1CB1A

Three-dimensional solution structure of ca2+-loaded porcine calbindin d9k determined by nuclear magnetic resonance spectroscopy
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
78
structure length
78
Chain Sequence
SAQKSPAELKSIFEKYAAKEGDPNQLSKEELKQLIQAEFPSLLKGPRTLDDLFQELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALBINDIN D9K
publication title Three-dimensional solution structure of Ca(2+)-loaded porcine calbindin D9k determined by nuclear magnetic resonance spectroscopy.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Calcium-binding protein
total genus 24
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 1991-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1cb1A00
3BUXB 5CPVA 5I2LA 1IGVA 1CDLA 1OMVA 1N0YA 4NDCA 1IJ5A 3HCMA 4ORBB 3SG5A 2QPTA 4D1EA 1R6PA 1K2HA 2KAVA 2I94A 4N5XA 1AJ4A 3TUYC 1S5GY 2M97A 2V53A 3D0YA 3M0WA 3NSLA 4PE1A 3QRXA 1FF1A 3PALA 1NCYA 1QTXA 2VRGA 1CLBA 1MWNA 1NX3A 1F55A 1PSRA 2K7OA 1NIWA 5TNCA 4MRXA 2L0PA 5ER4X 3C1VA 2HPSA 4DCKA 3CLNA 3JTDC 3PLFB 2E30A 3WHTB 1CLMA 2MLEC 4DIRA 4MZJA 1A2XA 4YI8A 2Q4UA 1CLLA 1WDCB 3BXKA 2CTNA 1Q80A 1WLZA 2OTGC 3EK8A 5HYDA 1FI6A 3BUWB 5IBWA 1LKJA 1YX8A 2HETA 4I5LB 2ISDA 2ZFDA 3DF0A 4PHJA 2Y5IA 2M7LA 1KFUL 2BE6A 3I5IB 1NCZA 3GK2A 4F0ZB 1OZSA 1S6JA 1KSMA 1BJFA 2HQ8A 1J55A 2SCPA 1KK8B 4FQOA 1PK0D 1AJ5A 2ZNDA 1LXFC 1VRKA 2K8MB 1FW4A 2M1UA 3ICBA 2LMVA 3SG3A 1K8UA 2KFHA 3SG2A 3CGAA 1CM1A 2MLFC 3ZNIA 2JTZA 3WNXB 2LUCA 3NXAA 4GGFC 5HLVA 1J7PA 1DJHA 1QLSA 2JXCA 3BQ3A 2Y4QA 2KYFA 5CSIA 1DF0A 2ZN9A 1F8HA 1SR6C 3FWBA 2PALA 1DT7B 1CKKA 2OTGB 1TRFA 4U8DA 3AAKA 1DGVA 1SL9A 2M29A 1U5IB 2L4HA 2F3YA 4ORAB 1J7OA 3DD4A 4I5NB 2FJUB 1Y1XA 4GGNA 1SNLA 1MXLC 1RROA 1YR5A 1G33A 1E8AA 5HLOA 3O6BA 1M45A 4ETOA 1CTRA 3IF7A 2LP3A 5CSNA 1IRJA 2M3WA 1F4OA 3NSIA 1V1FA 2K0JA 4ZCUA 1K95A 1QV0A 1TIZA 1UHJA 2K61A 1ALWA 2SASA 1RECA 2JULA 1Y0VH 3D10A 4R1EA 3TS5C 1DJXA 1OMDA 2KDHA 3KO0A 4XJKA 1YRTB 1B47A 1BMOA 1DGUA 2CXJA 1A29A 1SR6B 4CIDA 1CDNA 1JWDA 2NCOA 1QVIY 3CR2A 5I2OA 2A4JA 1SCMC 1B8LA 2LLUA 2QACA 3WXAA 3K21A 1FBVA 1YX7A 5HKYA 2GGMA 4MEWA 1OOJA 2KAYA 1IJ6A 1R2UA 2LV7A 3CWGA 2B1UA 2LVVA 2KYCA 2M9GA 1KFXS 4P5OE 1S3PA 4GNKB 3A8RA 3BOWA 3F45A 2F33A 1WRZA 4PE0A 1NWDA 3VRQA 2L98A 5HKZA 2AAOA 1AP4A 2KBMA 2JQ6A 1ODBA 2LE9B 2LVJA 2CT9A 1YVLA 4YGBB 3NSKA 4JQ0D 4N1FA 1QX5B 1NUBA 1SBJA 2F3ZA 2LNKA 1L2OC 2EC6C 1C7VA 1NX2A 4I5JA 1DJYA 1TNXA 1EL4A 3TS5B 1ALVA 1BU3A 4QJ3B 2ZN8A 1ZOTB 1H4BA 2LM5A 4PALA 4ICBA 1DJIA 2OS8C 5CSFA 1M39A 2R2IA 3TZ1A 2KGBC 2I2RE 1CMFA 1GGWA 2LVIA 3DVKA 1NP8A 1OZOA 4PCWA 1A4PA 4OKHA 3VRPA 1B4CA 1SCMB 2JZIA 3JVTC 3TDZA 3LL8B 1AK8A 1HQVA 2WCEA 1DJWA 1H8BA 4HREE 1MR8A 1BG1A 1NX0A 1XK4A 2JXLA 4XYNA 3AKAA 4PE7A 1A75A 1FPWA 5JOLA 2F2OA 1SL7A 4AQJA 2KOTA 1IQ3A 2L51A 2H61C 3TDUA 4YGDB 1KFXL 1TOPA 3I5HC 2BKHB 1BR4B 2LHLA 2LLTA 1OE9B 2JU0A 2L50A 1M31A 1S6IA 1CDPA 2NZ0A 1LINA 4MBEA 3KEVA 3RM1A 1EG3A 2BBMA 1XA5A 4OVNF 3KPXA 1UWOA 1CNPA 1L2OB 1ZACA 2EC6B 2ZNEA 1IWQA 1ZMZA 1NX1A 2LAPA 1TNPA 2LHIA 4WQ3A 2KFGA 4DS7A 2EHBA 1SMGA 3VROA 2G2BA 1GJYA 3OX5A 3DVMA 5I2QA 3TUYB 2OS8B 4GAOA 1XFWO 1JUOA 5G08A 4YBHB 2HF5A 2AMIA 2NLNA 5DKNA 3CS1A 1Y6WA 4MN0A 2L4IA 1LVCD 3VGOA 4ZCVA 2KGRA 4MZKA 5CSJA 1DJZA 2EGDA 3VRRA 1KQMC 2F8PA 3JTDB 4NQGA 2GV5A 3EK7A 1IKUA 4FTGA 4M2OA 2KI4C 2I18A 1QATA 2K2FA 1SKTA 1KK7Z 5AANA 1MF8B 3EKHA 5KTYA 2MA2A 1K9PA 2I7AA 2KSPA 1UHNA 2CCMA 1NYAA 4AQIA 1QS7A 1M63B 4OV2A 2KI6D 1HT9A 1TCOB 4IL1A 3CR5X 3RLZA 3TDIA 1YVHA 3BUOB 2PASA 1LA3A 2HQWA 2K2AA 5AEQA 1SK6D 4MRYA 5AFPA 3LK0A 3FS7A 2PMYA 3KF9A 4AOMA 4CPVA 1B7TZ 1BT6A 4QJ4B 4TNCA 1QXPA 4I5KA 2LP2A 1MUXA 1QIWA 1XO5A 1UHIA 3PATA 1QX2A 4DUQA 4E68A 3BUNB 2K7CA 2BL0C 1L7ZA 3A4UB 1QV1A 5BPJA 3DVEA 3I5GC 1KQMB 2K7DA 1YUSA 2M7NA 1M46A 5J3XA 3D0YB 1ZUZA 3SIAA 1YURA 2Y1NA 4HRHA 1K94A 2KI4B 1NSHA 3BYAA 4NDDA 1JFKA 1DJGA 3KHEA 2KAXA 2KQYA 2MHHA 2WCBA 4MVFA 2WCFA 1UHHA 4M2QA 4DRWA 1RWYA 1UURA 5AERA 1CM4A 1W7IB 1S36A 1CMGA 1EXRA 1BR1B 2JC2A 1RFJA 1PVBA 2OPOA 1SY9A 2LANA 1F70A 4YGAA 1DTLA 2BBNA 4YGEB 5DKQA 1BF5A 1SW8A 3DF0B 3DVJA 1IQ5A 1S26D 2JWWA 1XFXO 1TN4A 2DOQA 5PALA 3HX4A 3OP0A 1NPQA 2LMUA 1U5IA 1XVJA 1C07A 1JC2A 2ZKMX 3VRNA 4GUKA 1AVSA 2BL0B 4PHNA 1IG5A 1AUIB 1MXEA 3OB1B 3IQOA 3I5GB 1MHOA 3H4SE 2L5XB 3EK4A 1QLKA 5KU1A 1SRAA 3LK1A 2RGIA 4YRUA 2JNXA 1GQMA 2K7BA 3MSEB 3PSRA 3IQQA 2JRFA 2MAZA 3OX6A 4JPZB 4N1GA 1WLMA 4YI9A 1YUTA 5F6TA 5GQQC 2E6WA 4C0KA 1SYMA 1D1OA 1IH0A 1DF0B 4JWQA 2TN4A 4ORCB 4GGFA 4MLWA 1KK8C 3SG6A 4C0LA 1Y1AA 1KK7Y 4GBAA 4HSZA 2LVKA 3GK1A 3PFVA 3CZTX 5DKRA 1WRKA 3PM8A 4PE4A 1XFZO 2LUXA 4A4CA 1QVIZ 2O5GA 1UHKA 2WNDA 1K96A 1PVAA 1XFUO 4NDBA 1YUUA 2BCAA 2PVBA 3LCPC 4M2PA 3SG4A 1EG4A 1S1EA 1K9UA 3GK4X 1UP5A 1EJ3A 2M0RA 1KCYA 2PSRA 2LMTA 1WY9A 2NXQA 4UPGA 1RTP1 2FCDA 1B7TY 4BY5A 2LC5A 5I8NA 1PULA 3EVRA 2JPTA 3FIAA 1J7QA 2BE4A 3JVTB 1W7JB 1F4QA 2PRUA 3O78A 2FCEA 1CFFA 4XJKB 2ZRTA 2KFFA 2G9BA 1C7WA 2JT3A 1Y1UA 2IS9A 1AHRA 1B8CA 1SPYA 5B8IB 1DVIA 1N2DA 3I5HB 1N65A 1RK9A 3CTNA 3NSOA 1GGZA 1S5GZ 2ZRSA 3OB2B 4MZLA 4OR9B 4GPLB 3I5FC 2BKIB 4L9MA 4OCIA 1XK4C 2COLB 4CFQA 1ZFSA 2AUCA 1BODA 1X02A 1RJVA 1OQPA 5FYXA 2BECA 5JJGA 2L2EA 2JTTA 3EVVA 4CLNA 1A03A 1K90D 2JT0A 1CB1A 3SG7A 3BOWB 1QIVA 3WHUB 2FOTA 1JBAA 1NCXA 3PN7C 1KSOA 1XFVO 2BCBA 1SL8A 1B8RA 5KSZA 1G8IA 4CFRA 2KNEA 1PSBA 1K93D 1YRUB 1CFPA 1TCFA 3BUMB 1F71A 1KQVA 1DMOA 1TNQA 2M1KB 4PHMA 1WRLA 4QJ5B 3GOFA 1JFJA 2F2PA 2JNFA 1KWOC 2JT8A 1OSAA 1OMRA 2LCPA 5ER5A 1XFYO 1PRWA 1J1EA 4YGCB 2NCPA 1B1GA 2MBXA 2Q91A 4HRGA 1MQ1A 1YTZC 3SJSA 1JF0A 5D7FA 4A4BA 3I5FB 1CFCA 1PALA 5HKWA 2O60A 2CNPA 4WRIA 1K9KA 4USLA 1A75B 5AXIA 4WQ2A 1F54A 2LLSA 1V1GA 2M49B 4Q04A 2MJWB 1CDMA 4GFTA 1FI5A 1B9AA 2D8NA 2WOSA 3AAJA 2H2KA 4BY4A 1BOCA 1TNWA 3PN7B 1LA0A 1JSAA 2MRDA 2CBLA 3FWCA 2KQ6A 3O2PA 2H61A 1UUSA 2M8UA 3E3RA 1BLQA 1QX7A 2BCXA 2KBIA 3OHMB 1XYDA 3EKJA 1EH2A 1KWOB 2KI6C 4MSPA 1JF2A 3LLEA 1CFDA 2JOJA 1QASA 3SIBA 5D69A 5K89A 3O4YA 1WDCC 1S6CA 2WC8A 4P2YB 4PHKA 2KHNA 3CR4X 3ZWHA 1J7RA 2P6BB 3AKBA 1TTXA 4C0JA 1KFUS 2Y1MA 2GGZA 1G4YR 2WORA 3I5IC 1QJTA 3EVUA 1J1DA 1SCVA 4PDZA
chains in the Genus database with same CATH superfamily
3BUXB 5CPVA 5I2LA 1IGVA 1CDLA 1OMVA 1N0YA 2H8VA 4NDCA 1IJ5A 3HCMA 4ORBB 3SG5A 2QPTA 2GTEA 4D1EA 1R6PA 3FE9A 1K2HA 2KAVA 2I94A 4N5XA 5HL1A 1AJ4A 3D77A 3TUYC 1S5GY 2M97A 2V53A 3D0YA 3M0WA 3NSLA 3D76A 3QRXA 3R1OA 3PALA 4PE1A 1FF1A 1NCYA 1QTXA 2VRGA 3DY9A 1MWNA 1NX3A 1CLBA 1F55A 1PSRA 2K7OA 2YGUA 5FI7A 1NIWA 5TNCA 4FQTA 4MRXA 2L0PA 1P28A 3CABA 5ER4X 3C1VA 2HPSA 4DCKA 3CLNA 3JTDC 3PLFB 2E30A 3WHTB 1CLMA 2MLEC 4DIRA 2ERBA 4MZJA 2WCKA 1A2XA 4YI8A 3R1VA 2Q4UA 1CLLA 1WDCB 3BXKA 2CTNA 1Q80A 1WLZA 2OTGC 2PQLA 3EK8A 3R1PA 3BUWB 5HYDA 1FI6A 5IBWA 3L4LA 2QEVA 1LKJA 1YX8A 2HETA 4I5LB 2ISDA 2ZFDA 3DF0A 1Z4HA 2Y5IA 4PHJA 2M7LA 1KFUL 2BE6A 3I5IB 1NCZA 3GK2A 1QWVA 4F0ZB 1OZSA 1S6JA 1KSMA 2BNXA 1BJFA 2HQ8A 1J55A 5EL2A 2SCPA 3DXLA 1KK8B 4FQOA 1PK0D 1AJ5A 2ZNDA 1LXFC 3L47A 3S0DA 2WCLA 1VRKA 2K8MB 1FW4A 2M1UA 3D75A 3ICBA 2LMVA 3SG3A 1K8UA 2KFHA 3SG2A 3CGAA 1CM1A 2MLFC 3ZNIA 2JTZA 3WNXB 2LUCA 3NXAA 4GGFC 5HLVA 3EG5B 1J7PA 1DJHA 1QLSA 2JXCA 3BQ3A 2Y4QA 2KYFA 4KYNA 5CSIA 5D3OA 1DF0A 2ZN9A 1F8HA 1SR6C 3FWBA 2PALA 1DT7B 1CKKA 2OTGB 1TRFA 4U8DA 3AAKA 1DGVA 1SL9A 2M29A 1U5IB 2L4HA 2F3YA 4ORAB 1J7OA 3DD4A 4I5NB 2FJUB 1Y1XA 1OOFA 3D74A 4GGNA 1SNLA 1MXLC 1RROA 1YR5A 1G33A 3QMEA 1E8AA 5HLOA 3O6BA 1M45A 4ETOA 1CTRA 3IF7A 3B7AA 2LP3A 5CSNA 1IRJA 2M3WA 1F4OA 3NSIA 1V1FA 2K0JA 4ZCUA 1K95A 1QV0A 1TIZA 1UHJA 2K61A 1ALWA 3PM2A 2SASA 4PT1A 1RECA 2JULA 1Y0VH 2WCMA 3D10A 3N7HA 3UNWA 4R1EA 2WCJA 3TS5C 3IVTA 1DJXA 1OMDA 2KDHA 3KO0A 4XJKA 1YRTB 1B47A 1BMOA 1DGUA 2CXJA 1A29A 1SR6B 4CIDA 1CDNA 1JWDA 2NCOA 1QVIY 3CR2A 5I2OA 2A4JA 1SCMC 1B8LA 5FI6A 3NHIA 2LLUA 2QACA 3WXAA 3K21A 1FBVA 1YX7A 5HKYA 2GGMA 4MEWA 1OOJA 2KAYA 1IJ6A 1R2UA 2LV7A 3CWGA 2B1UA 2LVVA 2KYCA 2M9GA 1KFXS 4P5OE 1S3PA 4GNKB 3A8RA 3BOWA 3F45A 2F33A 1WRZA 4PE0A 1NWDA 3VRQA 2L98A 5HKZA 2AAOA 1AP4A 2KBMA 2JQ6A 1ODBA 2LE9B 2LVJA 2CT9A 1YVLA 4YGBB 3NSKA 4JQ0D 4N1FA 1QX5B 1NUBA 1SBJA 2F3ZA 2LNKA 3SS5A 1L2OC 2EC6C 1C7VA 1NX2A 4I5JA 3CZ2A 1DJYA 1TNXA 1EL4A 3TS5B 1ALVA 1BU3A 4QJ3B 2ZN8A 1IIOA 1ZOTB 1H4BA 2LM5A 4PALA 4ICBA 3V2LA 1DJIA 2OS8C 3B6XA 5CSFA 1M39A 2R2IA 3TZ1A 4OZDA 2KGBC 2I2RE 3FE8A 1CMFA 1GGWA 2LVIA 3DVKA 1NP8A 1OZOA 4PCWA 1A4PA 4OKHA 3O4XA 3VRPA 1SCMB 2JZIA 2WCHA 3JVTC 3TDZA 3LL8B 1AK8A 1HQVA 2WCEA 1DJWA 1H8BA 4HREE 1MR8A 1BG1A 1NX0A 1XK4A 2JXLA 4XYNA 3AKAA 3L4AA 1A75A 4PE7A 5JOLA 1FPWA 2WC5A 2F2OA 3NGVA 1SL7A 4AQJA 2KOTA 1IQ3A 2L51A 2H61C 3TDUA 4YGDB 1KFXL 3B88A 1TOPA 3I5HC 2BKHB 1TWOA 1BR4B 2LHLA 2LLTA 1OE9B 2JU0A 2L50A 1M31A 1S6IA 1CDPA 2NZ0A 1LINA 4MBEA 3KEVA 3RM1A 1EG3A 2BBMA 1XA5A 4OVNF 3KPXA 1UWOA 1CNPA 1L2OB 1ZACA 2EC6B 2ZNEA 1IWQA 1ZMZA 1NX1A 2LAPA 1TNPA 2LHIA 2PYQA 4WQ3A 2KFGA 4DS7A 2EHBA 1SMGA 3VROA 2G2BA 1GJYA 3OX5A 2QEHA 3DVMA 5I2QA 3TUYB 2OS8B 4GAOA 1XFWO 3CYZA 1JUOA 5G08A 4YBHB 2HF5A 3B87A 2KPHA 2AMIA 2NLNA 5DKNA 3CDNA 1Y6WA 3CS1A 4MN0A 5I94A 2L4IA 1LVCD 3K1EA 3VGOA 4ZCVA 2KGRA 4MZKA 5CSJA 1DJZA 2EGDA 3VRRA 1KQMC 2F8PA 3JTDB 4NQGA 2GV5A 3EK7A 1IKUA 1TUZA 4FTGA 4M2OA 2KI4C 2P70A 4IJ7A 2I18A 1QATA 2K2FA 1SKTA 1KK7Z 5AANA 1OOIX 1MF8B 3EKHA 5KTYA 4INXA 2MA2A 1K9PA 2I7AA 1OOHA 1UHNA 2KSPA 2CCMA 1NYAA 4AQIA 1QS7A 1M63B 4OV2A 2KI6D 1HT9A 1TCOB 2L5YA 3CR5X 4IL1A 3RLZA 1YVHA 3TDIA 3BUOB 2PASA 1LA3A 2HQWA 4JKTA 2K2AA 5AEQA 1SK6D 3SS3A 4MRYA 5AFPA 3LK0A 3FS7A 2PMYA 2QDIA 3KF9A 4AOMA 5DICA 4CPVA 1B7TZ 1BT6A 4QJ4B 4TNCA 1QXPA 4I5KA 2LP2A 1XO5A 1MUXA 1QIWA 1LS8A 1UHIA 3PATA 1QX2A 4DUQA 4E68A 1T14A 3BUNB 2K7CA 2BL0C 1L7ZA 3A4UB 1QV1A 5BPJA 3DVEA 4F7FA 3I5GC 1KQMB 2K7DA 1YUSA 2M7NA 1M46A 5J3XA 3D0YB 1ZUZA 3SIAA 1YURA 2Y1NA 4HRHA 1K94A 2KI4B 1NSHA 3BYAA 1OW4A 1DEKA 4INWA 4NDDA 1JFKA 1DJGA 3KHEA 2KAXA 5FI2A 2KQYA 2MHHA 2WCBA 4MVFA 3S0GA 2WCFA 1UHHA 4M2QA 4DRWA 1RWYA 1UURA 3OGNA 5AERA 1CM4A 1W7IB 1S36A 1CMGA 1EXRA 1BR1B 3PJIA 2JC2A 1RFJA 1PVBA 2OPOA 1SY9A 2LANA 1DQEA 1F70A 4YGAA 1DTLA 2BBNA 4YGEB 5DKQA 3S0BA 1SW8A 3DF0B 3DVJA 1BF5A 3D73A 3DZTA 1IQ5A 1S26D 2JWWA 1XFXO 1TN4A 2DOQA 5PALA 3HX4A 3CZ0A 3OP0A 1NPQA 2LMUA 1U5IA 1XVJA 1C07A 1JC2A 2ZKMX 3VRNA 4GUKA 1AVSA 2BL0B 4PHNA 1IG5A 1AUIB 1MXEA 3OB1B 3IQOA 3I5GB 1MHOA 3H4SE 2L5XB 3EK4A 1QLKA 5KU1A 3VB1A 1SRAA 3LK1A 2RGIA 4YRUA 2JNXA 1GQMA 2K7BA 3MSEB 3PSRA 3IQQA 2JRFA 2MAZA 3OX6A 4JPZB 3DYEA 4N1GA 1WLMA 4YI9A 1YUTA 5F6TA 5GQQC 2E6WA 4C0KA 1SYMA 1D1OA 1IH0A 1DF0B 4JWQA 2TN4A 4ORCB 4GGFA 4MLWA 1KK8C 3SG6A 2QEOA 2QEBA 4C0LA 1Y1AA 1KK7Y 4GBAA 4HSZA 2LVKA 3GK1A 3PFVA 3CZTX 5DKRA 3D78A 1WRKA 3PM8A 4PE4A 1XFZO 2LUXA 4A4CA 1QVIZ 2O5GA 1UHKA 2WNDA 1W9ZA 1K96A 1PVAA 1XFUO 4NDBA 1YUUA 1C3ZA 2BCAA 2PVBA 3LCPC 4M2PA 3SG4A 1EG4A 1S1EA 1K9UA 1ORGA 3GK4X 1UP5A 1EJ3A 2M0RA 2WC6A 1KCYA 3BFAA 2PSRA 2LMTA 1WY9A 2NXQA 4UPGA 1RTP1 2FCDA 1B7TY 4BY5A 2LC5A 5I8NA 3SS4A 1PULA 3EVRA 2JPTA 3FIAA 1J7QA 2BE4A 3JVTB 1OOGA 1W7JB 1F4QA 2PRUA 3O78A 2FCEA 1CFFA 3BFBA 4XJKB 2ZRTA 2KFFA 2G9BA 3FE6A 1C7WA 2JT3A 3UO9A 1Y1UA 1Z2CB 3S0EA 2IS9A 3BJHA 1AHRA 1B8CA 2L2CA 1SPYA 5B8IB 1DVIA 1N2DA 3I5HB 1N65A 1RK9A 3CTNA 3NSOA 1GGZA 1S5GZ 2ZRSA 3OB2B 4MZLA 4OR9B 4GPLB 3I5FC 2BKIB 4L9MA 4OCIA 1XK4C 2COLB 4CFQA 1ZFSA 2AUCA 3CZ1A 1BODA 1X02A 1RJVA 1OQPA 5FYXA 2BECA 5JJGA 1GM0A 2L2EA 2JTTA 3EVVA 4CLNA 1A03A 1K90D 2JT0A 1CB1A 3SG7A 3BOWB 1QIVA 3WHUB 2FOTA 1JBAA 1NCXA 3PN7C 1KSOA 1XFVO 2BCBA 1SL8A 1B8RA 5KSZA 1G8IA 4CFRA 3RZSA 2KNEA 1PSBA 1K93D 1YRUB 1CFPA 1TCFA 2KLDA 3BUMB 1F71A 1DMOA 1KQVA 1TNQA 2M1KB 4PHMA 1WRLA 4QJ5B 3GOFA 1TUJA 1JFJA 2F2PA 2JNFA 1KWOC 2JT8A 1OSAA 1OMRA 2KLEA 2LCPA 4JD9A 5ER5A 1XFYO 3R72A 1PRWA 1J1EA 4YGCB 2NCPA 1DC1A 1B1GA 2MBXA 1B4CA 2Q91A 4HRGA 1MQ1A 1YTZC 3SJSA 1JF0A 5D7FA 4A4BA 3I5FB 1CFCA 3Q8IA 1PALA 5HKWA 2O60A 2CNPA 4WRIA 1K9KA 4USLA 3S0AA 1A75B 5AXIA 4WQ2A 1F54A 3NHTA 2LLSA 1V1GA 2M49B 3B86A 4Q04A 2MJWB 1CDMA 4GFTA 1FI5A 1B9AA 2D8NA 1XFRA 2WOSA 3AAJA 2H2KA 1DELA 4BY4A 1TNWA 3PN7B 1BOCA 1LA0A 1JSAA 2MRDA 2FJYA 2BAPA 2CBLA 3FWCA 2KQ6A 3O2PA 2H61A 1UUSA 2M8UA 3E3RA 1BLQA 1QX7A 2BCXA 2KBIA 3OHMB 1XYDA 3EKJA 1EH2A 1KWOB 2KI6C 1C3YA 4MSPA 1JF2A 3LLEA 3S0FA 1CFDA 1SSEB 2JOJA 2JPOA 1QASA 3SIBA 5D69A 5K89A 2P71A 3O4YA 1WDCC 1S6CA 2WC8A 4P2YB 4PHKA 2KHNA 3OBVA 3CR4X 3ZWHA 1J7RA 2P6BB 3AKBA 1TTXA 3BFHA 4C0JA 1KFUS 2K60A 2Y1MA 2GGZA 1G4YR 2WORA 3I5IC 1QJTA 3EVUA 1J1DA 1SCVA 4PDZA
chains in the Genus database with same CATH topology
3BUXB 5CPVA 5I2LA 1IGVA 1CDLA 1OMVA 1N0YA 4NDCA 1IJ5A 3HCMA 4ORBB 3SG5A 2QPTA 4D1EA 1R6PA 1K2HA 2KAVA 2I94A 4N5XA 1AJ4A 3TUYC 1S5GY 2M97A 2V53A 3D0YA 3M0WA 3NSLA 4PE1A 3QRXA 1FF1A 3PALA 1NCYA 1QTXA 2VRGA 1CLBA 1MWNA 1NX3A 1F55A 1PSRA 2K7OA 1NIWA 5TNCA 4MRXA 2L0PA 5ER4X 3C1VA 2HPSA 4DCKA 3CLNA 3JTDC 3PLFB 2E30A 3WHTB 1CLMA 2MLEC 4DIRA 4MZJA 1A2XA 4YI8A 2Q4UA 1CLLA 1WDCB 3BXKA 2CTNA 1Q80A 1WLZA 2OTGC 3EK8A 5HYDA 1FI6A 3BUWB 5IBWA 1LKJA 1YX8A 2HETA 4I5LB 2ISDA 2ZFDA 3DF0A 4PHJA 2Y5IA 2M7LA 1KFUL 2BE6A 3I5IB 1NCZA 3GK2A 4F0ZB 1OZSA 1S6JA 1KSMA 1BJFA 2HQ8A 1J55A 2SCPA 1KK8B 4FQOA 1PK0D 1AJ5A 2ZNDA 1LXFC 1VRKA 2K8MB 1FW4A 2M1UA 3ICBA 2LMVA 3SG3A 1K8UA 2KFHA 3SG2A 3CGAA 1CM1A 2MLFC 3ZNIA 2JTZA 3WNXB 2LUCA 3NXAA 4GGFC 5HLVA 1J7PA 1DJHA 1QLSA 2JXCA 3BQ3A 2Y4QA 2KYFA 5CSIA 1DF0A 2ZN9A 1F8HA 1SR6C 3FWBA 2PALA 1DT7B 1CKKA 2OTGB 1TRFA 4U8DA 3AAKA 1DGVA 1SL9A 2M29A 1U5IB 2L4HA 2F3YA 4ORAB 1J7OA 3DD4A 4I5NB 2FJUB 1Y1XA 4GGNA 1SNLA 1MXLC 1RROA 1YR5A 1G33A 1E8AA 5HLOA 3O6BA 1M45A 4ETOA 1CTRA 3IF7A 2LP3A 5CSNA 1IRJA 2M3WA 1F4OA 3NSIA 1V1FA 2K0JA 4ZCUA 1K95A 1QV0A 1TIZA 1UHJA 2K61A 1ALWA 2SASA 1RECA 2JULA 1Y0VH 3D10A 4R1EA 3TS5C 1DJXA 1OMDA 2KDHA 3KO0A 4XJKA 1YRTB 1B47A 1BMOA 1DGUA 2CXJA 1A29A 1SR6B 4CIDA 1CDNA 1JWDA 2NCOA 1QVIY 3CR2A 5I2OA 2A4JA 1SCMC 1B8LA 2LLUA 2QACA 3WXAA 3K21A 1FBVA 1YX7A 5HKYA 2GGMA 4MEWA 1OOJA 2KAYA 1IJ6A 1R2UA 2LV7A 3CWGA 2B1UA 2LVVA 2KYCA 2M9GA 1KFXS 4P5OE 1S3PA 4GNKB 3A8RA 3BOWA 3F45A 2F33A 1WRZA 4PE0A 1NWDA 3VRQA 2L98A 5HKZA 2AAOA 1AP4A 2KBMA 2JQ6A 1ODBA 2LE9B 2LVJA 2CT9A 1YVLA 4YGBB 3NSKA 4JQ0D 4N1FA 1QX5B 1NUBA 1SBJA 2F3ZA 2LNKA 1L2OC 2EC6C 1C7VA 1NX2A 4I5JA 1DJYA 1TNXA 1EL4A 3TS5B 1ALVA 1BU3A 4QJ3B 2ZN8A 1ZOTB 1H4BA 2LM5A 4PALA 4ICBA 1DJIA 2OS8C 5CSFA 1M39A 2R2IA 3TZ1A 2KGBC 2I2RE 1CMFA 1GGWA 2LVIA 3DVKA 1NP8A 1OZOA 4PCWA 1A4PA 4OKHA 3VRPA 1B4CA 1SCMB 2JZIA 3JVTC 3TDZA 3LL8B 1AK8A 1HQVA 2WCEA 1DJWA 1H8BA 4HREE 1MR8A 1BG1A 1NX0A 1XK4A 2JXLA 4XYNA 3AKAA 4PE7A 1A75A 1FPWA 5JOLA 2F2OA 1SL7A 4AQJA 2KOTA 1IQ3A 2L51A 2H61C 3TDUA 4YGDB 1KFXL 1TOPA 3I5HC 2BKHB 1BR4B 2LHLA 2LLTA 1OE9B 2JU0A 2L50A 1M31A 1S6IA 1CDPA 2NZ0A 1LINA 4MBEA 3KEVA 3RM1A 1EG3A 2BBMA 1XA5A 4OVNF 3KPXA 1UWOA 1CNPA 1L2OB 1ZACA 2EC6B 2ZNEA 1IWQA 1ZMZA 1NX1A 2LAPA 1TNPA 2LHIA 4WQ3A 2KFGA 4DS7A 2EHBA 1SMGA 3VROA 2G2BA 1GJYA 3OX5A 3DVMA 5I2QA 3TUYB 2OS8B 4GAOA 1XFWO 1JUOA 5G08A 4YBHB 2HF5A 2AMIA 2NLNA 5DKNA 3CS1A 1Y6WA 4MN0A 2L4IA 1LVCD 3VGOA 4ZCVA 2KGRA 4MZKA 5CSJA 1DJZA 2EGDA 3VRRA 1KQMC 2F8PA 3JTDB 4NQGA 2GV5A 3EK7A 1IKUA 4FTGA 4M2OA 2KI4C 2I18A 1QATA 2K2FA 1SKTA 1KK7Z 5AANA 1MF8B 3EKHA 5KTYA 2MA2A 1K9PA 2I7AA 2KSPA 1UHNA 2CCMA 1NYAA 4AQIA 1QS7A 1M63B 4OV2A 2KI6D 1HT9A 1TCOB 4IL1A 3CR5X 3RLZA 3TDIA 1YVHA 3BUOB 2PASA 1LA3A 2HQWA 2K2AA 5AEQA 1SK6D 4MRYA 5AFPA 3LK0A 3FS7A 2PMYA 3KF9A 4AOMA 4CPVA 1B7TZ 1BT6A 4QJ4B 4TNCA 1QXPA 4I5KA 2LP2A 1MUXA 1QIWA 1XO5A 1UHIA 3PATA 1QX2A 4DUQA 4E68A 3BUNB 2K7CA 2BL0C 1L7ZA 3A4UB 1QV1A 5BPJA 3DVEA 3I5GC 1KQMB 2K7DA 1YUSA 2M7NA 1M46A 5J3XA 3D0YB 1ZUZA 3SIAA 1YURA 2Y1NA 4HRHA 1K94A 2KI4B 1NSHA 3BYAA 4NDDA 1JFKA 1DJGA 3KHEA 2KAXA 2KQYA 2MHHA 2WCBA 4MVFA 2WCFA 1UHHA 4M2QA 4DRWA 1RWYA 1UURA 5AERA 1CM4A 1W7IB 1S36A 1CMGA 1EXRA 1BR1B 2JC2A 1RFJA 1PVBA 2OPOA 1SY9A 2LANA 1F70A 4YGAA 1DTLA 2BBNA 4YGEB 5DKQA 1BF5A 1SW8A 3DF0B 3DVJA 1IQ5A 1S26D 2JWWA 1XFXO 1TN4A 2DOQA 5PALA 3HX4A 3OP0A 1NPQA 2LMUA 1U5IA 1XVJA 1C07A 1JC2A 2ZKMX 3VRNA 4GUKA 1AVSA 2BL0B 4PHNA 1IG5A 1AUIB 1MXEA 3OB1B 3IQOA 3I5GB 1MHOA 3H4SE 2L5XB 3EK4A 1QLKA 5KU1A 1SRAA 3LK1A 2RGIA 4YRUA 2JNXA 1GQMA 2K7BA 3MSEB 3PSRA 3IQQA 2JRFA 2MAZA 3OX6A 4JPZB 4N1GA 1WLMA 4YI9A 1YUTA 5F6TA 5GQQC 2E6WA 4C0KA 1SYMA 1D1OA 1IH0A 1DF0B 4JWQA 2TN4A 4ORCB 4GGFA 4MLWA 1KK8C 3SG6A 4C0LA 1Y1AA 1KK7Y 4GBAA 4HSZA 2LVKA 3GK1A 3PFVA 3CZTX 5DKRA 1WRKA 3PM8A 4PE4A 1XFZO 2LUXA 4A4CA 1QVIZ 2O5GA 1UHKA 2WNDA 1K96A 1PVAA 1XFUO 4NDBA 1YUUA 2BCAA 2PVBA 3LCPC 4M2PA 3SG4A 1EG4A 1S1EA 1K9UA 3GK4X 1UP5A 1EJ3A 2M0RA 1KCYA 2PSRA 2LMTA 1WY9A 2NXQA 4UPGA 1RTP1 2FCDA 1B7TY 4BY5A 2LC5A 5I8NA 1PULA 3EVRA 2JPTA 3FIAA 1J7QA 2BE4A 3JVTB 1W7JB 1F4QA 2PRUA 3O78A 2FCEA 1CFFA 4XJKB 2ZRTA 2KFFA 2G9BA 1C7WA 2JT3A 1Y1UA 2IS9A 1AHRA 1B8CA 1SPYA 5B8IB 1DVIA 1N2DA 3I5HB 1N65A 1RK9A 3CTNA 3NSOA 1GGZA 1S5GZ 2ZRSA 3OB2B 4MZLA 4OR9B 4GPLB 3I5FC 2BKIB 4L9MA 4OCIA 1XK4C 2COLB 4CFQA 1ZFSA 2AUCA 1BODA 1X02A 1RJVA 1OQPA 5FYXA 2BECA 5JJGA 2L2EA 2JTTA 3EVVA 4CLNA 1A03A 1K90D 2JT0A 1CB1A 3SG7A 3BOWB 1QIVA 3WHUB 2FOTA 1JBAA 1NCXA 3PN7C 1KSOA 1XFVO 2BCBA 1SL8A 1B8RA 5KSZA 1G8IA 4CFRA 2KNEA 1PSBA 1K93D 1YRUB 1CFPA 1TCFA 3BUMB 1F71A 1KQVA 1DMOA 1TNQA 2M1KB 4PHMA 1WRLA 4QJ5B 3GOFA 1JFJA 2F2PA 2JNFA 1KWOC 2JT8A 1OSAA 1OMRA 2LCPA 5ER5A 1XFYO 1PRWA 1J1EA 4YGCB 2NCPA 1B1GA 2MBXA 2Q91A 4HRGA 1MQ1A 1YTZC 3SJSA 1JF0A 5D7FA 4A4BA 3I5FB 1CFCA 1PALA 5HKWA 2O60A 2CNPA 4WRIA 1K9KA 4USLA 1A75B 5AXIA 4WQ2A 1F54A 2LLSA 1V1GA 2M49B 4Q04A 2MJWB 1CDMA 4GFTA 1FI5A 1B9AA 2D8NA 2WOSA 3AAJA 2H2KA 4BY4A 1BOCA 1TNWA 3PN7B 1LA0A 1JSAA 2MRDA 2CBLA 3FWCA 2KQ6A 3O2PA 2H61A 1UUSA 2M8UA 3E3RA 1BLQA 1QX7A 2BCXA 2KBIA 3OHMB 1XYDA 3EKJA 1EH2A 1KWOB 2KI6C 4MSPA 1JF2A 3LLEA 1CFDA 2JOJA 1QASA 3SIBA 5D69A 5K89A 3O4YA 1WDCC 1S6CA 2WC8A 4P2YB 4PHKA 2KHNA 3CR4X 3ZWHA 1J7RA 2P6BB 3AKBA 1TTXA 4C0JA 1KFUS 2Y1MA 2GGZA 1G4YR 2WORA 3I5IC 1QJTA 3EVUA 1J1DA 1SCVA 4PDZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BUX B;  5CPV A;  5I2L A;  1IGV A;  1CDL A;  1OMV A;  1N0Y A;  4NDC A;  1IJ5 A;  3HCM A;  4ORB B;  3SG5 A;  2QPT A;  4D1E A;  1R6P A;  1K2H A;  2KAV A;  2I94 A;  4N5X A;  1AJ4 A;  3TUY C;  1S5G Y;  2M97 A;  2V53 A;  3D0Y A;  3M0W A;  3NSL A;  4PE1 A;  3QRX A;  1FF1 A;  3PAL A;  1NCY A;  1QTX A;  2VRG A;  1CLB A;  1MWN A;  1NX3 A;  1F55 A;  1PSR A;  2K7O A;  1NIW A;  5TNC A;  4MRX A;  2L0P A;  5ER4 X;  3C1V A;  2HPS A;  4DCK A;  3CLN A;  3JTD C;  3PLF B;  2E30 A;  3WHT B;  1CLM A;  2MLE C;  4DIR A;  4MZJ A;  1A2X A;  4YI8 A;  2Q4U A;  1CLL A;  1WDC B;  3BXK A;  2CTN A;  1Q80 A;  1WLZ A;  2OTG C;  3EK8 A;  5HYD A;  1FI6 A;  3BUW B;  5IBW A;  1LKJ A;  1YX8 A;  2HET A;  4I5L B;  2ISD A;  2ZFD A;  3DF0 A;  4PHJ A;  2Y5I A;  2M7L A;  1KFU L;  2BE6 A;  3I5I B;  1NCZ A;  3GK2 A;  4F0Z B;  1OZS A;  1S6J A;  1KSM A;  1BJF A;  2HQ8 A;  1J55 A;  2SCP A;  1KK8 B;  4FQO A;  1PK0 D;  1AJ5 A;  2ZND A;  1LXF C;  1VRK A;  2K8M B;  1FW4 A;  2M1U A;  3ICB A;  2LMV A;  3SG3 A;  1K8U A;  2KFH A;  3SG2 A;  3CGA A;  1CM1 A;  2MLF C;  3ZNI A;  2JTZ A;  3WNX B;  2LUC A;  3NXA A;  4GGF C;  5HLV A;  1J7P A;  1DJH A;  1QLS A;  2JXC A;  3BQ3 A;  2Y4Q A;  2KYF A;  5CSI A;  1DF0 A;  2ZN9 A;  1F8H A;  1SR6 C;  3FWB A;  2PAL A;  1DT7 B;  1CKK A;  2OTG B;  1TRF A;  4U8D A;  3AAK A;  1DGV A;  1SL9 A;  2M29 A;  1U5I B;  2L4H A;  2F3Y A;  4ORA B;  1J7O A;  3DD4 A;  4I5N B;  2FJU B;  1Y1X A;  4GGN A;  1SNL A;  1MXL C;  1RRO A;  1YR5 A;  1G33 A;  1E8A A;  5HLO A;  3O6B A;  1M45 A;  4ETO A;  1CTR A;  3IF7 A;  2LP3 A;  5CSN A;  1IRJ A;  2M3W A;  1F4O A;  3NSI A;  1V1F A;  2K0J A;  4ZCU A;  1K95 A;  1QV0 A;  1TIZ A;  1UHJ A;  2K61 A;  1ALW A;  2SAS A;  1REC A;  2JUL A;  1Y0V H;  3D10 A;  4R1E A;  3TS5 C;  1DJX A;  1OMD A;  2KDH A;  3KO0 A;  4XJK A;  1YRT B;  1B47 A;  1BMO A;  1DGU A;  2CXJ A;  1A29 A;  1SR6 B;  4CID A;  1CDN A;  1JWD A;  2NCO A;  1QVI Y;  3CR2 A;  5I2O A;  2A4J A;  1SCM C;  1B8L A;  2LLU A;  2QAC A;  3WXA A;  3K21 A;  1FBV A;  1YX7 A;  5HKY A;  2GGM A;  4MEW A;  1OOJ A;  2KAY A;  1IJ6 A;  1R2U A;  2LV7 A;  3CWG A;  2B1U A;  2LVV A;  2KYC A;  2M9G A;  1KFX S;  4P5O E;  1S3P A;  4GNK B;  3A8R A;  3BOW A;  3F45 A;  2F33 A;  1WRZ A;  4PE0 A;  1NWD A;  3VRQ A;  2L98 A;  5HKZ A;  2AAO A;  1AP4 A;  2KBM A;  2JQ6 A;  1ODB A;  2LE9 B;  2LVJ A;  2CT9 A;  1YVL A;  4YGB B;  3NSK A;  4JQ0 D;  4N1F A;  1QX5 B;  1NUB A;  1SBJ A;  2F3Z A;  2LNK A;  1L2O C;  2EC6 C;  1C7V A;  1NX2 A;  4I5J A;  1DJY A;  1TNX A;  1EL4 A;  3TS5 B;  1ALV A;  1BU3 A;  4QJ3 B;  2ZN8 A;  1ZOT B;  1H4B A;  2LM5 A;  4PAL A;  4ICB A;  1DJI A;  2OS8 C;  5CSF A;  1M39 A;  2R2I A;  3TZ1 A;  2KGB C;  2I2R E;  1CMF A;  1GGW A;  2LVI A;  3DVK A;  1NP8 A;  1OZO A;  4PCW A;  1A4P A;  4OKH A;  3VRP A;  1B4C A;  1SCM B;  2JZI A;  3JVT C;  3TDZ A;  3LL8 B;  1AK8 A;  1HQV A;  2WCE A;  1DJW A;  1H8B A;  4HRE E;  1MR8 A;  1BG1 A;  1NX0 A;  1XK4 A;  2JXL A;  4XYN A;  3AKA A;  4PE7 A;  1A75 A;  1FPW A;  5JOL A;  2F2O A;  1SL7 A;  4AQJ A;  2KOT A;  1IQ3 A;  2L51 A;  2H61 C;  3TDU A;  4YGD B;  1KFX L;  1TOP A;  3I5H C;  2BKH B;  1BR4 B;  2LHL A;  2LLT A;  1OE9 B;  2JU0 A;  2L50 A;  1M31 A;  1S6I A;  1CDP A;  2NZ0 A;  1LIN A;  4MBE A;  3KEV A;  3RM1 A;  1EG3 A;  2BBM A;  1XA5 A;  4OVN F;  3KPX A;  1UWO A;  1CNP A;  1L2O B;  1ZAC A;  2EC6 B;  2ZNE A;  1IWQ A;  1ZMZ A;  1NX1 A;  2LAP A;  1TNP A;  2LHI A;  4WQ3 A;  2KFG A;  4DS7 A;  2EHB A;  1SMG A;  3VRO A;  2G2B A;  1GJY A;  3OX5 A;  3DVM A;  5I2Q A;  3TUY B;  2OS8 B;  4GAO A;  1XFW O;  1JUO A;  5G08 A;  4YBH B;  2HF5 A;  2AMI A;  2NLN A;  5DKN A;  3CS1 A;  1Y6W A;  4MN0 A;  2L4I A;  1LVC D;  3VGO A;  4ZCV A;  2KGR A;  4MZK A;  5CSJ A;  1DJZ A;  2EGD A;  3VRR A;  1KQM C;  2F8P A;  3JTD B;  4NQG A;  2GV5 A;  3EK7 A;  1IKU A;  4FTG A;  4M2O A;  2KI4 C;  2I18 A;  1QAT A;  2K2F A;  1SKT A;  1KK7 Z;  5AAN A;  1MF8 B;  3EKH A;  5KTY A;  2MA2 A;  1K9P A;  2I7A A;  2KSP A;  1UHN A;  2CCM A;  1NYA A;  4AQI A;  1QS7 A;  1M63 B;  4OV2 A;  2KI6 D;  1HT9 A;  1TCO B;  4IL1 A;  3CR5 X;  3RLZ A;  3TDI A;  1YVH A;  3BUO B;  2PAS A;  1LA3 A;  2HQW A;  2K2A A;  5AEQ A;  1SK6 D;  4MRY A;  5AFP A;  3LK0 A;  3FS7 A;  2PMY A;  3KF9 A;  4AOM A;  4CPV A;  1B7T Z;  1BT6 A;  4QJ4 B;  4TNC A;  1QXP A;  4I5K A;  2LP2 A;  1MUX A;  1QIW A;  1XO5 A;  1UHI A;  3PAT A;  1QX2 A;  4DUQ A;  4E68 A;  3BUN B;  2K7C A;  2BL0 C;  1L7Z A;  3A4U B;  1QV1 A;  5BPJ A;  3DVE A;  3I5G C;  1KQM B;  2K7D A;  1YUS A;  2M7N A;  1M46 A;  5J3X A;  3D0Y B;  1ZUZ A;  3SIA A;  1YUR A;  2Y1N A;  4HRH A;  1K94 A;  2KI4 B;  1NSH A;  3BYA A;  4NDD A;  1JFK A;  1DJG A;  3KHE A;  2KAX A;  2KQY A;  2MHH A;  2WCB A;  4MVF A;  2WCF A;  1UHH A;  4M2Q A;  4DRW A;  1RWY A;  1UUR A;  5AER A;  1CM4 A;  1W7I B;  1S36 A;  1CMG A;  1EXR A;  1BR1 B;  2JC2 A;  1RFJ A;  1PVB A;  2OPO A;  1SY9 A;  2LAN A;  1F70 A;  4YGA A;  1DTL A;  2BBN A;  4YGE B;  5DKQ A;  1BF5 A;  1SW8 A;  3DF0 B;  3DVJ A;  1IQ5 A;  1S26 D;  2JWW A;  1XFX O;  1TN4 A;  2DOQ A;  5PAL A;  3HX4 A;  3OP0 A;  1NPQ A;  2LMU A;  1U5I A;  1XVJ A;  1C07 A;  1JC2 A;  2ZKM X;  3VRN A;  4GUK A;  1AVS A;  2BL0 B;  4PHN A;  1IG5 A;  1AUI B;  1MXE A;  3OB1 B;  3IQO A;  3I5G B;  1MHO A;  3H4S E;  2L5X B;  3EK4 A;  1QLK A;  5KU1 A;  1SRA A;  3LK1 A;  2RGI A;  4YRU A;  2JNX A;  1GQM A;  2K7B A;  3MSE B;  3PSR A;  3IQQ A;  2JRF A;  2MAZ A;  3OX6 A;  4JPZ B;  4N1G A;  1WLM A;  4YI9 A;  1YUT A;  5F6T A;  5GQQ C;  2E6W A;  4C0K A;  1SYM A;  1D1O A;  1IH0 A;  1DF0 B;  4JWQ A;  2TN4 A;  4ORC B;  4GGF A;  4MLW A;  1KK8 C;  3SG6 A;  4C0L A;  1Y1A A;  1KK7 Y;  4GBA A;  4HSZ A;  2LVK A;  3GK1 A;  3PFV A;  3CZT X;  5DKR A;  1WRK A;  3PM8 A;  4PE4 A;  1XFZ O;  2LUX A;  4A4C A;  1QVI Z;  2O5G A;  1UHK A;  2WND A;  1K96 A;  1PVA A;  1XFU O;  4NDB A;  1YUU A;  2BCA A;  2PVB A;  3LCP C;  4M2P A;  3SG4 A;  1EG4 A;  1S1E A;  1K9U A;  3GK4 X;  1UP5 A;  1EJ3 A;  2M0R A;  1KCY A;  2PSR A;  2LMT A;  1WY9 A;  2NXQ A;  4UPG A;  1RTP 1;  2FCD A;  1B7T Y;  4BY5 A;  2LC5 A;  5I8N A;  1PUL A;  3EVR A;  2JPT A;  3FIA A;  1J7Q A;  2BE4 A;  3JVT B;  1W7J B;  1F4Q A;  2PRU A;  3O78 A;  2FCE A;  1CFF A;  4XJK B;  2ZRT A;  2KFF A;  2G9B A;  1C7W A;  2JT3 A;  1Y1U A;  2IS9 A;  1AHR A;  1B8C A;  1SPY A;  5B8I B;  1DVI A;  1N2D A;  3I5H B;  1N65 A;  1RK9 A;  3CTN A;  3NSO A;  1GGZ A;  1S5G Z;  2ZRS A;  3OB2 B;  4MZL A;  4OR9 B;  4GPL B;  3I5F C;  2BKI B;  4L9M A;  4OCI A;  1XK4 C;  2COL B;  4CFQ A;  1ZFS A;  2AUC A;  1BOD A;  1X02 A;  1RJV A;  1OQP A;  5FYX A;  2BEC A;  5JJG A;  2L2E A;  2JTT A;  3EVV A;  4CLN A;  1A03 A;  1K90 D;  2JT0 A;  1CB1 A;  3SG7 A;  3BOW B;  1QIV A;  3WHU B;  2FOT A;  1JBA A;  1NCX A;  3PN7 C;  1KSO A;  1XFV O;  2BCB A;  1SL8 A;  1B8R A;  5KSZ A;  1G8I A;  4CFR A;  2KNE A;  1PSB A;  1K93 D;  1YRU B;  1CFP A;  1TCF A;  3BUM B;  1F71 A;  1KQV A;  1DMO A;  1TNQ A;  2M1K B;  4PHM A;  1WRL A;  4QJ5 B;  3GOF A;  1JFJ A;  2F2P A;  2JNF A;  1KWO C;  2JT8 A;  1OSA A;  1OMR A;  2LCP A;  5ER5 A;  1XFY O;  1PRW A;  1J1E A;  4YGC B;  2NCP A;  1B1G A;  2MBX A;  2Q91 A;  4HRG A;  1MQ1 A;  1YTZ C;  3SJS A;  1JF0 A;  5D7F A;  4A4B A;  3I5F B;  1CFC A;  1PAL A;  5HKW A;  2O60 A;  2CNP A;  4WRI A;  1K9K A;  4USL A;  1A75 B;  5AXI A;  4WQ2 A;  1F54 A;  2LLS A;  1V1G A;  2M49 B;  4Q04 A;  2MJW B;  1CDM A;  4GFT A;  1FI5 A;  1B9A A;  2D8N A;  2WOS A;  3AAJ A;  2H2K A;  4BY4 A;  1BOC A;  1TNW A;  3PN7 B;  1LA0 A;  1JSA A;  2MRD A;  2CBL A;  3FWC A;  2KQ6 A;  3O2P A;  2H61 A;  1UUS A;  2M8U A;  3E3R A;  1BLQ A;  1QX7 A;  2BCX A;  2KBI A;  3OHM B;  1XYD A;  3EKJ A;  1EH2 A;  1KWO B;  2KI6 C;  4MSP A;  1JF2 A;  3LLE A;  1CFD A;  2JOJ A;  1QAS A;  3SIB A;  5D69 A;  5K89 A;  3O4Y A;  1WDC C;  1S6C A;  2WC8 A;  4P2Y B;  4PHK A;  2KHN A;  3CR4 X;  3ZWH A;  1J7R A;  2P6B B;  3AKB A;  1TTX A;  4C0J A;  1KFU S;  2Y1M A;  2GGZ A;  1G4Y R;  2WOR A;  3I5I C;  1QJT A;  3EVU A;  1J1D A;  1SCV A;  4PDZ A; 
#chains in the Genus database with same CATH topology
 3BUX B;  5CPV A;  5I2L A;  1IGV A;  1CDL A;  1OMV A;  1N0Y A;  2H8V A;  4NDC A;  1IJ5 A;  3HCM A;  4ORB B;  3SG5 A;  2QPT A;  2GTE A;  4D1E A;  1R6P A;  3FE9 A;  1K2H A;  2KAV A;  2I94 A;  4N5X A;  5HL1 A;  1AJ4 A;  3D77 A;  3TUY C;  1S5G Y;  2M97 A;  2V53 A;  3D0Y A;  3M0W A;  3NSL A;  3D76 A;  3QRX A;  3R1O A;  3PAL A;  4PE1 A;  1FF1 A;  1NCY A;  1QTX A;  2VRG A;  3DY9 A;  1MWN A;  1NX3 A;  1CLB A;  1F55 A;  1PSR A;  2K7O A;  2YGU A;  5FI7 A;  1NIW A;  5TNC A;  4FQT A;  4MRX A;  2L0P A;  1P28 A;  3CAB A;  5ER4 X;  3C1V A;  2HPS A;  4DCK A;  3CLN A;  3JTD C;  3PLF B;  2E30 A;  3WHT B;  1CLM A;  2MLE C;  4DIR A;  2ERB A;  4MZJ A;  2WCK A;  1A2X A;  4YI8 A;  3R1V A;  2Q4U A;  1CLL A;  1WDC B;  3BXK A;  2CTN A;  1Q80 A;  1WLZ A;  2OTG C;  2PQL A;  3EK8 A;  3R1P A;  3BUW B;  5HYD A;  1FI6 A;  5IBW A;  3L4L A;  2QEV A;  1LKJ A;  1YX8 A;  2HET A;  4I5L B;  2ISD A;  2ZFD A;  3DF0 A;  1Z4H A;  2Y5I A;  4PHJ A;  2M7L A;  1KFU L;  2BE6 A;  3I5I B;  1NCZ A;  3GK2 A;  1QWV A;  4F0Z B;  1OZS A;  1S6J A;  1KSM A;  2BNX A;  1BJF A;  2HQ8 A;  1J55 A;  5EL2 A;  2SCP A;  3DXL A;  1KK8 B;  4FQO A;  1PK0 D;  1AJ5 A;  2ZND A;  1LXF C;  3L47 A;  3S0D A;  2WCL A;  1VRK A;  2K8M B;  1FW4 A;  2M1U A;  3D75 A;  3ICB A;  2LMV A;  3SG3 A;  1K8U A;  2KFH A;  3SG2 A;  3CGA A;  1CM1 A;  2MLF C;  3ZNI A;  2JTZ A;  3WNX B;  2LUC A;  3NXA A;  4GGF C;  5HLV A;  3EG5 B;  1J7P A;  1DJH A;  1QLS A;  2JXC A;  3BQ3 A;  2Y4Q A;  2KYF A;  4KYN A;  5CSI A;  5D3O A;  1DF0 A;  2ZN9 A;  1F8H A;  1SR6 C;  3FWB A;  2PAL A;  1DT7 B;  1CKK A;  2OTG B;  1TRF A;  4U8D A;  3AAK A;  1DGV A;  1SL9 A;  2M29 A;  1U5I B;  2L4H A;  2F3Y A;  4ORA B;  1J7O A;  3DD4 A;  4I5N B;  2FJU B;  1Y1X A;  1OOF A;  3D74 A;  4GGN A;  1SNL A;  1MXL C;  1RRO A;  1YR5 A;  1G33 A;  3QME A;  1E8A A;  5HLO A;  3O6B A;  1M45 A;  4ETO A;  1CTR A;  3IF7 A;  3B7A A;  2LP3 A;  5CSN A;  1IRJ A;  2M3W A;  1F4O A;  3NSI A;  1V1F A;  2K0J A;  4ZCU A;  1K95 A;  1QV0 A;  1TIZ A;  1UHJ A;  2K61 A;  1ALW A;  3PM2 A;  2SAS A;  4PT1 A;  1REC A;  2JUL A;  1Y0V H;  2WCM A;  3D10 A;  3N7H A;  3UNW A;  4R1E A;  2WCJ A;  3TS5 C;  3IVT A;  1DJX A;  1OMD A;  2KDH A;  3KO0 A;  4XJK A;  1YRT B;  1B47 A;  1BMO A;  1DGU A;  2CXJ A;  1A29 A;  1SR6 B;  4CID A;  1CDN A;  1JWD A;  2NCO A;  1QVI Y;  3CR2 A;  5I2O A;  2A4J A;  1SCM C;  1B8L A;  5FI6 A;  3NHI A;  2LLU A;  2QAC A;  3WXA A;  3K21 A;  1FBV A;  1YX7 A;  5HKY A;  2GGM A;  4MEW A;  1OOJ A;  2KAY A;  1IJ6 A;  1R2U A;  2LV7 A;  3CWG A;  2B1U A;  2LVV A;  2KYC A;  2M9G A;  1KFX S;  4P5O E;  1S3P A;  4GNK B;  3A8R A;  3BOW A;  3F45 A;  2F33 A;  1WRZ A;  4PE0 A;  1NWD A;  3VRQ A;  2L98 A;  5HKZ A;  2AAO A;  1AP4 A;  2KBM A;  2JQ6 A;  1ODB A;  2LE9 B;  2LVJ A;  2CT9 A;  1YVL A;  4YGB B;  3NSK A;  4JQ0 D;  4N1F A;  1QX5 B;  1NUB A;  1SBJ A;  2F3Z A;  2LNK A;  3SS5 A;  1L2O C;  2EC6 C;  1C7V A;  1NX2 A;  4I5J A;  3CZ2 A;  1DJY A;  1TNX A;  1EL4 A;  3TS5 B;  1ALV A;  1BU3 A;  4QJ3 B;  2ZN8 A;  1IIO A;  1ZOT B;  1H4B A;  2LM5 A;  4PAL A;  4ICB A;  3V2L A;  1DJI A;  2OS8 C;  3B6X A;  5CSF A;  1M39 A;  2R2I A;  3TZ1 A;  4OZD A;  2KGB C;  2I2R E;  3FE8 A;  1CMF A;  1GGW A;  2LVI A;  3DVK A;  1NP8 A;  1OZO A;  4PCW A;  1A4P A;  4OKH A;  3O4X A;  3VRP A;  1SCM B;  2JZI A;  2WCH A;  3JVT C;  3TDZ A;  3LL8 B;  1AK8 A;  1HQV A;  2WCE A;  1DJW A;  1H8B A;  4HRE E;  1MR8 A;  1BG1 A;  1NX0 A;  1XK4 A;  2JXL A;  4XYN A;  3AKA A;  3L4A A;  1A75 A;  4PE7 A;  5JOL A;  1FPW A;  2WC5 A;  2F2O A;  3NGV A;  1SL7 A;  4AQJ A;  2KOT A;  1IQ3 A;  2L51 A;  2H61 C;  3TDU A;  4YGD B;  1KFX L;  3B88 A;  1TOP A;  3I5H C;  2BKH B;  1TWO A;  1BR4 B;  2LHL A;  2LLT A;  1OE9 B;  2JU0 A;  2L50 A;  1M31 A;  1S6I A;  1CDP A;  2NZ0 A;  1LIN A;  4MBE A;  3KEV A;  3RM1 A;  1EG3 A;  2BBM A;  1XA5 A;  4OVN F;  3KPX A;  1UWO A;  1CNP A;  1L2O B;  1ZAC A;  2EC6 B;  2ZNE A;  1IWQ A;  1ZMZ A;  1NX1 A;  2LAP A;  1TNP A;  2LHI A;  2PYQ A;  4WQ3 A;  2KFG A;  4DS7 A;  2EHB A;  1SMG A;  3VRO A;  2G2B A;  1GJY A;  3OX5 A;  2QEH A;  3DVM A;  5I2Q A;  3TUY B;  2OS8 B;  4GAO A;  1XFW O;  3CYZ A;  1JUO A;  5G08 A;  4YBH B;  2HF5 A;  3B87 A;  2KPH A;  2AMI A;  2NLN A;  5DKN A;  3CDN A;  1Y6W A;  3CS1 A;  4MN0 A;  5I94 A;  2L4I A;  1LVC D;  3K1E A;  3VGO A;  4ZCV A;  2KGR A;  4MZK A;  5CSJ A;  1DJZ A;  2EGD A;  3VRR A;  1KQM C;  2F8P A;  3JTD B;  4NQG A;  2GV5 A;  3EK7 A;  1IKU A;  1TUZ A;  4FTG A;  4M2O A;  2KI4 C;  2P70 A;  4IJ7 A;  2I18 A;  1QAT A;  2K2F A;  1SKT A;  1KK7 Z;  5AAN A;  1OOI X;  1MF8 B;  3EKH A;  5KTY A;  4INX A;  2MA2 A;  1K9P A;  2I7A A;  1OOH A;  1UHN A;  2KSP A;  2CCM A;  1NYA A;  4AQI A;  1QS7 A;  1M63 B;  4OV2 A;  2KI6 D;  1HT9 A;  1TCO B;  2L5Y A;  3CR5 X;  4IL1 A;  3RLZ A;  1YVH A;  3TDI A;  3BUO B;  2PAS A;  1LA3 A;  2HQW A;  4JKT A;  2K2A A;  5AEQ A;  1SK6 D;  3SS3 A;  4MRY A;  5AFP A;  3LK0 A;  3FS7 A;  2PMY A;  2QDI A;  3KF9 A;  4AOM A;  5DIC A;  4CPV A;  1B7T Z;  1BT6 A;  4QJ4 B;  4TNC A;  1QXP A;  4I5K A;  2LP2 A;  1XO5 A;  1MUX A;  1QIW A;  1LS8 A;  1UHI A;  3PAT A;  1QX2 A;  4DUQ A;  4E68 A;  1T14 A;  3BUN B;  2K7C A;  2BL0 C;  1L7Z A;  3A4U B;  1QV1 A;  5BPJ A;  3DVE A;  4F7F A;  3I5G C;  1KQM B;  2K7D A;  1YUS A;  2M7N A;  1M46 A;  5J3X A;  3D0Y B;  1ZUZ A;  3SIA A;  1YUR A;  2Y1N A;  4HRH A;  1K94 A;  2KI4 B;  1NSH A;  3BYA A;  1OW4 A;  1DEK A;  4INW A;  4NDD A;  1JFK A;  1DJG A;  3KHE A;  2KAX A;  5FI2 A;  2KQY A;  2MHH A;  2WCB A;  4MVF A;  3S0G A;  2WCF A;  1UHH A;  4M2Q A;  4DRW A;  1RWY A;  1UUR A;  3OGN A;  5AER A;  1CM4 A;  1W7I B;  1S36 A;  1CMG A;  1EXR A;  1BR1 B;  3PJI A;  2JC2 A;  1RFJ A;  1PVB A;  2OPO A;  1SY9 A;  2LAN A;  1DQE A;  1F70 A;  4YGA A;  1DTL A;  2BBN A;  4YGE B;  5DKQ A;  3S0B A;  1SW8 A;  3DF0 B;  3DVJ A;  1BF5 A;  3D73 A;  3DZT A;  1IQ5 A;  1S26 D;  2JWW A;  1XFX O;  1TN4 A;  2DOQ A;  5PAL A;  3HX4 A;  3CZ0 A;  3OP0 A;  1NPQ A;  2LMU A;  1U5I A;  1XVJ A;  1C07 A;  1JC2 A;  2ZKM X;  3VRN A;  4GUK A;  1AVS A;  2BL0 B;  4PHN A;  1IG5 A;  1AUI B;  1MXE A;  3OB1 B;  3IQO A;  3I5G B;  1MHO A;  3H4S E;  2L5X B;  3EK4 A;  1QLK A;  5KU1 A;  3VB1 A;  1SRA A;  3LK1 A;  2RGI A;  4YRU A;  2JNX A;  1GQM A;  2K7B A;  3MSE B;  3PSR A;  3IQQ A;  2JRF A;  2MAZ A;  3OX6 A;  4JPZ B;  3DYE A;  4N1G A;  1WLM A;  4YI9 A;  1YUT A;  5F6T A;  5GQQ C;  2E6W A;  4C0K A;  1SYM A;  1D1O A;  1IH0 A;  1DF0 B;  4JWQ A;  2TN4 A;  4ORC B;  4GGF A;  4MLW A;  1KK8 C;  3SG6 A;  2QEO A;  2QEB A;  4C0L A;  1Y1A A;  1KK7 Y;  4GBA A;  4HSZ A;  2LVK A;  3GK1 A;  3PFV A;  3CZT X;  5DKR A;  3D78 A;  1WRK A;  3PM8 A;  4PE4 A;  1XFZ O;  2LUX A;  4A4C A;  1QVI Z;  2O5G A;  1UHK A;  2WND A;  1W9Z A;  1K96 A;  1PVA A;  1XFU O;  4NDB A;  1YUU A;  1C3Z A;  2BCA A;  2PVB A;  3LCP C;  4M2P A;  3SG4 A;  1EG4 A;  1S1E A;  1K9U A;  1ORG A;  3GK4 X;  1UP5 A;  1EJ3 A;  2M0R A;  2WC6 A;  1KCY A;  3BFA A;  2PSR A;  2LMT A;  1WY9 A;  2NXQ A;  4UPG A;  1RTP 1;  2FCD A;  1B7T Y;  4BY5 A;  2LC5 A;  5I8N A;  3SS4 A;  1PUL A;  3EVR A;  2JPT A;  3FIA A;  1J7Q A;  2BE4 A;  3JVT B;  1OOG A;  1W7J B;  1F4Q A;  2PRU A;  3O78 A;  2FCE A;  1CFF A;  3BFB A;  4XJK B;  2ZRT A;  2KFF A;  2G9B A;  3FE6 A;  1C7W A;  2JT3 A;  3UO9 A;  1Y1U A;  1Z2C B;  3S0E A;  2IS9 A;  3BJH A;  1AHR A;  1B8C A;  2L2C A;  1SPY A;  5B8I B;  1DVI A;  1N2D A;  3I5H B;  1N65 A;  1RK9 A;  3CTN A;  3NSO A;  1GGZ A;  1S5G Z;  2ZRS A;  3OB2 B;  4MZL A;  4OR9 B;  4GPL B;  3I5F C;  2BKI B;  4L9M A;  4OCI A;  1XK4 C;  2COL B;  4CFQ A;  1ZFS A;  2AUC A;  3CZ1 A;  1BOD A;  1X02 A;  1RJV A;  1OQP A;  5FYX A;  2BEC A;  5JJG A;  1GM0 A;  2L2E A;  2JTT A;  3EVV A;  4CLN A;  1A03 A;  1K90 D;  2JT0 A;  1CB1 A;  3SG7 A;  3BOW B;  1QIV A;  3WHU B;  2FOT A;  1JBA A;  1NCX A;  3PN7 C;  1KSO A;  1XFV O;  2BCB A;  1SL8 A;  1B8R A;  5KSZ A;  1G8I A;  4CFR A;  3RZS A;  2KNE A;  1PSB A;  1K93 D;  1YRU B;  1CFP A;  1TCF A;  2KLD A;  3BUM B;  1F71 A;  1DMO A;  1KQV A;  1TNQ A;  2M1K B;  4PHM A;  1WRL A;  4QJ5 B;  3GOF A;  1TUJ A;  1JFJ A;  2F2P A;  2JNF A;  1KWO C;  2JT8 A;  1OSA A;  1OMR A;  2KLE A;  2LCP A;  4JD9 A;  5ER5 A;  1XFY O;  3R72 A;  1PRW A;  1J1E A;  4YGC B;  2NCP A;  1DC1 A;  1B1G A;  2MBX A;  1B4C A;  2Q91 A;  4HRG A;  1MQ1 A;  1YTZ C;  3SJS A;  1JF0 A;  5D7F A;  4A4B A;  3I5F B;  1CFC A;  3Q8I A;  1PAL A;  5HKW A;  2O60 A;  2CNP A;  4WRI A;  1K9K A;  4USL A;  3S0A A;  1A75 B;  5AXI A;  4WQ2 A;  1F54 A;  3NHT A;  2LLS A;  1V1G A;  2M49 B;  3B86 A;  4Q04 A;  2MJW B;  1CDM A;  4GFT A;  1FI5 A;  1B9A A;  2D8N A;  1XFR A;  2WOS A;  3AAJ A;  2H2K A;  1DEL A;  4BY4 A;  1TNW A;  3PN7 B;  1BOC A;  1LA0 A;  1JSA A;  2MRD A;  2FJY A;  2BAP A;  2CBL A;  3FWC A;  2KQ6 A;  3O2P A;  2H61 A;  1UUS A;  2M8U A;  3E3R A;  1BLQ A;  1QX7 A;  2BCX A;  2KBI A;  3OHM B;  1XYD A;  3EKJ A;  1EH2 A;  1KWO B;  2KI6 C;  1C3Y A;  4MSP A;  1JF2 A;  3LLE A;  3S0F A;  1CFD A;  1SSE B;  2JOJ A;  2JPO A;  1QAS A;  3SIB A;  5D69 A;  5K89 A;  2P71 A;  3O4Y A;  1WDC C;  1S6C A;  2WC8 A;  4P2Y B;  4PHK A;  2KHN A;  3OBV A;  3CR4 X;  3ZWH A;  1J7R A;  2P6B B;  3AKB A;  1TTX A;  3BFH A;  4C0J A;  1KFU S;  2K60 A;  2Y1M A;  2GGZ A;  1G4Y R;  2WOR A;  3I5I C;  1QJT A;  3EVU A;  1J1D A;  1SCV A;  4PDZ A; 
#chains in the Genus database with same CATH homology
 3BUX B;  5CPV A;  5I2L A;  1IGV A;  1CDL A;  1OMV A;  1N0Y A;  4NDC A;  1IJ5 A;  3HCM A;  4ORB B;  3SG5 A;  2QPT A;  4D1E A;  1R6P A;  1K2H A;  2KAV A;  2I94 A;  4N5X A;  1AJ4 A;  3TUY C;  1S5G Y;  2M97 A;  2V53 A;  3D0Y A;  3M0W A;  3NSL A;  4PE1 A;  3QRX A;  1FF1 A;  3PAL A;  1NCY A;  1QTX A;  2VRG A;  1CLB A;  1MWN A;  1NX3 A;  1F55 A;  1PSR A;  2K7O A;  1NIW A;  5TNC A;  4MRX A;  2L0P A;  5ER4 X;  3C1V A;  2HPS A;  4DCK A;  3CLN A;  3JTD C;  3PLF B;  2E30 A;  3WHT B;  1CLM A;  2MLE C;  4DIR A;  4MZJ A;  1A2X A;  4YI8 A;  2Q4U A;  1CLL A;  1WDC B;  3BXK A;  2CTN A;  1Q80 A;  1WLZ A;  2OTG C;  3EK8 A;  5HYD A;  1FI6 A;  3BUW B;  5IBW A;  1LKJ A;  1YX8 A;  2HET A;  4I5L B;  2ISD A;  2ZFD A;  3DF0 A;  4PHJ A;  2Y5I A;  2M7L A;  1KFU L;  2BE6 A;  3I5I B;  1NCZ A;  3GK2 A;  4F0Z B;  1OZS A;  1S6J A;  1KSM A;  1BJF A;  2HQ8 A;  1J55 A;  2SCP A;  1KK8 B;  4FQO A;  1PK0 D;  1AJ5 A;  2ZND A;  1LXF C;  1VRK A;  2K8M B;  1FW4 A;  2M1U A;  3ICB A;  2LMV A;  3SG3 A;  1K8U A;  2KFH A;  3SG2 A;  3CGA A;  1CM1 A;  2MLF C;  3ZNI A;  2JTZ A;  3WNX B;  2LUC A;  3NXA A;  4GGF C;  5HLV A;  1J7P A;  1DJH A;  1QLS A;  2JXC A;  3BQ3 A;  2Y4Q A;  2KYF A;  5CSI A;  1DF0 A;  2ZN9 A;  1F8H A;  1SR6 C;  3FWB A;  2PAL A;  1DT7 B;  1CKK A;  2OTG B;  1TRF A;  4U8D A;  3AAK A;  1DGV A;  1SL9 A;  2M29 A;  1U5I B;  2L4H A;  2F3Y A;  4ORA B;  1J7O A;  3DD4 A;  4I5N B;  2FJU B;  1Y1X A;  4GGN A;  1SNL A;  1MXL C;  1RRO A;  1YR5 A;  1G33 A;  1E8A A;  5HLO A;  3O6B A;  1M45 A;  4ETO A;  1CTR A;  3IF7 A;  2LP3 A;  5CSN A;  1IRJ A;  2M3W A;  1F4O A;  3NSI A;  1V1F A;  2K0J A;  4ZCU A;  1K95 A;  1QV0 A;  1TIZ A;  1UHJ A;  2K61 A;  1ALW A;  2SAS A;  1REC A;  2JUL A;  1Y0V H;  3D10 A;  4R1E A;  3TS5 C;  1DJX A;  1OMD A;  2KDH A;  3KO0 A;  4XJK A;  1YRT B;  1B47 A;  1BMO A;  1DGU A;  2CXJ A;  1A29 A;  1SR6 B;  4CID A;  1CDN A;  1JWD A;  2NCO A;  1QVI Y;  3CR2 A;  5I2O A;  2A4J A;  1SCM C;  1B8L A;  2LLU A;  2QAC A;  3WXA A;  3K21 A;  1FBV A;  1YX7 A;  5HKY A;  2GGM A;  4MEW A;  1OOJ A;  2KAY A;  1IJ6 A;  1R2U A;  2LV7 A;  3CWG A;  2B1U A;  2LVV A;  2KYC A;  2M9G A;  1KFX S;  4P5O E;  1S3P A;  4GNK B;  3A8R A;  3BOW A;  3F45 A;  2F33 A;  1WRZ A;  4PE0 A;  1NWD A;  3VRQ A;  2L98 A;  5HKZ A;  2AAO A;  1AP4 A;  2KBM A;  2JQ6 A;  1ODB A;  2LE9 B;  2LVJ A;  2CT9 A;  1YVL A;  4YGB B;  3NSK A;  4JQ0 D;  4N1F A;  1QX5 B;  1NUB A;  1SBJ A;  2F3Z A;  2LNK A;  1L2O C;  2EC6 C;  1C7V A;  1NX2 A;  4I5J A;  1DJY A;  1TNX A;  1EL4 A;  3TS5 B;  1ALV A;  1BU3 A;  4QJ3 B;  2ZN8 A;  1ZOT B;  1H4B A;  2LM5 A;  4PAL A;  4ICB A;  1DJI A;  2OS8 C;  5CSF A;  1M39 A;  2R2I A;  3TZ1 A;  2KGB C;  2I2R E;  1CMF A;  1GGW A;  2LVI A;  3DVK A;  1NP8 A;  1OZO A;  4PCW A;  1A4P A;  4OKH A;  3VRP A;  1B4C A;  1SCM B;  2JZI A;  3JVT C;  3TDZ A;  3LL8 B;  1AK8 A;  1HQV A;  2WCE A;  1DJW A;  1H8B A;  4HRE E;  1MR8 A;  1BG1 A;  1NX0 A;  1XK4 A;  2JXL A;  4XYN A;  3AKA A;  4PE7 A;  1A75 A;  1FPW A;  5JOL A;  2F2O A;  1SL7 A;  4AQJ A;  2KOT A;  1IQ3 A;  2L51 A;  2H61 C;  3TDU A;  4YGD B;  1KFX L;  1TOP A;  3I5H C;  2BKH B;  1BR4 B;  2LHL A;  2LLT A;  1OE9 B;  2JU0 A;  2L50 A;  1M31 A;  1S6I A;  1CDP A;  2NZ0 A;  1LIN A;  4MBE A;  3KEV A;  3RM1 A;  1EG3 A;  2BBM A;  1XA5 A;  4OVN F;  3KPX A;  1UWO A;  1CNP A;  1L2O B;  1ZAC A;  2EC6 B;  2ZNE A;  1IWQ A;  1ZMZ A;  1NX1 A;  2LAP A;  1TNP A;  2LHI A;  4WQ3 A;  2KFG A;  4DS7 A;  2EHB A;  1SMG A;  3VRO A;  2G2B A;  1GJY A;  3OX5 A;  3DVM A;  5I2Q A;  3TUY B;  2OS8 B;  4GAO A;  1XFW O;  1JUO A;  5G08 A;  4YBH B;  2HF5 A;  2AMI A;  2NLN A;  5DKN A;  3CS1 A;  1Y6W A;  4MN0 A;  2L4I A;  1LVC D;  3VGO A;  4ZCV A;  2KGR A;  4MZK A;  5CSJ A;  1DJZ A;  2EGD A;  3VRR A;  1KQM C;  2F8P A;  3JTD B;  4NQG A;  2GV5 A;  3EK7 A;  1IKU A;  4FTG A;  4M2O A;  2KI4 C;  2I18 A;  1QAT A;  2K2F A;  1SKT A;  1KK7 Z;  5AAN A;  1MF8 B;  3EKH A;  5KTY A;  2MA2 A;  1K9P A;  2I7A A;  2KSP A;  1UHN A;  2CCM A;  1NYA A;  4AQI A;  1QS7 A;  1M63 B;  4OV2 A;  2KI6 D;  1HT9 A;  1TCO B;  4IL1 A;  3CR5 X;  3RLZ A;  3TDI A;  1YVH A;  3BUO B;  2PAS A;  1LA3 A;  2HQW A;  2K2A A;  5AEQ A;  1SK6 D;  4MRY A;  5AFP A;  3LK0 A;  3FS7 A;  2PMY A;  3KF9 A;  4AOM A;  4CPV A;  1B7T Z;  1BT6 A;  4QJ4 B;  4TNC A;  1QXP A;  4I5K A;  2LP2 A;  1MUX A;  1QIW A;  1XO5 A;  1UHI A;  3PAT A;  1QX2 A;  4DUQ A;  4E68 A;  3BUN B;  2K7C A;  2BL0 C;  1L7Z A;  3A4U B;  1QV1 A;  5BPJ A;  3DVE A;  3I5G C;  1KQM B;  2K7D A;  1YUS A;  2M7N A;  1M46 A;  5J3X A;  3D0Y B;  1ZUZ A;  3SIA A;  1YUR A;  2Y1N A;  4HRH A;  1K94 A;  2KI4 B;  1NSH A;  3BYA A;  4NDD A;  1JFK A;  1DJG A;  3KHE A;  2KAX A;  2KQY A;  2MHH A;  2WCB A;  4MVF A;  2WCF A;  1UHH A;  4M2Q A;  4DRW A;  1RWY A;  1UUR A;  5AER A;  1CM4 A;  1W7I B;  1S36 A;  1CMG A;  1EXR A;  1BR1 B;  2JC2 A;  1RFJ A;  1PVB A;  2OPO A;  1SY9 A;  2LAN A;  1F70 A;  4YGA A;  1DTL A;  2BBN A;  4YGE B;  5DKQ A;  1BF5 A;  1SW8 A;  3DF0 B;  3DVJ A;  1IQ5 A;  1S26 D;  2JWW A;  1XFX O;  1TN4 A;  2DOQ A;  5PAL A;  3HX4 A;  3OP0 A;  1NPQ A;  2LMU A;  1U5I A;  1XVJ A;  1C07 A;  1JC2 A;  2ZKM X;  3VRN A;  4GUK A;  1AVS A;  2BL0 B;  4PHN A;  1IG5 A;  1AUI B;  1MXE A;  3OB1 B;  3IQO A;  3I5G B;  1MHO A;  3H4S E;  2L5X B;  3EK4 A;  1QLK A;  5KU1 A;  1SRA A;  3LK1 A;  2RGI A;  4YRU A;  2JNX A;  1GQM A;  2K7B A;  3MSE B;  3PSR A;  3IQQ A;  2JRF A;  2MAZ A;  3OX6 A;  4JPZ B;  4N1G A;  1WLM A;  4YI9 A;  1YUT A;  5F6T A;  5GQQ C;  2E6W A;  4C0K A;  1SYM A;  1D1O A;  1IH0 A;  1DF0 B;  4JWQ A;  2TN4 A;  4ORC B;  4GGF A;  4MLW A;  1KK8 C;  3SG6 A;  4C0L A;  1Y1A A;  1KK7 Y;  4GBA A;  4HSZ A;  2LVK A;  3GK1 A;  3PFV A;  3CZT X;  5DKR A;  1WRK A;  3PM8 A;  4PE4 A;  1XFZ O;  2LUX A;  4A4C A;  1QVI Z;  2O5G A;  1UHK A;  2WND A;  1K96 A;  1PVA A;  1XFU O;  4NDB A;  1YUU A;  2BCA A;  2PVB A;  3LCP C;  4M2P A;  3SG4 A;  1EG4 A;  1S1E A;  1K9U A;  3GK4 X;  1UP5 A;  1EJ3 A;  2M0R A;  1KCY A;  2PSR A;  2LMT A;  1WY9 A;  2NXQ A;  4UPG A;  1RTP 1;  2FCD A;  1B7T Y;  4BY5 A;  2LC5 A;  5I8N A;  1PUL A;  3EVR A;  2JPT A;  3FIA A;  1J7Q A;  2BE4 A;  3JVT B;  1W7J B;  1F4Q A;  2PRU A;  3O78 A;  2FCE A;  1CFF A;  4XJK B;  2ZRT A;  2KFF A;  2G9B A;  1C7W A;  2JT3 A;  1Y1U A;  2IS9 A;  1AHR A;  1B8C A;  1SPY A;  5B8I B;  1DVI A;  1N2D A;  3I5H B;  1N65 A;  1RK9 A;  3CTN A;  3NSO A;  1GGZ A;  1S5G Z;  2ZRS A;  3OB2 B;  4MZL A;  4OR9 B;  4GPL B;  3I5F C;  2BKI B;  4L9M A;  4OCI A;  1XK4 C;  2COL B;  4CFQ A;  1ZFS A;  2AUC A;  1BOD A;  1X02 A;  1RJV A;  1OQP A;  5FYX A;  2BEC A;  5JJG A;  2L2E A;  2JTT A;  3EVV A;  4CLN A;  1A03 A;  1K90 D;  2JT0 A;  1CB1 A;  3SG7 A;  3BOW B;  1QIV A;  3WHU B;  2FOT A;  1JBA A;  1NCX A;  3PN7 C;  1KSO A;  1XFV O;  2BCB A;  1SL8 A;  1B8R A;  5KSZ A;  1G8I A;  4CFR A;  2KNE A;  1PSB A;  1K93 D;  1YRU B;  1CFP A;  1TCF A;  3BUM B;  1F71 A;  1KQV A;  1DMO A;  1TNQ A;  2M1K B;  4PHM A;  1WRL A;  4QJ5 B;  3GOF A;  1JFJ A;  2F2P A;  2JNF A;  1KWO C;  2JT8 A;  1OSA A;  1OMR A;  2LCP A;  5ER5 A;  1XFY O;  1PRW A;  1J1E A;  4YGC B;  2NCP A;  1B1G A;  2MBX A;  2Q91 A;  4HRG A;  1MQ1 A;  1YTZ C;  3SJS A;  1JF0 A;  5D7F A;  4A4B A;  3I5F B;  1CFC A;  1PAL A;  5HKW A;  2O60 A;  2CNP A;  4WRI A;  1K9K A;  4USL A;  1A75 B;  5AXI A;  4WQ2 A;  1F54 A;  2LLS A;  1V1G A;  2M49 B;  4Q04 A;  2MJW B;  1CDM A;  4GFT A;  1FI5 A;  1B9A A;  2D8N A;  2WOS A;  3AAJ A;  2H2K A;  4BY4 A;  1BOC A;  1TNW A;  3PN7 B;  1LA0 A;  1JSA A;  2MRD A;  2CBL A;  3FWC A;  2KQ6 A;  3O2P A;  2H61 A;  1UUS A;  2M8U A;  3E3R A;  1BLQ A;  1QX7 A;  2BCX A;  2KBI A;  3OHM B;  1XYD A;  3EKJ A;  1EH2 A;  1KWO B;  2KI6 C;  4MSP A;  1JF2 A;  3LLE A;  1CFD A;  2JOJ A;  1QAS A;  3SIB A;  5D69 A;  5K89 A;  3O4Y A;  1WDC C;  1S6C A;  2WC8 A;  4P2Y B;  4PHK A;  2KHN A;  3CR4 X;  3ZWH A;  1J7R A;  2P6B B;  3AKB A;  1TTX A;  4C0J A;  1KFU S;  2Y1M A;  2GGZ A;  1G4Y R;  2WOR A;  3I5I C;  1QJT A;  3EVU A;  1J1D A;  1SCV A;  4PDZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...