5AANA

Crystal structure of drosophila ncs-1 bound to penothiazine fd44
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
183
structure length
183
Chain Sequence
KKNSKLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPDGDPSKFASLVFRVFDENNDGAIEFEEFIRALSITSRGNLDEKLHWAFRLYDVDNDGYITREEMYNIVDAIYQMVGQQPQTEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRMVQALSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CG5907-PA, ISOFORM A
publication title Interference of the complex between NCS-1 and Ric8a with phenothiazines regulates synaptic function and is an approach for fragile X syndrome.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Calcium-binding protein
total genus 71
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2015-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5aanA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5aanA02
5CSFA 1CLLA 5IBWA 2COLB 4E68A 3I5FB 4HSZA 1TIZA 3O2PA 1S6CA 3DF0A 4ORBB 4GFTA 2KAXA 3CTNA 4PCWA 3EK4A 4YGEB 1S5GZ 3KHEA 1L2OC 1UP5A 1F54A 1XA5A 2KI6C 1ALVA 1F55A 1SY9A 3JTDC 4MSPA 3BUWB 1KSMA 2KHNA 1C07A 4MLWA 1S5GY 3SIBA 4ETOA 3PM8A 1V1GA 1RFJA 5KU1A 1IRJA 2R2IA 2H61A 3TS5B 1J7OA 1ZOTB 2MAZA 1SR6C 4XYNA 1PVBA 2ZKMX 1CNPA 2K7CA 2JNXA 4OKHA 2L51A 1DGUA 5JOLA 1Y0VH 2LP2A 2H61C 1DVIA 2CT9A 2EC6B 2BKHB 3VRRA 1M46A 1HQVA 1CLMA 4PE7A 4QJ4B 4GPLB 2OS8B 2JTZA 3DVKA 1K8UA 2MA2A 2WCFA 3I5HC 3OX6A 2MRDA 1G4YR 3I5IB 3OX5A 2GGZA 1J7RA 1GQMA 1KQMC 1TNQA 5F6TA 5G08A 2I7AA 1CFPA 1RECA 2LANA 1F71A 2KGBC 2LMTA 1K90D 1XYDA 1YR5A 5AANA 1QJTA 3ICBA 1PVAA 3I5FC 2WNDA 1NX0A 1MF8B 1G33A 1XK4A 3DVMA 1KFUL 2H2KA 4C0KA 1TNXA 1M63B 3GK1A 4MZLA 1OMDA 1OZSA 2Y5IA 2CXJA 2Y1MA 1XK4C 3KPXA 1B7TZ 3FIAA 1DTLA 3DD4A 3KO0A 1SL8A 1AUIB 1DMOA 1SBJA 2KQYA 1YX8A 3SJSA 4UPGA 4N1GA 1A2XA 1B7TY 1DF0B 2FCDA 1TN4A 4N5XA 1UHJA 1KCYA 2KBIA 2FJUB 3EKJA 1GGZA 2BECA 4GBAA 5TNCA 3O6BA 1V1FA 1CDPA 1L7ZA 2LVKA 2Y1NA 3HCMA 2Q91A 3IQOA 4PHKA 2EC6C 1D1OA 4FTGA 1FPWA 3EK7A 2LE9B 5HKYA 1PULA 1NUBA 1RROA 5GQQC 2LHLA 1PK0D 1BR4B 3SG2A 1ALWA 2ZN8A 4OCIA 1SMGA 3I5IC 1TCOB 3FS7A 1AK8A 1EXRA 2K7OA 2MJWB 4YRUA 2BCAA 5D69A 1K9KA 2AAOA 1A4PA 1XVJA 3CR5X 4WRIA 4DCKA 1QVIZ 3OP0A 1QATA 5FYXA 1QXPA 1S36A 1EG3A 2SCPA 3E3RA 4MZKA 3SG5A 1FI6A 2LAPA 1UHIA 1BR1B 4CIDA 1SNLA 1QVIY 3EKHA 1MQ1A 4NDCA 1U5IB 4WQ3A 2NCPA 2O60A 1SK6D 1DF0A 2NXQA 1QS7A 3SG4A 1A29A 2LUXA 1SCMB 2KAYA 1MR8A 2M97A 5PALA 1RWYA 2JXCA 4DRWA 1A75A 1CFFA 1JFJA 1BJFA 2F2OA 2MLEC 2K8MB 2LVJA 4PE1A 1DJHA 1CDNA 1JC2A 4N1FA 1QV1A 2KFFA 2WOSA 1XFWO 3O4YA 1JF0A 2MBXA 2KBMA 1SPYA 3D0YA 5CSNA 1H8BA 1B8LA 2ZRTA 4GGFA 2LLTA 4P2YB 4C0JA 1KK8B 2BL0B 2F3YA 3PFVA 4I5JA 4YGAA 1OMVA 1WRLA 1JUOA 1AHRA 1IJ6A 1MHOA 1OE9B 1KWOB 1F70A 4GGFC 1NPQA 2A4JA 1OZOA 1DT7B 1BG1A 1NYAA 1BU3A 1J7QA 3SG7A 3I5GB 2ISDA 4XJKB 2KI4B 1CKKA 1LKJA 2ZNDA 3OB2B 2L98A 2F33A 4ORCB 3NSIA 1HT9A 2OPOA 1Q80A 3A8RA 1ODBA 2OTGB 3CZTX 1K9PA 1U5IA 5HYDA 1BOCA 1N2DA 1K94A 4PHMA 1X02A 3BOWB 4YGBB 1S3PA 2KQ6A 4DS7A 3LK1A 3OHMB 5I2QA 1BLQA 1YUTA 4YI9A 1Y6WA 1LVCD 4MEWA 3VRNA 2GV5A 2LC5A 2LHIA 2LV7A 1TRFA 3BQ3A 3AKAA 1W7JB 2KOTA 5AEQA 4L9MA 3RLZA 1YURA 1E8AA 5HKZA 1DJIA 5HKWA 1K9UA 5DKRA 1K2HA 4Q04A 1B8CA 3MSEB 4YI8A 1CTRA 3QRXA 2K2FA 1RK9A 4PHNA 2L0PA 3KEVA 1EG4A 2HPSA 1OMRA 1UURA 4OV2A 1YUSA 4MN0A 3D10A 1CMFA 1KK8C 5DKQA 3TDUA 2JC2A 3EK8A 2L4IA 4XJKA 5DKNA 2L5XB 2WC8A 1TNPA 2GGMA 3CR2A 2PRUA 3JVTB 2G9BA 1NWDA 4OR9B 2KI4C 2RGIA 4DIRA 4NQGA 3CWGA 2F8PA 1TCFA 3BOWA 3VGOA 2CBLA 1QIWA 2LCPA 1RJVA 1XFUO 4NDDA 1B1GA 2V53A 3GK2A 1H4BA 3EVRA 2HQWA 2KGRA 1OSAA 3TS5C 1GGWA 3AAJA 4TNCA 1MUXA 4HRHA 2BBMA 3PN7B 1SW8A 1DJZA 3VROA 2M1UA 1CDMA 1DJWA 1F8HA 1M39A 2MHHA 3WXAA 2KYCA 4I5LB 1TNWA 2BE6A 1PRWA 3TDIA 2LMVA 1NX3A 3ZWHA 4QJ5B 2ZRSA 2OS8C 4BY4A 1FF1A 2JRFA 1QASA 4OVNF 1SL9A 3WNXB 1YVHA 4BY5A 5I2OA 4USLA 3M0WA 3WHUB 3FWBA 4JWQA 1LA0A 5HLVA 2IS9A 5I2LA 1CFCA 1YX7A 3DVJA 3LLEA 4MBEA 2CNPA 2NZ0A 3GOFA 3SG6A 4YGDB 1WLZA 2JXLA 2DOQA 2LVIA 2JT3A 2JPTA 2Y4QA 1JFKA 2BKIB 3NSKA 1KFXS 3LK0A 1QTXA 3CGAA 1FI5A 2KFGA 1EH2A 3PSRA 2K61A 4PDZA 1CM1A 1L2OB 2KDHA 3LL8B 3F45A 2D8NA 1NX1A 1YUUA 1CLBA 1QX5B 2HF5A 2KSPA 1MWNA 3BUOB 3SG3A 1FBVA 1QLSA 1TTXA 2HQ8A 2LNKA 3O78A 1UHHA 3VRPA 1JSAA 1KQVA 1NCYA 2B1UA 3PN7C 4AQJA 2PVBA 1C7WA 3BYAA 5BPJA 1KSOA 2ZFDA 1NX2A 1IKUA 1SR6B 3IF7A 1S6JA 1AJ4A 1DJXA 3TZ1A 4M2QA 3AAKA 2ZNEA 3CS1A 1XO5A 2FOTA 1EJ3A 3VRQA 4CFQA 3FWCA 4A4BA 1BF5A 1SYMA 1ZFSA 4MZJA 1QIVA 3LCPC 4P5OE 4YGCB 1J7PA 5JJGA 4JPZB 1WRKA 2LLUA 2KI6D 4R1EA 1BODA 2O5GA 3I5HB 1UUSA 2LUCA 2EHBA 1VRKA 2F3ZA 1LA3A 2CTNA 1KQMB 4AQIA 1SKTA 2WCEA 4DUQA 2M8UA 3BUNB 1B9AA 1S1EA 2M29A 1A03A 1OOJA 1UHNA 1B8RA 4MRYA 1R2UA 2PMYA 2LLSA 5I8NA 1BT6A 1M31A 1YRTB 1WDCB 1NIWA 2KFHA 2Q4UA 1ZMZA 1SCMC 2JT0A 1S26D 5B8IB 1JBAA 2BE4A 4WQ2A 2M7LA 1IQ5A 2JNFA 2JT8A 4ZCUA 3C1VA 3IQQA 1J1DA 2E30A 1QLKA 1J55A 1M45A 1Y1XA 2M1KB 4PALA 1LXFC 1XFZO 1AJ5A 1YRUB 4PHJA 3DVEA 1KFXL 5CPVA 3NSLA 3TDZA 2BL0C 1N65A 1PALA 3H4SE 4M2PA 3RM1A 2JWWA 1UWOA 4C0LA 4F0ZB 2LM5A 5ER5A 5KTYA 1IWQA 1KWOC 4CFRA 3A4UB 3BUMB 2E6WA 1IG5A 1JF2A 2P6BB 1ZACA 2I18A 2QACA 2QPTA 2M49B 3BUXB 3I5GC 1CFDA 1WY9A 2HETA 2LP3A 3ZNIA 1RTP1 4GNKB 4A4CA 1IH0A 1MXEA 2JZIA 2MLFC 2JTTA 2OTGC 1UHKA 4QJ3B 1W7IB 2AUCA 3K21A 1IGVA 1BMOA 1XFVO 3EVUA 3NXAA 3PATA 1ZUZA 2PALA 2CCMA 3WHTB 4D1EA 2JOJA 4GAOA 5CSJA 4IL1A 1JWDA 3GK4X 1K93D 1WDCC 4HRGA 3CLNA 1WRZA 1NSHA 1CDLA 4MVFA 3NSOA 4FQOA 4U8DA 2F2PA 1IJ5A 1OQPA 2ZN9A 1F4QA 1XFXO 1NP8A 2K2AA 1SRAA 1MXLC 2EGDA 3AKBA 1B4CA 4GUKA 4HREE 2FCEA 4PE4A 3TUYB 2BCXA 1SCVA 2KAVA 1CB1A 3PLFB 1A75B 2NCOA 1TOPA 2K7DA 5KSZA 4PE0A 1C7VA 2I94A 2I2RE 2AMIA 1F4OA 2M0RA 3D0YB 2TN4A 4ORAB 1CM4A 3JVTC 5J3XA 1YVLA 1CMGA 1SL7A 3KF9A 4ICBA 1K96A 3CR4X 4GGNA 5D7FA 3DF0B 5AXIA 4CPVA 3BXKA 3JTDB 1WLMA 1QV0A 2PSRA 1PSBA 1DGVA 4M2OA 1NCZA 3PALA 4JQ0D 4I5KA 1KK7Z 1N0YA 1NCXA 1AP4A 1EL4A 4YBHB 1K95A 5CSIA 1R6PA 1KFUS 2K0JA 1DJGA 1B47A 3OB1B 1KK7Y 2M7NA 4NDBA 2LVVA 2VRGA 2BBNA 4MRXA 2WCBA 2G2BA 2SASA 1DJYA 5K89A 1GJYA 2JULA 4CLNA 2WORA 1QX7A 3TUYC 5AFPA 1J1EA 1IQ3A 2M3WA 5HLOA 4AOMA 1YTZC 1Y1AA 1XFYO 2K7BA 2L50A 2KYFA 1LINA 2L2EA 1FW4A 4I5NB 4ZCVA 3EVVA 1QX2A 1PSRA 1S6IA 2KNEA 2PASA 2JQ6A 2JU0A 2L4HA 3SIAA 5AERA 1AVSA 5ER4X 2BCBA 3HX4A 2M9GA 2NLNA 2LMUA 1G8IA 1Y1UA
chains in the Genus database with same CATH superfamily
5CSFA 1CLLA 5IBWA 2COLB 2P71A 4E68A 2WCHA 3I5FB 4HSZA 1TIZA 3O2PA 1S6CA 2WCMA 3DF0A 2PYQA 2WCLA 4ORBB 2KLEA 3SS4A 2H8VA 2KAXA 3CTNA 4GFTA 4PCWA 3EK4A 4YGEB 1S5GZ 3KHEA 1L2OC 1UP5A 1F54A 1XA5A 2KI6C 1ALVA 1F55A 1SY9A 3JTDC 2BNXA 3BUWB 1KSMA 4MSPA 2KHNA 1C07A 4MLWA 1S5GY 3SIBA 4ETOA 2WCJA 3PM8A 1V1GA 1RFJA 5KU1A 1IRJA 2R2IA 2H61A 3TS5B 2FJYA 1J7OA 1ZOTB 2MAZA 1SR6C 4XYNA 1PVBA 2ZKMX 1CNPA 2K7CA 2JNXA 4OKHA 2L51A 3BFBA 1DGUA 5JOLA 1Y0VH 2LP2A 2H61C 3S0DA 1DVIA 2CT9A 2EC6B 2BKHB 3VRRA 1M46A 3CZ2A 1HQVA 1CLMA 4PE7A 4QJ4B 4GPLB 3S0GA 2OS8B 2JTZA 3DVKA 1K8UA 2MA2A 2WCFA 3I5HC 3OX6A 2MRDA 1G4YR 3I5IB 3OX5A 2GGZA 1J7RA 1GQMA 1KQMC 1TNQA 5F6TA 5G08A 2I7AA 1CFPA 1RECA 2LANA 1F71A 2KGBC 2LMTA 1K90D 1XYDA 1YR5A 5AANA 1QJTA 3ICBA 1PVAA 3I5FC 5FI7A 2WNDA 1NX0A 2WCKA 1MF8B 1G33A 1XK4A 3OBVA 3DVMA 1KFUL 2H2KA 4C0KA 1TNXA 1M63B 3GK1A 4MZLA 1OMDA 1OZSA 2Y5IA 2CXJA 2KPHA 2Y1MA 1XK4C 3KPXA 1B7TZ 3FIAA 3NGVA 1DTLA 3DD4A 3KO0A 1SL8A 1AUIB 1DMOA 1SBJA 3B7AA 2KQYA 1YX8A 3SJSA 4F7FA 4N1GA 1A2XA 1B7TY 4UPGA 1DF0B 3EG5B 1DC1A 1DELA 2FCDA 1TN4A 2QEHA 4N5XA 1UHJA 1KCYA 2KBIA 2FJUB 3EKJA 1GGZA 2BECA 4GBAA 5TNCA 3D75A 1V1FA 1CDPA 3O6BA 1L7ZA 2LVKA 2Y1NA 3HCMA 2Q91A 3IQOA 4PHKA 2EC6C 1D1OA 4PT1A 4FTGA 1FPWA 3EK7A 1Z4HA 2LE9B 5HKYA 1PULA 1C3YA 1OOGA 1NUBA 1RROA 5GQQC 2LHLA 1PK0D 1BR4B 3SG2A 3R72A 1ALWA 1OOIX 2ZN8A 4OCIA 1SMGA 3I5IC 1TCOB 3DZTA 3FS7A 1AK8A 1EXRA 2K7OA 2MJWB 2K60A 4YRUA 2BCAA 5D69A 1K9KA 1A4PA 1XVJA 2AAOA 3CR5X 3FE9A 4WRIA 3DYEA 4DCKA 1QVIZ 3OP0A 1QATA 5FYXA 1QXPA 1S36A 1EG3A 2SCPA 3E3RA 4MZKA 3SG5A 1FI6A 2LAPA 1UHIA 1BR1B 4CIDA 1SNLA 1QVIY 3EKHA 1MQ1A 4NDCA 1U5IB 4WQ3A 2NCPA 2O60A 1SK6D 1DF0A 3CABA 3D74A 2NXQA 1QS7A 5EL2A 3SG4A 1A29A 2LUXA 1SCMB 2KAYA 1MR8A 3FE8A 2M97A 4OZDA 1RWYA 2JXCA 5PALA 1A75A 4DRWA 1CFFA 1JFJA 1BJFA 2F2OA 2MLEC 2K8MB 2LVJA 4PE1A 4INXA 1DJHA 1CDNA 1JC2A 3N7HA 4N1FA 1QV1A 2KFFA 2WOSA 1XFWO 3O4YA 1JF0A 2MBXA 2KBMA 1SPYA 3B87A 3D0YA 5CSNA 3IVTA 1H8BA 1B8LA 2ZRTA 3R1PA 3CYZA 4GGFA 3BFAA 2LLTA 4P2YB 4C0JA 1KK8B 2BL0B 3D76A 2F3YA 3PFVA 4I5JA 4YGAA 1OMVA 1WRLA 1JUOA 1AHRA 1IJ6A 1MHOA 1OE9B 1KWOB 1F70A 4GGFC 1NPQA 2A4JA 1OZOA 3DXLA 1DT7B 1BG1A 1NYAA 1BU3A 1J7QA 3SG7A 1TUZA 3I5GB 2ISDA 4XJKB 2KI4B 1CKKA 1LKJA 2ZNDA 1GM0A 3OB2B 2L98A 2F33A 4ORCB 3NSIA 1HT9A 2OPOA 3V2LA 1Q80A 3A8RA 1ODBA 2OTGB 3CZTX 1K9PA 1U5IA 2BAPA 3BJHA 5HYDA 1BOCA 3R1VA 1N2DA 1K94A 4PHMA 1X02A 2YGUA 3BOWB 4YGBB 1S3PA 2KQ6A 4INWA 4DS7A 3OGNA 3LK1A 3OHMB 5I2QA 1BLQA 1YUTA 1DQEA 4YI9A 1Y6WA 1LVCD 3S0AA 4MEWA 3VRNA 2GV5A 2LC5A 2LHIA 2LV7A 1TRFA 3BQ3A 3AKAA 1W7JB 2KOTA 5AEQA 4L9MA 3RLZA 1YURA 1E8AA 5HKZA 1DJIA 5HKWA 1K9UA 5DKRA 1TUJA 1K2HA 4Q04A 1B8CA 5DICA 3MSEB 4YI8A 1CTRA 3D78A 3QRXA 2K2FA 1RK9A 4PHNA 2L0PA 3KEVA 1EG4A 2HPSA 1OMRA 1UURA 4OV2A 1YUSA 4MN0A 3D10A 1CMFA 1KK8C 5DKQA 3TDUA 2JC2A 3EK8A 2L4IA 1QWVA 4XJKA 5DKNA 3FE6A 2L5XB 2WC8A 2ERBA 1TNPA 2GGMA 3CR2A 3Q8IA 2PRUA 3JVTB 2G9BA 1NWDA 4OR9B 2KI4C 2RGIA 4DIRA 4NQGA 2JPOA 3CWGA 2F8PA 1TCFA 3BOWA 3VGOA 2CBLA 1QIWA 2LCPA 1RJVA 1XFUO 4NDDA 1B1GA 2V53A 3GK2A 3L4LA 1H4BA 3EVRA 3RZSA 2HQWA 2KGRA 1OSAA 3TS5C 3S0EA 1GGWA 3AAJA 4TNCA 1MUXA 4HRHA 2BBMA 3PN7B 1SW8A 1DJZA 3VROA 2M1UA 2GTEA 1CDMA 1DJWA 1F8HA 1M39A 2MHHA 3WXAA 2KYCA 1OOHA 4I5LB 1TNWA 3K1EA 2BE6A 1PRWA 3TDIA 2LMVA 1NX3A 5FI2A 3ZWHA 4QJ5B 2ZRSA 5D3OA 5HL1A 2OS8C 4BY4A 1FF1A 2JRFA 1QASA 4OVNF 1SL9A 3WNXB 1YVHA 4BY5A 5I2OA 4USLA 2L2CA 3M0WA 3WHUB 3FWBA 4JWQA 1LA0A 5HLVA 2IS9A 5I2LA 1CFCA 1YX7A 3DVJA 3LLEA 4MBEA 1OW4A 2CNPA 2NZ0A 3GOFA 3SG6A 4YGDB 1WLZA 2JXLA 2DOQA 2LVIA 2JT3A 2JPTA 2Y4QA 1JFKA 2BKIB 3NSKA 1KFXS 3LK0A 1QTXA 3CGAA 1FI5A 2KFGA 1DEKA 1OOFA 1EH2A 3PSRA 2K61A 4PDZA 1CM1A 1L2OB 2QEOA 3L4AA 2KDHA 3LL8B 3F45A 2D8NA 1NX1A 1YUUA 3S0FA 1QX5B 3O4XA 1CLBA 2HF5A 2KSPA 1MWNA 3BUOB 3UNWA 3SG3A 1FBVA 1QLSA 1TTXA 2HQ8A 2LNKA 3O78A 1UHHA 3VRPA 1JSAA 1KQVA 1NCYA 2B1UA 3PN7C 4AQJA 1LS8A 2PVBA 1C7WA 3BYAA 5BPJA 1KSOA 2ZFDA 1NX2A 2PQLA 1IKUA 1SR6B 3IF7A 1S6JA 1AJ4A 1DJXA 3TZ1A 4M2QA 3AAKA 1IIOA 2ZNEA 3CS1A 1XO5A 2FOTA 1EJ3A 3VRQA 4CFQA 3FWCA 4A4BA 1BF5A 1SYMA 1ZFSA 4MZJA 1QIVA 3LCPC 4P5OE 4YGCB 1J7PA 5JJGA 1IQ3A 3R1OA 4JPZB 1WRKA 2LLUA 2KI6D 4R1EA 1BODA 2O5GA 3I5HB 3QMEA 1UUSA 2LUCA 3SS3A 2EHBA 1VRKA 4JKTA 2F3ZA 1LA3A 2CTNA 3CZ0A 1KQMB 2QEVA 1SKTA 4AQIA 2WCEA 4DUQA 3B6XA 2M8UA 3BUNB 1B9AA 1S1EA 2M29A 1A03A 3PM2A 1OOJA 1UHNA 1B8RA 4MRYA 1R2UA 2PMYA 2LLSA 3CDNA 5I8NA 1BT6A 1M31A 1YRTB 1WDCB 1NIWA 2KFHA 2Q4UA 1ZMZA 1SCMC 2JT0A 1S26D 5B8IB 1JBAA 2BE4A 4WQ2A 4IJ7A 2M7LA 1IQ5A 2JNFA 2JT8A 4ZCUA 3C1VA 3IQQA 1J1DA 2E30A 1QLKA 3CZ1A 1J55A 2WC5A 1M45A 1Y1XA 2M1KB 2L5YA 4PALA 1LXFC 1XFZO 1AJ5A 1YRUB 2KLDA 4PHJA 3D73A 3DVEA 1KFXL 5CPVA 3NSLA 3TDZA 2BL0C 1N65A 1PALA 3H4SE 4M2PA 3RM1A 2JWWA 1UWOA 4C0LA 4F0ZB 2LM5A 3DY9A 5ER5A 5KTYA 1IWQA 4FQTA 1KWOC 4CFRA 3A4UB 3BUMB 3BFHA 2E6WA 1IG5A 1JF2A 2P6BB 1ZACA 2I18A 2QACA 2QPTA 2M49B 3BUXB 3I5GC 3B86A 1CFDA 1WY9A 2HETA 2LP3A 3ZNIA 1RTP1 4GNKB 4A4CA 1IH0A 1MXEA 2JZIA 2MLFC 2JTTA 2OTGC 1UHKA 4QJ3B 3NHIA 1W7IB 2AUCA 3K21A 1IGVA 1BMOA 1XFRA 3B88A 1XFVO 3EVUA 3NXAA 3PATA 1ZUZA 2PALA 2CCMA 3WHTB 4D1EA 1P28A 2JOJA 4GAOA 5CSJA 3S0BA 4IL1A 1JWDA 3GK4X 1K93D 1WDCC 4HRGA 3CLNA 1WRZA 1NSHA 1CDLA 4MVFA 1Z2CB 3NSOA 4FQOA 4U8DA 2F2PA 1IJ5A 1OQPA 2ZN9A 1F4QA 1XFXO 1NP8A 2K2AA 1SRAA 1MXLC 2EGDA 3AKBA 1B4CA 4GUKA 4HREE 2FCEA 4PE4A 3TUYB 2BCXA 1SCVA 2KAVA 4JD9A 1T14A 1CB1A 3PLFB 1A75B 2NCOA 1TOPA 2K7DA 5KSZA 4PE0A 1C7VA 2I94A 2I2RE 2QEBA 2AMIA 1C3ZA 1F4OA 2M0RA 3D0YB 2TN4A 3PJIA 4ORAB 1CM4A 3JVTC 5FI6A 5J3XA 3SS5A 1YVLA 1CMGA 1SL7A 3KF9A 4ICBA 1K96A 3CR4X 4GGNA 5D7FA 3DF0B 5AXIA 4CPVA 3BXKA 3JTDB 1WLMA 3VB1A 1QV0A 2PSRA 1PSBA 1DGVA 4M2OA 1NCZA 3PALA 4KYNA 4JQ0D 4I5KA 1KK7Z 1N0YA 1NCXA 1AP4A 1EL4A 4YBHB 3L47A 1K95A 3D77A 2P70A 5CSIA 1R6PA 3NHTA 1KFUS 2K0JA 1DJGA 1B47A 3OB1B 1KK7Y 2M7NA 4NDBA 2LVVA 2VRGA 2BBNA 2WC6A 4MRXA 2WCBA 1ORGA 2G2BA 2SASA 1DJYA 5K89A 1GJYA 1W9ZA 2JULA 4CLNA 2WORA 1QX7A 3TUYC 5AFPA 1J1EA 3UO9A 2M3WA 5HLOA 4AOMA 1YTZC 1Y1AA 1XFYO 2K7BA 2L50A 2KYFA 1LINA 2L2EA 1FW4A 2QDIA 4I5NB 4ZCVA 5I94A 3EVVA 1QX2A 1PSRA 1S6IA 2KNEA 2PASA 2JQ6A 2JU0A 2L4HA 3SIAA 1SSEB 1AVSA 5ER4X 5AERA 2BCBA 3HX4A 1TWOA 2M9GA 2NLNA 2LMUA 1G8IA 1Y1UA
chains in the Genus database with same CATH topology
5CSFA 1CLLA 5IBWA 2COLB 4E68A 3I5FB 4HSZA 1TIZA 3O2PA 1S6CA 3DF0A 4ORBB 4GFTA 2KAXA 3CTNA 4PCWA 3EK4A 4YGEB 1S5GZ 3KHEA 1L2OC 1UP5A 1F54A 1XA5A 2KI6C 1ALVA 1F55A 1SY9A 3JTDC 4MSPA 3BUWB 1KSMA 2KHNA 1C07A 4MLWA 1S5GY 3SIBA 4ETOA 3PM8A 1V1GA 1RFJA 5KU1A 1IRJA 2R2IA 2H61A 3TS5B 1J7OA 1ZOTB 2MAZA 1SR6C 4XYNA 1PVBA 2ZKMX 1CNPA 2K7CA 2JNXA 4OKHA 2L51A 1DGUA 5JOLA 1Y0VH 2LP2A 2H61C 1DVIA 2CT9A 2EC6B 2BKHB 3VRRA 1M46A 1HQVA 1CLMA 4PE7A 4QJ4B 4GPLB 2OS8B 2JTZA 3DVKA 1K8UA 2MA2A 2WCFA 3I5HC 3OX6A 2MRDA 1G4YR 3I5IB 3OX5A 2GGZA 1J7RA 1GQMA 1KQMC 1TNQA 5F6TA 5G08A 2I7AA 1CFPA 1RECA 2LANA 1F71A 2KGBC 2LMTA 1K90D 1XYDA 1YR5A 5AANA 1QJTA 3ICBA 1PVAA 3I5FC 2WNDA 1NX0A 1MF8B 1G33A 1XK4A 3DVMA 1KFUL 2H2KA 4C0KA 1TNXA 1M63B 3GK1A 4MZLA 1OMDA 1OZSA 2Y5IA 2CXJA 2Y1MA 1XK4C 3KPXA 1B7TZ 3FIAA 1DTLA 3DD4A 3KO0A 1SL8A 1AUIB 1DMOA 1SBJA 2KQYA 1YX8A 3SJSA 4UPGA 4N1GA 1A2XA 1B7TY 1DF0B 2FCDA 1TN4A 4N5XA 1UHJA 1KCYA 2KBIA 2FJUB 3EKJA 1GGZA 2BECA 4GBAA 5TNCA 3O6BA 1V1FA 1CDPA 1L7ZA 2LVKA 2Y1NA 3HCMA 2Q91A 3IQOA 4PHKA 2EC6C 1D1OA 4FTGA 1FPWA 3EK7A 2LE9B 5HKYA 1PULA 1NUBA 1RROA 5GQQC 2LHLA 1PK0D 1BR4B 3SG2A 1ALWA 2ZN8A 4OCIA 1SMGA 3I5IC 1TCOB 3FS7A 1AK8A 1EXRA 2K7OA 2MJWB 4YRUA 2BCAA 5D69A 1K9KA 2AAOA 1A4PA 1XVJA 3CR5X 4WRIA 4DCKA 1QVIZ 3OP0A 1QATA 5FYXA 1QXPA 1S36A 1EG3A 2SCPA 3E3RA 4MZKA 3SG5A 1FI6A 2LAPA 1UHIA 1BR1B 4CIDA 1SNLA 1QVIY 3EKHA 1MQ1A 4NDCA 1U5IB 4WQ3A 2NCPA 2O60A 1SK6D 1DF0A 2NXQA 1QS7A 3SG4A 1A29A 2LUXA 1SCMB 2KAYA 1MR8A 2M97A 5PALA 1RWYA 2JXCA 4DRWA 1A75A 1CFFA 1JFJA 1BJFA 2F2OA 2MLEC 2K8MB 2LVJA 4PE1A 1DJHA 1CDNA 1JC2A 4N1FA 1QV1A 2KFFA 2WOSA 1XFWO 3O4YA 1JF0A 2MBXA 2KBMA 1SPYA 3D0YA 5CSNA 1H8BA 1B8LA 2ZRTA 4GGFA 2LLTA 4P2YB 4C0JA 1KK8B 2BL0B 2F3YA 3PFVA 4I5JA 4YGAA 1OMVA 1WRLA 1JUOA 1AHRA 1IJ6A 1MHOA 1OE9B 1KWOB 1F70A 4GGFC 1NPQA 2A4JA 1OZOA 1DT7B 1BG1A 1NYAA 1BU3A 1J7QA 3SG7A 3I5GB 2ISDA 4XJKB 2KI4B 1CKKA 1LKJA 2ZNDA 3OB2B 2L98A 2F33A 4ORCB 3NSIA 1HT9A 2OPOA 1Q80A 3A8RA 1ODBA 2OTGB 3CZTX 1K9PA 1U5IA 5HYDA 1BOCA 1N2DA 1K94A 4PHMA 1X02A 3BOWB 4YGBB 1S3PA 2KQ6A 4DS7A 3LK1A 3OHMB 5I2QA 1BLQA 1YUTA 4YI9A 1Y6WA 1LVCD 4MEWA 3VRNA 2GV5A 2LC5A 2LHIA 2LV7A 1TRFA 3BQ3A 3AKAA 1W7JB 2KOTA 5AEQA 4L9MA 3RLZA 1YURA 1E8AA 5HKZA 1DJIA 5HKWA 1K9UA 5DKRA 1K2HA 4Q04A 1B8CA 3MSEB 4YI8A 1CTRA 3QRXA 2K2FA 1RK9A 4PHNA 2L0PA 3KEVA 1EG4A 2HPSA 1OMRA 1UURA 4OV2A 1YUSA 4MN0A 3D10A 1CMFA 1KK8C 5DKQA 3TDUA 2JC2A 3EK8A 2L4IA 4XJKA 5DKNA 2L5XB 2WC8A 1TNPA 2GGMA 3CR2A 2PRUA 3JVTB 2G9BA 1NWDA 4OR9B 2KI4C 2RGIA 4DIRA 4NQGA 3CWGA 2F8PA 1TCFA 3BOWA 3VGOA 2CBLA 1QIWA 2LCPA 1RJVA 1XFUO 4NDDA 1B1GA 2V53A 3GK2A 1H4BA 3EVRA 2HQWA 2KGRA 1OSAA 3TS5C 1GGWA 3AAJA 4TNCA 1MUXA 4HRHA 2BBMA 3PN7B 1SW8A 1DJZA 3VROA 2M1UA 1CDMA 1DJWA 1F8HA 1M39A 2MHHA 3WXAA 2KYCA 4I5LB 1TNWA 2BE6A 1PRWA 3TDIA 2LMVA 1NX3A 3ZWHA 4QJ5B 2ZRSA 2OS8C 4BY4A 1FF1A 2JRFA 1QASA 4OVNF 1SL9A 3WNXB 1YVHA 4BY5A 5I2OA 4USLA 3M0WA 3WHUB 3FWBA 4JWQA 1LA0A 5HLVA 2IS9A 5I2LA 1CFCA 1YX7A 3DVJA 3LLEA 4MBEA 2CNPA 2NZ0A 3GOFA 3SG6A 4YGDB 1WLZA 2JXLA 2DOQA 2LVIA 2JT3A 2JPTA 2Y4QA 1JFKA 2BKIB 3NSKA 1KFXS 3LK0A 1QTXA 3CGAA 1FI5A 2KFGA 1EH2A 3PSRA 2K61A 4PDZA 1CM1A 1L2OB 2KDHA 3LL8B 3F45A 2D8NA 1NX1A 1YUUA 1CLBA 1QX5B 2HF5A 2KSPA 1MWNA 3BUOB 3SG3A 1FBVA 1QLSA 1TTXA 2HQ8A 2LNKA 3O78A 1UHHA 3VRPA 1JSAA 1KQVA 1NCYA 2B1UA 3PN7C 4AQJA 2PVBA 1C7WA 3BYAA 5BPJA 1KSOA 2ZFDA 1NX2A 1IKUA 1SR6B 3IF7A 1S6JA 1AJ4A 1DJXA 3TZ1A 4M2QA 3AAKA 2ZNEA 3CS1A 1XO5A 2FOTA 1EJ3A 3VRQA 4CFQA 3FWCA 4A4BA 1BF5A 1SYMA 1ZFSA 4MZJA 1QIVA 3LCPC 4P5OE 4YGCB 1J7PA 5JJGA 4JPZB 1WRKA 2LLUA 2KI6D 4R1EA 1BODA 2O5GA 3I5HB 1UUSA 2LUCA 2EHBA 1VRKA 2F3ZA 1LA3A 2CTNA 1KQMB 4AQIA 1SKTA 2WCEA 4DUQA 2M8UA 3BUNB 1B9AA 1S1EA 2M29A 1A03A 1OOJA 1UHNA 1B8RA 4MRYA 1R2UA 2PMYA 2LLSA 5I8NA 1BT6A 1M31A 1YRTB 1WDCB 1NIWA 2KFHA 2Q4UA 1ZMZA 1SCMC 2JT0A 1S26D 5B8IB 1JBAA 2BE4A 4WQ2A 2M7LA 1IQ5A 2JNFA 2JT8A 4ZCUA 3C1VA 3IQQA 1J1DA 2E30A 1QLKA 1J55A 1M45A 1Y1XA 2M1KB 4PALA 1LXFC 1XFZO 1AJ5A 1YRUB 4PHJA 3DVEA 1KFXL 5CPVA 3NSLA 3TDZA 2BL0C 1N65A 1PALA 3H4SE 4M2PA 3RM1A 2JWWA 1UWOA 4C0LA 4F0ZB 2LM5A 5ER5A 5KTYA 1IWQA 1KWOC 4CFRA 3A4UB 3BUMB 2E6WA 1IG5A 1JF2A 2P6BB 1ZACA 2I18A 2QACA 2QPTA 2M49B 3BUXB 3I5GC 1CFDA 1WY9A 2HETA 2LP3A 3ZNIA 1RTP1 4GNKB 4A4CA 1IH0A 1MXEA 2JZIA 2MLFC 2JTTA 2OTGC 1UHKA 4QJ3B 1W7IB 2AUCA 3K21A 1IGVA 1BMOA 1XFVO 3EVUA 3NXAA 3PATA 1ZUZA 2PALA 2CCMA 3WHTB 4D1EA 2JOJA 4GAOA 5CSJA 4IL1A 1JWDA 3GK4X 1K93D 1WDCC 4HRGA 3CLNA 1WRZA 1NSHA 1CDLA 4MVFA 3NSOA 4FQOA 4U8DA 2F2PA 1IJ5A 1OQPA 2ZN9A 1F4QA 1XFXO 1NP8A 2K2AA 1SRAA 1MXLC 2EGDA 3AKBA 1B4CA 4GUKA 4HREE 2FCEA 4PE4A 3TUYB 2BCXA 1SCVA 2KAVA 1CB1A 3PLFB 1A75B 2NCOA 1TOPA 2K7DA 5KSZA 4PE0A 1C7VA 2I94A 2I2RE 2AMIA 1F4OA 2M0RA 3D0YB 2TN4A 4ORAB 1CM4A 3JVTC 5J3XA 1YVLA 1CMGA 1SL7A 3KF9A 4ICBA 1K96A 3CR4X 4GGNA 5D7FA 3DF0B 5AXIA 4CPVA 3BXKA 3JTDB 1WLMA 1QV0A 2PSRA 1PSBA 1DGVA 4M2OA 1NCZA 3PALA 4JQ0D 4I5KA 1KK7Z 1N0YA 1NCXA 1AP4A 1EL4A 4YBHB 1K95A 5CSIA 1R6PA 1KFUS 2K0JA 1DJGA 1B47A 3OB1B 1KK7Y 2M7NA 4NDBA 2LVVA 2VRGA 2BBNA 4MRXA 2WCBA 2G2BA 2SASA 1DJYA 5K89A 1GJYA 2JULA 4CLNA 2WORA 1QX7A 3TUYC 5AFPA 1J1EA 1IQ3A 2M3WA 5HLOA 4AOMA 1YTZC 1Y1AA 1XFYO 2K7BA 2L50A 2KYFA 1LINA 2L2EA 1FW4A 4I5NB 4ZCVA 3EVVA 1QX2A 1PSRA 1S6IA 2KNEA 2PASA 2JQ6A 2JU0A 2L4HA 3SIAA 5AERA 1AVSA 5ER4X 2BCBA 3HX4A 2M9GA 2NLNA 2LMUA 1G8IA 1Y1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CSF A;  1CLL A;  5IBW A;  2COL B;  4E68 A;  3I5F B;  4HSZ A;  1TIZ A;  3O2P A;  1S6C A;  3DF0 A;  4ORB B;  4GFT A;  2KAX A;  3CTN A;  4PCW A;  3EK4 A;  4YGE B;  1S5G Z;  3KHE A;  1L2O C;  1UP5 A;  1F54 A;  1XA5 A;  2KI6 C;  1ALV A;  1F55 A;  1SY9 A;  3JTD C;  4MSP A;  3BUW B;  1KSM A;  2KHN A;  1C07 A;  4MLW A;  1S5G Y;  3SIB A;  4ETO A;  3PM8 A;  1V1G A;  1RFJ A;  5KU1 A;  1IRJ A;  2R2I A;  2H61 A;  3TS5 B;  1J7O A;  1ZOT B;  2MAZ A;  1SR6 C;  4XYN A;  1PVB A;  2ZKM X;  1CNP A;  2K7C A;  2JNX A;  4OKH A;  2L51 A;  1DGU A;  5JOL A;  1Y0V H;  2LP2 A;  2H61 C;  1DVI A;  2CT9 A;  2EC6 B;  2BKH B;  3VRR A;  1M46 A;  1HQV A;  1CLM A;  4PE7 A;  4QJ4 B;  4GPL B;  2OS8 B;  2JTZ A;  3DVK A;  1K8U A;  2MA2 A;  2WCF A;  3I5H C;  3OX6 A;  2MRD A;  1G4Y R;  3I5I B;  3OX5 A;  2GGZ A;  1J7R A;  1GQM A;  1KQM C;  1TNQ A;  5F6T A;  5G08 A;  2I7A A;  1CFP A;  1REC A;  2LAN A;  1F71 A;  2KGB C;  2LMT A;  1K90 D;  1XYD A;  1YR5 A;  5AAN A;  1QJT A;  3ICB A;  1PVA A;  3I5F C;  2WND A;  1NX0 A;  1MF8 B;  1G33 A;  1XK4 A;  3DVM A;  1KFU L;  2H2K A;  4C0K A;  1TNX A;  1M63 B;  3GK1 A;  4MZL A;  1OMD A;  1OZS A;  2Y5I A;  2CXJ A;  2Y1M A;  1XK4 C;  3KPX A;  1B7T Z;  3FIA A;  1DTL A;  3DD4 A;  3KO0 A;  1SL8 A;  1AUI B;  1DMO A;  1SBJ A;  2KQY A;  1YX8 A;  3SJS A;  4UPG A;  4N1G A;  1A2X A;  1B7T Y;  1DF0 B;  2FCD A;  1TN4 A;  4N5X A;  1UHJ A;  1KCY A;  2KBI A;  2FJU B;  3EKJ A;  1GGZ A;  2BEC A;  4GBA A;  5TNC A;  3O6B A;  1V1F A;  1CDP A;  1L7Z A;  2LVK A;  2Y1N A;  3HCM A;  2Q91 A;  3IQO A;  4PHK A;  2EC6 C;  1D1O A;  4FTG A;  1FPW A;  3EK7 A;  2LE9 B;  5HKY A;  1PUL A;  1NUB A;  1RRO A;  5GQQ C;  2LHL A;  1PK0 D;  1BR4 B;  3SG2 A;  1ALW A;  2ZN8 A;  4OCI A;  1SMG A;  3I5I C;  1TCO B;  3FS7 A;  1AK8 A;  1EXR A;  2K7O A;  2MJW B;  4YRU A;  2BCA A;  5D69 A;  1K9K A;  2AAO A;  1A4P A;  1XVJ A;  3CR5 X;  4WRI A;  4DCK A;  1QVI Z;  3OP0 A;  1QAT A;  5FYX A;  1QXP A;  1S36 A;  1EG3 A;  2SCP A;  3E3R A;  4MZK A;  3SG5 A;  1FI6 A;  2LAP A;  1UHI A;  1BR1 B;  4CID A;  1SNL A;  1QVI Y;  3EKH A;  1MQ1 A;  4NDC A;  1U5I B;  4WQ3 A;  2NCP A;  2O60 A;  1SK6 D;  1DF0 A;  2NXQ A;  1QS7 A;  3SG4 A;  1A29 A;  2LUX A;  1SCM B;  2KAY A;  1MR8 A;  2M97 A;  5PAL A;  1RWY A;  2JXC A;  4DRW A;  1A75 A;  1CFF A;  1JFJ A;  1BJF A;  2F2O A;  2MLE C;  2K8M B;  2LVJ A;  4PE1 A;  1DJH A;  1CDN A;  1JC2 A;  4N1F A;  1QV1 A;  2KFF A;  2WOS A;  1XFW O;  3O4Y A;  1JF0 A;  2MBX A;  2KBM A;  1SPY A;  3D0Y A;  5CSN A;  1H8B A;  1B8L A;  2ZRT A;  4GGF A;  2LLT A;  4P2Y B;  4C0J A;  1KK8 B;  2BL0 B;  2F3Y A;  3PFV A;  4I5J A;  4YGA A;  1OMV A;  1WRL A;  1JUO A;  1AHR A;  1IJ6 A;  1MHO A;  1OE9 B;  1KWO B;  1F70 A;  4GGF C;  1NPQ A;  2A4J A;  1OZO A;  1DT7 B;  1BG1 A;  1NYA A;  1BU3 A;  1J7Q A;  3SG7 A;  3I5G B;  2ISD A;  4XJK B;  2KI4 B;  1CKK A;  1LKJ A;  2ZND A;  3OB2 B;  2L98 A;  2F33 A;  4ORC B;  3NSI A;  1HT9 A;  2OPO A;  1Q80 A;  3A8R A;  1ODB A;  2OTG B;  3CZT X;  1K9P A;  1U5I A;  5HYD A;  1BOC A;  1N2D A;  1K94 A;  4PHM A;  1X02 A;  3BOW B;  4YGB B;  1S3P A;  2KQ6 A;  4DS7 A;  3LK1 A;  3OHM B;  5I2Q A;  1BLQ A;  1YUT A;  4YI9 A;  1Y6W A;  1LVC D;  4MEW A;  3VRN A;  2GV5 A;  2LC5 A;  2LHI A;  2LV7 A;  1TRF A;  3BQ3 A;  3AKA A;  1W7J B;  2KOT A;  5AEQ A;  4L9M A;  3RLZ A;  1YUR A;  1E8A A;  5HKZ A;  1DJI A;  5HKW A;  1K9U A;  5DKR A;  1K2H A;  4Q04 A;  1B8C A;  3MSE B;  4YI8 A;  1CTR A;  3QRX A;  2K2F A;  1RK9 A;  4PHN A;  2L0P A;  3KEV A;  1EG4 A;  2HPS A;  1OMR A;  1UUR A;  4OV2 A;  1YUS A;  4MN0 A;  3D10 A;  1CMF A;  1KK8 C;  5DKQ A;  3TDU A;  2JC2 A;  3EK8 A;  2L4I A;  4XJK A;  5DKN A;  2L5X B;  2WC8 A;  1TNP A;  2GGM A;  3CR2 A;  2PRU A;  3JVT B;  2G9B A;  1NWD A;  4OR9 B;  2KI4 C;  2RGI A;  4DIR A;  4NQG A;  3CWG A;  2F8P A;  1TCF A;  3BOW A;  3VGO A;  2CBL A;  1QIW A;  2LCP A;  1RJV A;  1XFU O;  4NDD A;  1B1G A;  2V53 A;  3GK2 A;  1H4B A;  3EVR A;  2HQW A;  2KGR A;  1OSA A;  3TS5 C;  1GGW A;  3AAJ A;  4TNC A;  1MUX A;  4HRH A;  2BBM A;  3PN7 B;  1SW8 A;  1DJZ A;  3VRO A;  2M1U A;  1CDM A;  1DJW A;  1F8H A;  1M39 A;  2MHH A;  3WXA A;  2KYC A;  4I5L B;  1TNW A;  2BE6 A;  1PRW A;  3TDI A;  2LMV A;  1NX3 A;  3ZWH A;  4QJ5 B;  2ZRS A;  2OS8 C;  4BY4 A;  1FF1 A;  2JRF A;  1QAS A;  4OVN F;  1SL9 A;  3WNX B;  1YVH A;  4BY5 A;  5I2O A;  4USL A;  3M0W A;  3WHU B;  3FWB A;  4JWQ A;  1LA0 A;  5HLV A;  2IS9 A;  5I2L A;  1CFC A;  1YX7 A;  3DVJ A;  3LLE A;  4MBE A;  2CNP A;  2NZ0 A;  3GOF A;  3SG6 A;  4YGD B;  1WLZ A;  2JXL A;  2DOQ A;  2LVI A;  2JT3 A;  2JPT A;  2Y4Q A;  1JFK A;  2BKI B;  3NSK A;  1KFX S;  3LK0 A;  1QTX A;  3CGA A;  1FI5 A;  2KFG A;  1EH2 A;  3PSR A;  2K61 A;  4PDZ A;  1CM1 A;  1L2O B;  2KDH A;  3LL8 B;  3F45 A;  2D8N A;  1NX1 A;  1YUU A;  1CLB A;  1QX5 B;  2HF5 A;  2KSP A;  1MWN A;  3BUO B;  3SG3 A;  1FBV A;  1QLS A;  1TTX A;  2HQ8 A;  2LNK A;  3O78 A;  1UHH A;  3VRP A;  1JSA A;  1KQV A;  1NCY A;  2B1U A;  3PN7 C;  4AQJ A;  2PVB A;  1C7W A;  3BYA A;  5BPJ A;  1KSO A;  2ZFD A;  1NX2 A;  1IKU A;  1SR6 B;  3IF7 A;  1S6J A;  1AJ4 A;  1DJX A;  3TZ1 A;  4M2Q A;  3AAK A;  2ZNE A;  3CS1 A;  1XO5 A;  2FOT A;  1EJ3 A;  3VRQ A;  4CFQ A;  3FWC A;  4A4B A;  1BF5 A;  1SYM A;  1ZFS A;  4MZJ A;  1QIV A;  3LCP C;  4P5O E;  4YGC B;  1J7P A;  5JJG A;  4JPZ B;  1WRK A;  2LLU A;  2KI6 D;  4R1E A;  1BOD A;  2O5G A;  3I5H B;  1UUS A;  2LUC A;  2EHB A;  1VRK A;  2F3Z A;  1LA3 A;  2CTN A;  1KQM B;  4AQI A;  1SKT A;  2WCE A;  4DUQ A;  2M8U A;  3BUN B;  1B9A A;  1S1E A;  2M29 A;  1A03 A;  1OOJ A;  1UHN A;  1B8R A;  4MRY A;  1R2U A;  2PMY A;  2LLS A;  5I8N A;  1BT6 A;  1M31 A;  1YRT B;  1WDC B;  1NIW A;  2KFH A;  2Q4U A;  1ZMZ A;  1SCM C;  2JT0 A;  1S26 D;  5B8I B;  1JBA A;  2BE4 A;  4WQ2 A;  2M7L A;  1IQ5 A;  2JNF A;  2JT8 A;  4ZCU A;  3C1V A;  3IQQ A;  1J1D A;  2E30 A;  1QLK A;  1J55 A;  1M45 A;  1Y1X A;  2M1K B;  4PAL A;  1LXF C;  1XFZ O;  1AJ5 A;  1YRU B;  4PHJ A;  3DVE A;  1KFX L;  5CPV A;  3NSL A;  3TDZ A;  2BL0 C;  1N65 A;  1PAL A;  3H4S E;  4M2P A;  3RM1 A;  2JWW A;  1UWO A;  4C0L A;  4F0Z B;  2LM5 A;  5ER5 A;  5KTY A;  1IWQ A;  1KWO C;  4CFR A;  3A4U B;  3BUM B;  2E6W A;  1IG5 A;  1JF2 A;  2P6B B;  1ZAC A;  2I18 A;  2QAC A;  2QPT A;  2M49 B;  3BUX B;  3I5G C;  1CFD A;  1WY9 A;  2HET A;  2LP3 A;  3ZNI A;  1RTP 1;  4GNK B;  4A4C A;  1IH0 A;  1MXE A;  2JZI A;  2MLF C;  2JTT A;  2OTG C;  1UHK A;  4QJ3 B;  1W7I B;  2AUC A;  3K21 A;  1IGV A;  1BMO A;  1XFV O;  3EVU A;  3NXA A;  3PAT A;  1ZUZ A;  2PAL A;  2CCM A;  3WHT B;  4D1E A;  2JOJ A;  4GAO A;  5CSJ A;  4IL1 A;  1JWD A;  3GK4 X;  1K93 D;  1WDC C;  4HRG A;  3CLN A;  1WRZ A;  1NSH A;  1CDL A;  4MVF A;  3NSO A;  4FQO A;  4U8D A;  2F2P A;  1IJ5 A;  1OQP A;  2ZN9 A;  1F4Q A;  1XFX O;  1NP8 A;  2K2A A;  1SRA A;  1MXL C;  2EGD A;  3AKB A;  1B4C A;  4GUK A;  4HRE E;  2FCE A;  4PE4 A;  3TUY B;  2BCX A;  1SCV A;  2KAV A;  1CB1 A;  3PLF B;  1A75 B;  2NCO A;  1TOP A;  2K7D A;  5KSZ A;  4PE0 A;  1C7V A;  2I94 A;  2I2R E;  2AMI A;  1F4O A;  2M0R A;  3D0Y B;  2TN4 A;  4ORA B;  1CM4 A;  3JVT C;  5J3X A;  1YVL A;  1CMG A;  1SL7 A;  3KF9 A;  4ICB A;  1K96 A;  3CR4 X;  4GGN A;  5D7F A;  3DF0 B;  5AXI A;  4CPV A;  3BXK A;  3JTD B;  1WLM A;  1QV0 A;  2PSR A;  1PSB A;  1DGV A;  4M2O A;  1NCZ A;  3PAL A;  4JQ0 D;  4I5K A;  1KK7 Z;  1N0Y A;  1NCX A;  1AP4 A;  1EL4 A;  4YBH B;  1K95 A;  5CSI A;  1R6P A;  1KFU S;  2K0J A;  1DJG A;  1B47 A;  3OB1 B;  1KK7 Y;  2M7N A;  4NDB A;  2LVV A;  2VRG A;  2BBN A;  4MRX A;  2WCB A;  2G2B A;  2SAS A;  1DJY A;  5K89 A;  1GJY A;  2JUL A;  4CLN A;  2WOR A;  1QX7 A;  3TUY C;  5AFP A;  1J1E A;  1IQ3 A;  2M3W A;  5HLO A;  4AOM A;  1YTZ C;  1Y1A A;  1XFY O;  2K7B A;  2L50 A;  2KYF A;  1LIN A;  2L2E A;  1FW4 A;  4I5N B;  4ZCV A;  3EVV A;  1QX2 A;  1PSR A;  1S6I A;  2KNE A;  2PAS A;  2JQ6 A;  2JU0 A;  2L4H A;  3SIA A;  5AER A;  1AVS A;  5ER4 X;  2BCB A;  3HX4 A;  2M9G A;  2NLN A;  2LMU A;  1G8I A;  1Y1U A; 
#chains in the Genus database with same CATH topology
 5CSF A;  1CLL A;  5IBW A;  2COL B;  2P71 A;  4E68 A;  2WCH A;  3I5F B;  4HSZ A;  1TIZ A;  3O2P A;  1S6C A;  2WCM A;  3DF0 A;  2PYQ A;  2WCL A;  4ORB B;  2KLE A;  3SS4 A;  2H8V A;  2KAX A;  3CTN A;  4GFT A;  4PCW A;  3EK4 A;  4YGE B;  1S5G Z;  3KHE A;  1L2O C;  1UP5 A;  1F54 A;  1XA5 A;  2KI6 C;  1ALV A;  1F55 A;  1SY9 A;  3JTD C;  2BNX A;  3BUW B;  1KSM A;  4MSP A;  2KHN A;  1C07 A;  4MLW A;  1S5G Y;  3SIB A;  4ETO A;  2WCJ A;  3PM8 A;  1V1G A;  1RFJ A;  5KU1 A;  1IRJ A;  2R2I A;  2H61 A;  3TS5 B;  2FJY A;  1J7O A;  1ZOT B;  2MAZ A;  1SR6 C;  4XYN A;  1PVB A;  2ZKM X;  1CNP A;  2K7C A;  2JNX A;  4OKH A;  2L51 A;  3BFB A;  1DGU A;  5JOL A;  1Y0V H;  2LP2 A;  2H61 C;  3S0D A;  1DVI A;  2CT9 A;  2EC6 B;  2BKH B;  3VRR A;  1M46 A;  3CZ2 A;  1HQV A;  1CLM A;  4PE7 A;  4QJ4 B;  4GPL B;  3S0G A;  2OS8 B;  2JTZ A;  3DVK A;  1K8U A;  2MA2 A;  2WCF A;  3I5H C;  3OX6 A;  2MRD A;  1G4Y R;  3I5I B;  3OX5 A;  2GGZ A;  1J7R A;  1GQM A;  1KQM C;  1TNQ A;  5F6T A;  5G08 A;  2I7A A;  1CFP A;  1REC A;  2LAN A;  1F71 A;  2KGB C;  2LMT A;  1K90 D;  1XYD A;  1YR5 A;  5AAN A;  1QJT A;  3ICB A;  1PVA A;  3I5F C;  5FI7 A;  2WND A;  1NX0 A;  2WCK A;  1MF8 B;  1G33 A;  1XK4 A;  3OBV A;  3DVM A;  1KFU L;  2H2K A;  4C0K A;  1TNX A;  1M63 B;  3GK1 A;  4MZL A;  1OMD A;  1OZS A;  2Y5I A;  2CXJ A;  2KPH A;  2Y1M A;  1XK4 C;  3KPX A;  1B7T Z;  3FIA A;  3NGV A;  1DTL A;  3DD4 A;  3KO0 A;  1SL8 A;  1AUI B;  1DMO A;  1SBJ A;  3B7A A;  2KQY A;  1YX8 A;  3SJS A;  4F7F A;  4N1G A;  1A2X A;  1B7T Y;  4UPG A;  1DF0 B;  3EG5 B;  1DC1 A;  1DEL A;  2FCD A;  1TN4 A;  2QEH A;  4N5X A;  1UHJ A;  1KCY A;  2KBI A;  2FJU B;  3EKJ A;  1GGZ A;  2BEC A;  4GBA A;  5TNC A;  3D75 A;  1V1F A;  1CDP A;  3O6B A;  1L7Z A;  2LVK A;  2Y1N A;  3HCM A;  2Q91 A;  3IQO A;  4PHK A;  2EC6 C;  1D1O A;  4PT1 A;  4FTG A;  1FPW A;  3EK7 A;  1Z4H A;  2LE9 B;  5HKY A;  1PUL A;  1C3Y A;  1OOG A;  1NUB A;  1RRO A;  5GQQ C;  2LHL A;  1PK0 D;  1BR4 B;  3SG2 A;  3R72 A;  1ALW A;  1OOI X;  2ZN8 A;  4OCI A;  1SMG A;  3I5I C;  1TCO B;  3DZT A;  3FS7 A;  1AK8 A;  1EXR A;  2K7O A;  2MJW B;  2K60 A;  4YRU A;  2BCA A;  5D69 A;  1K9K A;  1A4P A;  1XVJ A;  2AAO A;  3CR5 X;  3FE9 A;  4WRI A;  3DYE A;  4DCK A;  1QVI Z;  3OP0 A;  1QAT A;  5FYX A;  1QXP A;  1S36 A;  1EG3 A;  2SCP A;  3E3R A;  4MZK A;  3SG5 A;  1FI6 A;  2LAP A;  1UHI A;  1BR1 B;  4CID A;  1SNL A;  1QVI Y;  3EKH A;  1MQ1 A;  4NDC A;  1U5I B;  4WQ3 A;  2NCP A;  2O60 A;  1SK6 D;  1DF0 A;  3CAB A;  3D74 A;  2NXQ A;  1QS7 A;  5EL2 A;  3SG4 A;  1A29 A;  2LUX A;  1SCM B;  2KAY A;  1MR8 A;  3FE8 A;  2M97 A;  4OZD A;  1RWY A;  2JXC A;  5PAL A;  1A75 A;  4DRW A;  1CFF A;  1JFJ A;  1BJF A;  2F2O A;  2MLE C;  2K8M B;  2LVJ A;  4PE1 A;  4INX A;  1DJH A;  1CDN A;  1JC2 A;  3N7H A;  4N1F A;  1QV1 A;  2KFF A;  2WOS A;  1XFW O;  3O4Y A;  1JF0 A;  2MBX A;  2KBM A;  1SPY A;  3B87 A;  3D0Y A;  5CSN A;  3IVT A;  1H8B A;  1B8L A;  2ZRT A;  3R1P A;  3CYZ A;  4GGF A;  3BFA A;  2LLT A;  4P2Y B;  4C0J A;  1KK8 B;  2BL0 B;  3D76 A;  2F3Y A;  3PFV A;  4I5J A;  4YGA A;  1OMV A;  1WRL A;  1JUO A;  1AHR A;  1IJ6 A;  1MHO A;  1OE9 B;  1KWO B;  1F70 A;  4GGF C;  1NPQ A;  2A4J A;  1OZO A;  3DXL A;  1DT7 B;  1BG1 A;  1NYA A;  1BU3 A;  1J7Q A;  3SG7 A;  1TUZ A;  3I5G B;  2ISD A;  4XJK B;  2KI4 B;  1CKK A;  1LKJ A;  2ZND A;  1GM0 A;  3OB2 B;  2L98 A;  2F33 A;  4ORC B;  3NSI A;  1HT9 A;  2OPO A;  3V2L A;  1Q80 A;  3A8R A;  1ODB A;  2OTG B;  3CZT X;  1K9P A;  1U5I A;  2BAP A;  3BJH A;  5HYD A;  1BOC A;  3R1V A;  1N2D A;  1K94 A;  4PHM A;  1X02 A;  2YGU A;  3BOW B;  4YGB B;  1S3P A;  2KQ6 A;  4INW A;  4DS7 A;  3OGN A;  3LK1 A;  3OHM B;  5I2Q A;  1BLQ A;  1YUT A;  1DQE A;  4YI9 A;  1Y6W A;  1LVC D;  3S0A A;  4MEW A;  3VRN A;  2GV5 A;  2LC5 A;  2LHI A;  2LV7 A;  1TRF A;  3BQ3 A;  3AKA A;  1W7J B;  2KOT A;  5AEQ A;  4L9M A;  3RLZ A;  1YUR A;  1E8A A;  5HKZ A;  1DJI A;  5HKW A;  1K9U A;  5DKR A;  1TUJ A;  1K2H A;  4Q04 A;  1B8C A;  5DIC A;  3MSE B;  4YI8 A;  1CTR A;  3D78 A;  3QRX A;  2K2F A;  1RK9 A;  4PHN A;  2L0P A;  3KEV A;  1EG4 A;  2HPS A;  1OMR A;  1UUR A;  4OV2 A;  1YUS A;  4MN0 A;  3D10 A;  1CMF A;  1KK8 C;  5DKQ A;  3TDU A;  2JC2 A;  3EK8 A;  2L4I A;  1QWV A;  4XJK A;  5DKN A;  3FE6 A;  2L5X B;  2WC8 A;  2ERB A;  1TNP A;  2GGM A;  3CR2 A;  3Q8I A;  2PRU A;  3JVT B;  2G9B A;  1NWD A;  4OR9 B;  2KI4 C;  2RGI A;  4DIR A;  4NQG A;  2JPO A;  3CWG A;  2F8P A;  1TCF A;  3BOW A;  3VGO A;  2CBL A;  1QIW A;  2LCP A;  1RJV A;  1XFU O;  4NDD A;  1B1G A;  2V53 A;  3GK2 A;  3L4L A;  1H4B A;  3EVR A;  3RZS A;  2HQW A;  2KGR A;  1OSA A;  3TS5 C;  3S0E A;  1GGW A;  3AAJ A;  4TNC A;  1MUX A;  4HRH A;  2BBM A;  3PN7 B;  1SW8 A;  1DJZ A;  3VRO A;  2M1U A;  2GTE A;  1CDM A;  1DJW A;  1F8H A;  1M39 A;  2MHH A;  3WXA A;  2KYC A;  1OOH A;  4I5L B;  1TNW A;  3K1E A;  2BE6 A;  1PRW A;  3TDI A;  2LMV A;  1NX3 A;  5FI2 A;  3ZWH A;  4QJ5 B;  2ZRS A;  5D3O A;  5HL1 A;  2OS8 C;  4BY4 A;  1FF1 A;  2JRF A;  1QAS A;  4OVN F;  1SL9 A;  3WNX B;  1YVH A;  4BY5 A;  5I2O A;  4USL A;  2L2C A;  3M0W A;  3WHU B;  3FWB A;  4JWQ A;  1LA0 A;  5HLV A;  2IS9 A;  5I2L A;  1CFC A;  1YX7 A;  3DVJ A;  3LLE A;  4MBE A;  1OW4 A;  2CNP A;  2NZ0 A;  3GOF A;  3SG6 A;  4YGD B;  1WLZ A;  2JXL A;  2DOQ A;  2LVI A;  2JT3 A;  2JPT A;  2Y4Q A;  1JFK A;  2BKI B;  3NSK A;  1KFX S;  3LK0 A;  1QTX A;  3CGA A;  1FI5 A;  2KFG A;  1DEK A;  1OOF A;  1EH2 A;  3PSR A;  2K61 A;  4PDZ A;  1CM1 A;  1L2O B;  2QEO A;  3L4A A;  2KDH A;  3LL8 B;  3F45 A;  2D8N A;  1NX1 A;  1YUU A;  3S0F A;  1QX5 B;  3O4X A;  1CLB A;  2HF5 A;  2KSP A;  1MWN A;  3BUO B;  3UNW A;  3SG3 A;  1FBV A;  1QLS A;  1TTX A;  2HQ8 A;  2LNK A;  3O78 A;  1UHH A;  3VRP A;  1JSA A;  1KQV A;  1NCY A;  2B1U A;  3PN7 C;  4AQJ A;  1LS8 A;  2PVB A;  1C7W A;  3BYA A;  5BPJ A;  1KSO A;  2ZFD A;  1NX2 A;  2PQL A;  1IKU A;  1SR6 B;  3IF7 A;  1S6J A;  1AJ4 A;  1DJX A;  3TZ1 A;  4M2Q A;  3AAK A;  1IIO A;  2ZNE A;  3CS1 A;  1XO5 A;  2FOT A;  1EJ3 A;  3VRQ A;  4CFQ A;  3FWC A;  4A4B A;  1BF5 A;  1SYM A;  1ZFS A;  4MZJ A;  1QIV A;  3LCP C;  4P5O E;  4YGC B;  1J7P A;  5JJG A;  1IQ3 A;  3R1O A;  4JPZ B;  1WRK A;  2LLU A;  2KI6 D;  4R1E A;  1BOD A;  2O5G A;  3I5H B;  3QME A;  1UUS A;  2LUC A;  3SS3 A;  2EHB A;  1VRK A;  4JKT A;  2F3Z A;  1LA3 A;  2CTN A;  3CZ0 A;  1KQM B;  2QEV A;  1SKT A;  4AQI A;  2WCE A;  4DUQ A;  3B6X A;  2M8U A;  3BUN B;  1B9A A;  1S1E A;  2M29 A;  1A03 A;  3PM2 A;  1OOJ A;  1UHN A;  1B8R A;  4MRY A;  1R2U A;  2PMY A;  2LLS A;  3CDN A;  5I8N A;  1BT6 A;  1M31 A;  1YRT B;  1WDC B;  1NIW A;  2KFH A;  2Q4U A;  1ZMZ A;  1SCM C;  2JT0 A;  1S26 D;  5B8I B;  1JBA A;  2BE4 A;  4WQ2 A;  4IJ7 A;  2M7L A;  1IQ5 A;  2JNF A;  2JT8 A;  4ZCU A;  3C1V A;  3IQQ A;  1J1D A;  2E30 A;  1QLK A;  3CZ1 A;  1J55 A;  2WC5 A;  1M45 A;  1Y1X A;  2M1K B;  2L5Y A;  4PAL A;  1LXF C;  1XFZ O;  1AJ5 A;  1YRU B;  2KLD A;  4PHJ A;  3D73 A;  3DVE A;  1KFX L;  5CPV A;  3NSL A;  3TDZ A;  2BL0 C;  1N65 A;  1PAL A;  3H4S E;  4M2P A;  3RM1 A;  2JWW A;  1UWO A;  4C0L A;  4F0Z B;  2LM5 A;  3DY9 A;  5ER5 A;  5KTY A;  1IWQ A;  4FQT A;  1KWO C;  4CFR A;  3A4U B;  3BUM B;  3BFH A;  2E6W A;  1IG5 A;  1JF2 A;  2P6B B;  1ZAC A;  2I18 A;  2QAC A;  2QPT A;  2M49 B;  3BUX B;  3I5G C;  3B86 A;  1CFD A;  1WY9 A;  2HET A;  2LP3 A;  3ZNI A;  1RTP 1;  4GNK B;  4A4C A;  1IH0 A;  1MXE A;  2JZI A;  2MLF C;  2JTT A;  2OTG C;  1UHK A;  4QJ3 B;  3NHI A;  1W7I B;  2AUC A;  3K21 A;  1IGV A;  1BMO A;  1XFR A;  3B88 A;  1XFV O;  3EVU A;  3NXA A;  3PAT A;  1ZUZ A;  2PAL A;  2CCM A;  3WHT B;  4D1E A;  1P28 A;  2JOJ A;  4GAO A;  5CSJ A;  3S0B A;  4IL1 A;  1JWD A;  3GK4 X;  1K93 D;  1WDC C;  4HRG A;  3CLN A;  1WRZ A;  1NSH A;  1CDL A;  4MVF A;  1Z2C B;  3NSO A;  4FQO A;  4U8D A;  2F2P A;  1IJ5 A;  1OQP A;  2ZN9 A;  1F4Q A;  1XFX O;  1NP8 A;  2K2A A;  1SRA A;  1MXL C;  2EGD A;  3AKB A;  1B4C A;  4GUK A;  4HRE E;  2FCE A;  4PE4 A;  3TUY B;  2BCX A;  1SCV A;  2KAV A;  4JD9 A;  1T14 A;  1CB1 A;  3PLF B;  1A75 B;  2NCO A;  1TOP A;  2K7D A;  5KSZ A;  4PE0 A;  1C7V A;  2I94 A;  2I2R E;  2QEB A;  2AMI A;  1C3Z A;  1F4O A;  2M0R A;  3D0Y B;  2TN4 A;  3PJI A;  4ORA B;  1CM4 A;  3JVT C;  5FI6 A;  5J3X A;  3SS5 A;  1YVL A;  1CMG A;  1SL7 A;  3KF9 A;  4ICB A;  1K96 A;  3CR4 X;  4GGN A;  5D7F A;  3DF0 B;  5AXI A;  4CPV A;  3BXK A;  3JTD B;  1WLM A;  3VB1 A;  1QV0 A;  2PSR A;  1PSB A;  1DGV A;  4M2O A;  1NCZ A;  3PAL A;  4KYN A;  4JQ0 D;  4I5K A;  1KK7 Z;  1N0Y A;  1NCX A;  1AP4 A;  1EL4 A;  4YBH B;  3L47 A;  1K95 A;  3D77 A;  2P70 A;  5CSI A;  1R6P A;  3NHT A;  1KFU S;  2K0J A;  1DJG A;  1B47 A;  3OB1 B;  1KK7 Y;  2M7N A;  4NDB A;  2LVV A;  2VRG A;  2BBN A;  2WC6 A;  4MRX A;  2WCB A;  1ORG A;  2G2B A;  2SAS A;  1DJY A;  5K89 A;  1GJY A;  1W9Z A;  2JUL A;  4CLN A;  2WOR A;  1QX7 A;  3TUY C;  5AFP A;  1J1E A;  3UO9 A;  2M3W A;  5HLO A;  4AOM A;  1YTZ C;  1Y1A A;  1XFY O;  2K7B A;  2L50 A;  2KYF A;  1LIN A;  2L2E A;  1FW4 A;  2QDI A;  4I5N B;  4ZCV A;  5I94 A;  3EVV A;  1QX2 A;  1PSR A;  1S6I A;  2KNE A;  2PAS A;  2JQ6 A;  2JU0 A;  2L4H A;  3SIA A;  1SSE B;  1AVS A;  5ER4 X;  5AER A;  2BCB A;  3HX4 A;  1TWO A;  2M9G A;  2NLN A;  2LMU A;  1G8I A;  1Y1U A; 
#chains in the Genus database with same CATH homology
 5CSF A;  1CLL A;  5IBW A;  2COL B;  4E68 A;  3I5F B;  4HSZ A;  1TIZ A;  3O2P A;  1S6C A;  3DF0 A;  4ORB B;  4GFT A;  2KAX A;  3CTN A;  4PCW A;  3EK4 A;  4YGE B;  1S5G Z;  3KHE A;  1L2O C;  1UP5 A;  1F54 A;  1XA5 A;  2KI6 C;  1ALV A;  1F55 A;  1SY9 A;  3JTD C;  4MSP A;  3BUW B;  1KSM A;  2KHN A;  1C07 A;  4MLW A;  1S5G Y;  3SIB A;  4ETO A;  3PM8 A;  1V1G A;  1RFJ A;  5KU1 A;  1IRJ A;  2R2I A;  2H61 A;  3TS5 B;  1J7O A;  1ZOT B;  2MAZ A;  1SR6 C;  4XYN A;  1PVB A;  2ZKM X;  1CNP A;  2K7C A;  2JNX A;  4OKH A;  2L51 A;  1DGU A;  5JOL A;  1Y0V H;  2LP2 A;  2H61 C;  1DVI A;  2CT9 A;  2EC6 B;  2BKH B;  3VRR A;  1M46 A;  1HQV A;  1CLM A;  4PE7 A;  4QJ4 B;  4GPL B;  2OS8 B;  2JTZ A;  3DVK A;  1K8U A;  2MA2 A;  2WCF A;  3I5H C;  3OX6 A;  2MRD A;  1G4Y R;  3I5I B;  3OX5 A;  2GGZ A;  1J7R A;  1GQM A;  1KQM C;  1TNQ A;  5F6T A;  5G08 A;  2I7A A;  1CFP A;  1REC A;  2LAN A;  1F71 A;  2KGB C;  2LMT A;  1K90 D;  1XYD A;  1YR5 A;  5AAN A;  1QJT A;  3ICB A;  1PVA A;  3I5F C;  2WND A;  1NX0 A;  1MF8 B;  1G33 A;  1XK4 A;  3DVM A;  1KFU L;  2H2K A;  4C0K A;  1TNX A;  1M63 B;  3GK1 A;  4MZL A;  1OMD A;  1OZS A;  2Y5I A;  2CXJ A;  2Y1M A;  1XK4 C;  3KPX A;  1B7T Z;  3FIA A;  1DTL A;  3DD4 A;  3KO0 A;  1SL8 A;  1AUI B;  1DMO A;  1SBJ A;  2KQY A;  1YX8 A;  3SJS A;  4UPG A;  4N1G A;  1A2X A;  1B7T Y;  1DF0 B;  2FCD A;  1TN4 A;  4N5X A;  1UHJ A;  1KCY A;  2KBI A;  2FJU B;  3EKJ A;  1GGZ A;  2BEC A;  4GBA A;  5TNC A;  3O6B A;  1V1F A;  1CDP A;  1L7Z A;  2LVK A;  2Y1N A;  3HCM A;  2Q91 A;  3IQO A;  4PHK A;  2EC6 C;  1D1O A;  4FTG A;  1FPW A;  3EK7 A;  2LE9 B;  5HKY A;  1PUL A;  1NUB A;  1RRO A;  5GQQ C;  2LHL A;  1PK0 D;  1BR4 B;  3SG2 A;  1ALW A;  2ZN8 A;  4OCI A;  1SMG A;  3I5I C;  1TCO B;  3FS7 A;  1AK8 A;  1EXR A;  2K7O A;  2MJW B;  4YRU A;  2BCA A;  5D69 A;  1K9K A;  2AAO A;  1A4P A;  1XVJ A;  3CR5 X;  4WRI A;  4DCK A;  1QVI Z;  3OP0 A;  1QAT A;  5FYX A;  1QXP A;  1S36 A;  1EG3 A;  2SCP A;  3E3R A;  4MZK A;  3SG5 A;  1FI6 A;  2LAP A;  1UHI A;  1BR1 B;  4CID A;  1SNL A;  1QVI Y;  3EKH A;  1MQ1 A;  4NDC A;  1U5I B;  4WQ3 A;  2NCP A;  2O60 A;  1SK6 D;  1DF0 A;  2NXQ A;  1QS7 A;  3SG4 A;  1A29 A;  2LUX A;  1SCM B;  2KAY A;  1MR8 A;  2M97 A;  5PAL A;  1RWY A;  2JXC A;  4DRW A;  1A75 A;  1CFF A;  1JFJ A;  1BJF A;  2F2O A;  2MLE C;  2K8M B;  2LVJ A;  4PE1 A;  1DJH A;  1CDN A;  1JC2 A;  4N1F A;  1QV1 A;  2KFF A;  2WOS A;  1XFW O;  3O4Y A;  1JF0 A;  2MBX A;  2KBM A;  1SPY A;  3D0Y A;  5CSN A;  1H8B A;  1B8L A;  2ZRT A;  4GGF A;  2LLT A;  4P2Y B;  4C0J A;  1KK8 B;  2BL0 B;  2F3Y A;  3PFV A;  4I5J A;  4YGA A;  1OMV A;  1WRL A;  1JUO A;  1AHR A;  1IJ6 A;  1MHO A;  1OE9 B;  1KWO B;  1F70 A;  4GGF C;  1NPQ A;  2A4J A;  1OZO A;  1DT7 B;  1BG1 A;  1NYA A;  1BU3 A;  1J7Q A;  3SG7 A;  3I5G B;  2ISD A;  4XJK B;  2KI4 B;  1CKK A;  1LKJ A;  2ZND A;  3OB2 B;  2L98 A;  2F33 A;  4ORC B;  3NSI A;  1HT9 A;  2OPO A;  1Q80 A;  3A8R A;  1ODB A;  2OTG B;  3CZT X;  1K9P A;  1U5I A;  5HYD A;  1BOC A;  1N2D A;  1K94 A;  4PHM A;  1X02 A;  3BOW B;  4YGB B;  1S3P A;  2KQ6 A;  4DS7 A;  3LK1 A;  3OHM B;  5I2Q A;  1BLQ A;  1YUT A;  4YI9 A;  1Y6W A;  1LVC D;  4MEW A;  3VRN A;  2GV5 A;  2LC5 A;  2LHI A;  2LV7 A;  1TRF A;  3BQ3 A;  3AKA A;  1W7J B;  2KOT A;  5AEQ A;  4L9M A;  3RLZ A;  1YUR A;  1E8A A;  5HKZ A;  1DJI A;  5HKW A;  1K9U A;  5DKR A;  1K2H A;  4Q04 A;  1B8C A;  3MSE B;  4YI8 A;  1CTR A;  3QRX A;  2K2F A;  1RK9 A;  4PHN A;  2L0P A;  3KEV A;  1EG4 A;  2HPS A;  1OMR A;  1UUR A;  4OV2 A;  1YUS A;  4MN0 A;  3D10 A;  1CMF A;  1KK8 C;  5DKQ A;  3TDU A;  2JC2 A;  3EK8 A;  2L4I A;  4XJK A;  5DKN A;  2L5X B;  2WC8 A;  1TNP A;  2GGM A;  3CR2 A;  2PRU A;  3JVT B;  2G9B A;  1NWD A;  4OR9 B;  2KI4 C;  2RGI A;  4DIR A;  4NQG A;  3CWG A;  2F8P A;  1TCF A;  3BOW A;  3VGO A;  2CBL A;  1QIW A;  2LCP A;  1RJV A;  1XFU O;  4NDD A;  1B1G A;  2V53 A;  3GK2 A;  1H4B A;  3EVR A;  2HQW A;  2KGR A;  1OSA A;  3TS5 C;  1GGW A;  3AAJ A;  4TNC A;  1MUX A;  4HRH A;  2BBM A;  3PN7 B;  1SW8 A;  1DJZ A;  3VRO A;  2M1U A;  1CDM A;  1DJW A;  1F8H A;  1M39 A;  2MHH A;  3WXA A;  2KYC A;  4I5L B;  1TNW A;  2BE6 A;  1PRW A;  3TDI A;  2LMV A;  1NX3 A;  3ZWH A;  4QJ5 B;  2ZRS A;  2OS8 C;  4BY4 A;  1FF1 A;  2JRF A;  1QAS A;  4OVN F;  1SL9 A;  3WNX B;  1YVH A;  4BY5 A;  5I2O A;  4USL A;  3M0W A;  3WHU B;  3FWB A;  4JWQ A;  1LA0 A;  5HLV A;  2IS9 A;  5I2L A;  1CFC A;  1YX7 A;  3DVJ A;  3LLE A;  4MBE A;  2CNP A;  2NZ0 A;  3GOF A;  3SG6 A;  4YGD B;  1WLZ A;  2JXL A;  2DOQ A;  2LVI A;  2JT3 A;  2JPT A;  2Y4Q A;  1JFK A;  2BKI B;  3NSK A;  1KFX S;  3LK0 A;  1QTX A;  3CGA A;  1FI5 A;  2KFG A;  1EH2 A;  3PSR A;  2K61 A;  4PDZ A;  1CM1 A;  1L2O B;  2KDH A;  3LL8 B;  3F45 A;  2D8N A;  1NX1 A;  1YUU A;  1CLB A;  1QX5 B;  2HF5 A;  2KSP A;  1MWN A;  3BUO B;  3SG3 A;  1FBV A;  1QLS A;  1TTX A;  2HQ8 A;  2LNK A;  3O78 A;  1UHH A;  3VRP A;  1JSA A;  1KQV A;  1NCY A;  2B1U A;  3PN7 C;  4AQJ A;  2PVB A;  1C7W A;  3BYA A;  5BPJ A;  1KSO A;  2ZFD A;  1NX2 A;  1IKU A;  1SR6 B;  3IF7 A;  1S6J A;  1AJ4 A;  1DJX A;  3TZ1 A;  4M2Q A;  3AAK A;  2ZNE A;  3CS1 A;  1XO5 A;  2FOT A;  1EJ3 A;  3VRQ A;  4CFQ A;  3FWC A;  4A4B A;  1BF5 A;  1SYM A;  1ZFS A;  4MZJ A;  1QIV A;  3LCP C;  4P5O E;  4YGC B;  1J7P A;  5JJG A;  4JPZ B;  1WRK A;  2LLU A;  2KI6 D;  4R1E A;  1BOD A;  2O5G A;  3I5H B;  1UUS A;  2LUC A;  2EHB A;  1VRK A;  2F3Z A;  1LA3 A;  2CTN A;  1KQM B;  4AQI A;  1SKT A;  2WCE A;  4DUQ A;  2M8U A;  3BUN B;  1B9A A;  1S1E A;  2M29 A;  1A03 A;  1OOJ A;  1UHN A;  1B8R A;  4MRY A;  1R2U A;  2PMY A;  2LLS A;  5I8N A;  1BT6 A;  1M31 A;  1YRT B;  1WDC B;  1NIW A;  2KFH A;  2Q4U A;  1ZMZ A;  1SCM C;  2JT0 A;  1S26 D;  5B8I B;  1JBA A;  2BE4 A;  4WQ2 A;  2M7L A;  1IQ5 A;  2JNF A;  2JT8 A;  4ZCU A;  3C1V A;  3IQQ A;  1J1D A;  2E30 A;  1QLK A;  1J55 A;  1M45 A;  1Y1X A;  2M1K B;  4PAL A;  1LXF C;  1XFZ O;  1AJ5 A;  1YRU B;  4PHJ A;  3DVE A;  1KFX L;  5CPV A;  3NSL A;  3TDZ A;  2BL0 C;  1N65 A;  1PAL A;  3H4S E;  4M2P A;  3RM1 A;  2JWW A;  1UWO A;  4C0L A;  4F0Z B;  2LM5 A;  5ER5 A;  5KTY A;  1IWQ A;  1KWO C;  4CFR A;  3A4U B;  3BUM B;  2E6W A;  1IG5 A;  1JF2 A;  2P6B B;  1ZAC A;  2I18 A;  2QAC A;  2QPT A;  2M49 B;  3BUX B;  3I5G C;  1CFD A;  1WY9 A;  2HET A;  2LP3 A;  3ZNI A;  1RTP 1;  4GNK B;  4A4C A;  1IH0 A;  1MXE A;  2JZI A;  2MLF C;  2JTT A;  2OTG C;  1UHK A;  4QJ3 B;  1W7I B;  2AUC A;  3K21 A;  1IGV A;  1BMO A;  1XFV O;  3EVU A;  3NXA A;  3PAT A;  1ZUZ A;  2PAL A;  2CCM A;  3WHT B;  4D1E A;  2JOJ A;  4GAO A;  5CSJ A;  4IL1 A;  1JWD A;  3GK4 X;  1K93 D;  1WDC C;  4HRG A;  3CLN A;  1WRZ A;  1NSH A;  1CDL A;  4MVF A;  3NSO A;  4FQO A;  4U8D A;  2F2P A;  1IJ5 A;  1OQP A;  2ZN9 A;  1F4Q A;  1XFX O;  1NP8 A;  2K2A A;  1SRA A;  1MXL C;  2EGD A;  3AKB A;  1B4C A;  4GUK A;  4HRE E;  2FCE A;  4PE4 A;  3TUY B;  2BCX A;  1SCV A;  2KAV A;  1CB1 A;  3PLF B;  1A75 B;  2NCO A;  1TOP A;  2K7D A;  5KSZ A;  4PE0 A;  1C7V A;  2I94 A;  2I2R E;  2AMI A;  1F4O A;  2M0R A;  3D0Y B;  2TN4 A;  4ORA B;  1CM4 A;  3JVT C;  5J3X A;  1YVL A;  1CMG A;  1SL7 A;  3KF9 A;  4ICB A;  1K96 A;  3CR4 X;  4GGN A;  5D7F A;  3DF0 B;  5AXI A;  4CPV A;  3BXK A;  3JTD B;  1WLM A;  1QV0 A;  2PSR A;  1PSB A;  1DGV A;  4M2O A;  1NCZ A;  3PAL A;  4JQ0 D;  4I5K A;  1KK7 Z;  1N0Y A;  1NCX A;  1AP4 A;  1EL4 A;  4YBH B;  1K95 A;  5CSI A;  1R6P A;  1KFU S;  2K0J A;  1DJG A;  1B47 A;  3OB1 B;  1KK7 Y;  2M7N A;  4NDB A;  2LVV A;  2VRG A;  2BBN A;  4MRX A;  2WCB A;  2G2B A;  2SAS A;  1DJY A;  5K89 A;  1GJY A;  2JUL A;  4CLN A;  2WOR A;  1QX7 A;  3TUY C;  5AFP A;  1J1E A;  1IQ3 A;  2M3W A;  5HLO A;  4AOM A;  1YTZ C;  1Y1A A;  1XFY O;  2K7B A;  2L50 A;  2KYF A;  1LIN A;  2L2E A;  1FW4 A;  4I5N B;  4ZCV A;  3EVV A;  1QX2 A;  1PSR A;  1S6I A;  2KNE A;  2PAS A;  2JQ6 A;  2JU0 A;  2L4H A;  3SIA A;  5AER A;  1AVS A;  5ER4 X;  2BCB A;  3HX4 A;  2M9G A;  2NLN A;  2LMU A;  1G8I A;  1Y1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...