1CB1A

Three-dimensional solution structure of ca2+-loaded porcine calbindin d9k determined by nuclear magnetic resonance spectroscopy
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
78
structure length
78
Chain Sequence
b'SAQKSPAELKSIFEKYAAKEGDPNQLSKEELKQLIQAEFPSLLKGPRTLDDLFQELDKNGDGEVSFEEFQVLVKKISQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALBINDIN D9K
publication title Three-dimensional solution structure of Ca(2+)-loaded porcine calbindin D9k determined by nuclear magnetic resonance spectroscopy.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Calcium-binding protein
total genus 24
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 1991-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1cb1A00
2LUXA 1TCFA 1JUOA 2EC6B 1RECA 1ZOTB 4NDBA 4HRGA 3O4YA 2LVVA 2M7LA 1A2XA 2LHLA 2I2RE 4QJ4B 3VRQA 4NDDA 1J1EA 2KFHA 1HQVA 1PSRA 1BODA 2ZKMX 2ZFDA 4ORCB 2RGIA 1KWOB 3JVTC 4FQOA 2JU0A 2KI4B 3DVKA 5AERA 4AOMA 1J55A 4YGDB 1A75A 1YR5A 4QJ3B 2O5GA 1CTRA 3AAKA 3RM1A 2ZN9A 1UHHA 4N1GA 5PALA 1RJVA 4MLWA 1F71A 4FTGA 2JNFA 3I5GC 1J7PA 1B7TZ 3BUMB 4OVNF 1AP4A 2MRDA 3IQQA 1G4YR 4MZLA 4GUKA 4C0KA 1NX1A 2PVBA 2JNXA 1Y1UA 2M97A 3LLEA 1BR4B 2NCOA 3O6BA 2FCEA 1UUSA 3CR4X 3DVMA 2JRFA 1KWOC 1UHIA 2M8UA 3BUOB 1L2OB 1AJ5A 1M31A 4JQ0D 1XA5A 3EKHA 2JT3A 3MSEB 1RFJA 1QVIZ 1S6JA 1OOJA 4DIRA 2Y4QA 1UHNA 1GGWA 1OE9B 3NXAA 4JPZB 1QATA 1XFWO 1KFXL 1DVIA 1VRKA 1IQ3A 1C7WA 2JTZA 3C1VA 3D0YB 3DVJA 1CM1A 4PE4A 1UWOA 3SG3A 4IL1A 1YUTA 4GFTA 4USLA 3GK1A 4DRWA 1OMRA 2LANA 1KFUL 2Y1NA 1S1EA 1QLKA 3SJSA 1K2HA 1LKJA 1ZMZA 3CR5X 1EG3A 2MHHA 3EVUA 3PALA 1IJ5A 4M2PA 3BQ3A 2FOTA 2COLB 2NLNA 1XFZO 3I5HB 1RK9A 2DOQA 1MQ1A 4L9MA 1TTXA 2HQ8A 2KFFA 3ICBA 4GGNA 2BCBA 1KSMA 3PN7B 2JC2A 5TNCA 1QX5B 1GJYA 2M1KB 1NX0A 2L2EA 1ZACA 2SCPA 2KAYA 2L50A 5JJGA 3JTDB 5CSFA 1BMOA 1JSAA 3EK4A 2CXJA 4HRHA 4TNCA 1JC2A 3SIAA 1NX2A 2HPSA 3A4UB 2BKIB 1DGVA 1K96A 2BL0B 1K9UA 2A4JA 2SASA 3AKBA 1JBAA 1TNPA 1XFUO 1C7VA 2G2BA 3LCPC 1JF2A 2M0RA 3M0WA 2B1UA 1CKKA 2LE9B 4GNKB 4C0JA 4DS7A 3FWCA 2M49B 1AUIB 2JQ6A 4M2OA 1Y1AA 1EJ3A 2EHBA 2KQYA 1PVBA 1WRLA 1SCMC 2LP2A 3GK2A 5HKZA 2K7DA 2CNPA 1V1FA 1BLQA 1K95A 3CS1A 2WCBA 2BCXA 1DGUA 1CMGA 1Q80A 2GV5A 1S6IA 2WCFA 3LL8B 3GOFA 1B7TY 2E6WA 2LM5A 5AXIA 1GQMA 3ZWHA 1KK7Z 2BL0C 2R2IA 1SL7A 1DJYA 5ER5A 1CFPA 1F8HA 2D8NA 1U5IB 5ER4X 1RWYA 4PALA 3BXKA 1BF5A 3A8RA 4M2QA 4E68A 1A03A 2OPOA 2BKHB 3TUYB 3DVEA 1DT7B 1CLMA 1LA0A 3E3RA 3SG7A 3OB2B 3DF0B 1QVIY 5AFPA 1N0YA 1TNQA 2KYCA 1S3PA 2V53A 2EGDA 4BY4A 2AMIA 1F55A 1IRJA 2PALA 2ZN8A 3LK1A 3VRPA 1CMFA 2M1UA 1SW8A 4I5KA 3D10A 2CCMA 4JWQA 1V1GA 4UPGA 3CWGA 5KTYA 1DF0B 1PK0D 2LP3A 1SK6D 5HYDA 3NSOA 3OB1B 2KQ6A 4D1EA 2KAVA 2M7NA 2KOTA 2L98A 1MHOA 2LMUA 1SR6C 3CGAA 5D7FA 1NP8A 4OCIA 1OZOA 1QS7A 1KQMB 5HLVA 4WQ2A 1J7RA 2PRUA 1NCYA 3PM8A 1AJ4A 1ODBA 4MBEA 4GGFC 4CLNA 2BCAA 1B47A 1HT9A 1S26D 2BBMA 2LVIA 1NYAA 5KU1A 1SY9A 2EC6C 2JTTA 2MAZA 1WDCB 1EH2A 2L4HA 2ZNEA 1K90D 2CBLA 1SBJA 1KCYA 1W7JB 1TRFA 1M46A 1B9AA 1JFKA 1W7IB 1ZUZA 4PHJA 4A4CA 1IWQA 1QJTA 4PE0A 1JFJA 1H8BA 1L7ZA 1XK4A 2E30A 2KI4C 2F3YA 2KFGA 1DJZA 2L4IA 2ZRTA 3EVVA 3OHMB 4QJ5B 5DKQA 4CIDA 2H61C 2NCPA 2ISDA 1B8RA 2WC8A 1KSOA 4CFQA 1NIWA 3PATA 5AANA 2GGMA 2H2KA 3IF7A 1IJ6A 3SG2A 3TDZA 2JXLA 3PSRA 2L5XB 1QASA 1XVJA 2I7AA 2LCPA 4DUQA 2TN4A 1SL9A 1NUBA 2LHIA 4NQGA 1N2DA 2QPTA 1XYDA 1F4OA 1G8IA 3SG5A 3O78A 3WHUB 1CFDA 1S36A 4OR9B 3ZNIA 4PHMA 1OSAA 2LAPA 1QIWA 1B8LA 1KK7Y 3WXAA 1CLLA 3I5FB 1A75B 2LMTA 3BOWA 3HCMA 2WCEA 5GQQC 3VRRA 5D69A 2OTGB 1K8UA 4MRYA 2GGZA 1IGVA 1SKTA 4MZJA 4U8DA 1BR1B 1L2OC 4MZKA 1NCZA 1K94A 1SPYA 2KBMA 4CPVA 4I5LB 4MSPA 3NSIA 2JZIA 3SG6A 3HX4A 1SNLA 1J7OA 2KHNA 2F8PA 1CDLA 1WLZA 4A4BA 4I5JA 1A4PA 5K89A 1FI6A 4YI8A 1A29A 2JT0A 2OS8B 1YTZC 1WRKA 2LLUA 3WNXB 1M45A 1UHKA 1CDNA 1OMDA 2CT9A 1OZSA 3WHTB 2BBNA 1U5IA 1NCXA 4YGAA 3CR2A 2BE4A 2L51A 1SMGA 3AAJA 3VRNA 1IG5A 1XK4C 3I5HC 1BOCA 1D1OA 5CSNA 2L0PA 2KI6D 1QTXA 1KK8B 2HETA 4YGBB 2LC5A 1DJWA 3PN7C 5I2LA 4GGFA 2MBXA 3PLFB 5BPJA 4AQIA 2F3ZA 4YRUA 2JT8A 1ALVA 3DD4A 3JTDC 1QLSA 2BECA 2K7BA 3TZ1A 1PALA 2QACA 2OS8C 1XFVO 2IS9A 1F54A 1LVCD 2MJWB 1YRUB 4XJKB 2NXQA 1DJIA 2HQWA 5HLOA 5IBWA 1SYMA 2H61A 2LV7A 3OX5A 1ALWA 3FWBA 1YVLA 1MR8A 1FW4A 4ORAB 4I5NB 1QIVA 1SL8A 1R2UA 4C0LA 2LLTA 1MXEA 2JULA 1YUUA 1ZFSA 1UP5A 1KQVA 1Y6WA 3JVTB 4N1FA 1FF1A 1QXPA 4PHKA 2F2PA 1WLMA 1UHJA 1WRZA 1CB1A 2F33A 1DTLA 1XO5A 4CFRA 3QRXA 1RROA 1BJFA 2KI6C 1EG4A 4MEWA 4MVFA 4P2YB 3TUYC 1CM4A 4PE1A 1YRTB 2WNDA 3EVRA 3PFVA 5HKYA 1CNPA 1TIZA 2K7OA 2NZ0A 3I5GB 1BU3A 1BG1A 1M39A 3TS5B 1X02A 4YBHB 4YI9A 1CFCA 4GPLB 3EK7A 1CLBA 3D0YA 3BYAA 4MN0A 3I5IB 1JWDA 2K2AA 2M9GA 3CZTX 3VROA 1FI5A 4P5OE 1PULA 1WY9A 1AK8A 3OP0A 4WRIA 1DJHA 1CDPA 4OKHA 3TDUA 4DCKA 2CTNA 3KO0A 1XFXO 1SRAA 2LVJA 2KYFA 1MWNA 1S5GZ 4PDZA 2LUCA 1UURA 1YX8A 3GK4X 1KQMC 1B8CA 1G33A 1B4CA 1OQPA 4MRXA 1E8AA 1K9KA 2KBIA 4HSZA 1NSHA 2MLEC 3TS5C 1TOPA 4GBAA 2O60A 1DJXA 4PE7A 3I5IC 3CLNA 3TDIA 1YURA 1KFXS 1WDCC 1QX2A 1QV1A 3FS7A 3SIBA 4XYNA 2HF5A 3BUXB 2ZNDA 2FCDA 3O2PA 1LXFC 1AVSA 4Q04A 1KFUS 1J7QA 1K9PA 3KF9A 5DKNA 5FYXA 4BY5A 2Q91A 3NSLA 4YGEB 3NSKA 2F2OA 1R6PA 1CFFA 2P6BB 4GAOA 1EXRA 3CTNA 2PMYA 5DKRA 1XFYO 2I18A 4ETOA 2BE6A 3EKJA 1YUSA 3K21A 1QV0A 2M3WA 2WOSA 2K2FA 5I8NA 1OMVA 1QX7A 4R1EA 2K0JA 5J3XA 3SG4A 2K7CA 1NPQA 3I5FC 1NWDA 2Y1MA 4XJKA 2LVKA 1SCMB 5CSJA 2MA2A 2OTGC 5HKWA 5JOLA 3RLZA 5CSIA 1SCVA 3VGOA 1MF8B 2PSRA 2LMVA 1J1DA 3DF0A 3F45A 5G08A 1AHRA 1IQ5A 1CDMA 2FJUB 5KSZA 1IH0A 2JXCA 5I2OA 2G9BA 2VRGA 1TNXA 2LLSA 1DJGA 1LINA 1N65A 2AUCA 2JWWA 4ORBB 2KNEA 3OX6A 3H4SE 5F6TA 2KGBC 5AEQA 1DF0A 3BOWB 2AAOA 3BUWB 1F4QA 5B8IB 1BT6A 4ZCUA 1TNWA 1PVAA 1PRWA 3KEVA 1FPWA 1F70A 3KPXA 2LNKA 2JOJA 4N5XA 1M63B 3BUNB 1TN4A 1H4BA 1S5GY 1Y1XA 3AKAA 2M29A 4ICBA 2ZRSA 5CPVA 1KK8C 1JF0A 3KHEA 2KGRA 1LA3A 1C07A 3FIAA 2K61A 1YX7A 3EK8A 1B1GA 4ZCVA 1TCOB 2KDHA 1DMOA 3LK0A 4PCWA 4AQJA 1EL4A 2KSPA 1NX3A 1PSBA 3IQOA 2Y5IA 1MUXA 4PHNA 2PASA 4F0ZB 1YVHA 2Q4UA 1IKUA 1S6CA 1SR6B 1Y0VH 2K8MB 1K93D 1RTP1 1GGZA 2KAXA 4NDCA 4WQ3A 4OV2A 4HREE 4YGCB 2WORA 1FBVA 1MXLC 2JPTA 2MLFC 2I94A 5I2QA
chains in the Genus database with same CATH superfamily
3BFBA 2LUXA 1TCFA 1JUOA 2EC6B 1RECA 1ZOTB 3CZ1A 4NDBA 3D75A 4HRGA 3O4YA 2GTEA 2LVVA 2M7LA 1A2XA 2LHLA 2I2RE 4QJ4B 3VRQA 4NDDA 1J1EA 2KFHA 2L2CA 1HQVA 1PSRA 1BODA 2ZKMX 2ZFDA 4ORCB 2RGIA 1KWOB 3JVTC 4FQOA 2JU0A 2KI4B 1DQEA 3DVKA 5AERA 4AOMA 1J55A 4YGDB 1A75A 1YR5A 4QJ3B 3D74A 2O5GA 4PT1A 1CTRA 3AAKA 3RM1A 2ZN9A 1UHHA 2QEBA 4N1GA 5PALA 3D73A 1RJVA 1OOFA 4MLWA 1F71A 4FTGA 2JNFA 3I5GC 1J7PA 1B7TZ 3BUMB 4OVNF 1AP4A 2MRDA 3IQQA 1G4YR 4MZLA 4GUKA 4C0KA 1NX1A 2JPOA 2PVBA 2JNXA 1Y1UA 2M97A 3LLEA 1BR4B 2NCOA 3O6BA 2FCEA 1UUSA 3CR4X 3DVMA 2JRFA 1KWOC 1UHIA 2M8UA 3BUOB 1L2OB 1AJ5A 1M31A 4JQ0D 1XA5A 3EKHA 2JT3A 3MSEB 1RFJA 1QVIZ 1S6JA 1OOJA 4DIRA 2Y4QA 1UHNA 1GGWA 1OE9B 3NXAA 4JPZB 1LS8A 1QATA 2QEVA 3B7AA 1XFWO 1KFXL 1DVIA 1VRKA 3K1EA 1IQ3A 1C7WA 2JTZA 3C1VA 3D0YB 3DVJA 1CM1A 4PE4A 1UWOA 3SG3A 4IL1A 1YUTA 4GFTA 4USLA 3GK1A 4DRWA 1OMRA 2LANA 1KFUL 2Y1NA 1S1EA 1QLKA 3SJSA 1K2HA 1LKJA 1ZMZA 3CR5X 1EG3A 2MHHA 2WC6A 3EVUA 3PALA 1IJ5A 3R72A 4M2PA 3BQ3A 2FOTA 2COLB 2NLNA 1XFZO 3I5HB 1RK9A 2DOQA 1MQ1A 4L9MA 1DC1A 1TTXA 2HQ8A 5FI6A 2KFFA 2WCMA 2QEHA 3ICBA 4JD9A 4GGNA 2BCBA 1KSMA 3PN7B 2JC2A 5TNCA 1QX5B 1GJYA 2M1KB 1NX0A 2L2EA 1ZACA 2SCPA 2KAYA 2L50A 5JJGA 3JTDB 5CSFA 3NGVA 1BMOA 1JSAA 3EK4A 2CXJA 2BNXA 4HRHA 4TNCA 1JC2A 3SIAA 1NX2A 2HPSA 3A4UB 2BAPA 2BKIB 1DGVA 1K96A 1K9UA 2A4JA 2BL0B 2SASA 3AKBA 3D77A 1TNPA 1XFUO 1C7VA 2G2BA 3LCPC 1JF2A 2M0RA 3M0WA 5FI2A 3Q8IA 2B1UA 1CKKA 2LE9B 4GNKB 4C0JA 4DS7A 3FWCA 2M49B 1AUIB 2JQ6A 4M2OA 1Y1AA 1EJ3A 2EHBA 2KQYA 1PVBA 1WRLA 1SCMC 2LP2A 3GK2A 5HKZA 3S0GA 2K7DA 1V1FA 2CNPA 1BLQA 1K95A 3CS1A 2WCBA 2BCXA 1DGUA 1CMGA 1Q80A 2H8VA 2GV5A 1S6IA 2WCFA 3LL8B 3GOFA 1B7TY 2E6WA 2LM5A 5AXIA 1GQMA 3ZWHA 1KK7Z 2BL0C 2R2IA 1SL7A 1DJYA 5ER5A 1CFPA 1F8HA 2D8NA 1U5IB 5ER4X 3PM2A 1RWYA 4PALA 3BXKA 1BF5A 3A8RA 4M2QA 4E68A 1A03A 2OPOA 2BKHB 3TUYB 3DVEA 1DT7B 1CLMA 1SSEB 1Z2CB 1LA0A 3E3RA 3SG7A 3OB2B 3DF0B 5DICA 1QVIY 5AFPA 1N0YA 1TNQA 2KYCA 1S3PA 2V53A 3O4XA 4F7FA 5I94A 2EGDA 3S0EA 2AMIA 4BY4A 1IRJA 1F55A 2PALA 2ZN8A 3LK1A 3VRPA 1CMFA 2M1UA 1SW8A 4I5KA 3D10A 3FE8A 2CCMA 4JWQA 3B88A 1V1GA 4UPGA 3CWGA 5KTYA 1DF0B 1PK0D 2LP3A 1SK6D 5HYDA 3NSOA 3OB1B 3UNWA 3QMEA 2KQ6A 4D1EA 2KAVA 2M7NA 1OOHA 1ORGA 2KOTA 2L98A 1MHOA 2LMUA 1SR6C 3CGAA 5D7FA 1NP8A 4OCIA 1OZOA 1QS7A 1KQMB 5HLVA 4WQ2A 1J7RA 2PRUA 1NCYA 3PM8A 1AJ4A 1ODBA 4MBEA 4GGFC 4CLNA 2BCAA 1B47A 1HT9A 1S26D 1TUJA 2BBMA 2LVIA 2WC5A 1NYAA 5KU1A 3SS3A 1SY9A 2EC6C 2JTTA 2MAZA 1WDCB 1EH2A 2L4HA 2ZNEA 1K90D 2CBLA 3CZ2A 1SBJA 1KCYA 1W7JB 1TRFA 1M46A 1B9AA 1JFKA 1T14A 4IJ7A 1W7IB 1ZUZA 4PHJA 4A4CA 1IWQA 3S0AA 1QJTA 3S0FA 4PE0A 1JFJA 1H8BA 1L7ZA 1TWOA 1XK4A 2E30A 2KI4C 2F3YA 2KFGA 1DJZA 2L4IA 2ZRTA 3EVVA 3OHMB 4QJ5B 5DKQA 4CIDA 2H61C 2NCPA 2ISDA 1B8RA 2WC8A 5HL1A 1KSOA 4CFQA 1NIWA 3PATA 5AANA 2GGMA 2H2KA 3IF7A 1IJ6A 1IIOA 3SG2A 3TDZA 2JXLA 3PSRA 2L5XB 1QASA 1XVJA 2I7AA 2LCPA 4DUQA 2TN4A 1SL9A 1NUBA 2LHIA 4NQGA 1N2DA 2QPTA 1XYDA 1F4OA 3S0BA 1G8IA 3SG5A 3O78A 3WHUB 1CFDA 1S36A 4OR9B 3ZNIA 4PHMA 1OSAA 2LAPA 1QIWA 3S0DA 1B8LA 1KK7Y 3WXAA 1CLLA 3I5FB 1A75B 2LMTA 3BOWA 3HCMA 2WCEA 5GQQC 3VRRA 5D69A 2OTGB 1K8UA 3L47A 4MRYA 2GGZA 1IGVA 1SKTA 4MZJA 4U8DA 1BR1B 1L2OC 4MZKA 1NCZA 1K94A 1SPYA 2KBMA 2WCJA 4CPVA 3BFAA 4I5LB 3NSIA 4MSPA 2JZIA 3SG6A 3HX4A 1SNLA 1J7OA 2KHNA 2F8PA 1CDLA 1WLZA 3R1OA 4A4BA 4I5JA 3V2LA 1A4PA 5K89A 1FI6A 2QDIA 4YI8A 1A29A 2JT0A 2OS8B 1YTZC 1WRKA 2LLUA 3WNXB 1M45A 1UHKA 1Z4HA 1CDNA 1OMDA 2CT9A 1OZSA 3WHTB 3UO9A 2BBNA 1U5IA 3PJIA 3NHIA 1NCXA 4INWA 5D3OA 4YGAA 3CR2A 2BE4A 2L51A 1SMGA 3AAJA 3VRNA 1IG5A 1XK4C 3I5HC 1BOCA 1D1OA 5CSNA 2L0PA 2KI6D 1QTXA 3OBVA 1KK8B 2HETA 4YGBB 2LC5A 1DJWA 3PN7C 5I2LA 4GGFA 1TUZA 3PLFB 2MBXA 5BPJA 4AQIA 2F3ZA 4YRUA 2P70A 2JT8A 1ALVA 3DD4A 3JTDC 1QLSA 3D78A 2BECA 2K7BA 3TZ1A 1PALA 2QACA 2OS8C 1XFVO 2IS9A 1F54A 1LVCD 2MJWB 1YRUB 4XJKB 2NXQA 1DJIA 2HQWA 5HLOA 5IBWA 1SYMA 2H61A 2LV7A 2WCLA 3OX5A 1ALWA 3R1PA 3FWBA 1YVLA 1MR8A 1FW4A 4KYNA 4ORAB 4I5NB 1QIVA 1SL8A 1R2UA 4C0LA 2LLTA 1MXEA 2JULA 1YUUA 1ZFSA 1UP5A 1KQVA 1Y6WA 3JVTB 4INXA 3IVTA 4N1FA 3FE6A 3SS4A 1P28A 1QXPA 4PHKA 1FF1A 2F2PA 3B87A 1WLMA 3DY9A 1UHJA 1WRZA 1CB1A 2F33A 1DTLA 1XO5A 2WCKA 1OOGA 4CFRA 3QRXA 1RROA 1BJFA 2KI6C 1EG4A 4MEWA 4MVFA 4P2YB 3TUYC 1CM4A 4PE1A 1YRTB 2WNDA 3EVRA 3PFVA 2ERBA 5HKYA 1TIZA 2K7OA 1CNPA 2NZ0A 3I5GB 1BU3A 1BG1A 1M39A 3TS5B 1X02A 4YBHB 4YI9A 1CFCA 4GPLB 3EK7A 1CLBA 3D0YA 1W9ZA 3BYAA 3I5IB 4MN0A 1JWDA 2K2AA 2M9GA 3CZTX 3VROA 1FI5A 4P5OE 1PULA 1WY9A 1AK8A 3OP0A 4WRIA 1DJHA 1XFRA 1CDPA 4OKHA 3TDUA 4DCKA 2CTNA 3N7HA 3KO0A 1XFXO 3DYEA 1SRAA 2LVJA 2KYFA 1MWNA 3L4LA 1S5GZ 4PDZA 2LUCA 5FI7A 4FQTA 1UURA 1YX8A 3GK4X 1KQMC 1B8CA 1G33A 2KPHA 1B4CA 1OQPA 4MRXA 1E8AA 1K9KA 2KBIA 4HSZA 1NSHA 2MLEC 3TS5C 1TOPA 4GBAA 1JBAA 2O60A 1DJXA 4PE7A 2YGUA 3I5IC 3CLNA 2KLEA 3TDIA 1YURA 1KFXS 1WDCC 1QX2A 2WCHA 1QV1A 2P71A 3FS7A 3SIBA 4XYNA 2HF5A 3BUXB 2ZNDA 2FCDA 3O2PA 1DEKA 3RZSA 1LXFC 1C3YA 1AVSA 4Q04A 1KFUS 1J7QA 1K9PA 3KF9A 5DKNA 5FYXA 4BY5A 2Q91A 3NSLA 4YGEB 3NSKA 2F2OA 3FE9A 1R6PA 1CFFA 2P6BB 4GAOA 1EXRA 3CTNA 2PMYA 5DKRA 1XFYO 2I18A 4ETOA 2BE6A 3EKJA 1YUSA 3K21A 1QV0A 2M3WA 2WOSA 2K2FA 3BFHA 3CDNA 5I8NA 3B86A 1OMVA 3VB1A 1QX7A 4R1EA 3CZ0A 2K0JA 5J3XA 3SS5A 3SG4A 1GM0A 2K7CA 1NPQA 3I5FC 1NWDA 2Y1MA 4XJKA 2LVKA 1SCMB 5CSJA 2MA2A 2OTGC 5HKWA 1C3ZA 5JOLA 3RLZA 5CSIA 3NHTA 1SCVA 3VGOA 1MF8B 2K60A 2PSRA 3DZTA 3DXLA 4OZDA 3CYZA 2LMVA 1J1DA 3DF0A 3F45A 5G08A 1AHRA 1IQ5A 1CDMA 2FJUB 5KSZA 1IH0A 2JXCA 5I2OA 2G9BA 2VRGA 1OW4A 1TNXA 2LLSA 1DJGA 1LINA 1N65A 2AUCA 2JWWA 4ORBB 2KNEA 3OX6A 3BJHA 3H4SE 5F6TA 2KGBC 5AEQA 1DF0A 3BOWB 2AAOA 3BUWB 2KLDA 1F4QA 1DELA 2QEOA 3OGNA 5B8IB 1BT6A 1QWVA 4ZCUA 1TNWA 3R1VA 2FJYA 1PVAA 1PRWA 3KEVA 1FPWA 1F70A 3KPXA 2LNKA 2JOJA 4N5XA 1M63B 3BUNB 1TN4A 1H4BA 1S5GY 1Y1XA 3AKAA 2M29A 4ICBA 2ZRSA 4JKTA 5CPVA 1KK8C 1JF0A 3KHEA 2KGRA 1LA3A 1C07A 3D76A 2K61A 1YX7A 3EK8A 3FIAA 3L4AA 1B1GA 4ZCVA 1TCOB 2KDHA 1DMOA 3CABA 3LK0A 4PCWA 4AQJA 1EL4A 2KSPA 1NX3A 1PSBA 3IQOA 2L5YA 2Y5IA 1MUXA 4PHNA 2PASA 4F0ZB 1YVHA 2Q4UA 1IKUA 1S6CA 1SR6B 3EG5B 1Y0VH 2K8MB 1K93D 1RTP1 1GGZA 2KAXA 2PQLA 4NDCA 4WQ3A 4OV2A 5EL2A 4HREE 3B6XA 4YGCB 2WORA 1FBVA 1MXLC 2JPTA 2MLFC 2PYQA 2I94A 1OOIX 5I2QA
chains in the Genus database with same CATH topology
2LUXA 1TCFA 1JUOA 2EC6B 1RECA 1ZOTB 4NDBA 4HRGA 3O4YA 2LVVA 2M7LA 1A2XA 2LHLA 2I2RE 4QJ4B 3VRQA 4NDDA 1J1EA 2KFHA 1HQVA 1PSRA 1BODA 2ZKMX 2ZFDA 4ORCB 2RGIA 1KWOB 3JVTC 4FQOA 2JU0A 2KI4B 3DVKA 5AERA 4AOMA 1J55A 4YGDB 1A75A 1YR5A 4QJ3B 2O5GA 1CTRA 3AAKA 3RM1A 2ZN9A 1UHHA 4N1GA 5PALA 1RJVA 4MLWA 1F71A 4FTGA 2JNFA 3I5GC 1J7PA 1B7TZ 3BUMB 4OVNF 1AP4A 2MRDA 3IQQA 1G4YR 4MZLA 4GUKA 4C0KA 1NX1A 2PVBA 2JNXA 1Y1UA 2M97A 3LLEA 1BR4B 2NCOA 3O6BA 2FCEA 1UUSA 3CR4X 3DVMA 2JRFA 1KWOC 1UHIA 2M8UA 3BUOB 1L2OB 1AJ5A 1M31A 4JQ0D 1XA5A 3EKHA 2JT3A 3MSEB 1RFJA 1QVIZ 1S6JA 1OOJA 4DIRA 2Y4QA 1UHNA 1GGWA 1OE9B 3NXAA 4JPZB 1QATA 1XFWO 1KFXL 1DVIA 1VRKA 1IQ3A 1C7WA 2JTZA 3C1VA 3D0YB 3DVJA 1CM1A 4PE4A 1UWOA 3SG3A 4IL1A 1YUTA 4GFTA 4USLA 3GK1A 4DRWA 1OMRA 2LANA 1KFUL 2Y1NA 1S1EA 1QLKA 3SJSA 1K2HA 1LKJA 1ZMZA 3CR5X 1EG3A 2MHHA 3EVUA 3PALA 1IJ5A 4M2PA 3BQ3A 2FOTA 2COLB 2NLNA 1XFZO 3I5HB 1RK9A 2DOQA 1MQ1A 4L9MA 1TTXA 2HQ8A 2KFFA 3ICBA 4GGNA 2BCBA 1KSMA 3PN7B 2JC2A 5TNCA 1QX5B 1GJYA 2M1KB 1NX0A 2L2EA 1ZACA 2SCPA 2KAYA 2L50A 5JJGA 3JTDB 5CSFA 1BMOA 1JSAA 3EK4A 2CXJA 4HRHA 4TNCA 1JC2A 3SIAA 1NX2A 2HPSA 3A4UB 2BKIB 1DGVA 1K96A 2BL0B 1K9UA 2A4JA 2SASA 3AKBA 1JBAA 1TNPA 1XFUO 1C7VA 2G2BA 3LCPC 1JF2A 2M0RA 3M0WA 2B1UA 1CKKA 2LE9B 4GNKB 4C0JA 4DS7A 3FWCA 2M49B 1AUIB 2JQ6A 4M2OA 1Y1AA 1EJ3A 2EHBA 2KQYA 1PVBA 1WRLA 1SCMC 2LP2A 3GK2A 5HKZA 2K7DA 2CNPA 1V1FA 1BLQA 1K95A 3CS1A 2WCBA 2BCXA 1DGUA 1CMGA 1Q80A 2GV5A 1S6IA 2WCFA 3LL8B 3GOFA 1B7TY 2E6WA 2LM5A 5AXIA 1GQMA 3ZWHA 1KK7Z 2BL0C 2R2IA 1SL7A 1DJYA 5ER5A 1CFPA 1F8HA 2D8NA 1U5IB 5ER4X 1RWYA 4PALA 3BXKA 1BF5A 3A8RA 4M2QA 4E68A 1A03A 2OPOA 2BKHB 3TUYB 3DVEA 1DT7B 1CLMA 1LA0A 3E3RA 3SG7A 3OB2B 3DF0B 1QVIY 5AFPA 1N0YA 1TNQA 2KYCA 1S3PA 2V53A 2EGDA 4BY4A 2AMIA 1F55A 1IRJA 2PALA 2ZN8A 3LK1A 3VRPA 1CMFA 2M1UA 1SW8A 4I5KA 3D10A 2CCMA 4JWQA 1V1GA 4UPGA 3CWGA 5KTYA 1DF0B 1PK0D 2LP3A 1SK6D 5HYDA 3NSOA 3OB1B 2KQ6A 4D1EA 2KAVA 2M7NA 2KOTA 2L98A 1MHOA 2LMUA 1SR6C 3CGAA 5D7FA 1NP8A 4OCIA 1OZOA 1QS7A 1KQMB 5HLVA 4WQ2A 1J7RA 2PRUA 1NCYA 3PM8A 1AJ4A 1ODBA 4MBEA 4GGFC 4CLNA 2BCAA 1B47A 1HT9A 1S26D 2BBMA 2LVIA 1NYAA 5KU1A 1SY9A 2EC6C 2JTTA 2MAZA 1WDCB 1EH2A 2L4HA 2ZNEA 1K90D 2CBLA 1SBJA 1KCYA 1W7JB 1TRFA 1M46A 1B9AA 1JFKA 1W7IB 1ZUZA 4PHJA 4A4CA 1IWQA 1QJTA 4PE0A 1JFJA 1H8BA 1L7ZA 1XK4A 2E30A 2KI4C 2F3YA 2KFGA 1DJZA 2L4IA 2ZRTA 3EVVA 3OHMB 4QJ5B 5DKQA 4CIDA 2H61C 2NCPA 2ISDA 1B8RA 2WC8A 1KSOA 4CFQA 1NIWA 3PATA 5AANA 2GGMA 2H2KA 3IF7A 1IJ6A 3SG2A 3TDZA 2JXLA 3PSRA 2L5XB 1QASA 1XVJA 2I7AA 2LCPA 4DUQA 2TN4A 1SL9A 1NUBA 2LHIA 4NQGA 1N2DA 2QPTA 1XYDA 1F4OA 1G8IA 3SG5A 3O78A 3WHUB 1CFDA 1S36A 4OR9B 3ZNIA 4PHMA 1OSAA 2LAPA 1QIWA 1B8LA 1KK7Y 3WXAA 1CLLA 3I5FB 1A75B 2LMTA 3BOWA 3HCMA 2WCEA 5GQQC 3VRRA 5D69A 2OTGB 1K8UA 4MRYA 2GGZA 1IGVA 1SKTA 4MZJA 4U8DA 1BR1B 1L2OC 4MZKA 1NCZA 1K94A 1SPYA 2KBMA 4CPVA 4I5LB 4MSPA 3NSIA 2JZIA 3SG6A 3HX4A 1SNLA 1J7OA 2KHNA 2F8PA 1CDLA 1WLZA 4A4BA 4I5JA 1A4PA 5K89A 1FI6A 4YI8A 1A29A 2JT0A 2OS8B 1YTZC 1WRKA 2LLUA 3WNXB 1M45A 1UHKA 1CDNA 1OMDA 2CT9A 1OZSA 3WHTB 2BBNA 1U5IA 1NCXA 4YGAA 3CR2A 2BE4A 2L51A 1SMGA 3AAJA 3VRNA 1IG5A 1XK4C 3I5HC 1BOCA 1D1OA 5CSNA 2L0PA 2KI6D 1QTXA 1KK8B 2HETA 4YGBB 2LC5A 1DJWA 3PN7C 5I2LA 4GGFA 2MBXA 3PLFB 5BPJA 4AQIA 2F3ZA 4YRUA 2JT8A 1ALVA 3DD4A 3JTDC 1QLSA 2BECA 2K7BA 3TZ1A 1PALA 2QACA 2OS8C 1XFVO 2IS9A 1F54A 1LVCD 2MJWB 1YRUB 4XJKB 2NXQA 1DJIA 2HQWA 5HLOA 5IBWA 1SYMA 2H61A 2LV7A 3OX5A 1ALWA 3FWBA 1YVLA 1MR8A 1FW4A 4ORAB 4I5NB 1QIVA 1SL8A 1R2UA 4C0LA 2LLTA 1MXEA 2JULA 1YUUA 1ZFSA 1UP5A 1KQVA 1Y6WA 3JVTB 4N1FA 1FF1A 1QXPA 4PHKA 2F2PA 1WLMA 1UHJA 1WRZA 1CB1A 2F33A 1DTLA 1XO5A 4CFRA 3QRXA 1RROA 1BJFA 2KI6C 1EG4A 4MEWA 4MVFA 4P2YB 3TUYC 1CM4A 4PE1A 1YRTB 2WNDA 3EVRA 3PFVA 5HKYA 1CNPA 1TIZA 2K7OA 2NZ0A 3I5GB 1BU3A 1BG1A 1M39A 3TS5B 1X02A 4YBHB 4YI9A 1CFCA 4GPLB 3EK7A 1CLBA 3D0YA 3BYAA 4MN0A 3I5IB 1JWDA 2K2AA 2M9GA 3CZTX 3VROA 1FI5A 4P5OE 1PULA 1WY9A 1AK8A 3OP0A 4WRIA 1DJHA 1CDPA 4OKHA 3TDUA 4DCKA 2CTNA 3KO0A 1XFXO 1SRAA 2LVJA 2KYFA 1MWNA 1S5GZ 4PDZA 2LUCA 1UURA 1YX8A 3GK4X 1KQMC 1B8CA 1G33A 1B4CA 1OQPA 4MRXA 1E8AA 1K9KA 2KBIA 4HSZA 1NSHA 2MLEC 3TS5C 1TOPA 4GBAA 2O60A 1DJXA 4PE7A 3I5IC 3CLNA 3TDIA 1YURA 1KFXS 1WDCC 1QX2A 1QV1A 3FS7A 3SIBA 4XYNA 2HF5A 3BUXB 2ZNDA 2FCDA 3O2PA 1LXFC 1AVSA 4Q04A 1KFUS 1J7QA 1K9PA 3KF9A 5DKNA 5FYXA 4BY5A 2Q91A 3NSLA 4YGEB 3NSKA 2F2OA 1R6PA 1CFFA 2P6BB 4GAOA 1EXRA 3CTNA 2PMYA 5DKRA 1XFYO 2I18A 4ETOA 2BE6A 3EKJA 1YUSA 3K21A 1QV0A 2M3WA 2WOSA 2K2FA 5I8NA 1OMVA 1QX7A 4R1EA 2K0JA 5J3XA 3SG4A 2K7CA 1NPQA 3I5FC 1NWDA 2Y1MA 4XJKA 2LVKA 1SCMB 5CSJA 2MA2A 2OTGC 5HKWA 5JOLA 3RLZA 5CSIA 1SCVA 3VGOA 1MF8B 2PSRA 2LMVA 1J1DA 3DF0A 3F45A 5G08A 1AHRA 1IQ5A 1CDMA 2FJUB 5KSZA 1IH0A 2JXCA 5I2OA 2G9BA 2VRGA 1TNXA 2LLSA 1DJGA 1LINA 1N65A 2AUCA 2JWWA 4ORBB 2KNEA 3OX6A 3H4SE 5F6TA 2KGBC 5AEQA 1DF0A 3BOWB 2AAOA 3BUWB 1F4QA 5B8IB 1BT6A 4ZCUA 1TNWA 1PVAA 1PRWA 3KEVA 1FPWA 1F70A 3KPXA 2LNKA 2JOJA 4N5XA 1M63B 3BUNB 1TN4A 1H4BA 1S5GY 1Y1XA 3AKAA 2M29A 4ICBA 2ZRSA 5CPVA 1KK8C 1JF0A 3KHEA 2KGRA 1LA3A 1C07A 3FIAA 2K61A 1YX7A 3EK8A 1B1GA 4ZCVA 1TCOB 2KDHA 1DMOA 3LK0A 4PCWA 4AQJA 1EL4A 2KSPA 1NX3A 1PSBA 3IQOA 2Y5IA 1MUXA 4PHNA 2PASA 4F0ZB 1YVHA 2Q4UA 1IKUA 1S6CA 1SR6B 1Y0VH 2K8MB 1K93D 1RTP1 1GGZA 2KAXA 4NDCA 4WQ3A 4OV2A 4HREE 4YGCB 2WORA 1FBVA 1MXLC 2JPTA 2MLFC 2I94A 5I2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LUX A;  1TCF A;  1JUO A;  2EC6 B;  1REC A;  1ZOT B;  4NDB A;  4HRG A;  3O4Y A;  2LVV A;  2M7L A;  1A2X A;  2LHL A;  2I2R E;  4QJ4 B;  3VRQ A;  4NDD A;  1J1E A;  2KFH A;  1HQV A;  1PSR A;  1BOD A;  2ZKM X;  2ZFD A;  4ORC B;  2RGI A;  1KWO B;  3JVT C;  4FQO A;  2JU0 A;  2KI4 B;  3DVK A;  5AER A;  4AOM A;  1J55 A;  4YGD B;  1A75 A;  1YR5 A;  4QJ3 B;  2O5G A;  1CTR A;  3AAK A;  3RM1 A;  2ZN9 A;  1UHH A;  4N1G A;  5PAL A;  1RJV A;  4MLW A;  1F71 A;  4FTG A;  2JNF A;  3I5G C;  1J7P A;  1B7T Z;  3BUM B;  4OVN F;  1AP4 A;  2MRD A;  3IQQ A;  1G4Y R;  4MZL A;  4GUK A;  4C0K A;  1NX1 A;  2PVB A;  2JNX A;  1Y1U A;  2M97 A;  3LLE A;  1BR4 B;  2NCO A;  3O6B A;  2FCE A;  1UUS A;  3CR4 X;  3DVM A;  2JRF A;  1KWO C;  1UHI A;  2M8U A;  3BUO B;  1L2O B;  1AJ5 A;  1M31 A;  4JQ0 D;  1XA5 A;  3EKH A;  2JT3 A;  3MSE B;  1RFJ A;  1QVI Z;  1S6J A;  1OOJ A;  4DIR A;  2Y4Q A;  1UHN A;  1GGW A;  1OE9 B;  3NXA A;  4JPZ B;  1QAT A;  1XFW O;  1KFX L;  1DVI A;  1VRK A;  1IQ3 A;  1C7W A;  2JTZ A;  3C1V A;  3D0Y B;  3DVJ A;  1CM1 A;  4PE4 A;  1UWO A;  3SG3 A;  4IL1 A;  1YUT A;  4GFT A;  4USL A;  3GK1 A;  4DRW A;  1OMR A;  2LAN A;  1KFU L;  2Y1N A;  1S1E A;  1QLK A;  3SJS A;  1K2H A;  1LKJ A;  1ZMZ A;  3CR5 X;  1EG3 A;  2MHH A;  3EVU A;  3PAL A;  1IJ5 A;  4M2P A;  3BQ3 A;  2FOT A;  2COL B;  2NLN A;  1XFZ O;  3I5H B;  1RK9 A;  2DOQ A;  1MQ1 A;  4L9M A;  1TTX A;  2HQ8 A;  2KFF A;  3ICB A;  4GGN A;  2BCB A;  1KSM A;  3PN7 B;  2JC2 A;  5TNC A;  1QX5 B;  1GJY A;  2M1K B;  1NX0 A;  2L2E A;  1ZAC A;  2SCP A;  2KAY A;  2L50 A;  5JJG A;  3JTD B;  5CSF A;  1BMO A;  1JSA A;  3EK4 A;  2CXJ A;  4HRH A;  4TNC A;  1JC2 A;  3SIA A;  1NX2 A;  2HPS A;  3A4U B;  2BKI B;  1DGV A;  1K96 A;  2BL0 B;  1K9U A;  2A4J A;  2SAS A;  3AKB A;  1JBA A;  1TNP A;  1XFU O;  1C7V A;  2G2B A;  3LCP C;  1JF2 A;  2M0R A;  3M0W A;  2B1U A;  1CKK A;  2LE9 B;  4GNK B;  4C0J A;  4DS7 A;  3FWC A;  2M49 B;  1AUI B;  2JQ6 A;  4M2O A;  1Y1A A;  1EJ3 A;  2EHB A;  2KQY A;  1PVB A;  1WRL A;  1SCM C;  2LP2 A;  3GK2 A;  5HKZ A;  2K7D A;  2CNP A;  1V1F A;  1BLQ A;  1K95 A;  3CS1 A;  2WCB A;  2BCX A;  1DGU A;  1CMG A;  1Q80 A;  2GV5 A;  1S6I A;  2WCF A;  3LL8 B;  3GOF A;  1B7T Y;  2E6W A;  2LM5 A;  5AXI A;  1GQM A;  3ZWH A;  1KK7 Z;  2BL0 C;  2R2I A;  1SL7 A;  1DJY A;  5ER5 A;  1CFP A;  1F8H A;  2D8N A;  1U5I B;  5ER4 X;  1RWY A;  4PAL A;  3BXK A;  1BF5 A;  3A8R A;  4M2Q A;  4E68 A;  1A03 A;  2OPO A;  2BKH B;  3TUY B;  3DVE A;  1DT7 B;  1CLM A;  1LA0 A;  3E3R A;  3SG7 A;  3OB2 B;  3DF0 B;  1QVI Y;  5AFP A;  1N0Y A;  1TNQ A;  2KYC A;  1S3P A;  2V53 A;  2EGD A;  4BY4 A;  2AMI A;  1F55 A;  1IRJ A;  2PAL A;  2ZN8 A;  3LK1 A;  3VRP A;  1CMF A;  2M1U A;  1SW8 A;  4I5K A;  3D10 A;  2CCM A;  4JWQ A;  1V1G A;  4UPG A;  3CWG A;  5KTY A;  1DF0 B;  1PK0 D;  2LP3 A;  1SK6 D;  5HYD A;  3NSO A;  3OB1 B;  2KQ6 A;  4D1E A;  2KAV A;  2M7N A;  2KOT A;  2L98 A;  1MHO A;  2LMU A;  1SR6 C;  3CGA A;  5D7F A;  1NP8 A;  4OCI A;  1OZO A;  1QS7 A;  1KQM B;  5HLV A;  4WQ2 A;  1J7R A;  2PRU A;  1NCY A;  3PM8 A;  1AJ4 A;  1ODB A;  4MBE A;  4GGF C;  4CLN A;  2BCA A;  1B47 A;  1HT9 A;  1S26 D;  2BBM A;  2LVI A;  1NYA A;  5KU1 A;  1SY9 A;  2EC6 C;  2JTT A;  2MAZ A;  1WDC B;  1EH2 A;  2L4H A;  2ZNE A;  1K90 D;  2CBL A;  1SBJ A;  1KCY A;  1W7J B;  1TRF A;  1M46 A;  1B9A A;  1JFK A;  1W7I B;  1ZUZ A;  4PHJ A;  4A4C A;  1IWQ A;  1QJT A;  4PE0 A;  1JFJ A;  1H8B A;  1L7Z A;  1XK4 A;  2E30 A;  2KI4 C;  2F3Y A;  2KFG A;  1DJZ A;  2L4I A;  2ZRT A;  3EVV A;  3OHM B;  4QJ5 B;  5DKQ A;  4CID A;  2H61 C;  2NCP A;  2ISD A;  1B8R A;  2WC8 A;  1KSO A;  4CFQ A;  1NIW A;  3PAT A;  5AAN A;  2GGM A;  2H2K A;  3IF7 A;  1IJ6 A;  3SG2 A;  3TDZ A;  2JXL A;  3PSR A;  2L5X B;  1QAS A;  1XVJ A;  2I7A A;  2LCP A;  4DUQ A;  2TN4 A;  1SL9 A;  1NUB A;  2LHI A;  4NQG A;  1N2D A;  2QPT A;  1XYD A;  1F4O A;  1G8I A;  3SG5 A;  3O78 A;  3WHU B;  1CFD A;  1S36 A;  4OR9 B;  3ZNI A;  4PHM A;  1OSA A;  2LAP A;  1QIW A;  1B8L A;  1KK7 Y;  3WXA A;  1CLL A;  3I5F B;  1A75 B;  2LMT A;  3BOW A;  3HCM A;  2WCE A;  5GQQ C;  3VRR A;  5D69 A;  2OTG B;  1K8U A;  4MRY A;  2GGZ A;  1IGV A;  1SKT A;  4MZJ A;  4U8D A;  1BR1 B;  1L2O C;  4MZK A;  1NCZ A;  1K94 A;  1SPY A;  2KBM A;  4CPV A;  4I5L B;  4MSP A;  3NSI A;  2JZI A;  3SG6 A;  3HX4 A;  1SNL A;  1J7O A;  2KHN A;  2F8P A;  1CDL A;  1WLZ A;  4A4B A;  4I5J A;  1A4P A;  5K89 A;  1FI6 A;  4YI8 A;  1A29 A;  2JT0 A;  2OS8 B;  1YTZ C;  1WRK A;  2LLU A;  3WNX B;  1M45 A;  1UHK A;  1CDN A;  1OMD A;  2CT9 A;  1OZS A;  3WHT B;  2BBN A;  1U5I A;  1NCX A;  4YGA A;  3CR2 A;  2BE4 A;  2L51 A;  1SMG A;  3AAJ A;  3VRN A;  1IG5 A;  1XK4 C;  3I5H C;  1BOC A;  1D1O A;  5CSN A;  2L0P A;  2KI6 D;  1QTX A;  1KK8 B;  2HET A;  4YGB B;  2LC5 A;  1DJW A;  3PN7 C;  5I2L A;  4GGF A;  2MBX A;  3PLF B;  5BPJ A;  4AQI A;  2F3Z A;  4YRU A;  2JT8 A;  1ALV A;  3DD4 A;  3JTD C;  1QLS A;  2BEC A;  2K7B A;  3TZ1 A;  1PAL A;  2QAC A;  2OS8 C;  1XFV O;  2IS9 A;  1F54 A;  1LVC D;  2MJW B;  1YRU B;  4XJK B;  2NXQ A;  1DJI A;  2HQW A;  5HLO A;  5IBW A;  1SYM A;  2H61 A;  2LV7 A;  3OX5 A;  1ALW A;  3FWB A;  1YVL A;  1MR8 A;  1FW4 A;  4ORA B;  4I5N B;  1QIV A;  1SL8 A;  1R2U A;  4C0L A;  2LLT A;  1MXE A;  2JUL A;  1YUU A;  1ZFS A;  1UP5 A;  1KQV A;  1Y6W A;  3JVT B;  4N1F A;  1FF1 A;  1QXP A;  4PHK A;  2F2P A;  1WLM A;  1UHJ A;  1WRZ A;  1CB1 A;  2F33 A;  1DTL A;  1XO5 A;  4CFR A;  3QRX A;  1RRO A;  1BJF A;  2KI6 C;  1EG4 A;  4MEW A;  4MVF A;  4P2Y B;  3TUY C;  1CM4 A;  4PE1 A;  1YRT B;  2WND A;  3EVR A;  3PFV A;  5HKY A;  1CNP A;  1TIZ A;  2K7O A;  2NZ0 A;  3I5G B;  1BU3 A;  1BG1 A;  1M39 A;  3TS5 B;  1X02 A;  4YBH B;  4YI9 A;  1CFC A;  4GPL B;  3EK7 A;  1CLB A;  3D0Y A;  3BYA A;  4MN0 A;  3I5I B;  1JWD A;  2K2A A;  2M9G A;  3CZT X;  3VRO A;  1FI5 A;  4P5O E;  1PUL A;  1WY9 A;  1AK8 A;  3OP0 A;  4WRI A;  1DJH A;  1CDP A;  4OKH A;  3TDU A;  4DCK A;  2CTN A;  3KO0 A;  1XFX O;  1SRA A;  2LVJ A;  2KYF A;  1MWN A;  1S5G Z;  4PDZ A;  2LUC A;  1UUR A;  1YX8 A;  3GK4 X;  1KQM C;  1B8C A;  1G33 A;  1B4C A;  1OQP A;  4MRX A;  1E8A A;  1K9K A;  2KBI A;  4HSZ A;  1NSH A;  2MLE C;  3TS5 C;  1TOP A;  4GBA A;  2O60 A;  1DJX A;  4PE7 A;  3I5I C;  3CLN A;  3TDI A;  1YUR A;  1KFX S;  1WDC C;  1QX2 A;  1QV1 A;  3FS7 A;  3SIB A;  4XYN A;  2HF5 A;  3BUX B;  2ZND A;  2FCD A;  3O2P A;  1LXF C;  1AVS A;  4Q04 A;  1KFU S;  1J7Q A;  1K9P A;  3KF9 A;  5DKN A;  5FYX A;  4BY5 A;  2Q91 A;  3NSL A;  4YGE B;  3NSK A;  2F2O A;  1R6P A;  1CFF A;  2P6B B;  4GAO A;  1EXR A;  3CTN A;  2PMY A;  5DKR A;  1XFY O;  2I18 A;  4ETO A;  2BE6 A;  3EKJ A;  1YUS A;  3K21 A;  1QV0 A;  2M3W A;  2WOS A;  2K2F A;  5I8N A;  1OMV A;  1QX7 A;  4R1E A;  2K0J A;  5J3X A;  3SG4 A;  2K7C A;  1NPQ A;  3I5F C;  1NWD A;  2Y1M A;  4XJK A;  2LVK A;  1SCM B;  5CSJ A;  2MA2 A;  2OTG C;  5HKW A;  5JOL A;  3RLZ A;  5CSI A;  1SCV A;  3VGO A;  1MF8 B;  2PSR A;  2LMV A;  1J1D A;  3DF0 A;  3F45 A;  5G08 A;  1AHR A;  1IQ5 A;  1CDM A;  2FJU B;  5KSZ A;  1IH0 A;  2JXC A;  5I2O A;  2G9B A;  2VRG A;  1TNX A;  2LLS A;  1DJG A;  1LIN A;  1N65 A;  2AUC A;  2JWW A;  4ORB B;  2KNE A;  3OX6 A;  3H4S E;  5F6T A;  2KGB C;  5AEQ A;  1DF0 A;  3BOW B;  2AAO A;  3BUW B;  1F4Q A;  5B8I B;  1BT6 A;  4ZCU A;  1TNW A;  1PVA A;  1PRW A;  3KEV A;  1FPW A;  1F70 A;  3KPX A;  2LNK A;  2JOJ A;  4N5X A;  1M63 B;  3BUN B;  1TN4 A;  1H4B A;  1S5G Y;  1Y1X A;  3AKA A;  2M29 A;  4ICB A;  2ZRS A;  5CPV A;  1KK8 C;  1JF0 A;  3KHE A;  2KGR A;  1LA3 A;  1C07 A;  3FIA A;  2K61 A;  1YX7 A;  3EK8 A;  1B1G A;  4ZCV A;  1TCO B;  2KDH A;  1DMO A;  3LK0 A;  4PCW A;  4AQJ A;  1EL4 A;  2KSP A;  1NX3 A;  1PSB A;  3IQO A;  2Y5I A;  1MUX A;  4PHN A;  2PAS A;  4F0Z B;  1YVH A;  2Q4U A;  1IKU A;  1S6C A;  1SR6 B;  1Y0V H;  2K8M B;  1K93 D;  1RTP 1;  1GGZ A;  2KAX A;  4NDC A;  4WQ3 A;  4OV2 A;  4HRE E;  4YGC B;  2WOR A;  1FBV A;  1MXL C;  2JPT A;  2MLF C;  2I94 A;  5I2Q A; 
#chains in the Genus database with same CATH topology
 3BFB A;  2LUX A;  1TCF A;  1JUO A;  2EC6 B;  1REC A;  1ZOT B;  3CZ1 A;  4NDB A;  3D75 A;  4HRG A;  3O4Y A;  2GTE A;  2LVV A;  2M7L A;  1A2X A;  2LHL A;  2I2R E;  4QJ4 B;  3VRQ A;  4NDD A;  1J1E A;  2KFH A;  2L2C A;  1HQV A;  1PSR A;  1BOD A;  2ZKM X;  2ZFD A;  4ORC B;  2RGI A;  1KWO B;  3JVT C;  4FQO A;  2JU0 A;  2KI4 B;  1DQE A;  3DVK A;  5AER A;  4AOM A;  1J55 A;  4YGD B;  1A75 A;  1YR5 A;  4QJ3 B;  3D74 A;  2O5G A;  4PT1 A;  1CTR A;  3AAK A;  3RM1 A;  2ZN9 A;  1UHH A;  2QEB A;  4N1G A;  5PAL A;  3D73 A;  1RJV A;  1OOF A;  4MLW A;  1F71 A;  4FTG A;  2JNF A;  3I5G C;  1J7P A;  1B7T Z;  3BUM B;  4OVN F;  1AP4 A;  2MRD A;  3IQQ A;  1G4Y R;  4MZL A;  4GUK A;  4C0K A;  1NX1 A;  2JPO A;  2PVB A;  2JNX A;  1Y1U A;  2M97 A;  3LLE A;  1BR4 B;  2NCO A;  3O6B A;  2FCE A;  1UUS A;  3CR4 X;  3DVM A;  2JRF A;  1KWO C;  1UHI A;  2M8U A;  3BUO B;  1L2O B;  1AJ5 A;  1M31 A;  4JQ0 D;  1XA5 A;  3EKH A;  2JT3 A;  3MSE B;  1RFJ A;  1QVI Z;  1S6J A;  1OOJ A;  4DIR A;  2Y4Q A;  1UHN A;  1GGW A;  1OE9 B;  3NXA A;  4JPZ B;  1LS8 A;  1QAT A;  2QEV A;  3B7A A;  1XFW O;  1KFX L;  1DVI A;  1VRK A;  3K1E A;  1IQ3 A;  1C7W A;  2JTZ A;  3C1V A;  3D0Y B;  3DVJ A;  1CM1 A;  4PE4 A;  1UWO A;  3SG3 A;  4IL1 A;  1YUT A;  4GFT A;  4USL A;  3GK1 A;  4DRW A;  1OMR A;  2LAN A;  1KFU L;  2Y1N A;  1S1E A;  1QLK A;  3SJS A;  1K2H A;  1LKJ A;  1ZMZ A;  3CR5 X;  1EG3 A;  2MHH A;  2WC6 A;  3EVU A;  3PAL A;  1IJ5 A;  3R72 A;  4M2P A;  3BQ3 A;  2FOT A;  2COL B;  2NLN A;  1XFZ O;  3I5H B;  1RK9 A;  2DOQ A;  1MQ1 A;  4L9M A;  1DC1 A;  1TTX A;  2HQ8 A;  5FI6 A;  2KFF A;  2WCM A;  2QEH A;  3ICB A;  4JD9 A;  4GGN A;  2BCB A;  1KSM A;  3PN7 B;  2JC2 A;  5TNC A;  1QX5 B;  1GJY A;  2M1K B;  1NX0 A;  2L2E A;  1ZAC A;  2SCP A;  2KAY A;  2L50 A;  5JJG A;  3JTD B;  5CSF A;  3NGV A;  1BMO A;  1JSA A;  3EK4 A;  2CXJ A;  2BNX A;  4HRH A;  4TNC A;  1JC2 A;  3SIA A;  1NX2 A;  2HPS A;  3A4U B;  2BAP A;  2BKI B;  1DGV A;  1K96 A;  1K9U A;  2A4J A;  2BL0 B;  2SAS A;  3AKB A;  3D77 A;  1TNP A;  1XFU O;  1C7V A;  2G2B A;  3LCP C;  1JF2 A;  2M0R A;  3M0W A;  5FI2 A;  3Q8I A;  2B1U A;  1CKK A;  2LE9 B;  4GNK B;  4C0J A;  4DS7 A;  3FWC A;  2M49 B;  1AUI B;  2JQ6 A;  4M2O A;  1Y1A A;  1EJ3 A;  2EHB A;  2KQY A;  1PVB A;  1WRL A;  1SCM C;  2LP2 A;  3GK2 A;  5HKZ A;  3S0G A;  2K7D A;  1V1F A;  2CNP A;  1BLQ A;  1K95 A;  3CS1 A;  2WCB A;  2BCX A;  1DGU A;  1CMG A;  1Q80 A;  2H8V A;  2GV5 A;  1S6I A;  2WCF A;  3LL8 B;  3GOF A;  1B7T Y;  2E6W A;  2LM5 A;  5AXI A;  1GQM A;  3ZWH A;  1KK7 Z;  2BL0 C;  2R2I A;  1SL7 A;  1DJY A;  5ER5 A;  1CFP A;  1F8H A;  2D8N A;  1U5I B;  5ER4 X;  3PM2 A;  1RWY A;  4PAL A;  3BXK A;  1BF5 A;  3A8R A;  4M2Q A;  4E68 A;  1A03 A;  2OPO A;  2BKH B;  3TUY B;  3DVE A;  1DT7 B;  1CLM A;  1SSE B;  1Z2C B;  1LA0 A;  3E3R A;  3SG7 A;  3OB2 B;  3DF0 B;  5DIC A;  1QVI Y;  5AFP A;  1N0Y A;  1TNQ A;  2KYC A;  1S3P A;  2V53 A;  3O4X A;  4F7F A;  5I94 A;  2EGD A;  3S0E A;  2AMI A;  4BY4 A;  1IRJ A;  1F55 A;  2PAL A;  2ZN8 A;  3LK1 A;  3VRP A;  1CMF A;  2M1U A;  1SW8 A;  4I5K A;  3D10 A;  3FE8 A;  2CCM A;  4JWQ A;  3B88 A;  1V1G A;  4UPG A;  3CWG A;  5KTY A;  1DF0 B;  1PK0 D;  2LP3 A;  1SK6 D;  5HYD A;  3NSO A;  3OB1 B;  3UNW A;  3QME A;  2KQ6 A;  4D1E A;  2KAV A;  2M7N A;  1OOH A;  1ORG A;  2KOT A;  2L98 A;  1MHO A;  2LMU A;  1SR6 C;  3CGA A;  5D7F A;  1NP8 A;  4OCI A;  1OZO A;  1QS7 A;  1KQM B;  5HLV A;  4WQ2 A;  1J7R A;  2PRU A;  1NCY A;  3PM8 A;  1AJ4 A;  1ODB A;  4MBE A;  4GGF C;  4CLN A;  2BCA A;  1B47 A;  1HT9 A;  1S26 D;  1TUJ A;  2BBM A;  2LVI A;  2WC5 A;  1NYA A;  5KU1 A;  3SS3 A;  1SY9 A;  2EC6 C;  2JTT A;  2MAZ A;  1WDC B;  1EH2 A;  2L4H A;  2ZNE A;  1K90 D;  2CBL A;  3CZ2 A;  1SBJ A;  1KCY A;  1W7J B;  1TRF A;  1M46 A;  1B9A A;  1JFK A;  1T14 A;  4IJ7 A;  1W7I B;  1ZUZ A;  4PHJ A;  4A4C A;  1IWQ A;  3S0A A;  1QJT A;  3S0F A;  4PE0 A;  1JFJ A;  1H8B A;  1L7Z A;  1TWO A;  1XK4 A;  2E30 A;  2KI4 C;  2F3Y A;  2KFG A;  1DJZ A;  2L4I A;  2ZRT A;  3EVV A;  3OHM B;  4QJ5 B;  5DKQ A;  4CID A;  2H61 C;  2NCP A;  2ISD A;  1B8R A;  2WC8 A;  5HL1 A;  1KSO A;  4CFQ A;  1NIW A;  3PAT A;  5AAN A;  2GGM A;  2H2K A;  3IF7 A;  1IJ6 A;  1IIO A;  3SG2 A;  3TDZ A;  2JXL A;  3PSR A;  2L5X B;  1QAS A;  1XVJ A;  2I7A A;  2LCP A;  4DUQ A;  2TN4 A;  1SL9 A;  1NUB A;  2LHI A;  4NQG A;  1N2D A;  2QPT A;  1XYD A;  1F4O A;  3S0B A;  1G8I A;  3SG5 A;  3O78 A;  3WHU B;  1CFD A;  1S36 A;  4OR9 B;  3ZNI A;  4PHM A;  1OSA A;  2LAP A;  1QIW A;  3S0D A;  1B8L A;  1KK7 Y;  3WXA A;  1CLL A;  3I5F B;  1A75 B;  2LMT A;  3BOW A;  3HCM A;  2WCE A;  5GQQ C;  3VRR A;  5D69 A;  2OTG B;  1K8U A;  3L47 A;  4MRY A;  2GGZ A;  1IGV A;  1SKT A;  4MZJ A;  4U8D A;  1BR1 B;  1L2O C;  4MZK A;  1NCZ A;  1K94 A;  1SPY A;  2KBM A;  2WCJ A;  4CPV A;  3BFA A;  4I5L B;  3NSI A;  4MSP A;  2JZI A;  3SG6 A;  3HX4 A;  1SNL A;  1J7O A;  2KHN A;  2F8P A;  1CDL A;  1WLZ A;  3R1O A;  4A4B A;  4I5J A;  3V2L A;  1A4P A;  5K89 A;  1FI6 A;  2QDI A;  4YI8 A;  1A29 A;  2JT0 A;  2OS8 B;  1YTZ C;  1WRK A;  2LLU A;  3WNX B;  1M45 A;  1UHK A;  1Z4H A;  1CDN A;  1OMD A;  2CT9 A;  1OZS A;  3WHT B;  3UO9 A;  2BBN A;  1U5I A;  3PJI A;  3NHI A;  1NCX A;  4INW A;  5D3O A;  4YGA A;  3CR2 A;  2BE4 A;  2L51 A;  1SMG A;  3AAJ A;  3VRN A;  1IG5 A;  1XK4 C;  3I5H C;  1BOC A;  1D1O A;  5CSN A;  2L0P A;  2KI6 D;  1QTX A;  3OBV A;  1KK8 B;  2HET A;  4YGB B;  2LC5 A;  1DJW A;  3PN7 C;  5I2L A;  4GGF A;  1TUZ A;  3PLF B;  2MBX A;  5BPJ A;  4AQI A;  2F3Z A;  4YRU A;  2P70 A;  2JT8 A;  1ALV A;  3DD4 A;  3JTD C;  1QLS A;  3D78 A;  2BEC A;  2K7B A;  3TZ1 A;  1PAL A;  2QAC A;  2OS8 C;  1XFV O;  2IS9 A;  1F54 A;  1LVC D;  2MJW B;  1YRU B;  4XJK B;  2NXQ A;  1DJI A;  2HQW A;  5HLO A;  5IBW A;  1SYM A;  2H61 A;  2LV7 A;  2WCL A;  3OX5 A;  1ALW A;  3R1P A;  3FWB A;  1YVL A;  1MR8 A;  1FW4 A;  4KYN A;  4ORA B;  4I5N B;  1QIV A;  1SL8 A;  1R2U A;  4C0L A;  2LLT A;  1MXE A;  2JUL A;  1YUU A;  1ZFS A;  1UP5 A;  1KQV A;  1Y6W A;  3JVT B;  4INX A;  3IVT A;  4N1F A;  3FE6 A;  3SS4 A;  1P28 A;  1QXP A;  4PHK A;  1FF1 A;  2F2P A;  3B87 A;  1WLM A;  3DY9 A;  1UHJ A;  1WRZ A;  1CB1 A;  2F33 A;  1DTL A;  1XO5 A;  2WCK A;  1OOG A;  4CFR A;  3QRX A;  1RRO A;  1BJF A;  2KI6 C;  1EG4 A;  4MEW A;  4MVF A;  4P2Y B;  3TUY C;  1CM4 A;  4PE1 A;  1YRT B;  2WND A;  3EVR A;  3PFV A;  2ERB A;  5HKY A;  1TIZ A;  2K7O A;  1CNP A;  2NZ0 A;  3I5G B;  1BU3 A;  1BG1 A;  1M39 A;  3TS5 B;  1X02 A;  4YBH B;  4YI9 A;  1CFC A;  4GPL B;  3EK7 A;  1CLB A;  3D0Y A;  1W9Z A;  3BYA A;  3I5I B;  4MN0 A;  1JWD A;  2K2A A;  2M9G A;  3CZT X;  3VRO A;  1FI5 A;  4P5O E;  1PUL A;  1WY9 A;  1AK8 A;  3OP0 A;  4WRI A;  1DJH A;  1XFR A;  1CDP A;  4OKH A;  3TDU A;  4DCK A;  2CTN A;  3N7H A;  3KO0 A;  1XFX O;  3DYE A;  1SRA A;  2LVJ A;  2KYF A;  1MWN A;  3L4L A;  1S5G Z;  4PDZ A;  2LUC A;  5FI7 A;  4FQT A;  1UUR A;  1YX8 A;  3GK4 X;  1KQM C;  1B8C A;  1G33 A;  2KPH A;  1B4C A;  1OQP A;  4MRX A;  1E8A A;  1K9K A;  2KBI A;  4HSZ A;  1NSH A;  2MLE C;  3TS5 C;  1TOP A;  4GBA A;  1JBA A;  2O60 A;  1DJX A;  4PE7 A;  2YGU A;  3I5I C;  3CLN A;  2KLE A;  3TDI A;  1YUR A;  1KFX S;  1WDC C;  1QX2 A;  2WCH A;  1QV1 A;  2P71 A;  3FS7 A;  3SIB A;  4XYN A;  2HF5 A;  3BUX B;  2ZND A;  2FCD A;  3O2P A;  1DEK A;  3RZS A;  1LXF C;  1C3Y A;  1AVS A;  4Q04 A;  1KFU S;  1J7Q A;  1K9P A;  3KF9 A;  5DKN A;  5FYX A;  4BY5 A;  2Q91 A;  3NSL A;  4YGE B;  3NSK A;  2F2O A;  3FE9 A;  1R6P A;  1CFF A;  2P6B B;  4GAO A;  1EXR A;  3CTN A;  2PMY A;  5DKR A;  1XFY O;  2I18 A;  4ETO A;  2BE6 A;  3EKJ A;  1YUS A;  3K21 A;  1QV0 A;  2M3W A;  2WOS A;  2K2F A;  3BFH A;  3CDN A;  5I8N A;  3B86 A;  1OMV A;  3VB1 A;  1QX7 A;  4R1E A;  3CZ0 A;  2K0J A;  5J3X A;  3SS5 A;  3SG4 A;  1GM0 A;  2K7C A;  1NPQ A;  3I5F C;  1NWD A;  2Y1M A;  4XJK A;  2LVK A;  1SCM B;  5CSJ A;  2MA2 A;  2OTG C;  5HKW A;  1C3Z A;  5JOL A;  3RLZ A;  5CSI A;  3NHT A;  1SCV A;  3VGO A;  1MF8 B;  2K60 A;  2PSR A;  3DZT A;  3DXL A;  4OZD A;  3CYZ A;  2LMV A;  1J1D A;  3DF0 A;  3F45 A;  5G08 A;  1AHR A;  1IQ5 A;  1CDM A;  2FJU B;  5KSZ A;  1IH0 A;  2JXC A;  5I2O A;  2G9B A;  2VRG A;  1OW4 A;  1TNX A;  2LLS A;  1DJG A;  1LIN A;  1N65 A;  2AUC A;  2JWW A;  4ORB B;  2KNE A;  3OX6 A;  3BJH A;  3H4S E;  5F6T A;  2KGB C;  5AEQ A;  1DF0 A;  3BOW B;  2AAO A;  3BUW B;  2KLD A;  1F4Q A;  1DEL A;  2QEO A;  3OGN A;  5B8I B;  1BT6 A;  1QWV A;  4ZCU A;  1TNW A;  3R1V A;  2FJY A;  1PVA A;  1PRW A;  3KEV A;  1FPW A;  1F70 A;  3KPX A;  2LNK A;  2JOJ A;  4N5X A;  1M63 B;  3BUN B;  1TN4 A;  1H4B A;  1S5G Y;  1Y1X A;  3AKA A;  2M29 A;  4ICB A;  2ZRS A;  4JKT A;  5CPV A;  1KK8 C;  1JF0 A;  3KHE A;  2KGR A;  1LA3 A;  1C07 A;  3D76 A;  2K61 A;  1YX7 A;  3EK8 A;  3FIA A;  3L4A A;  1B1G A;  4ZCV A;  1TCO B;  2KDH A;  1DMO A;  3CAB A;  3LK0 A;  4PCW A;  4AQJ A;  1EL4 A;  2KSP A;  1NX3 A;  1PSB A;  3IQO A;  2L5Y A;  2Y5I A;  1MUX A;  4PHN A;  2PAS A;  4F0Z B;  1YVH A;  2Q4U A;  1IKU A;  1S6C A;  1SR6 B;  3EG5 B;  1Y0V H;  2K8M B;  1K93 D;  1RTP 1;  1GGZ A;  2KAX A;  2PQL A;  4NDC A;  4WQ3 A;  4OV2 A;  5EL2 A;  4HRE E;  3B6X A;  4YGC B;  2WOR A;  1FBV A;  1MXL C;  2JPT A;  2MLF C;  2PYQ A;  2I94 A;  1OOI X;  5I2Q A; 
#chains in the Genus database with same CATH homology
 2LUX A;  1TCF A;  1JUO A;  2EC6 B;  1REC A;  1ZOT B;  4NDB A;  4HRG A;  3O4Y A;  2LVV A;  2M7L A;  1A2X A;  2LHL A;  2I2R E;  4QJ4 B;  3VRQ A;  4NDD A;  1J1E A;  2KFH A;  1HQV A;  1PSR A;  1BOD A;  2ZKM X;  2ZFD A;  4ORC B;  2RGI A;  1KWO B;  3JVT C;  4FQO A;  2JU0 A;  2KI4 B;  3DVK A;  5AER A;  4AOM A;  1J55 A;  4YGD B;  1A75 A;  1YR5 A;  4QJ3 B;  2O5G A;  1CTR A;  3AAK A;  3RM1 A;  2ZN9 A;  1UHH A;  4N1G A;  5PAL A;  1RJV A;  4MLW A;  1F71 A;  4FTG A;  2JNF A;  3I5G C;  1J7P A;  1B7T Z;  3BUM B;  4OVN F;  1AP4 A;  2MRD A;  3IQQ A;  1G4Y R;  4MZL A;  4GUK A;  4C0K A;  1NX1 A;  2PVB A;  2JNX A;  1Y1U A;  2M97 A;  3LLE A;  1BR4 B;  2NCO A;  3O6B A;  2FCE A;  1UUS A;  3CR4 X;  3DVM A;  2JRF A;  1KWO C;  1UHI A;  2M8U A;  3BUO B;  1L2O B;  1AJ5 A;  1M31 A;  4JQ0 D;  1XA5 A;  3EKH A;  2JT3 A;  3MSE B;  1RFJ A;  1QVI Z;  1S6J A;  1OOJ A;  4DIR A;  2Y4Q A;  1UHN A;  1GGW A;  1OE9 B;  3NXA A;  4JPZ B;  1QAT A;  1XFW O;  1KFX L;  1DVI A;  1VRK A;  1IQ3 A;  1C7W A;  2JTZ A;  3C1V A;  3D0Y B;  3DVJ A;  1CM1 A;  4PE4 A;  1UWO A;  3SG3 A;  4IL1 A;  1YUT A;  4GFT A;  4USL A;  3GK1 A;  4DRW A;  1OMR A;  2LAN A;  1KFU L;  2Y1N A;  1S1E A;  1QLK A;  3SJS A;  1K2H A;  1LKJ A;  1ZMZ A;  3CR5 X;  1EG3 A;  2MHH A;  3EVU A;  3PAL A;  1IJ5 A;  4M2P A;  3BQ3 A;  2FOT A;  2COL B;  2NLN A;  1XFZ O;  3I5H B;  1RK9 A;  2DOQ A;  1MQ1 A;  4L9M A;  1TTX A;  2HQ8 A;  2KFF A;  3ICB A;  4GGN A;  2BCB A;  1KSM A;  3PN7 B;  2JC2 A;  5TNC A;  1QX5 B;  1GJY A;  2M1K B;  1NX0 A;  2L2E A;  1ZAC A;  2SCP A;  2KAY A;  2L50 A;  5JJG A;  3JTD B;  5CSF A;  1BMO A;  1JSA A;  3EK4 A;  2CXJ A;  4HRH A;  4TNC A;  1JC2 A;  3SIA A;  1NX2 A;  2HPS A;  3A4U B;  2BKI B;  1DGV A;  1K96 A;  2BL0 B;  1K9U A;  2A4J A;  2SAS A;  3AKB A;  1JBA A;  1TNP A;  1XFU O;  1C7V A;  2G2B A;  3LCP C;  1JF2 A;  2M0R A;  3M0W A;  2B1U A;  1CKK A;  2LE9 B;  4GNK B;  4C0J A;  4DS7 A;  3FWC A;  2M49 B;  1AUI B;  2JQ6 A;  4M2O A;  1Y1A A;  1EJ3 A;  2EHB A;  2KQY A;  1PVB A;  1WRL A;  1SCM C;  2LP2 A;  3GK2 A;  5HKZ A;  2K7D A;  2CNP A;  1V1F A;  1BLQ A;  1K95 A;  3CS1 A;  2WCB A;  2BCX A;  1DGU A;  1CMG A;  1Q80 A;  2GV5 A;  1S6I A;  2WCF A;  3LL8 B;  3GOF A;  1B7T Y;  2E6W A;  2LM5 A;  5AXI A;  1GQM A;  3ZWH A;  1KK7 Z;  2BL0 C;  2R2I A;  1SL7 A;  1DJY A;  5ER5 A;  1CFP A;  1F8H A;  2D8N A;  1U5I B;  5ER4 X;  1RWY A;  4PAL A;  3BXK A;  1BF5 A;  3A8R A;  4M2Q A;  4E68 A;  1A03 A;  2OPO A;  2BKH B;  3TUY B;  3DVE A;  1DT7 B;  1CLM A;  1LA0 A;  3E3R A;  3SG7 A;  3OB2 B;  3DF0 B;  1QVI Y;  5AFP A;  1N0Y A;  1TNQ A;  2KYC A;  1S3P A;  2V53 A;  2EGD A;  4BY4 A;  2AMI A;  1F55 A;  1IRJ A;  2PAL A;  2ZN8 A;  3LK1 A;  3VRP A;  1CMF A;  2M1U A;  1SW8 A;  4I5K A;  3D10 A;  2CCM A;  4JWQ A;  1V1G A;  4UPG A;  3CWG A;  5KTY A;  1DF0 B;  1PK0 D;  2LP3 A;  1SK6 D;  5HYD A;  3NSO A;  3OB1 B;  2KQ6 A;  4D1E A;  2KAV A;  2M7N A;  2KOT A;  2L98 A;  1MHO A;  2LMU A;  1SR6 C;  3CGA A;  5D7F A;  1NP8 A;  4OCI A;  1OZO A;  1QS7 A;  1KQM B;  5HLV A;  4WQ2 A;  1J7R A;  2PRU A;  1NCY A;  3PM8 A;  1AJ4 A;  1ODB A;  4MBE A;  4GGF C;  4CLN A;  2BCA A;  1B47 A;  1HT9 A;  1S26 D;  2BBM A;  2LVI A;  1NYA A;  5KU1 A;  1SY9 A;  2EC6 C;  2JTT A;  2MAZ A;  1WDC B;  1EH2 A;  2L4H A;  2ZNE A;  1K90 D;  2CBL A;  1SBJ A;  1KCY A;  1W7J B;  1TRF A;  1M46 A;  1B9A A;  1JFK A;  1W7I B;  1ZUZ A;  4PHJ A;  4A4C A;  1IWQ A;  1QJT A;  4PE0 A;  1JFJ A;  1H8B A;  1L7Z A;  1XK4 A;  2E30 A;  2KI4 C;  2F3Y A;  2KFG A;  1DJZ A;  2L4I A;  2ZRT A;  3EVV A;  3OHM B;  4QJ5 B;  5DKQ A;  4CID A;  2H61 C;  2NCP A;  2ISD A;  1B8R A;  2WC8 A;  1KSO A;  4CFQ A;  1NIW A;  3PAT A;  5AAN A;  2GGM A;  2H2K A;  3IF7 A;  1IJ6 A;  3SG2 A;  3TDZ A;  2JXL A;  3PSR A;  2L5X B;  1QAS A;  1XVJ A;  2I7A A;  2LCP A;  4DUQ A;  2TN4 A;  1SL9 A;  1NUB A;  2LHI A;  4NQG A;  1N2D A;  2QPT A;  1XYD A;  1F4O A;  1G8I A;  3SG5 A;  3O78 A;  3WHU B;  1CFD A;  1S36 A;  4OR9 B;  3ZNI A;  4PHM A;  1OSA A;  2LAP A;  1QIW A;  1B8L A;  1KK7 Y;  3WXA A;  1CLL A;  3I5F B;  1A75 B;  2LMT A;  3BOW A;  3HCM A;  2WCE A;  5GQQ C;  3VRR A;  5D69 A;  2OTG B;  1K8U A;  4MRY A;  2GGZ A;  1IGV A;  1SKT A;  4MZJ A;  4U8D A;  1BR1 B;  1L2O C;  4MZK A;  1NCZ A;  1K94 A;  1SPY A;  2KBM A;  4CPV A;  4I5L B;  4MSP A;  3NSI A;  2JZI A;  3SG6 A;  3HX4 A;  1SNL A;  1J7O A;  2KHN A;  2F8P A;  1CDL A;  1WLZ A;  4A4B A;  4I5J A;  1A4P A;  5K89 A;  1FI6 A;  4YI8 A;  1A29 A;  2JT0 A;  2OS8 B;  1YTZ C;  1WRK A;  2LLU A;  3WNX B;  1M45 A;  1UHK A;  1CDN A;  1OMD A;  2CT9 A;  1OZS A;  3WHT B;  2BBN A;  1U5I A;  1NCX A;  4YGA A;  3CR2 A;  2BE4 A;  2L51 A;  1SMG A;  3AAJ A;  3VRN A;  1IG5 A;  1XK4 C;  3I5H C;  1BOC A;  1D1O A;  5CSN A;  2L0P A;  2KI6 D;  1QTX A;  1KK8 B;  2HET A;  4YGB B;  2LC5 A;  1DJW A;  3PN7 C;  5I2L A;  4GGF A;  2MBX A;  3PLF B;  5BPJ A;  4AQI A;  2F3Z A;  4YRU A;  2JT8 A;  1ALV A;  3DD4 A;  3JTD C;  1QLS A;  2BEC A;  2K7B A;  3TZ1 A;  1PAL A;  2QAC A;  2OS8 C;  1XFV O;  2IS9 A;  1F54 A;  1LVC D;  2MJW B;  1YRU B;  4XJK B;  2NXQ A;  1DJI A;  2HQW A;  5HLO A;  5IBW A;  1SYM A;  2H61 A;  2LV7 A;  3OX5 A;  1ALW A;  3FWB A;  1YVL A;  1MR8 A;  1FW4 A;  4ORA B;  4I5N B;  1QIV A;  1SL8 A;  1R2U A;  4C0L A;  2LLT A;  1MXE A;  2JUL A;  1YUU A;  1ZFS A;  1UP5 A;  1KQV A;  1Y6W A;  3JVT B;  4N1F A;  1FF1 A;  1QXP A;  4PHK A;  2F2P A;  1WLM A;  1UHJ A;  1WRZ A;  1CB1 A;  2F33 A;  1DTL A;  1XO5 A;  4CFR A;  3QRX A;  1RRO A;  1BJF A;  2KI6 C;  1EG4 A;  4MEW A;  4MVF A;  4P2Y B;  3TUY C;  1CM4 A;  4PE1 A;  1YRT B;  2WND A;  3EVR A;  3PFV A;  5HKY A;  1CNP A;  1TIZ A;  2K7O A;  2NZ0 A;  3I5G B;  1BU3 A;  1BG1 A;  1M39 A;  3TS5 B;  1X02 A;  4YBH B;  4YI9 A;  1CFC A;  4GPL B;  3EK7 A;  1CLB A;  3D0Y A;  3BYA A;  4MN0 A;  3I5I B;  1JWD A;  2K2A A;  2M9G A;  3CZT X;  3VRO A;  1FI5 A;  4P5O E;  1PUL A;  1WY9 A;  1AK8 A;  3OP0 A;  4WRI A;  1DJH A;  1CDP A;  4OKH A;  3TDU A;  4DCK A;  2CTN A;  3KO0 A;  1XFX O;  1SRA A;  2LVJ A;  2KYF A;  1MWN A;  1S5G Z;  4PDZ A;  2LUC A;  1UUR A;  1YX8 A;  3GK4 X;  1KQM C;  1B8C A;  1G33 A;  1B4C A;  1OQP A;  4MRX A;  1E8A A;  1K9K A;  2KBI A;  4HSZ A;  1NSH A;  2MLE C;  3TS5 C;  1TOP A;  4GBA A;  2O60 A;  1DJX A;  4PE7 A;  3I5I C;  3CLN A;  3TDI A;  1YUR A;  1KFX S;  1WDC C;  1QX2 A;  1QV1 A;  3FS7 A;  3SIB A;  4XYN A;  2HF5 A;  3BUX B;  2ZND A;  2FCD A;  3O2P A;  1LXF C;  1AVS A;  4Q04 A;  1KFU S;  1J7Q A;  1K9P A;  3KF9 A;  5DKN A;  5FYX A;  4BY5 A;  2Q91 A;  3NSL A;  4YGE B;  3NSK A;  2F2O A;  1R6P A;  1CFF A;  2P6B B;  4GAO A;  1EXR A;  3CTN A;  2PMY A;  5DKR A;  1XFY O;  2I18 A;  4ETO A;  2BE6 A;  3EKJ A;  1YUS A;  3K21 A;  1QV0 A;  2M3W A;  2WOS A;  2K2F A;  5I8N A;  1OMV A;  1QX7 A;  4R1E A;  2K0J A;  5J3X A;  3SG4 A;  2K7C A;  1NPQ A;  3I5F C;  1NWD A;  2Y1M A;  4XJK A;  2LVK A;  1SCM B;  5CSJ A;  2MA2 A;  2OTG C;  5HKW A;  5JOL A;  3RLZ A;  5CSI A;  1SCV A;  3VGO A;  1MF8 B;  2PSR A;  2LMV A;  1J1D A;  3DF0 A;  3F45 A;  5G08 A;  1AHR A;  1IQ5 A;  1CDM A;  2FJU B;  5KSZ A;  1IH0 A;  2JXC A;  5I2O A;  2G9B A;  2VRG A;  1TNX A;  2LLS A;  1DJG A;  1LIN A;  1N65 A;  2AUC A;  2JWW A;  4ORB B;  2KNE A;  3OX6 A;  3H4S E;  5F6T A;  2KGB C;  5AEQ A;  1DF0 A;  3BOW B;  2AAO A;  3BUW B;  1F4Q A;  5B8I B;  1BT6 A;  4ZCU A;  1TNW A;  1PVA A;  1PRW A;  3KEV A;  1FPW A;  1F70 A;  3KPX A;  2LNK A;  2JOJ A;  4N5X A;  1M63 B;  3BUN B;  1TN4 A;  1H4B A;  1S5G Y;  1Y1X A;  3AKA A;  2M29 A;  4ICB A;  2ZRS A;  5CPV A;  1KK8 C;  1JF0 A;  3KHE A;  2KGR A;  1LA3 A;  1C07 A;  3FIA A;  2K61 A;  1YX7 A;  3EK8 A;  1B1G A;  4ZCV A;  1TCO B;  2KDH A;  1DMO A;  3LK0 A;  4PCW A;  4AQJ A;  1EL4 A;  2KSP A;  1NX3 A;  1PSB A;  3IQO A;  2Y5I A;  1MUX A;  4PHN A;  2PAS A;  4F0Z B;  1YVH A;  2Q4U A;  1IKU A;  1S6C A;  1SR6 B;  1Y0V H;  2K8M B;  1K93 D;  1RTP 1;  1GGZ A;  2KAX A;  4NDC A;  4WQ3 A;  4OV2 A;  4HRE E;  4YGC B;  2WOR A;  1FBV A;  1MXL C;  2JPT A;  2MLF C;  2I94 A;  5I2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...