX6 A;  4XJK B;  1NX0 A;  5I2Q A;  1S5G Y;  3B7A A;  3AKA A;  3DVE A;  4F0Z B;  3EK7 A;  3NHT A;  1QX2 A;  1WDC B;  3TDU A;  1YTZ C;  1QVI Y;  1YR5 A;  5JOL A;  2BL0 B;  1JBA A;  4PHK A;  1EG3 A;  3V2L A;  3O4Y A;  2OPO A;  1QXP A;  2CNP A;  2WCJ A;  3B86 A;  3L4L A;  5EL2 A;  4DIR A;  1J7P A;  3VB1 A;  1EH2 A;  4PHJ A;  1BOD A;  2NXQ A;  1N2D A;  3NSL A;  1WRZ A;  5ER5 A;  1JC2 A;  2K7D A;  3L4A A;  1EJ3 A;  5DKN A;  1A03 A;  4I5L B;  3EVU A;  1QLS A;  2KFH A;  3UNW A;  1B8R A;  1K9P A;  1YX8 A;  2LMV A;  3B6X A;  1K2H A;  2JNF A;  3DZT A;  1QIW A;  4C0L A;  4R1E A;  5AEQ A;  2LMT A;  4CID A;  1ZMZ A;  2KGR A;  3PJI A;  5CSI A;  5I2L A;  5HYD A;  3D75 A;  4GPL B;  2PYQ A;  5CPV A;  5FI6 A;  1A2X A;  5B8I B;  2Y4Q A;  3PAL A;  1XK4 A;  3F45 A;  3KHE A;  5HLV A;  3RZS A;  5TNC A;  1BOC A;  1SNL A;  1WLZ A;  2HQW A;  2PQL A;  2K8M B;  2KFF A;  3JVT C;  4MN0 A;  2D8N A;  1KFX S;  2P6B B;  4PE7 A;  4Q04 A;  2CTN A;  1WRK A;  4PAL A;  1DT7 B;  1AJ4 A;  1G33 A;  1L2O C;  4OKH A;  2BNX A;  2WCM A;  2CCM A;  2NLN A;  4N1G A;  4BY4 A;  1MWN A;  3IF7 A;  2GGM A;  5I8N A;  1CDM A;  2KI6 D;  2O5G A;  4CFR A;  1JWD A;  2JT3 A;  1KFU S;  1S6J A;  1CTR A;  1U5I B;  2K60 A;  2LUX A;  3TUY C;  4WRI A;  4HRG A;  1TNW A;  5D7F A;  3S0B A;  1S3P A;  3L47 A;  1RK9 A;  1DJG A;  1OMV A;  1UP5 A;  5CSF A;  3GK2 A;  3D0Y A;  2ZNE A;  3I5H B;  5CSJ A;  1OOJ A;  1Y1A A;  2NCO A;  4F7F A;  4GNK B;  1KWO C;  3TS5 C;  2QEH A;  1W7I B;  3K1E A;  3PM8 A;  1IIO A;  1AVS A;  1FW4 A;  2LLS A;  4YGC B;  1TCF A;  3BFA A;  2MJW B;  3BYA A;  3CZT X;  2WC8 A;  1S36 A;  1IRJ A;  4YGE B;  2R2I A;  3SS3 A;  3H4S E;  1TCO B;  1JSA A;  4PCW A;  2QPT A;  1E8A A;  2KQ6 A;  1BR4 B;  3S0E A;  1B8C A;  3EKH A;  5I2O A;  1KSO A;  1C3Y A;  1SR6 B;  1WDC C;  4I5K A;  1XFX O;  1YUT A;  2LUC A;  2BL0 C;  3D0Y B;  1H8B A;  2M29 A;  1MQ1 A;  3B88 A;  1LA3 A;  3S0A A;  4KYN A;  3NSI A;  2HET A;  1CFP A;  1OOI X;  1YX7 A;  3BOW A;  1TIZ A;  2LVI A;  1AK8 A;  3R1P A;  2ZN9 A;  1ALW A;  1NWD A;  1VRK A;  1MF8 B;  3WHT B;  4ICB A;  5KSZ A;  2LAP A;  1G8I A;  1AHR A;  3MSE B;  3BFB A;  2CT9 A;  3C1V A;  1KK7 Z;  1XFW O;  3PM2 A;  4WQ2 A;  3VRO A;  4IL1 A;  3SG6 A;  2L4H A;  1BU3 A;  4I5N B;  2KLE A;  1CB1 A;  4HRE E;  1DTL A;  3NXA A;  2L5Y A;  3CR5 X;  4PT1 A;  4YRU A;  1OMD A;  2L2C A;  3BUM B;  1FI5 A;  3TUY B;  1NCZ A;  3BOW B;  3SG7 A;  1SRA A;  3SG3 A;  1CFF A;  1F55 A;  2P70 A;  2DOQ A;  3OGN A;  1PUL A;  1GJY A;  5DKQ A;  1RWY A;  1UHK A;  1B4C A;  1D1O A;  1PAL A;  1OOH A;  1WLM A;  3HX4 A;  1CM4 A;  1TOP A;  4D1E A;  3FE6 A;  2FCD A;  1IJ5 A;  5ER4 X;  2QDI A;  2LLT A;  1CDN A;  1QTX A;  4E68 A;  1YUR A;  2CBL A;  2JUL A;  2WCK A;  1DEL A;  3FWB A;  2EC6 B;  1DJW A;  2V53 A;  2FCE A;  2HF5 A;  2OS8 B;  2KSP A;  1RJV A;  1IWQ A;  3OHM B;  1UHI A;  3LK1 A;  2PSR A;  1UUR A;  1TNX A;  1XK4 C;  3NHI A;  2K7O A;  1NCY A;  2LLU A;  3R1V A;  1MR8 A;  1M39 A;  3CZ2 A;  5FYX A;  4A4C A;  5KTY A;  2WCE A;  3I5H C;  3SIB A;  1JF2 A;  3O2P A;  5PAL A;  4A4B A;  4MRX A;  1CLL A;  1OMR A;  2MLE C;  1CMG A;  3DVM A;  2L50 A;  1JUO A;  1K95 A;  2K7B A;  3CZ0 A;  3DD4 A;  3EVR A;  3OB2 B;  2WCB A;  4YGA A;  2KBI A;  1J55 A;  3LL8 B;  4CPV A;  2HPS A;  1SY9 A;  2JT0 A;  4YI8 A;  1A75 A;  2COL B;  1K90 D;  4OV2 A;  1NYA A;  3DYE A;  3BXK A;  4OR9 B;  4UPG A;  1C07 A;  3EVV A;  3VGO A;  2KPH A;  3DVJ A;  3TDI A;  5IBW A; 
#chains in the Genus database with same CATH homology
 3Q8I A;  3DXL A;  3S0B A;  3DY9 A;  3L47 A;  3CAB A;  4JD9 A;  1OW4 A;  1P28 A;  3R72 A;  3D73 A;  4F7F A;  2GTE A;  2QEH A;  3B87 A;  3K1E A;  3D76 A;  3BFA A;  1XFR A;  3CYZ A;  3D74 A;  3FE9 A;  3CDN A;  1TWO A;  3BFH A;  2ERB A;  1C3Z A;  1DQE A;  1GM0 A;  3S0E A;  1C3Y A;  4FQT A;  4INW A;  3B88 A;  3S0A A;  4OZD A;  1OOF A;  1OOI X;  2WC5 A;  2WC6 A;  3R1O A;  1TUJ A;  2WCL A;  3R1P A;  2H8V A;  2QEB A;  1OOG A;  3BFB A;  2P71 A;  2WCH A;  3NGV A;  2QEV A;  4PT1 A;  3CZ1 A;  2L2C A;  2QEO A;  3B7A A;  3NHT A;  1QWV A;  5DIC A;  2P70 A;  3OGN A;  4INX A;  3V2L A;  3L4L A;  3B86 A;  2WCJ A;  5EL2 A;  3FE8 A;  3VB1 A;  1OOH A;  3S0D A;  3FE6 A;  2QDI A;  2FJY A;  3L4A A;  1ORG A;  2WCK A;  3B6X A;  3DZT A;  1T14 A;  3QME A;  3PJI A;  3D77 A;  3NHI A;  3BJH A;  3D75 A;  3R1V A;  3S0F A;  3CZ2 A;  3D78 A;  3RZS A;  2PQL A;  3CZ0 A;  3S0G A;  1LS8 A;  2JPO A;  2WCM A;  3N7H A;  3DYE A;  2KPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...