5AANA

Crystal structure of drosophila ncs-1 bound to penothiazine fd44
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
183
structure length
183
Chain Sequence
KKNSKLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFFPDGDPSKFASLVFRVFDENNDGAIEFEEFIRALSITSRGNLDEKLHWAFRLYDVDNDGYITREEMYNIVDAIYQMVGQQPQTEDENTPQKRVDKIFDQMDKNHDDRLTLEEFREGSKADPRMVQALSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding protein
molecule keywords CG5907-PA, ISOFORM A
publication title Interference of the complex between NCS-1 and Ric8a with phenothiazines regulates synaptic function and is an approach for fragile X syndrome.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 71
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2015-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5aanA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5aanA02
4D1EA 4QJ4B 1QTXA 2MLFC 1DGVA 2Q91A 5AEQA 1J7OA 4MRYA 1WLZA 3TS5C 3BUWB 3SG6A 2JNFA 2TN4A 2BKHB 2EGDA 2EC6C 1DJGA 1OMDA 2WC8A 2BCBA 3IQOA 1TTXA 2WNDA 4U8DA 1BU3A 2LANA 2M8UA 3BXKA 1DJIA 4AOMA 4XJKB 4MRXA 2KFFA 1XA5A 1MWNA 2KI6D 1QV1A 2KSPA 3I5HC 1M63B 3JVTB 3H4SE 3QRXA 3TDUA 5HYDA 2KAXA 1UWOA 1GGZA 1J1EA 1G4YR 1UUSA 2K7OA 2LHLA 1XYDA 2K2AA 3GK1A 3BQ3A 1SPYA 1Y1XA 4CFRA 3PATA 1AJ5A 1LA0A 5CSNA 2JPTA 4Q04A 4ORAB 1XK4C 3WHTB 4GGNA 1M31A 2LLTA 4QJ3B 1SL7A 2CTNA 1OMVA 2LP3A 3NSKA 4DIRA 3TZ1A 1MUXA 4C0LA 1C7WA 2PVBA 4HRGA 4PE0A 1J1DA 1TNXA 1CM1A 1M39A 4C0KA 2FJUB 4MZLA 1KQMB 4ZCVA 1Y6WA 1TRFA 2D8NA 1SW8A 2E30A 1TCFA 3OX5A 1X02A 4QJ5B 2M1UA 2Y4QA 4JPZB 1YVLA 1TCOB 2JQ6A 1C7VA 2CXJA 1S26D 3EK8A 3LLEA 1XK4A 4CIDA 2LMVA 2KOTA 1MXLC 1EG3A 2F3ZA 2FCEA 4N1FA 3AKBA 5CSJA 1IKUA 1Q80A 3BUXB 2KYFA 1NCXA 2WORA 3WNXB 2LVJA 3TUYC 1NYAA 1U5IB 3CS1A 2LAPA 2M7LA 2HETA 5JJGA 1K9UA 2MBXA 2NXQA 2E6WA 3PN7C 1JBAA 1A75B 2G2BA 4GFTA 2KBMA 2VRGA 3D0YA 2L98A 4WQ3A 1KFUL 2OS8B 1QX7A 1HT9A 1GQMA 1KK7Z 1PK0D 2HQWA 4JQ0D 1YUSA 4N1GA 4N5XA 1B8RA 1SCVA 1TN4A 1ZOTB 4FTGA 2JU0A 5HKZA 1BLQA 2OTGB 1NX0A 3PM8A 4M2OA 1DF0B 1ODBA 3NSOA 3I5FC 4OV2A 3VROA 1JFKA 1S6JA 3DF0A 2L4IA 1PRWA 1A4PA 2MLEC 3RM1A 1B9AA 4BY4A 3PSRA 1XFZO 5HLVA 1R6PA 1LA3A 2M0RA 1DJWA 1SL8A 3SIBA 1BG1A 1QIWA 5KU1A 1F71A 2P6BB 4GAOA 1RECA 4DRWA 2K7CA 2ZN8A 1ZMZA 1NCZA 1NX3A 1WRZA 3LCPC 1OMRA 2M49B 4YI9A 4ETOA 5I2OA 3JVTC 3VRRA 1W7IB 2F2PA 3GK4X 1LXFC 1CMGA 1NP8A 1MXEA 4OVNF 2V53A 1F4OA 4A4CA 2K7DA 1IQ3A 1BT6A 1V1FA 1S5GZ 2BBMA 1ZFSA 2F33A 3EVVA 3SG4A 1WRKA 1K90D 2I94A 2M1KB 4P5OE 3SIAA 4DUQA 1OSAA 2LMTA 3D10A 2M29A 4ORBB 1CFFA 4MZJA 1UHNA 1CDNA 2FOTA 1QIVA 3DD4A 2ISDA 1SKTA 1R2UA 2CT9A 1K8UA 1TOPA 2L51A 4PE1A 4WQ2A 1KQMC 1J7RA 1E8AA 1YUTA 2KFHA 1SRAA 2WOSA 5I2QA 1WDCB 2GV5A 2KI4B 3WXAA 4MVFA 2LHIA 4GPLB 4M2PA 3OB2B 1QLSA 3C1VA 2KBIA 4I5NB 1K2HA 2JT8A 2SCPA 2NCOA 3F45A 2L4HA 1SR6B 1C07A 3LK1A 1PSRA 4NDCA 1IH0A 1FF1A 3SG5A 3EK4A 5BPJA 1OQPA 2M3WA 2JC2A 5KTYA 4R1EA 2Y5IA 1AHRA 1A03A 2KFGA 2MRDA 2JT0A 5B8IB 4YBHB 4AQIA 1KK7Y 2BE4A 1CLLA 1IWQA 2JTZA 2LLUA 4CLNA 3PFVA 3NXAA 2MHHA 4C0JA 1LKJA 1DVIA 2OS8C 2LM5A 1MF8B 1W7JB 2AMIA 5HKYA 1QS7A 2BE6A 1Y0VH 1KFXS 2OPOA 2WCFA 4OKHA 1VRKA 4CPVA 1H4BA 2JNXA 4HREE 1JSAA 1K9PA 1DMOA 1BR1B 1QASA 5D7FA 1U5IA 3OP0A 1IG5A 1CFCA 1B4CA 3HCMA 2ZRSA 4I5KA 2EHBA 4PALA 1AP4A 1A75A 3JTDB 2BL0B 2CNPA 3O78A 1CKKA 4MEWA 4ORCB 4OR9B 2HF5A 4PHNA 1DTLA 4A4BA 2G9BA 1OOJA 1KQVA 2KI6C 2JXCA 4CFQA 3VGOA 1F4QA 3WHUB 2BECA 2KGRA 4AQJA 1S36A 5J3XA 4E68A 3O4YA 1KFUS 2Q4UA 4FQOA 1PULA 1S5GY 2MAZA 1AVSA 1DF0A 1JF2A 5ER5A 1CLBA 2ZKMX 5HKWA 1MHOA 1JF0A 3CTNA 2QPTA 1EG4A 1PALA 2LLSA 1DGUA 3TS5B 1TIZA 1L7ZA 4YGCB 1QX5B 5JOLA 1RROA 2QACA 4XYNA 1UHKA 5AANA 1UURA 1KWOC 1QV0A 1SL9A 2PSRA 4DS7A 3LK0A 4I5JA 4PHJA 1KCYA 2Y1NA 3OX6A 2WCBA 1K95A 1KSMA 1WDCC 2GGZA 2KI4C 1NCYA 4PHMA 3NSIA 3KF9A 1PSBA 1YRTB 1FPWA 2K8MB 2JT3A 2I18A 1DJXA 1PVAA 1Y1UA 2FCDA 2NLNA 3GK2A 3DVJA 4PE7A 2K0JA 3BYAA 1SBJA 3IF7A 1XO5A 3KEVA 2LVKA 1IGVA 2F3YA 1SY9A 2JOJA 1G33A 1HQVA 3SG7A 3FIAA 2F2OA 3OB1B 4YGDB 1S3PA 1M45A 1F8HA 1K93D 1AJ4A 1Y1AA 2B1UA 3DVKA 1KSOA 3AAJA 4HSZA 3LL8B 1RK9A 2LE9B 2ZNEA 1CM4A 2DOQA 5DKNA 1WLMA 4YRUA 2KHNA 4MSPA 5PALA 3SJSA 1IJ6A 1OZOA 1UHHA 2JRFA 2M97A 4HRHA 4XJKA 2K2FA 1KK8B 1SK6D 2ZNDA 3ZWHA 1A2XA 3FWCA 5CPVA 1CLMA 3ICBA 1GGWA 3A4UB 2JULA 3OHMB 1J7QA 1XFWO 1SCMB 3JTDC 3PALA 4OCIA 3AAKA 3CZTX 2AAOA 3O6BA 3RLZA 1CTRA 3CR5X 5TNCA 2JTTA 2Y1MA 1CFDA 3DF0B 2LCPA 3BUNB 3PN7B 4GGFC 1LINA 1XFUO 1ZACA 2ZFDA 3TDZA 1QLKA 1NPQA 3EK7A 1F55A 2CBLA 2LNKA 3M0WA 1QX2A 2A4JA 2PMYA 1TNPA 2RGIA 1WY9A 1S6CA 3BOWB 2HPSA 1JUOA 2NCPA 1AUIB 1YX8A 1FW4A 1UHJA 4DCKA 1YTZC 1NUBA 4PCWA 1F70A 1LVCD 1RWYA 1BMOA 2H2KA 2L2EA 3I5FB 1SYMA 1H8BA 1YURA 4GGFA 4MZKA 4I5LB 2KDHA 2LUCA 3CGAA 1QXPA 3BUOB 1NX2A 4BY5A 1RTP1 3CR2A 4M2QA 1CDLA 1MR8A 3KHEA 4P2YB 2JWWA 3DVEA 2OTGC 4PE4A 4L9MA 1ALVA 2I2RE 5DKRA 1K94A 1XFYO 2WCEA 3KO0A 4NDBA 3GOFA 1CDMA 4F0ZB 2MJWB 3I5IB 4PDZA 2BCXA 2JXLA 1F54A 4YI8A 3EKHA 1RJVA 2PRUA 1B8CA 3SG3A 1CDPA 5AXIA 1N65A 1S1EA 1QJTA 1YRUB 1V1GA 1FI6A 1IJ5A 1EL4A 5DKQA 3EKJA 3FWBA 2SASA 1NX1A 1CMFA 2R2IA 1A29A 1M46A 1UP5A 3I5GB 3IQQA 4MLWA 1L2OB 4YGAA 1AK8A 3BUMB 5CSIA 1J7PA 5I8NA 4YGEB 3NSLA 3FS7A 1QVIY 1YVHA 2JZIA 2LUXA 2M9GA 1OE9B 5GQQC 5I2LA 3DVMA 5F6TA 1QATA 2GGMA 5G08A 3VRNA 1B8LA 1B7TZ 1BR4B 4GNKB 1JWDA 1CNPA 2ZN9A 4NQGA 2BKIB 1XFXO 2PASA 1YR5A 1G8IA 1KK8C 2EC6B 3A8RA 3K21A 1KFXL 2L0PA 4GUKA 1IRJA 2KYCA 2L50A 4WRIA 2H61C 3VRQA 2LVVA 2BBNA 2IS9A 1DJZA 3HX4A 1SNLA 1K96A 1PVBA 1BF5A 5FYXA 1SCMC 1DJYA 3AKAA 3ZNIA 2KNEA 2KAYA 3I5HB 4TNCA 1S6IA 1EJ3A 1ZUZA 2HQ8A 1UHIA 1NSHA 2LC5A 2MA2A 4IL1A 4USLA 1K9KA 4GBAA 4MBEA 2M7NA 3PLFB 1SR6C 1YUUA 2K61A 2LMUA 4ZCUA 2AUCA 4ICBA 3MSEB 2H61A 1TNQA 5CSFA 2BCAA 3SG2A 1XVJA 2LP2A 5KSZA 1CB1A 1N2DA 2LVIA 3CLNA 4JWQA 1J55A 3O2PA 1CFPA 3CR4X 1DJHA 1IQ5A 1MQ1A 1D1OA 1FBVA 5K89A 2KAVA 3KPXA 1DT7B 3VRPA 5AERA 5IBWA 2F8PA 2O60A 1WRLA 2LV7A 1FI5A 2COLB 5ER4X 1B47A 1GJYA 1QVIZ 3D0YB 2O5GA 3BOWA 1YX7A 2KQYA 1SMGA 5D69A 3TDIA 3E3RA 4YGBB 4UPGA 1BOCA 3CWGA 4MN0A 4PHKA 1RFJA 1BODA 2KGBC 3I5IC 3EVUA 1ALWA 2BL0C 1TNWA 3EVRA 1BJFA 2KQ6A 3TUYB 5AFPA 2PALA 4NDDA 1B1GA 1JC2A 2NZ0A 1JFJA 1OZSA 1EXRA 2CCMA 2I7AA 3I5GC 1N0YA 1NIWA 2K7BA 1L2OC 1NWDA 2L5XB 1KWOB 1EH2A 2ZRTA 5HLOA 1B7TY 1XFVO
chains in the Genus database with same CATH superfamily
4D1EA 4QJ4B 1QTXA 2MLFC 1DGVA 2Q91A 5AEQA 1J7OA 3S0BA 4MRYA 1WLZA 3TS5C 3BUWB 2WCKA 3SG6A 2JNFA 2TN4A 2BKHB 2EGDA 2EC6C 1DJGA 1OMDA 2WC8A 3DZTA 2BCBA 3IQOA 1TTXA 2WNDA 4U8DA 3BFBA 1BU3A 2LANA 2M8UA 3BXKA 1DJIA 4AOMA 4XJKB 4MRXA 2KFFA 3R1PA 3BFAA 1XA5A 1MWNA 2KI6D 1QV1A 2KSPA 3I5HC 1M63B 3JVTB 3H4SE 3QRXA 3TDUA 4GUKA 2QEOA 5HYDA 3K1EA 2KAXA 1UWOA 1GGZA 1J1EA 1G4YR 1UUSA 2K7OA 2LHLA 1XYDA 2K2AA 3GK1A 3BQ3A 1SPYA 1Y1XA 4CFRA 3SS3A 3PATA 1AJ5A 1LA0A 5CSNA 2JPTA 4Q04A 4ORAB 1XK4C 3WHTB 4GGNA 1M31A 2LLTA 4QJ3B 1SL7A 2CTNA 1C3ZA 1OMVA 2LP3A 3NSKA 4DIRA 3TZ1A 1MUXA 3PJIA 1C7WA 4C0LA 2PVBA 4HRGA 4PE0A 1J1DA 1TNXA 1CM1A 1M39A 4C0KA 2FJUB 3S0FA 4MZLA 1KQMB 4ZCVA 1Y6WA 3CZ0A 1TRFA 2D8NA 1SW8A 2E30A 1TCFA 3OX5A 1X02A 2WC6A 2M1UA 2Y4QA 3O4XA 4JPZB 1YVLA 1TCOB 2JQ6A 4QJ5B 1C7VA 2CXJA 3VB1A 1S26D 3EK8A 3LLEA 1XK4A 4CIDA 2LMVA 2KOTA 1MXLC 1EG3A 2F3ZA 2FCEA 4N1FA 3AKBA 5CSJA 1IKUA 1Q80A 3BUXB 2KYFA 2QEBA 1NCXA 2WORA 3WNXB 2LVJA 2GTEA 1NYAA 3TUYC 1U5IB 3CS1A 2LAPA 2M7LA 3D78A 2HETA 5JJGA 1K9UA 2MBXA 2NXQA 2E6WA 3PN7C 3PM2A 1JBAA 1A75B 2G2BA 4GFTA 2KBMA 2VRGA 3D0YA 2L98A 4WQ3A 2P71A 1KFUL 2OS8B 1QX7A 1HT9A 1GQMA 1KK7Z 1PK0D 2HQWA 4JQ0D 1YUSA 4N1GA 4N5XA 1B8RA 1SCVA 1TN4A 1ZOTB 2YGUA 2JU0A 3FE6A 4FTGA 2OTGB 5HKZA 1BLQA 1NX0A 3PM8A 4M2OA 1DF0B 1ODBA 2FJYA 3CYZA 3NSOA 3I5FC 4OV2A 3VROA 1JFKA 1S6JA 3DF0A 2L4IA 1PRWA 1A4PA 2MLEC 5FI2A 1B9AA 1W9ZA 3RM1A 3S0GA 3PSRA 4BY4A 1XFZO 5HLVA 1R6PA 1LA3A 2M0RA 1DJWA 1SL8A 3SIBA 1BG1A 1QIWA 5KU1A 1F71A 2P6BB 4GAOA 1RECA 4DRWA 2K7CA 3B87A 2ZN8A 1ZMZA 1NCZA 1NX3A 1WRZA 3LCPC 1OMRA 2M49B 4YI9A 4ETOA 5I2OA 3JVTC 3VRRA 1W7IB 2F2PA 3GK4X 1LXFC 1CMGA 1NP8A 4F7FA 1MXEA 4OVNF 2V53A 1T14A 1F4OA 4A4CA 2K7DA 1IQ3A 1BT6A 2K60A 1V1FA 3NHIA 1S5GZ 2BBMA 1ZFSA 2F33A 3EVVA 3SG4A 1WRKA 1K90D 2I94A 2M1KB 3BJHA 4P5OE 3SIAA 4DUQA 1OSAA 2LMTA 3D10A 2L5YA 2M29A 4ORBB 4MZJA 1CFFA 3UNWA 1UHNA 1CDNA 2FOTA 1QIVA 3DD4A 2ISDA 1SKTA 3R1VA 1R2UA 2CT9A 1K8UA 1TOPA 2L51A 4PE1A 4WQ2A 1KQMC 1J7RA 1E8AA 1YUTA 2KFHA 1SRAA 2WOSA 5I2QA 1WDCB 2GV5A 2KI4B 3WXAA 4MVFA 3D73A 2LHIA 1XFRA 4GPLB 4M2PA 3OB2B 1QLSA 3C1VA 1DQEA 2KBIA 3S0EA 4I5NB 1K2HA 2JT8A 1Z2CB 2SCPA 2NCOA 3F45A 2L4HA 1SR6B 1C07A 3LK1A 1PSRA 4NDCA 3D75A 1FF1A 3B86A 1IH0A 3SG5A 3EK4A 3BFHA 5BPJA 1DEKA 1OQPA 2M3WA 2JC2A 5KTYA 2WCJA 3CZ2A 4R1EA 2Y5IA 1AHRA 1A03A 1DELA 2KFGA 2MRDA 2JT0A 5B8IB 4YBHB 4AQIA 1KK7Y 2BE4A 1CLLA 1IWQA 2JTZA 2LLUA 1C3YA 4CLNA 3PFVA 3NXAA 2MHHA 3R72A 1LKJA 4C0JA 1DVIA 2OS8C 2LM5A 1MF8B 1W7JB 2AMIA 5D3OA 5HKYA 1QS7A 2BE6A 5FI6A 1Y0VH 1KFXS 2OPOA 2WCFA 4OKHA 1VRKA 4CPVA 1H4BA 2JNXA 4HREE 1JSAA 1K9PA 1DMOA 1BR1B 1QASA 5D7FA 1DC1A 1U5IA 3OP0A 1IG5A 1CFCA 1B4CA 3HCMA 3UO9A 2ZRSA 4I5KA 2EHBA 4PALA 1AP4A 1A75A 3JTDB 2BL0B 2CNPA 3O78A 1CKKA 3EG5B 4MEWA 4ORCB 4OR9B 2HF5A 3NGVA 4PHNA 1DTLA 4A4BA 2G9BA 1OOJA 4IJ7A 2KI6C 1KQVA 2JXCA 4CFQA 3VGOA 1F4QA 3WHUB 2BECA 2KGRA 5I94A 4AQJA 2WCLA 1S36A 5J3XA 4E68A 3O4YA 1KFUS 2Q4UA 3L4AA 4FQOA 1PULA 1S5GY 2MAZA 1AVSA 1DF0A 1JF2A 5ER5A 1CLBA 2ZKMX 1P28A 5HKWA 1MHOA 1JF0A 3CTNA 2QPTA 1EG4A 1PALA 2LLSA 1DGUA 3TS5B 1TIZA 1L7ZA 4YGCB 4OZDA 3D74A 1QX5B 5JOLA 1RROA 2QACA 4XYNA 1UHKA 5AANA 1UURA 1KWOC 1QV0A 1SL9A 2PSRA 4DS7A 3LK0A 3CABA 4I5JA 3DY9A 4PHJA 1KCYA 2Y1NA 3RZSA 3OX6A 2WCBA 4INWA 1K95A 1TUJA 1KSMA 1WDCC 2GGZA 2KPHA 2KI4C 3B6XA 5EL2A 1NCYA 4PHMA 3NSIA 3KF9A 1PSBA 1YRTB 1FPWA 2K8MB 2JT3A 2I18A 1DJXA 1PVAA 1Y1UA 2FCDA 2NLNA 3GK2A 2BAPA 3CDNA 3DVJA 4PE7A 2K0JA 3BYAA 1LS8A 1SBJA 1XO5A 3IF7A 3KEVA 2LVKA 1IGVA 2F3YA 1SY9A 2JOJA 1G33A 1HQVA 3SG7A 3FIAA 1OOIX 1OOHA 2F2OA 3OB1B 4YGDB 1ORGA 1S3PA 1M45A 1F8HA 1K93D 1AJ4A 1Y1AA 2B1UA 3NHTA 5HL1A 3DVKA 1KSOA 3AAJA 4HSZA 3LL8B 1RK9A 2LE9B 2ZNEA 1CM4A 2DOQA 5DKNA 1WLMA 3B7AA 4YRUA 2KHNA 4MSPA 5PALA 3SJSA 1IJ6A 1OZOA 1UHHA 2JRFA 2KLEA 2M97A 1GM0A 4HRHA 4XJKA 2K2FA 4JD9A 1KK8B 1SK6D 2ZNDA 3ZWHA 1A2XA 3FWCA 3CZ1A 5CPVA 1CLMA 3ICBA 1GGWA 3S0DA 3A4UB 2JULA 3OHMB 2BNXA 1J7QA 1XFWO 1SCMB 3IVTA 3JTDC 3PALA 3AAKA 3CZTX 3L47A 4OCIA 2AAOA 3O6BA 3QMEA 1CTRA 3CR5X 5TNCA 1SSEB 2JTTA 3RLZA 2Y1MA 1CFDA 3DF0B 2LCPA 3BUNB 3PN7B 4GGFC 1LINA 1TUZA 1XFUO 1ZACA 2ZFDA 3TDZA 1QLKA 1NPQA 3EK7A 1F55A 2CBLA 2LNKA 3M0WA 1QX2A 1TWOA 2A4JA 1TNPA 2PMYA 1WY9A 1S6CA 2RGIA 3BOWB 2HPSA 1JUOA 2NCPA 4KYNA 1AUIB 1YX8A 1FW4A 1UHJA 1Z4HA 4DCKA 1OOGA 1YTZC 1NUBA 4PCWA 1F70A 1LVCD 1RWYA 2KLDA 1BMOA 2H2KA 4INXA 2L2EA 2QDIA 3I5FB 1SYMA 1H8BA 1YURA 4FQTA 4GGFA 4MZKA 3OBVA 4I5LB 2KDHA 2LUCA 3CGAA 1QXPA 3BUOB 1NX2A 4BY5A 1RTP1 3CR2A 3DXLA 4M2QA 1CDLA 1MR8A 3KHEA 4P2YB 2JWWA 3DVEA 2OTGC 4PE4A 4L9MA 1ALVA 2I2RE 5DKRA 1K94A 1XFYO 2WCEA 3KO0A 3B88A 4NDBA 3N7HA 3GOFA 1CDMA 4F0ZB 2MJWB 3I5IB 4PDZA 2BCXA 3L4LA 2JXLA 3SS5A 3FE8A 4JKTA 4YI8A 3EKHA 1F54A 1RJVA 2PRUA 1B8CA 3SG3A 1CDPA 5AXIA 1N65A 1S1EA 1QJTA 3D77A 3FE9A 1YRUB 1V1GA 1FI6A 1IJ5A 1EL4A 3DYEA 3EKJA 3FWBA 2SASA 5DKQA 1NX1A 1CMFA 2R2IA 1A29A 1M46A 1UP5A 3I5GB 3IQQA 4MLWA 1L2OB 4YGAA 1AK8A 3BUMB 5CSIA 1J7PA 5I8NA 2QEHA 4YGEB 2PYQA 3NSLA 3FS7A 1QVIY 1YVHA 2JZIA 2LUXA 2M9GA 1OE9B 3D76A 5GQQC 5I2LA 3DVMA 5F6TA 1QATA 2GGMA 5G08A 3VRNA 1B8LA 1B7TZ 1BR4B 4GNKB 1JWDA 1CNPA 2ZN9A 4NQGA 2BKIB 1XFXO 2PASA 1YR5A 1G8IA 1KK8C 1OOFA 2EC6B 3A8RA 1KFXL 2L0PA 3K21A 3Q8IA 1IRJA 2KYCA 2L50A 4WRIA 2H61C 3VRQA 2LVVA 2BBNA 2IS9A 1DJZA 3HX4A 1SNLA 1K96A 1PVBA 1BF5A 5FYXA 1SCMC 1DJYA 3AKAA 3ZNIA 2KNEA 2KAYA 1QWVA 3I5HB 4TNCA 1S6IA 1EJ3A 1ZUZA 2HQ8A 1UHIA 1NSHA 2LC5A 3SS4A 2MA2A 4IL1A 4USLA 1K9KA 4GBAA 4MBEA 2M7NA 3PLFB 1SR6C 1YUUA 2K61A 2WCHA 2LMUA 4ZCUA 2AUCA 4ICBA 3MSEB 2H61A 1TNQA 5CSFA 2BCAA 3SG2A 1XVJA 2LP2A 2L2CA 5KSZA 1N2DA 2LVIA 1CB1A 3CLNA 4JWQA 1J55A 1IIOA 3O2PA 1CFPA 3CR4X 1DJHA 1IQ5A 1MQ1A 2P70A 1D1OA 1FBVA 5K89A 1OW4A 2KAVA 2WCMA 3KPXA 1DT7B 3VRPA 5AERA 5IBWA 2F8PA 2O60A 1WRLA 2LV7A 3V2LA 1FI5A 2COLB 5ER4X 1B47A 1GJYA 1QVIZ 3D0YB 2O5GA 3BOWA 5FI7A 1YX7A 2KQYA 1SMGA 5D69A 3TDIA 3E3RA 4YGBB 3OGNA 4UPGA 1BOCA 2QEVA 2ERBA 3CWGA 4MN0A 4PHKA 1RFJA 1BODA 2KGBC 4PT1A 3I5IC 3EVUA 3R1OA 1ALWA 2BL0C 1TNWA 3EVRA 1BJFA 2KQ6A 3TUYB 5AFPA 2PALA 4NDDA 1B1GA 1JC2A 2NZ0A 1JFJA 1OZSA 2H8VA 5DICA 2PQLA 1EXRA 2CCMA 3S0AA 2JPOA 2I7AA 3I5GC 1N0YA 1NIWA 2K7BA 1L2OC 1NWDA 2L5XB 1KWOB 2WC5A 1EH2A 2ZRTA 5HLOA 1B7TY 1XFVO
chains in the Genus database with same CATH topology
4D1EA 4QJ4B 1QTXA 2MLFC 1DGVA 2Q91A 5AEQA 1J7OA 4MRYA 1WLZA 3TS5C 3BUWB 3SG6A 2JNFA 2TN4A 2BKHB 2EGDA 2EC6C 1DJGA 1OMDA 2WC8A 2BCBA 3IQOA 1TTXA 2WNDA 4U8DA 1BU3A 2LANA 2M8UA 3BXKA 1DJIA 4AOMA 4XJKB 4MRXA 2KFFA 1XA5A 1MWNA 2KI6D 1QV1A 2KSPA 3I5HC 1M63B 3JVTB 3H4SE 3QRXA 3TDUA 5HYDA 2KAXA 1UWOA 1GGZA 1J1EA 1G4YR 1UUSA 2K7OA 2LHLA 1XYDA 2K2AA 3GK1A 3BQ3A 1SPYA 1Y1XA 4CFRA 3PATA 1AJ5A 1LA0A 5CSNA 2JPTA 4Q04A 4ORAB 1XK4C 3WHTB 4GGNA 1M31A 2LLTA 4QJ3B 1SL7A 2CTNA 1OMVA 2LP3A 3NSKA 4DIRA 3TZ1A 1MUXA 4C0LA 1C7WA 2PVBA 4HRGA 4PE0A 1J1DA 1TNXA 1CM1A 1M39A 4C0KA 2FJUB 4MZLA 1KQMB 4ZCVA 1Y6WA 1TRFA 2D8NA 1SW8A 2E30A 1TCFA 3OX5A 1X02A 4QJ5B 2M1UA 2Y4QA 4JPZB 1YVLA 1TCOB 2JQ6A 1C7VA 2CXJA 1S26D 3EK8A 3LLEA 1XK4A 4CIDA 2LMVA 2KOTA 1MXLC 1EG3A 2F3ZA 2FCEA 4N1FA 3AKBA 5CSJA 1IKUA 1Q80A 3BUXB 2KYFA 1NCXA 2WORA 3WNXB 2LVJA 3TUYC 1NYAA 1U5IB 3CS1A 2LAPA 2M7LA 2HETA 5JJGA 1K9UA 2MBXA 2NXQA 2E6WA 3PN7C 1JBAA 1A75B 2G2BA 4GFTA 2KBMA 2VRGA 3D0YA 2L98A 4WQ3A 1KFUL 2OS8B 1QX7A 1HT9A 1GQMA 1KK7Z 1PK0D 2HQWA 4JQ0D 1YUSA 4N1GA 4N5XA 1B8RA 1SCVA 1TN4A 1ZOTB 4FTGA 2JU0A 5HKZA 1BLQA 2OTGB 1NX0A 3PM8A 4M2OA 1DF0B 1ODBA 3NSOA 3I5FC 4OV2A 3VROA 1JFKA 1S6JA 3DF0A 2L4IA 1PRWA 1A4PA 2MLEC 3RM1A 1B9AA 4BY4A 3PSRA 1XFZO 5HLVA 1R6PA 1LA3A 2M0RA 1DJWA 1SL8A 3SIBA 1BG1A 1QIWA 5KU1A 1F71A 2P6BB 4GAOA 1RECA 4DRWA 2K7CA 2ZN8A 1ZMZA 1NCZA 1NX3A 1WRZA 3LCPC 1OMRA 2M49B 4YI9A 4ETOA 5I2OA 3JVTC 3VRRA 1W7IB 2F2PA 3GK4X 1LXFC 1CMGA 1NP8A 1MXEA 4OVNF 2V53A 1F4OA 4A4CA 2K7DA 1IQ3A 1BT6A 1V1FA 1S5GZ 2BBMA 1ZFSA 2F33A 3EVVA 3SG4A 1WRKA 1K90D 2I94A 2M1KB 4P5OE 3SIAA 4DUQA 1OSAA 2LMTA 3D10A 2M29A 4ORBB 1CFFA 4MZJA 1UHNA 1CDNA 2FOTA 1QIVA 3DD4A 2ISDA 1SKTA 1R2UA 2CT9A 1K8UA 1TOPA 2L51A 4PE1A 4WQ2A 1KQMC 1J7RA 1E8AA 1YUTA 2KFHA 1SRAA 2WOSA 5I2QA 1WDCB 2GV5A 2KI4B 3WXAA 4MVFA 2LHIA 4GPLB 4M2PA 3OB2B 1QLSA 3C1VA 2KBIA 4I5NB 1K2HA 2JT8A 2SCPA 2NCOA 3F45A 2L4HA 1SR6B 1C07A 3LK1A 1PSRA 4NDCA 1IH0A 1FF1A 3SG5A 3EK4A 5BPJA 1OQPA 2M3WA 2JC2A 5KTYA 4R1EA 2Y5IA 1AHRA 1A03A 2KFGA 2MRDA 2JT0A 5B8IB 4YBHB 4AQIA 1KK7Y 2BE4A 1CLLA 1IWQA 2JTZA 2LLUA 4CLNA 3PFVA 3NXAA 2MHHA 4C0JA 1LKJA 1DVIA 2OS8C 2LM5A 1MF8B 1W7JB 2AMIA 5HKYA 1QS7A 2BE6A 1Y0VH 1KFXS 2OPOA 2WCFA 4OKHA 1VRKA 4CPVA 1H4BA 2JNXA 4HREE 1JSAA 1K9PA 1DMOA 1BR1B 1QASA 5D7FA 1U5IA 3OP0A 1IG5A 1CFCA 1B4CA 3HCMA 2ZRSA 4I5KA 2EHBA 4PALA 1AP4A 1A75A 3JTDB 2BL0B 2CNPA 3O78A 1CKKA 4MEWA 4ORCB 4OR9B 2HF5A 4PHNA 1DTLA 4A4BA 2G9BA 1OOJA 1KQVA 2KI6C 2JXCA 4CFQA 3VGOA 1F4QA 3WHUB 2BECA 2KGRA 4AQJA 1S36A 5J3XA 4E68A 3O4YA 1KFUS 2Q4UA 4FQOA 1PULA 1S5GY 2MAZA 1AVSA 1DF0A 1JF2A 5ER5A 1CLBA 2ZKMX 5HKWA 1MHOA 1JF0A 3CTNA 2QPTA 1EG4A 1PALA 2LLSA 1DGUA 3TS5B 1TIZA 1L7ZA 4YGCB 1QX5B 5JOLA 1RROA 2QACA 4XYNA 1UHKA 5AANA 1UURA 1KWOC 1QV0A 1SL9A 2PSRA 4DS7A 3LK0A 4I5JA 4PHJA 1KCYA 2Y1NA 3OX6A 2WCBA 1K95A 1KSMA 1WDCC 2GGZA 2KI4C 1NCYA 4PHMA 3NSIA 3KF9A 1PSBA 1YRTB 1FPWA 2K8MB 2JT3A 2I18A 1DJXA 1PVAA 1Y1UA 2FCDA 2NLNA 3GK2A 3DVJA 4PE7A 2K0JA 3BYAA 1SBJA 3IF7A 1XO5A 3KEVA 2LVKA 1IGVA 2F3YA 1SY9A 2JOJA 1G33A 1HQVA 3SG7A 3FIAA 2F2OA 3OB1B 4YGDB 1S3PA 1M45A 1F8HA 1K93D 1AJ4A 1Y1AA 2B1UA 3DVKA 1KSOA 3AAJA 4HSZA 3LL8B 1RK9A 2LE9B 2ZNEA 1CM4A 2DOQA 5DKNA 1WLMA 4YRUA 2KHNA 4MSPA 5PALA 3SJSA 1IJ6A 1OZOA 1UHHA 2JRFA 2M97A 4HRHA 4XJKA 2K2FA 1KK8B 1SK6D 2ZNDA 3ZWHA 1A2XA 3FWCA 5CPVA 1CLMA 3ICBA 1GGWA 3A4UB 2JULA 3OHMB 1J7QA 1XFWO 1SCMB 3JTDC 3PALA 4OCIA 3AAKA 3CZTX 2AAOA 3O6BA 3RLZA 1CTRA 3CR5X 5TNCA 2JTTA 2Y1MA 1CFDA 3DF0B 2LCPA 3BUNB 3PN7B 4GGFC 1LINA 1XFUO 1ZACA 2ZFDA 3TDZA 1QLKA 1NPQA 3EK7A 1F55A 2CBLA 2LNKA 3M0WA 1QX2A 2A4JA 2PMYA 1TNPA 2RGIA 1WY9A 1S6CA 3BOWB 2HPSA 1JUOA 2NCPA 1AUIB 1YX8A 1FW4A 1UHJA 4DCKA 1YTZC 1NUBA 4PCWA 1F70A 1LVCD 1RWYA 1BMOA 2H2KA 2L2EA 3I5FB 1SYMA 1H8BA 1YURA 4GGFA 4MZKA 4I5LB 2KDHA 2LUCA 3CGAA 1QXPA 3BUOB 1NX2A 4BY5A 1RTP1 3CR2A 4M2QA 1CDLA 1MR8A 3KHEA 4P2YB 2JWWA 3DVEA 2OTGC 4PE4A 4L9MA 1ALVA 2I2RE 5DKRA 1K94A 1XFYO 2WCEA 3KO0A 4NDBA 3GOFA 1CDMA 4F0ZB 2MJWB 3I5IB 4PDZA 2BCXA 2JXLA 1F54A 4YI8A 3EKHA 1RJVA 2PRUA 1B8CA 3SG3A 1CDPA 5AXIA 1N65A 1S1EA 1QJTA 1YRUB 1V1GA 1FI6A 1IJ5A 1EL4A 5DKQA 3EKJA 3FWBA 2SASA 1NX1A 1CMFA 2R2IA 1A29A 1M46A 1UP5A 3I5GB 3IQQA 4MLWA 1L2OB 4YGAA 1AK8A 3BUMB 5CSIA 1J7PA 5I8NA 4YGEB 3NSLA 3FS7A 1QVIY 1YVHA 2JZIA 2LUXA 2M9GA 1OE9B 5GQQC 5I2LA 3DVMA 5F6TA 1QATA 2GGMA 5G08A 3VRNA 1B8LA 1B7TZ 1BR4B 4GNKB 1JWDA 1CNPA 2ZN9A 4NQGA 2BKIB 1XFXO 2PASA 1YR5A 1G8IA 1KK8C 2EC6B 3A8RA 3K21A 1KFXL 2L0PA 4GUKA 1IRJA 2KYCA 2L50A 4WRIA 2H61C 3VRQA 2LVVA 2BBNA 2IS9A 1DJZA 3HX4A 1SNLA 1K96A 1PVBA 1BF5A 5FYXA 1SCMC 1DJYA 3AKAA 3ZNIA 2KNEA 2KAYA 3I5HB 4TNCA 1S6IA 1EJ3A 1ZUZA 2HQ8A 1UHIA 1NSHA 2LC5A 2MA2A 4IL1A 4USLA 1K9KA 4GBAA 4MBEA 2M7NA 3PLFB 1SR6C 1YUUA 2K61A 2LMUA 4ZCUA 2AUCA 4ICBA 3MSEB 2H61A 1TNQA 5CSFA 2BCAA 3SG2A 1XVJA 2LP2A 5KSZA 1CB1A 1N2DA 2LVIA 3CLNA 4JWQA 1J55A 3O2PA 1CFPA 3CR4X 1DJHA 1IQ5A 1MQ1A 1D1OA 1FBVA 5K89A 2KAVA 3KPXA 1DT7B 3VRPA 5AERA 5IBWA 2F8PA 2O60A 1WRLA 2LV7A 1FI5A 2COLB 5ER4X 1B47A 1GJYA 1QVIZ 3D0YB 2O5GA 3BOWA 1YX7A 2KQYA 1SMGA 5D69A 3TDIA 3E3RA 4YGBB 4UPGA 1BOCA 3CWGA 4MN0A 4PHKA 1RFJA 1BODA 2KGBC 3I5IC 3EVUA 1ALWA 2BL0C 1TNWA 3EVRA 1BJFA 2KQ6A 3TUYB 5AFPA 2PALA 4NDDA 1B1GA 1JC2A 2NZ0A 1JFJA 1OZSA 1EXRA 2CCMA 2I7AA 3I5GC 1N0YA 1NIWA 2K7BA 1L2OC 1NWDA 2L5XB 1KWOB 1EH2A 2ZRTA 5HLOA 1B7TY 1XFVO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D1E A;  4QJ4 B;  1QTX A;  2MLF C;  1DGV A;  2Q91 A;  5AEQ A;  1J7O A;  4MRY A;  1WLZ A;  3TS5 C;  3BUW B;  3SG6 A;  2JNF A;  2TN4 A;  2BKH B;  2EGD A;  2EC6 C;  1DJG A;  1OMD A;  2WC8 A;  2BCB A;  3IQO A;  1TTX A;  2WND A;  4U8D A;  1BU3 A;  2LAN A;  2M8U A;  3BXK A;  1DJI A;  4AOM A;  4XJK B;  4MRX A;  2KFF A;  1XA5 A;  1MWN A;  2KI6 D;  1QV1 A;  2KSP A;  3I5H C;  1M63 B;  3JVT B;  3H4S E;  3QRX A;  3TDU A;  5HYD A;  2KAX A;  1UWO A;  1GGZ A;  1J1E A;  1G4Y R;  1UUS A;  2K7O A;  2LHL A;  1XYD A;  2K2A A;  3GK1 A;  3BQ3 A;  1SPY A;  1Y1X A;  4CFR A;  3PAT A;  1AJ5 A;  1LA0 A;  5CSN A;  2JPT A;  4Q04 A;  4ORA B;  1XK4 C;  3WHT B;  4GGN A;  1M31 A;  2LLT A;  4QJ3 B;  1SL7 A;  2CTN A;  1OMV A;  2LP3 A;  3NSK A;  4DIR A;  3TZ1 A;  1MUX A;  4C0L A;  1C7W A;  2PVB A;  4HRG A;  4PE0 A;  1J1D A;  1TNX A;  1CM1 A;  1M39 A;  4C0K A;  2FJU B;  4MZL A;  1KQM B;  4ZCV A;  1Y6W A;  1TRF A;  2D8N A;  1SW8 A;  2E30 A;  1TCF A;  3OX5 A;  1X02 A;  4QJ5 B;  2M1U A;  2Y4Q A;  4JPZ B;  1YVL A;  1TCO B;  2JQ6 A;  1C7V A;  2CXJ A;  1S26 D;  3EK8 A;  3LLE A;  1XK4 A;  4CID A;  2LMV A;  2KOT A;  1MXL C;  1EG3 A;  2F3Z A;  2FCE A;  4N1F A;  3AKB A;  5CSJ A;  1IKU A;  1Q80 A;  3BUX B;  2KYF A;  1NCX A;  2WOR A;  3WNX B;  2LVJ A;  3TUY C;  1NYA A;  1U5I B;  3CS1 A;  2LAP A;  2M7L A;  2HET A;  5JJG A;  1K9U A;  2MBX A;  2NXQ A;  2E6W A;  3PN7 C;  1JBA A;  1A75 B;  2G2B A;  4GFT A;  2KBM A;  2VRG A;  3D0Y A;  2L98 A;  4WQ3 A;  1KFU L;  2OS8 B;  1QX7 A;  1HT9 A;  1GQM A;  1KK7 Z;  1PK0 D;  2HQW A;  4JQ0 D;  1YUS A;  4N1G A;  4N5X A;  1B8R A;  1SCV A;  1TN4 A;  1ZOT B;  4FTG A;  2JU0 A;  5HKZ A;  1BLQ A;  2OTG B;  1NX0 A;  3PM8 A;  4M2O A;  1DF0 B;  1ODB A;  3NSO A;  3I5F C;  4OV2 A;  3VRO A;  1JFK A;  1S6J A;  3DF0 A;  2L4I A;  1PRW A;  1A4P A;  2MLE C;  3RM1 A;  1B9A A;  4BY4 A;  3PSR A;  1XFZ O;  5HLV A;  1R6P A;  1LA3 A;  2M0R A;  1DJW A;  1SL8 A;  3SIB A;  1BG1 A;  1QIW A;  5KU1 A;  1F71 A;  2P6B B;  4GAO A;  1REC A;  4DRW A;  2K7C A;  2ZN8 A;  1ZMZ A;  1NCZ A;  1NX3 A;  1WRZ A;  3LCP C;  1OMR A;  2M49 B;  4YI9 A;  4ETO A;  5I2O A;  3JVT C;  3VRR A;  1W7I B;  2F2P A;  3GK4 X;  1LXF C;  1CMG A;  1NP8 A;  1MXE A;  4OVN F;  2V53 A;  1F4O A;  4A4C A;  2K7D A;  1IQ3 A;  1BT6 A;  1V1F A;  1S5G Z;  2BBM A;  1ZFS A;  2F33 A;  3EVV A;  3SG4 A;  1WRK A;  1K90 D;  2I94 A;  2M1K B;  4P5O E;  3SIA A;  4DUQ A;  1OSA A;  2LMT A;  3D10 A;  2M29 A;  4ORB B;  1CFF A;  4MZJ A;  1UHN A;  1CDN A;  2FOT A;  1QIV A;  3DD4 A;  2ISD A;  1SKT A;  1R2U A;  2CT9 A;  1K8U A;  1TOP A;  2L51 A;  4PE1 A;  4WQ2 A;  1KQM C;  1J7R A;  1E8A A;  1YUT A;  2KFH A;  1SRA A;  2WOS A;  5I2Q A;  1WDC B;  2GV5 A;  2KI4 B;  3WXA A;  4MVF A;  2LHI A;  4GPL B;  4M2P A;  3OB2 B;  1QLS A;  3C1V A;  2KBI A;  4I5N B;  1K2H A;  2JT8 A;  2SCP A;  2NCO A;  3F45 A;  2L4H A;  1SR6 B;  1C07 A;  3LK1 A;  1PSR A;  4NDC A;  1IH0 A;  1FF1 A;  3SG5 A;  3EK4 A;  5BPJ A;  1OQP A;  2M3W A;  2JC2 A;  5KTY A;  4R1E A;  2Y5I A;  1AHR A;  1A03 A;  2KFG A;  2MRD A;  2JT0 A;  5B8I B;  4YBH B;  4AQI A;  1KK7 Y;  2BE4 A;  1CLL A;  1IWQ A;  2JTZ A;  2LLU A;  4CLN A;  3PFV A;  3NXA A;  2MHH A;  4C0J A;  1LKJ A;  1DVI A;  2OS8 C;  2LM5 A;  1MF8 B;  1W7J B;  2AMI A;  5HKY A;  1QS7 A;  2BE6 A;  1Y0V H;  1KFX S;  2OPO A;  2WCF A;  4OKH A;  1VRK A;  4CPV A;  1H4B A;  2JNX A;  4HRE E;  1JSA A;  1K9P A;  1DMO A;  1BR1 B;  1QAS A;  5D7F A;  1U5I A;  3OP0 A;  1IG5 A;  1CFC A;  1B4C A;  3HCM A;  2ZRS A;  4I5K A;  2EHB A;  4PAL A;  1AP4 A;  1A75 A;  3JTD B;  2BL0 B;  2CNP A;  3O78 A;  1CKK A;  4MEW A;  4ORC B;  4OR9 B;  2HF5 A;  4PHN A;  1DTL A;  4A4B A;  2G9B A;  1OOJ A;  1KQV A;  2KI6 C;  2JXC A;  4CFQ A;  3VGO A;  1F4Q A;  3WHU B;  2BEC A;  2KGR A;  4AQJ A;  1S36 A;  5J3X A;  4E68 A;  3O4Y A;  1KFU S;  2Q4U A;  4FQO A;  1PUL A;  1S5G Y;  2MAZ A;  1AVS A;  1DF0 A;  1JF2 A;  5ER5 A;  1CLB A;  2ZKM X;  5HKW A;  1MHO A;  1JF0 A;  3CTN A;  2QPT A;  1EG4 A;  1PAL A;  2LLS A;  1DGU A;  3TS5 B;  1TIZ A;  1L7Z A;  4YGC B;  1QX5 B;  5JOL A;  1RRO A;  2QAC A;  4XYN A;  1UHK A;  5AAN A;  1UUR A;  1KWO C;  1QV0 A;  1SL9 A;  2PSR A;  4DS7 A;  3LK0 A;  4I5J A;  4PHJ A;  1KCY A;  2Y1N A;  3OX6 A;  2WCB A;  1K95 A;  1KSM A;  1WDC C;  2GGZ A;  2KI4 C;  1NCY A;  4PHM A;  3NSI A;  3KF9 A;  1PSB A;  1YRT B;  1FPW A;  2K8M B;  2JT3 A;  2I18 A;  1DJX A;  1PVA A;  1Y1U A;  2FCD A;  2NLN A;  3GK2 A;  3DVJ A;  4PE7 A;  2K0J A;  3BYA A;  1SBJ A;  3IF7 A;  1XO5 A;  3KEV A;  2LVK A;  1IGV A;  2F3Y A;  1SY9 A;  2JOJ A;  1G33 A;  1HQV A;  3SG7 A;  3FIA A;  2F2O A;  3OB1 B;  4YGD B;  1S3P A;  1M45 A;  1F8H A;  1K93 D;  1AJ4 A;  1Y1A A;  2B1U A;  3DVK A;  1KSO A;  3AAJ A;  4HSZ A;  3LL8 B;  1RK9 A;  2LE9 B;  2ZNE A;  1CM4 A;  2DOQ A;  5DKN A;  1WLM A;  4YRU A;  2KHN A;  4MSP A;  5PAL A;  3SJS A;  1IJ6 A;  1OZO A;  1UHH A;  2JRF A;  2M97 A;  4HRH A;  4XJK A;  2K2F A;  1KK8 B;  1SK6 D;  2ZND A;  3ZWH A;  1A2X A;  3FWC A;  5CPV A;  1CLM A;  3ICB A;  1GGW A;  3A4U B;  2JUL A;  3OHM B;  1J7Q A;  1XFW O;  1SCM B;  3JTD C;  3PAL A;  4OCI A;  3AAK A;  3CZT X;  2AAO A;  3O6B A;  3RLZ A;  1CTR A;  3CR5 X;  5TNC A;  2JTT A;  2Y1M A;  1CFD A;  3DF0 B;  2LCP A;  3BUN B;  3PN7 B;  4GGF C;  1LIN A;  1XFU O;  1ZAC A;  2ZFD A;  3TDZ A;  1QLK A;  1NPQ A;  3EK7 A;  1F55 A;  2CBL A;  2LNK A;  3M0W A;  1QX2 A;  2A4J A;  2PMY A;  1TNP A;  2RGI A;  1WY9 A;  1S6C A;  3BOW B;  2HPS A;  1JUO A;  2NCP A;  1AUI B;  1YX8 A;  1FW4 A;  1UHJ A;  4DCK A;  1YTZ C;  1NUB A;  4PCW A;  1F70 A;  1LVC D;  1RWY A;  1BMO A;  2H2K A;  2L2E A;  3I5F B;  1SYM A;  1H8B A;  1YUR A;  4GGF A;  4MZK A;  4I5L B;  2KDH A;  2LUC A;  3CGA A;  1QXP A;  3BUO B;  1NX2 A;  4BY5 A;  1RTP 1;  3CR2 A;  4M2Q A;  1CDL A;  1MR8 A;  3KHE A;  4P2Y B;  2JWW A;  3DVE A;  2OTG C;  4PE4 A;  4L9M A;  1ALV A;  2I2R E;  5DKR A;  1K94 A;  1XFY O;  2WCE A;  3KO0 A;  4NDB A;  3GOF A;  1CDM A;  4F0Z B;  2MJW B;  3I5I B;  4PDZ A;  2BCX A;  2JXL A;  1F54 A;  4YI8 A;  3EKH A;  1RJV A;  2PRU A;  1B8C A;  3SG3 A;  1CDP A;  5AXI A;  1N65 A;  1S1E A;  1QJT A;  1YRU B;  1V1G A;  1FI6 A;  1IJ5 A;  1EL4 A;  5DKQ A;  3EKJ A;  3FWB A;  2SAS A;  1NX1 A;  1CMF A;  2R2I A;  1A29 A;  1M46 A;  1UP5 A;  3I5G B;  3IQQ A;  4MLW A;  1L2O B;  4YGA A;  1AK8 A;  3BUM B;  5CSI A;  1J7P A;  5I8N A;  4YGE B;  3NSL A;  3FS7 A;  1QVI Y;  1YVH A;  2JZI A;  2LUX A;  2M9G A;  1OE9 B;  5GQQ C;  5I2L A;  3DVM A;  5F6T A;  1QAT A;  2GGM A;  5G08 A;  3VRN A;  1B8L A;  1B7T Z;  1BR4 B;  4GNK B;  1JWD A;  1CNP A;  2ZN9 A;  4NQG A;  2BKI B;  1XFX O;  2PAS A;  1YR5 A;  1G8I A;  1KK8 C;  2EC6 B;  3A8R A;  3K21 A;  1KFX L;  2L0P A;  4GUK A;  1IRJ A;  2KYC A;  2L50 A;  4WRI A;  2H61 C;  3VRQ A;  2LVV A;  2BBN A;  2IS9 A;  1DJZ A;  3HX4 A;  1SNL A;  1K96 A;  1PVB A;  1BF5 A;  5FYX A;  1SCM C;  1DJY A;  3AKA A;  3ZNI A;  2KNE A;  2KAY A;  3I5H B;  4TNC A;  1S6I A;  1EJ3 A;  1ZUZ A;  2HQ8 A;  1UHI A;  1NSH A;  2LC5 A;  2MA2 A;  4IL1 A;  4USL A;  1K9K A;  4GBA A;  4MBE A;  2M7N A;  3PLF B;  1SR6 C;  1YUU A;  2K61 A;  2LMU A;  4ZCU A;  2AUC A;  4ICB A;  3MSE B;  2H61 A;  1TNQ A;  5CSF A;  2BCA A;  3SG2 A;  1XVJ A;  2LP2 A;  5KSZ A;  1CB1 A;  1N2D A;  2LVI A;  3CLN A;  4JWQ A;  1J55 A;  3O2P A;  1CFP A;  3CR4 X;  1DJH A;  1IQ5 A;  1MQ1 A;  1D1O A;  1FBV A;  5K89 A;  2KAV A;  3KPX A;  1DT7 B;  3VRP A;  5AER A;  5IBW A;  2F8P A;  2O60 A;  1WRL A;  2LV7 A;  1FI5 A;  2COL B;  5ER4 X;  1B47 A;  1GJY A;  1QVI Z;  3D0Y B;  2O5G A;  3BOW A;  1YX7 A;  2KQY A;  1SMG A;  5D69 A;  3TDI A;  3E3R A;  4YGB B;  4UPG A;  1BOC A;  3CWG A;  4MN0 A;  4PHK A;  1RFJ A;  1BOD A;  2KGB C;  3I5I C;  3EVU A;  1ALW A;  2BL0 C;  1TNW A;  3EVR A;  1BJF A;  2KQ6 A;  3TUY B;  5AFP A;  2PAL A;  4NDD A;  1B1G A;  1JC2 A;  2NZ0 A;  1JFJ A;  1OZS A;  1EXR A;  2CCM A;  2I7A A;  3I5G C;  1N0Y A;  1NIW A;  2K7B A;  1L2O C;  1NWD A;  2L5X B;  1KWO B;  1EH2 A;  2ZRT A;  5HLO A;  1B7T Y;  1XFV O; 
#chains in the Genus database with same CATH topology
 4D1E A;  4QJ4 B;  1QTX A;  2MLF C;  1DGV A;  2Q91 A;  5AEQ A;  1J7O A;  3S0B A;  4MRY A;  1WLZ A;  3TS5 C;  3BUW B;  2WCK A;  3SG6 A;  2JNF A;  2TN4 A;  2BKH B;  2EGD A;  2EC6 C;  1DJG A;  1OMD A;  2WC8 A;  3DZT A;  2BCB A;  3IQO A;  1TTX A;  2WND A;  4U8D A;  3BFB A;  1BU3 A;  2LAN A;  2M8U A;  3BXK A;  1DJI A;  4AOM A;  4XJK B;  4MRX A;  2KFF A;  3R1P A;  3BFA A;  1XA5 A;  1MWN A;  2KI6 D;  1QV1 A;  2KSP A;  3I5H C;  1M63 B;  3JVT B;  3H4S E;  3QRX A;  3TDU A;  4GUK A;  2QEO A;  5HYD A;  3K1E A;  2KAX A;  1UWO A;  1GGZ A;  1J1E A;  1G4Y R;  1UUS A;  2K7O A;  2LHL A;  1XYD A;  2K2A A;  3GK1 A;  3BQ3 A;  1SPY A;  1Y1X A;  4CFR A;  3SS3 A;  3PAT A;  1AJ5 A;  1LA0 A;  5CSN A;  2JPT A;  4Q04 A;  4ORA B;  1XK4 C;  3WHT B;  4GGN A;  1M31 A;  2LLT A;  4QJ3 B;  1SL7 A;  2CTN A;  1C3Z A;  1OMV A;  2LP3 A;  3NSK A;  4DIR A;  3TZ1 A;  1MUX A;  3PJI A;  1C7W A;  4C0L A;  2PVB A;  4HRG A;  4PE0 A;  1J1D A;  1TNX A;  1CM1 A;  1M39 A;  4C0K A;  2FJU B;  3S0F A;  4MZL A;  1KQM B;  4ZCV A;  1Y6W A;  3CZ0 A;  1TRF A;  2D8N A;  1SW8 A;  2E30 A;  1TCF A;  3OX5 A;  1X02 A;  2WC6 A;  2M1U A;  2Y4Q A;  3O4X A;  4JPZ B;  1YVL A;  1TCO B;  2JQ6 A;  4QJ5 B;  1C7V A;  2CXJ A;  3VB1 A;  1S26 D;  3EK8 A;  3LLE A;  1XK4 A;  4CID A;  2LMV A;  2KOT A;  1MXL C;  1EG3 A;  2F3Z A;  2FCE A;  4N1F A;  3AKB A;  5CSJ A;  1IKU A;  1Q80 A;  3BUX B;  2KYF A;  2QEB A;  1NCX A;  2WOR A;  3WNX B;  2LVJ A;  2GTE A;  1NYA A;  3TUY C;  1U5I B;  3CS1 A;  2LAP A;  2M7L A;  3D78 A;  2HET A;  5JJG A;  1K9U A;  2MBX A;  2NXQ A;  2E6W A;  3PN7 C;  3PM2 A;  1JBA A;  1A75 B;  2G2B A;  4GFT A;  2KBM A;  2VRG A;  3D0Y A;  2L98 A;  4WQ3 A;  2P71 A;  1KFU L;  2OS8 B;  1QX7 A;  1HT9 A;  1GQM A;  1KK7 Z;  1PK0 D;  2HQW A;  4JQ0 D;  1YUS A;  4N1G A;  4N5X A;  1B8R A;  1SCV A;  1TN4 A;  1ZOT B;  2YGU A;  2JU0 A;  3FE6 A;  4FTG A;  2OTG B;  5HKZ A;  1BLQ A;  1NX0 A;  3PM8 A;  4M2O A;  1DF0 B;  1ODB A;  2FJY A;  3CYZ A;  3NSO A;  3I5F C;  4OV2 A;  3VRO A;  1JFK A;  1S6J A;  3DF0 A;  2L4I A;  1PRW A;  1A4P A;  2MLE C;  5FI2 A;  1B9A A;  1W9Z A;  3RM1 A;  3S0G A;  3PSR A;  4BY4 A;  1XFZ O;  5HLV A;  1R6P A;  1LA3 A;  2M0R A;  1DJW A;  1SL8 A;  3SIB A;  1BG1 A;  1QIW A;  5KU1 A;  1F71 A;  2P6B B;  4GAO A;  1REC A;  4DRW A;  2K7C A;  3B87 A;  2ZN8 A;  1ZMZ A;  1NCZ A;  1NX3 A;  1WRZ A;  3LCP C;  1OMR A;  2M49 B;  4YI9 A;  4ETO A;  5I2O A;  3JVT C;  3VRR A;  1W7I B;  2F2P A;  3GK4 X;  1LXF C;  1CMG A;  1NP8 A;  4F7F A;  1MXE A;  4OVN F;  2V53 A;  1T14 A;  1F4O A;  4A4C A;  2K7D A;  1IQ3 A;  1BT6 A;  2K60 A;  1V1F A;  3NHI A;  1S5G Z;  2BBM A;  1ZFS A;  2F33 A;  3EVV A;  3SG4 A;  1WRK A;  1K90 D;  2I94 A;  2M1K B;  3BJH A;  4P5O E;  3SIA A;  4DUQ A;  1OSA A;  2LMT A;  3D10 A;  2L5Y A;  2M29 A;  4ORB B;  4MZJ A;  1CFF A;  3UNW A;  1UHN A;  1CDN A;  2FOT A;  1QIV A;  3DD4 A;  2ISD A;  1SKT A;  3R1V A;  1R2U A;  2CT9 A;  1K8U A;  1TOP A;  2L51 A;  4PE1 A;  4WQ2 A;  1KQM C;  1J7R A;  1E8A A;  1YUT A;  2KFH A;  1SRA A;  2WOS A;  5I2Q A;  1WDC B;  2GV5 A;  2KI4 B;  3WXA A;  4MVF A;  3D73 A;  2LHI A;  1XFR A;  4GPL B;  4M2P A;  3OB2 B;  1QLS A;  3C1V A;  1DQE A;  2KBI A;  3S0E A;  4I5N B;  1K2H A;  2JT8 A;  1Z2C B;  2SCP A;  2NCO A;  3F45 A;  2L4H A;  1SR6 B;  1C07 A;  3LK1 A;  1PSR A;  4NDC A;  3D75 A;  1FF1 A;  3B86 A;  1IH0 A;  3SG5 A;  3EK4 A;  3BFH A;  5BPJ A;  1DEK A;  1OQP A;  2M3W A;  2JC2 A;  5KTY A;  2WCJ A;  3CZ2 A;  4R1E A;  2Y5I A;  1AHR A;  1A03 A;  1DEL A;  2KFG A;  2MRD A;  2JT0 A;  5B8I B;  4YBH B;  4AQI A;  1KK7 Y;  2BE4 A;  1CLL A;  1IWQ A;  2JTZ A;  2LLU A;  1C3Y A;  4CLN A;  3PFV A;  3NXA A;  2MHH A;  3R72 A;  1LKJ A;  4C0J A;  1DVI A;  2OS8 C;  2LM5 A;  1MF8 B;  1W7J B;  2AMI A;  5D3O A;  5HKY A;  1QS7 A;  2BE6 A;  5FI6 A;  1Y0V H;  1KFX S;  2OPO A;  2WCF A;  4OKH A;  1VRK A;  4CPV A;  1H4B A;  2JNX A;  4HRE E;  1JSA A;  1K9P A;  1DMO A;  1BR1 B;  1QAS A;  5D7F A;  1DC1 A;  1U5I A;  3OP0 A;  1IG5 A;  1CFC A;  1B4C A;  3HCM A;  3UO9 A;  2ZRS A;  4I5K A;  2EHB A;  4PAL A;  1AP4 A;  1A75 A;  3JTD B;  2BL0 B;  2CNP A;  3O78 A;  1CKK A;  3EG5 B;  4MEW A;  4ORC B;  4OR9 B;  2HF5 A;  3NGV A;  4PHN A;  1DTL A;  4A4B A;  2G9B A;  1OOJ A;  4IJ7 A;  2KI6 C;  1KQV A;  2JXC A;  4CFQ A;  3VGO A;  1F4Q A;  3WHU B;  2BEC A;  2KGR A;  5I94 A;  4AQJ A;  2WCL A;  1S36 A;  5J3X A;  4E68 A;  3O4Y A;  1KFU S;  2Q4U A;  3L4A A;  4FQO A;  1PUL A;  1S5G Y;  2MAZ A;  1AVS A;  1DF0 A;  1JF2 A;  5ER5 A;  1CLB A;  2ZKM X;  1P28 A;  5HKW A;  1MHO A;  1JF0 A;  3CTN A;  2QPT A;  1EG4 A;  1PAL A;  2LLS A;  1DGU A;  3TS5 B;  1TIZ A;  1L7Z A;  4YGC B;  4OZD A;  3D74 A;  1QX5 B;  5JOL A;  1RRO A;  2QAC A;  4XYN A;  1UHK A;  5AAN A;  1UUR A;  1KWO C;  1QV0 A;  1SL9 A;  2PSR A;  4DS7 A;  3LK0 A;  3CAB A;  4I5J A;  3DY9 A;  4PHJ A;  1KCY A;  2Y1N A;  3RZS A;  3OX6 A;  2WCB A;  4INW A;  1K95 A;  1TUJ A;  1KSM A;  1WDC C;  2GGZ A;  2KPH A;  2KI4 C;  3B6X A;  5EL2 A;  1NCY A;  4PHM A;  3NSI A;  3KF9 A;  1PSB A;  1YRT B;  1FPW A;  2K8M B;  2JT3 A;  2I18 A;  1DJX A;  1PVA A;  1Y1U A;  2FCD A;  2NLN A;  3GK2 A;  2BAP A;  3CDN A;  3DVJ A;  4PE7 A;  2K0J A;  3BYA A;  1LS8 A;  1SBJ A;  1XO5 A;  3IF7 A;  3KEV A;  2LVK A;  1IGV A;  2F3Y A;  1SY9 A;  2JOJ A;  1G33 A;  1HQV A;  3SG7 A;  3FIA A;  1OOI X;  1OOH A;  2F2O A;  3OB1 B;  4YGD B;  1ORG A;  1S3P A;  1M45 A;  1F8H A;  1K93 D;  1AJ4 A;  1Y1A A;  2B1U A;  3NHT A;  5HL1 A;  3DVK A;  1KSO A;  3AAJ A;  4HSZ A;  3LL8 B;  1RK9 A;  2LE9 B;  2ZNE A;  1CM4 A;  2DOQ A;  5DKN A;  1WLM A;  3B7A A;  4YRU A;  2KHN A;  4MSP A;  5PAL A;  3SJS A;  1IJ6 A;  1OZO A;  1UHH A;  2JRF A;  2KLE A;  2M97 A;  1GM0 A;  4HRH A;  4XJK A;  2K2F A;  4JD9 A;  1KK8 B;  1SK6 D;  2ZND A;  3ZWH A;  1A2X A;  3FWC A;  3CZ1 A;  5CPV A;  1CLM A;  3ICB A;  1GGW A;  3S0D A;  3A4U B;  2JUL A;  3OHM B;  2BNX A;  1J7Q A;  1XFW O;  1SCM B;  3IVT A;  3JTD C;  3PAL A;  3AAK A;  3CZT X;  3L47 A;  4OCI A;  2AAO A;  3O6B A;  3QME A;  1CTR A;  3CR5 X;  5TNC A;  1SSE B;  2JTT A;  3RLZ A;  2Y1M A;  1CFD A;  3DF0 B;  2LCP A;  3BUN B;  3PN7 B;  4GGF C;  1LIN A;  1TUZ A;  1XFU O;  1ZAC A;  2ZFD A;  3TDZ A;  1QLK A;  1NPQ A;  3EK7 A;  1F55 A;  2CBL A;  2LNK A;  3M0W A;  1QX2 A;  1TWO A;  2A4J A;  1TNP A;  2PMY A;  1WY9 A;  1S6C A;  2RGI A;  3BOW B;  2HPS A;  1JUO A;  2NCP A;  4KYN A;  1AUI B;  1YX8 A;  1FW4 A;  1UHJ A;  1Z4H A;  4DCK A;  1OOG A;  1YTZ C;  1NUB A;  4PCW A;  1F70 A;  1LVC D;  1RWY A;  2KLD A;  1BMO A;  2H2K A;  4INX A;  2L2E A;  2QDI A;  3I5F B;  1SYM A;  1H8B A;  1YUR A;  4FQT A;  4GGF A;  4MZK A;  3OBV A;  4I5L B;  2KDH A;  2LUC A;  3CGA A;  1QXP A;  3BUO B;  1NX2 A;  4BY5 A;  1RTP 1;  3CR2 A;  3DXL A;  4M2Q A;  1CDL A;  1MR8 A;  3KHE A;  4P2Y B;  2JWW A;  3DVE A;  2OTG C;  4PE4 A;  4L9M A;  1ALV A;  2I2R E;  5DKR A;  1K94 A;  1XFY O;  2WCE A;  3KO0 A;  3B88 A;  4NDB A;  3N7H A;  3GOF A;  1CDM A;  4F0Z B;  2MJW B;  3I5I B;  4PDZ A;  2BCX A;  3L4L A;  2JXL A;  3SS5 A;  3FE8 A;  4JKT A;  4YI8 A;  3EKH A;  1F54 A;  1RJV A;  2PRU A;  1B8C A;  3SG3 A;  1CDP A;  5AXI A;  1N65 A;  1S1E A;  1QJT A;  3D77 A;  3FE9 A;  1YRU B;  1V1G A;  1FI6 A;  1IJ5 A;  1EL4 A;  3DYE A;  3EKJ A;  3FWB A;  2SAS A;  5DKQ A;  1NX1 A;  1CMF A;  2R2I A;  1A29 A;  1M46 A;  1UP5 A;  3I5G B;  3IQQ A;  4MLW A;  1L2O B;  4YGA A;  1AK8 A;  3BUM B;  5CSI A;  1J7P A;  5I8N A;  2QEH A;  4YGE B;  2PYQ A;  3NSL A;  3FS7 A;  1QVI Y;  1YVH A;  2JZI A;  2LUX A;  2M9G A;  1OE9 B;  3D76 A;  5GQQ C;  5I2L A;  3DVM A;  5F6T A;  1QAT A;  2GGM A;  5G08 A;  3VRN A;  1B8L A;  1B7T Z;  1BR4 B;  4GNK B;  1JWD A;  1CNP A;  2ZN9 A;  4NQG A;  2BKI B;  1XFX O;  2PAS A;  1YR5 A;  1G8I A;  1KK8 C;  1OOF A;  2EC6 B;  3A8R A;  1KFX L;  2L0P A;  3K21 A;  3Q8I A;  1IRJ A;  2KYC A;  2L50 A;  4WRI A;  2H61 C;  3VRQ A;  2LVV A;  2BBN A;  2IS9 A;  1DJZ A;  3HX4 A;  1SNL A;  1K96 A;  1PVB A;  1BF5 A;  5FYX A;  1SCM C;  1DJY A;  3AKA A;  3ZNI A;  2KNE A;  2KAY A;  1QWV A;  3I5H B;  4TNC A;  1S6I A;  1EJ3 A;  1ZUZ A;  2HQ8 A;  1UHI A;  1NSH A;  2LC5 A;  3SS4 A;  2MA2 A;  4IL1 A;  4USL A;  1K9K A;  4GBA A;  4MBE A;  2M7N A;  3PLF B;  1SR6 C;  1YUU A;  2K61 A;  2WCH A;  2LMU A;  4ZCU A;  2AUC A;  4ICB A;  3MSE B;  2H61 A;  1TNQ A;  5CSF A;  2BCA A;  3SG2 A;  1XVJ A;  2LP2 A;  2L2C A;  5KSZ A;  1N2D A;  2LVI A;  1CB1 A;  3CLN A;  4JWQ A;  1J55 A;  1IIO A;  3O2P A;  1CFP A;  3CR4 X;  1DJH A;  1IQ5 A;  1MQ1 A;  2P70 A;  1D1O A;  1FBV A;  5K89 A;  1OW4 A;  2KAV A;  2WCM A;  3KPX A;  1DT7 B;  3VRP A;  5AER A;  5IBW A;  2F8P A;  2O60 A;  1WRL A;  2LV7 A;  3V2L A;  1FI5 A;  2COL B;  5ER4 X;  1B47 A;  1GJY A;  1QVI Z;  3D0Y B;  2O5G A;  3BOW A;  5FI7 A;  1YX7 A;  2KQY A;  1SMG A;  5D69 A;  3TDI A;  3E3R A;  4YGB B;  3OGN A;  4UPG A;  1BOC A;  2QEV A;  2ERB A;  3CWG A;  4MN0 A;  4PHK A;  1RFJ A;  1BOD A;  2KGB C;  4PT1 A;  3I5I C;  3EVU A;  3R1O A;  1ALW A;  2BL0 C;  1TNW A;  3EVR A;  1BJF A;  2KQ6 A;  3TUY B;  5AFP A;  2PAL A;  4NDD A;  1B1G A;  1JC2 A;  2NZ0 A;  1JFJ A;  1OZS A;  2H8V A;  5DIC A;  2PQL A;  1EXR A;  2CCM A;  3S0A A;  2JPO A;  2I7A A;  3I5G C;  1N0Y A;  1NIW A;  2K7B A;  1L2O C;  1NWD A;  2L5X B;  1KWO B;  2WC5 A;  1EH2 A;  2ZRT A;  5HLO A;  1B7T Y;  1XFV O; 
#chains in the Genus database with same CATH homology
 4D1E A;  4QJ4 B;  1QTX A;  2MLF C;  1DGV A;  2Q91 A;  5AEQ A;  1J7O A;  4MRY A;  1WLZ A;  3TS5 C;  3BUW B;  3SG6 A;  2JNF A;  2TN4 A;  2BKH B;  2EGD A;  2EC6 C;  1DJG A;  1OMD A;  2WC8 A;  2BCB A;  3IQO A;  1TTX A;  2WND A;  4U8D A;  1BU3 A;  2LAN A;  2M8U A;  3BXK A;  1DJI A;  4AOM A;  4XJK B;  4MRX A;  2KFF A;  1XA5 A;  1MWN A;  2KI6 D;  1QV1 A;  2KSP A;  3I5H C;  1M63 B;  3JVT B;  3H4S E;  3QRX A;  3TDU A;  5HYD A;  2KAX A;  1UWO A;  1GGZ A;  1J1E A;  1G4Y R;  1UUS A;  2K7O A;  2LHL A;  1XYD A;  2K2A A;  3GK1 A;  3BQ3 A;  1SPY A;  1Y1X A;  4CFR A;  3PAT A;  1AJ5 A;  1LA0 A;  5CSN A;  2JPT A;  4Q04 A;  4ORA B;  1XK4 C;  3WHT B;  4GGN A;  1M31 A;  2LLT A;  4QJ3 B;  1SL7 A;  2CTN A;  1OMV A;  2LP3 A;  3NSK A;  4DIR A;  3TZ1 A;  1MUX A;  4C0L A;  1C7W A;  2PVB A;  4HRG A;  4PE0 A;  1J1D A;  1TNX A;  1CM1 A;  1M39 A;  4C0K A;  2FJU B;  4MZL A;  1KQM B;  4ZCV A;  1Y6W A;  1TRF A;  2D8N A;  1SW8 A;  2E30 A;  1TCF A;  3OX5 A;  1X02 A;  4QJ5 B;  2M1U A;  2Y4Q A;  4JPZ B;  1YVL A;  1TCO B;  2JQ6 A;  1C7V A;  2CXJ A;  1S26 D;  3EK8 A;  3LLE A;  1XK4 A;  4CID A;  2LMV A;  2KOT A;  1MXL C;  1EG3 A;  2F3Z A;  2FCE A;  4N1F A;  3AKB A;  5CSJ A;  1IKU A;  1Q80 A;  3BUX B;  2KYF A;  1NCX A;  2WOR A;  3WNX B;  2LVJ A;  3TUY C;  1NYA A;  1U5I B;  3CS1 A;  2LAP A;  2M7L A;  2HET A;  5JJG A;  1K9U A;  2MBX A;  2NXQ A;  2E6W A;  3PN7 C;  1JBA A;  1A75 B;  2G2B A;  4GFT A;  2KBM A;  2VRG A;  3D0Y A;  2L98 A;  4WQ3 A;  1KFU L;  2OS8 B;  1QX7 A;  1HT9 A;  1GQM A;  1KK7 Z;  1PK0 D;  2HQW A;  4JQ0 D;  1YUS A;  4N1G A;  4N5X A;  1B8R A;  1SCV A;  1TN4 A;  1ZOT B;  4FTG A;  2JU0 A;  5HKZ A;  1BLQ A;  2OTG B;  1NX0 A;  3PM8 A;  4M2O A;  1DF0 B;  1ODB A;  3NSO A;  3I5F C;  4OV2 A;  3VRO A;  1JFK A;  1S6J A;  3DF0 A;  2L4I A;  1PRW A;  1A4P A;  2MLE C;  3RM1 A;  1B9A A;  4BY4 A;  3PSR A;  1XFZ O;  5HLV A;  1R6P A;  1LA3 A;  2M0R A;  1DJW A;  1SL8 A;  3SIB A;  1BG1 A;  1QIW A;  5KU1 A;  1F71 A;  2P6B B;  4GAO A;  1REC A;  4DRW A;  2K7C A;  2ZN8 A;  1ZMZ A;  1NCZ A;  1NX3 A;  1WRZ A;  3LCP C;  1OMR A;  2M49 B;  4YI9 A;  4ETO A;  5I2O A;  3JVT C;  3VRR A;  1W7I B;  2F2P A;  3GK4 X;  1LXF C;  1CMG A;  1NP8 A;  1MXE A;  4OVN F;  2V53 A;  1F4O A;  4A4C A;  2K7D A;  1IQ3 A;  1BT6 A;  1V1F A;  1S5G Z;  2BBM A;  1ZFS A;  2F33 A;  3EVV A;  3SG4 A;  1WRK A;  1K90 D;  2I94 A;  2M1K B;  4P5O E;  3SIA A;  4DUQ A;  1OSA A;  2LMT A;  3D10 A;  2M29 A;  4ORB B;  1CFF A;  4MZJ A;  1UHN A;  1CDN A;  2FOT A;  1QIV A;  3DD4 A;  2ISD A;  1SKT A;  1R2U A;  2CT9 A;  1K8U A;  1TOP A;  2L51 A;  4PE1 A;  4WQ2 A;  1KQM C;  1J7R A;  1E8A A;  1YUT A;  2KFH A;  1SRA A;  2WOS A;  5I2Q A;  1WDC B;  2GV5 A;  2KI4 B;  3WXA A;  4MVF A;  2LHI A;  4GPL B;  4M2P A;  3OB2 B;  1QLS A;  3C1V A;  2KBI A;  4I5N B;  1K2H A;  2JT8 A;  2SCP A;  2NCO A;  3F45 A;  2L4H A;  1SR6 B;  1C07 A;  3LK1 A;  1PSR A;  4NDC A;  1IH0 A;  1FF1 A;  3SG5 A;  3EK4 A;  5BPJ A;  1OQP A;  2M3W A;  2JC2 A;  5KTY A;  4R1E A;  2Y5I A;  1AHR A;  1A03 A;  2KFG A;  2MRD A;  2JT0 A;  5B8I B;  4YBH B;  4AQI A;  1KK7 Y;  2BE4 A;  1CLL A;  1IWQ A;  2JTZ A;  2LLU A;  4CLN A;  3PFV A;  3NXA A;  2MHH A;  4C0J A;  1LKJ A;  1DVI A;  2OS8 C;  2LM5 A;  1MF8 B;  1W7J B;  2AMI A;  5HKY A;  1QS7 A;  2BE6 A;  1Y0V H;  1KFX S;  2OPO A;  2WCF A;  4OKH A;  1VRK A;  4CPV A;  1H4B A;  2JNX A;  4HRE E;  1JSA A;  1K9P A;  1DMO A;  1BR1 B;  1QAS A;  5D7F A;  1U5I A;  3OP0 A;  1IG5 A;  1CFC A;  1B4C A;  3HCM A;  2ZRS A;  4I5K A;  2EHB A;  4PAL A;  1AP4 A;  1A75 A;  3JTD B;  2BL0 B;  2CNP A;  3O78 A;  1CKK A;  4MEW A;  4ORC B;  4OR9 B;  2HF5 A;  4PHN A;  1DTL A;  4A4B A;  2G9B A;  1OOJ A;  1KQV A;  2KI6 C;  2JXC A;  4CFQ A;  3VGO A;  1F4Q A;  3WHU B;  2BEC A;  2KGR A;  4AQJ A;  1S36 A;  5J3X A;  4E68 A;  3O4Y A;  1KFU S;  2Q4U A;  4FQO A;  1PUL A;  1S5G Y;  2MAZ A;  1AVS A;  1DF0 A;  1JF2 A;  5ER5 A;  1CLB A;  2ZKM X;  5HKW A;  1MHO A;  1JF0 A;  3CTN A;  2QPT A;  1EG4 A;  1PAL A;  2LLS A;  1DGU A;  3TS5 B;  1TIZ A;  1L7Z A;  4YGC B;  1QX5 B;  5JOL A;  1RRO A;  2QAC A;  4XYN A;  1UHK A;  5AAN A;  1UUR A;  1KWO C;  1QV0 A;  1SL9 A;  2PSR A;  4DS7 A;  3LK0 A;  4I5J A;  4PHJ A;  1KCY A;  2Y1N A;  3OX6 A;  2WCB A;  1K95 A;  1KSM A;  1WDC C;  2GGZ A;  2KI4 C;  1NCY A;  4PHM A;  3NSI A;  3KF9 A;  1PSB A;  1YRT B;  1FPW A;  2K8M B;  2JT3 A;  2I18 A;  1DJX A;  1PVA A;  1Y1U A;  2FCD A;  2NLN A;  3GK2 A;  3DVJ A;  4PE7 A;  2K0J A;  3BYA A;  1SBJ A;  3IF7 A;  1XO5 A;  3KEV A;  2LVK A;  1IGV A;  2F3Y A;  1SY9 A;  2JOJ A;  1G33 A;  1HQV A;  3SG7 A;  3FIA A;  2F2O A;  3OB1 B;  4YGD B;  1S3P A;  1M45 A;  1F8H A;  1K93 D;  1AJ4 A;  1Y1A A;  2B1U A;  3DVK A;  1KSO A;  3AAJ A;  4HSZ A;  3LL8 B;  1RK9 A;  2LE9 B;  2ZNE A;  1CM4 A;  2DOQ A;  5DKN A;  1WLM A;  4YRU A;  2KHN A;  4MSP A;  5PAL A;  3SJS A;  1IJ6 A;  1OZO A;  1UHH A;  2JRF A;  2M97 A;  4HRH A;  4XJK A;  2K2F A;  1KK8 B;  1SK6 D;  2ZND A;  3ZWH A;  1A2X A;  3FWC A;  5CPV A;  1CLM A;  3ICB A;  1GGW A;  3A4U B;  2JUL A;  3OHM B;  1J7Q A;  1XFW O;  1SCM B;  3JTD C;  3PAL A;  4OCI A;  3AAK A;  3CZT X;  2AAO A;  3O6B A;  3RLZ A;  1CTR A;  3CR5 X;  5TNC A;  2JTT A;  2Y1M A;  1CFD A;  3DF0 B;  2LCP A;  3BUN B;  3PN7 B;  4GGF C;  1LIN A;  1XFU O;  1ZAC A;  2ZFD A;  3TDZ A;  1QLK A;  1NPQ A;  3EK7 A;  1F55 A;  2CBL A;  2LNK A;  3M0W A;  1QX2 A;  2A4J A;  2PMY A;  1TNP A;  2RGI A;  1WY9 A;  1S6C A;  3BOW B;  2HPS A;  1JUO A;  2NCP A;  1AUI B;  1YX8 A;  1FW4 A;  1UHJ A;  4DCK A;  1YTZ C;  1NUB A;  4PCW A;  1F70 A;  1LVC D;  1RWY A;  1BMO A;  2H2K A;  2L2E A;  3I5F B;  1SYM A;  1H8B A;  1YUR A;  4GGF A;  4MZK A;  4I5L B;  2KDH A;  2LUC A;  3CGA A;  1QXP A;  3BUO B;  1NX2 A;  4BY5 A;  1RTP 1;  3CR2 A;  4M2Q A;  1CDL A;  1MR8 A;  3KHE A;  4P2Y B;  2JWW A;  3DVE A;  2OTG C;  4PE4 A;  4L9M A;  1ALV A;  2I2R E;  5DKR A;  1K94 A;  1XFY O;  2WCE A;  3KO0 A;  4NDB A;  3GOF A;  1CDM A;  4F0Z B;  2MJW B;  3I5I B;  4PDZ A;  2BCX A;  2JXL A;  1F54 A;  4YI8 A;  3EKH A;  1RJV A;  2PRU A;  1B8C A;  3SG3 A;  1CDP A;  5AXI A;  1N65 A;  1S1E A;  1QJT A;  1YRU B;  1V1G A;  1FI6 A;  1IJ5 A;  1EL4 A;  5DKQ A;  3EKJ A;  3FWB A;  2SAS A;  1NX1 A;  1CMF A;  2R2I A;  1A29 A;  1M46 A;  1UP5 A;  3I5G B;  3IQQ A;  4MLW A;  1L2O B;  4YGA A;  1AK8 A;  3BUM B;  5CSI A;  1J7P A;  5I8N A;  4YGE B;  3NSL A;  3FS7 A;  1QVI Y;  1YVH A;  2JZI A;  2LUX A;  2M9G A;  1OE9 B;  5GQQ C;  5I2L A;  3DVM A;  5F6T A;  1QAT A;  2GGM A;  5G08 A;  3VRN A;  1B8L A;  1B7T Z;  1BR4 B;  4GNK B;  1JWD A;  1CNP A;  2ZN9 A;  4NQG A;  2BKI B;  1XFX O;  2PAS A;  1YR5 A;  1G8I A;  1KK8 C;  2EC6 B;  3A8R A;  3K21 A;  1KFX L;  2L0P A;  4GUK A;  1IRJ A;  2KYC A;  2L50 A;  4WRI A;  2H61 C;  3VRQ A;  2LVV A;  2BBN A;  2IS9 A;  1DJZ A;  3HX4 A;  1SNL A;  1K96 A;  1PVB A;  1BF5 A;  5FYX A;  1SCM C;  1DJY A;  3AKA A;  3ZNI A;  2KNE A;  2KAY A;  3I5H B;  4TNC A;  1S6I A;  1EJ3 A;  1ZUZ A;  2HQ8 A;  1UHI A;  1NSH A;  2LC5 A;  2MA2 A;  4IL1 A;  4USL A;  1K9K A;  4GBA A;  4MBE A;  2M7N A;  3PLF B;  1SR6 C;  1YUU A;  2K61 A;  2LMU A;  4ZCU A;  2AUC A;  4ICB A;  3MSE B;  2H61 A;  1TNQ A;  5CSF A;  2BCA A;  3SG2 A;  1XVJ A;  2LP2 A;  5KSZ A;  1CB1 A;  1N2D A;  2LVI A;  3CLN A;  4JWQ A;  1J55 A;  3O2P A;  1CFP A;  3CR4 X;  1DJH A;  1IQ5 A;  1MQ1 A;  1D1O A;  1FBV A;  5K89 A;  2KAV A;  3KPX A;  1DT7 B;  3VRP A;  5AER A;  5IBW A;  2F8P A;  2O60 A;  1WRL A;  2LV7 A;  1FI5 A;  2COL B;  5ER4 X;  1B47 A;  1GJY A;  1QVI Z;  3D0Y B;  2O5G A;  3BOW A;  1YX7 A;  2KQY A;  1SMG A;  5D69 A;  3TDI A;  3E3R A;  4YGB B;  4UPG A;  1BOC A;  3CWG A;  4MN0 A;  4PHK A;  1RFJ A;  1BOD A;  2KGB C;  3I5I C;  3EVU A;  1ALW A;  2BL0 C;  1TNW A;  3EVR A;  1BJF A;  2KQ6 A;  3TUY B;  5AFP A;  2PAL A;  4NDD A;  1B1G A;  1JC2 A;  2NZ0 A;  1JFJ A;  1OZS A;  1EXR A;  2CCM A;  2I7A A;  3I5G C;  1N0Y A;  1NIW A;  2K7B A;  1L2O C;  1NWD A;  2L5X B;  1KWO B;  1EH2 A;  2ZRT A;  5HLO A;  1B7T Y;  1XFV O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...