1CB1A

Three-dimensional solution structure of ca2+-loaded porcine calbindin d9k determined by nuclear magnetic resonance spectroscopy
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
78
structure length
78
Chain Sequence
SAQKSPAELKSIFEKYAAKEGDPNQLSKEELKQLIQAEFPSLLKGPRTLDDLFQELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALBINDIN D9K
publication title Three-dimensional solution structure of Ca(2+)-loaded porcine calbindin D9k determined by nuclear magnetic resonance spectroscopy.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Calcium-binding protein
total genus 24
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 1991-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1cb1A00
1R2UA 2LANA 3CR4X 3RLZA 2KBMA 3A8RA 1YUUA 2WORA 1XFYO 3PM8A 1TRFA 3EVRA 4MSPA 3D0YA 3WNXB 1BF5A 1YRUB 1SCMC 1GQMA 1WY9A 1CFCA 2SCPA 1SCMB 2KI4C 1DJHA 2KI4B 3DVMA 1KFXL 1X02A 1XA5A 1G33A 1QLKA 2WCEA 4OVNF 3NSIA 3LL8B 4MRXA 1PK0D 1FW4A 1V1GA 4YGEB 1CFPA 5DKQA 1F54A 3GK2A 4NQGA 1NX2A 1JFKA 3BUMB 2BE6A 4I5LB 2K61A 5KTYA 4N1GA 3BXKA 2Y1NA 3GOFA 3OX6A 1M46A 2H61C 2O60A 3VRPA 5AANA 1TIZA 2L98A 1KWOC 2G9BA 4FTGA 3SG4A 1KWOB 2L4IA 1N2DA 1GGWA 3I5FC 2AAOA 2I7AA 1MF8B 2JT0A 1YVLA 1HQVA 1BT6A 1TNQA 3I5FB 1F4QA 3BUNB 3O6BA 1XFVO 5HYDA 2BECA 3CR5X 1NPQA 3SIBA 3H4SE 1L2OC 1XFUO 1Q80A 1YUTA 1K93D 2PMYA 1IWQA 4HRGA 2LMVA 3GK4X 2E30A 1DJGA 3RM1A 1A75A 1E8AA 2WNDA 5IBWA 2HETA 1MHOA 4UPGA 3TDIA 1XO5A 2LAPA 4MBEA 3CLNA 1BU3A 1TN4A 2BE4A 4YGAA 1PULA 1PALA 2HQ8A 2KQYA 1MXEA 4M2OA 4YI9A 2M1KB 1OZOA 3CWGA 3PFVA 4NDCA 2COLB 2HF5A 4QJ3B 1ALWA 1PRWA 3JTDC 3FS7A 3OX5A 2B1UA 4WQ2A 4CFRA 4DCKA 3JTDB 3BYAA 4D1EA 2PRUA 5KSZA 2BL0C 1JWDA 1DT7B 2BL0B 1LXFC 3SIAA 2MRDA 1QIWA 1LA0A 4PHJA 2TN4A 2VRGA 1LA3A 2L2EA 2MA2A 1NX0A 1YUSA 2KFGA 1G8IA 3CTNA 5CSFA 1GJYA 2WC8A 2ZRSA 4GNKB 4JPZB 5DKRA 5HLOA 2MBXA 3AAJA 5HKWA 1C7WA 1PVBA 4C0JA 5AEQA 1S26D 1RK9A 1F8HA 4F0ZB 1J1EA 1NX3A 1BODA 4C0LA 3HCMA 1EXRA 2CBLA 2K7DA 1KK8C 2WCFA 1J7PA 1JSAA 3BUWB 1F4OA 1QVIY 3FWCA 2JU0A 1BR1B 1QTXA 2KOTA 2M3WA 2SASA 3I5GC 3BQ3A 1HT9A 5I2OA 1NSHA 3I5GB 1NIWA 5J3XA 1W7JB 1PSRA 5JOLA 1KK7Y 1M63B 5AERA 1EG3A 2FCEA 5JJGA 2BKIB 2LUXA 3SG3A 4NDBA 4ZCUA 2JT3A 1S5GY 1S6CA 1A4PA 1U5IB 1BG1A 3WXAA 1CM1A 1OQPA 1YX7A 1K9KA 1ODBA 2KFHA 3PATA 2KFFA 2ZN8A 1DF0B 4MZLA 1SCVA 1UWOA 2MLFC 1B4CA 4GBAA 1WDCC 1MQ1A 1WDCB 2G2BA 2LLSA 2EGDA 1CTRA 2F3ZA 2QPTA 1RWYA 2JZIA 2KI6C 1S3PA 5CSNA 2F8PA 2KYCA 2RGIA 1KCYA 5ER5A 2EC6C 2AMIA 1IJ5A 1EJ3A 1TOPA 1Y1AA 2EC6B 1XVJA 1J7QA 1YR5A 1J7OA 3DD4A 3MSEB 1BLQA 2PALA 1NUBA 1Y1UA 4I5JA 1DVIA 2FJUB 2ISDA 3CR2A 3I5HC 3BUXB 4N5XA 1UHHA 2KGRA 1YURA 3I5HB 3O78A 1S6IA 3O2PA 4XYNA 4N1FA 2LC5A 1V1FA 2FCDA 2IS9A 3WHTB 1B8LA 1NCYA 3SG7A 4DRWA 4YGBB 4GFTA 4GGFA 3AKAA 1SRAA 4CLNA 1IQ5A 3ZWHA 1UHJA 1ZFSA 1AJ4A 1K8UA 1SW8A 1RROA 1W7IB 1GGZA 2LHIA 1OSAA 3KHEA 3LLEA 1SPYA 2M97A 4XJKA 1KQVA 2O5GA 1FBVA 1XFWO 2GGZA 5AFPA 2ZNEA 1QV0A 2ZNDA 3CZTX 4JQ0D 2ZN9A 2M0RA 4GUKA 3LK0A 2A4JA 1SL9A 2JPTA 4QJ4B 1CMFA 3DVEA 1QIVA 2BCBA 2WOSA 1D1OA 3VRNA 5PALA 1XK4C 1BMOA 3D10A 2JTTA 5AXIA 2F2PA 2BCAA 2LE9B 3KPXA 2K2FA 2MJWB 1B9AA 1K90D 3DVKA 3PALA 4PCWA 1CDMA 2M7LA 4Q04A 1CDPA 4ETOA 4E68A 1CMGA 4MLWA 1MWNA 2ZKMX 1SY9A 1B47A 3OB2B 5BPJA 1AP4A 1K94A 2I2RE 1IJ6A 4A4BA 1DJZA 1Y6WA 1UHNA 2CXJA 3JVTC 3JVTB 2OTGC 4U8DA 2GGMA 2KAXA 5CSJA 2L0PA 3VGOA 2OTGB 2KDHA 3LCPC 1K9PA 2CT9A 4PE0A 1OMDA 2JXCA 3VRQA 4PHKA 2JULA 3KO0A 2I18A 1YRTB 3VROA 2H61A 1J1DA 2KSPA 1BOCA 3PN7C 1KFUS 3PN7B 2JOJA 2LLUA 1DGVA 1WRLA 3NSOA 4MZKA 1AVSA 2NCOA 3NXAA 1IGVA 3NSKA 2JNXA 2M7NA 1NCZA 1QX7A 1RJVA 3EK7A 2EHBA 3EKHA 1B8RA 4OCIA 4HSZA 3TUYB 2KBIA 3ICBA 1EH2A 2JC2A 3DF0B 1AJ5A 2HQWA 5B8IB 1B7TY 3AKBA 4YGCB 4FQOA 1SL8A 1QX5B 2KAYA 4OKHA 3PSRA 1K2HA 3IQOA 1NCXA 2FOTA 1UP5A 1KSMA 5K89A 1PVAA 2L5XB 2BBMA 3NSLA 4ZCVA 1LINA 2MAZA 2F2OA 1QATA 1CLBA 1SL7A 2ZFDA 3E3RA 1OOJA 2MLEC 1JUOA 1QLSA 3GK1A 2CCMA 4PE7A 4AQIA 2M9GA 3OB1B 1F70A 1DJXA 1DMOA 1RFJA 1H4BA 1KFUL 2LVKA 1YX8A 2F33A 1S6JA 3D0YB 3ZNIA 2LHLA 2NLNA 1CLMA 2L4HA 5D7FA 1IG5A 1Y0VH 3EK4A 4QJ5B 1WRZA 2K0JA 3M0WA 1K9UA 3QRXA 1QASA 2ZRTA 2LVIA 2K7OA 2JRFA 2V53A 3EKJA 2JXLA 3SG5A 2Q91A 1AUIB 2I94A 2LCPA 5I2QA 3BOWA 2NCPA 3OHMB 1QJTA 2L51A 1OMRA 2AUCA 2LP3A 4CPVA 2QACA 4GAOA 4XJKB 4MEWA 1FI6A 2Y5IA 2HPSA 3FWBA 1YVHA 1QXPA 2Y1MA 4JWQA 3TDZA 1CM4A 2KNEA 2D8NA 3F45A 4ORCB 4OV2A 1S5GZ 1EG4A 1DJWA 1N0YA 1S36A 1CDLA 1TNXA 3OP0A 3VRRA 4AQJA 1JFJA 1DTLA 4M2QA 4PE4A 1EL4A 4PALA 5HLVA 1A2XA 1XFXO 2K7BA 4MRYA 2E6WA 1U5IA 1SK6D 2NXQA 3BUOB 3DVJA 1SBJA 4HRHA 1CKKA 3TZ1A 3PLFB 2JQ6A 1DF0A 2JNFA 1PSBA 1A75B 1ALVA 1ZUZA 4I5NB 4ICBA 1QX2A 5DKNA 5HKYA 3I5IC 1TNWA 4CIDA 3I5IB 1FPWA 1YTZC 2H2KA 3HX4A 4DUQA 1IH0A 1LVCD 1BR4B 5F6TA 2KGBC 2P6BB 1FI5A 4WRIA 1LKJA 4PDZA 2K2AA 4PE1A 1L7ZA 4ORBB 3IQQA 2KAVA 4M2PA 2M29A 1NWDA 1XYDA 4ORAB 4A4CA 1JC2A 2CNPA 1B8CA 4YRUA 1UHKA 2MHHA 1CDNA 1KQMC 2KHNA 1KQMB 2PSRA 1SNLA 1AHRA 2L50A 5HKZA 1F55A 2M8UA 2GV5A 1OZSA 2LNKA 2NZ0A 2K8MB 2BCXA 1IRJA 2LMUA 2KI6D 1MUXA 1L2OB 1TNPA 3KF9A 2PASA 2BBNA 2Y4QA 4YI8A 1TCOB 1BJFA 2DOQA 2JT8A 3FIAA 1ZACA 4YBHB 2JWWA 2LV7A 5GQQC 1UHIA 4L9MA 4CFQA 1AK8A 2JTZA 4PHNA 3EVVA 1NYAA 1JF2A 1RECA 1XFZO 1H8BA 4DIRA 3WHUB 4BY5A 4I5KA 3LK1A 1XK4A 1DJIA 4GPLB 4DS7A 3SG6A 1TTXA 3TDUA 4MN0A 3TUYC 1CNPA 4R1EA 1MR8A 4OR9B 1K96A 3EVUA 1MXLC 2LUCA 2KYFA 2PVBA 1CFFA 1WLZA 4TNCA 1QS7A 1CB1A 1IQ3A 2M49B 1F71A 1FF1A 2LMTA 5FYXA 5ER4X 2F3YA 3AAKA 1SR6C 5D69A 1UUSA 1SR6B 2K7CA 2LVJA 4BY4A 3TS5C 1JF0A 1DJYA 1C7VA 4YGDB 2CTNA 1K95A 3TS5B 5CPVA 1J7RA 3C1VA 1DGUA 1OE9B 2WCBA 3K21A 1NX1A 3CGAA 2LLTA 2LVVA 1SYMA 4PHMA 4USLA 1QV1A 3BOWB 1J55A 1CFDA 4MZJA 1SKTA 2KQ6A 1ZMZA 4AOMA 1WRKA 4IL1A 1S1EA 1A03A 1KK8B 3EK8A 1UURA 2LM5A 1B1GA 1NP8A 4MVFA 4P2YB 1B7TZ 1R6PA 3SJSA 1KFXS 5TNCA 1TCFA 3CS1A 3SG2A 1Y1XA 2R2IA 4P5OE 5G08A 4GGNA 3O4YA 4GGFC 4HREE 4WQ3A 1M45A 1SMGA 4NDDA 1VRKA 1QVIZ 1WLMA 4C0KA 3DF0A 1KSOA 1M31A 2LP2A 1OMVA 1N65A 1M39A 1C07A 5I2LA 1ZOTB 3A4UB 2OS8C 1RTP1 2BKHB 1KK7Z 2OS8B 3KEVA 1JBAA 1CLLA 2M1UA 3IF7A 1G4YR 5I8NA 5CSIA 2OPOA 5KU1A 2Q4UA 1IKUA 1A29A
chains in the Genus database with same CATH superfamily
1R2UA 2LANA 3CR4X 3RLZA 2WCJA 2KBMA 3A8RA 1YUUA 2QDIA 2WORA 3RZSA 1XFYO 3PM8A 1TRFA 3EVRA 4MSPA 3D0YA 3WNXB 1BF5A 3S0BA 1YRUB 3NHTA 1SCMC 1GQMA 1WY9A 1CFCA 2SCPA 1SCMB 2KI4C 1DJHA 2KI4B 3DVMA 1KFXL 1X02A 1XA5A 3CYZA 1G33A 1QLKA 1TUJA 2WCEA 4OVNF 3NSIA 3LL8B 4MRXA 1PK0D 4FQTA 1FW4A 1V1GA 4YGEB 1CFPA 5DKQA 1F54A 3GK2A 4NQGA 1NX2A 1JFKA 3BUMB 2BE6A 4I5LB 2K61A 5KTYA 4N1GA 3BXKA 2Y1NA 3GOFA 3OX6A 1DEKA 1M46A 2H61C 2O60A 3VRPA 5AANA 3BFHA 1TIZA 2L98A 1KWOC 2G9BA 4FTGA 3SG4A 1KWOB 2L4IA 1N2DA 1GGWA 3I5FC 2AAOA 2I7AA 1MF8B 2JT0A 1YVLA 1BT6A 1HQVA 1TNQA 3I5FB 1F4QA 3BUNB 3O6BA 1XFVO 2WCKA 2BECA 5HYDA 3CR5X 1NPQA 4INWA 3SIBA 3H4SE 1L2OC 1XFUO 1Q80A 1YUTA 1K93D 4JD9A 2PMYA 1IWQA 4HRGA 2LMVA 1XFRA 2E30A 1DJGA 1DQEA 3GK4X 3RM1A 1A75A 3S0EA 1E8AA 2WNDA 5IBWA 2HETA 1MHOA 3N7HA 3TDIA 1XO5A 4UPGA 2QEBA 2LAPA 4MBEA 3CLNA 1W9ZA 1BU3A 2YGUA 1TN4A 2BE4A 4YGAA 1PULA 1PALA 2HQ8A 2KQYA 1MXEA 4M2OA 4YI9A 2KLDA 2M1KB 1OZOA 2WC6A 3NHIA 5FI7A 3CWGA 3PFVA 4NDCA 2COLB 3CABA 2HF5A 4QJ3B 3IVTA 1ALWA 1PRWA 3JTDC 3FS7A 3OX5A 2B1UA 4WQ2A 4CFRA 4DCKA 3JTDB 3BYAA 2PYQA 4D1EA 2PRUA 5KSZA 2BL0C 1JWDA 1DT7B 2BL0B 3DYEA 3S0FA 1LXFC 3SIAA 2MRDA 1GM0A 1QIWA 1LA0A 4PHJA 2TN4A 2VRGA 1LA3A 3UNWA 1C3YA 3R72A 2L2EA 2MA2A 1NX0A 1OOIX 1YUSA 2K60A 2KFGA 1G8IA 4IJ7A 3CTNA 5CSFA 1GJYA 2WC8A 2ZRSA 4GNKB 4JPZB 5DKRA 5HLOA 2MBXA 3AAJA 5HKWA 1C7WA 1PVBA 4C0JA 5AEQA 2WCLA 1S26D 1TUZA 1RK9A 1F8HA 4F0ZB 1J1EA 3L4LA 1NX3A 1BODA 4C0LA 3HCMA 1EXRA 2CBLA 2K7DA 1KK8C 2WCFA 2ERBA 2WCHA 3B6XA 1J7PA 2P70A 1JSAA 3BUWB 1F4OA 3BFBA 1QVIY 3FWCA 2JU0A 3CDNA 1BR1B 1QTXA 2KOTA 2M3WA 2SASA 3I5GC 3BQ3A 1HT9A 3O4XA 3V2LA 1NSHA 3I5GB 1NIWA 5I2OA 5J3XA 1W7JB 1PSRA 5JOLA 1KK7Y 1M63B 5AERA 1EG3A 2FCEA 2KPHA 3L4AA 5JJGA 2BKIB 2LUXA 3SG3A 4NDBA 4ZCUA 2JT3A 1S5GY 1S6CA 1A4PA 1U5IB 1BG1A 3WXAA 1CM1A 1OQPA 1YX7A 1K9KA 1ODBA 2KFHA 3PATA 2KFFA 2PQLA 1DF0B 2ZN8A 1SCVA 1UWOA 2MLFC 4MZLA 4GBAA 1B4CA 1WDCC 3B7AA 1MQ1A 3S0AA 1WDCB 2G2BA 2LLSA 2EGDA 1CTRA 3FE9A 3L47A 2F3ZA 2QPTA 1RWYA 2JZIA 2KI6C 1S3PA 5CSNA 2F8PA 2KYCA 2RGIA 1KCYA 5ER5A 2EC6C 2AMIA 1IJ5A 1EJ3A 1TOPA 1Y1AA 2EC6B 1XVJA 1J7QA 1YR5A 1J7OA 3DD4A 3MSEB 1BLQA 2PALA 1NUBA 1Y1UA 4I5JA 1DVIA 2FJUB 2ISDA 3CR2A 3I5HC 3BUXB 4N5XA 1UHHA 2KGRA 1YURA 3I5HB 3O78A 3PM2A 1S6IA 2WCMA 3O2PA 3OGNA 4N1FA 4XYNA 2LC5A 1V1FA 2FCDA 2L2CA 2QEVA 2IS9A 3NGVA 3WHTB 1B8LA 3DZTA 1NCYA 3SG7A 4DRWA 4YGBB 4GFTA 2JPOA 4GGFA 3AKAA 1SRAA 4CLNA 1IQ5A 3ZWHA 1OOFA 1UHJA 1ZFSA 1AJ4A 1K8UA 1SW8A 1RROA 1W7IB 1GGZA 2LHIA 1OSAA 3KHEA 3LLEA 1SPYA 2M97A 4XJKA 1KQVA 2O5GA 1FBVA 1XFWO 2GGZA 5AFPA 2ZNEA 1QV0A 3BJHA 2ZNDA 3CZTX 4JQ0D 2ZN9A 2M0RA 4GUKA 3LK0A 2A4JA 1SL9A 2JPTA 4QJ4B 3EG5B 1CMFA 3DVEA 1QWVA 3DY9A 1QIVA 2BCBA 2WOSA 1D1OA 3VRNA 5PALA 1XK4C 3BFAA 1DC1A 1BMOA 3D10A 2JTTA 5AXIA 2F2PA 2BCAA 2QEHA 2LE9B 3KPXA 4KYNA 2K2FA 2MJWB 1B9AA 1K90D 1Z4HA 3DVKA 3PALA 4PCWA 1CDMA 2M7LA 4Q04A 1CDPA 4ETOA 4E68A 1CMGA 4MLWA 1MWNA 2ZKMX 1SY9A 1B47A 3OB2B 5BPJA 1AP4A 1K94A 1ORGA 2I2RE 4JKTA 1IJ6A 4A4BA 1DJZA 1Y6WA 1UHNA 2CXJA 3JVTC 3JVTB 2OTGC 4U8DA 2GGMA 2KAXA 5CSJA 2L0PA 3VGOA 2OTGB 2KDHA 3LCPC 1K9PA 2CT9A 4PE0A 1OMDA 2JXCA 3VRQA 4PHKA 2JULA 3KO0A 2I18A 1YRTB 3VROA 2H61A 1J1DA 2KSPA 1BOCA 3PN7C 1KFUS 2H8VA 3PN7B 2JOJA 3D76A 2LLUA 1DGVA 1WRLA 1IIOA 1TWOA 3NSOA 4MZKA 1AVSA 2NCOA 3NXAA 1IGVA 3NSKA 2JNXA 2M7NA 1NCZA 1QX7A 1RJVA 3EK7A 2EHBA 3EKHA 1B8RA 3D78A 4OCIA 4HSZA 3TUYB 1P28A 2KBIA 3ICBA 1DELA 2JC2A 1EH2A 3DF0B 1AJ5A 2HQWA 5B8IB 1B7TY 3AKBA 3FE8A 4YGCB 4FQOA 1LS8A 1SL8A 1QX5B 1SSEB 2KAYA 4OKHA 3PSRA 1K2HA 3IQOA 1NCXA 2FOTA 1UP5A 1KSMA 5K89A 1PVAA 2L5XB 2BBMA 3NSLA 4ZCVA 1LINA 2MAZA 2F2OA 1QATA 1CLBA 1SL7A 2ZFDA 3E3RA 1OOJA 2MLEC 1JUOA 1QLSA 3GK1A 2CCMA 4PE7A 4AQIA 2M9GA 3OB1B 3VB1A 1F70A 1DJXA 1DMOA 1RFJA 1H4BA 1KFUL 2LVKA 1YX8A 2F33A 1S6JA 3D0YB 3R1VA 2LHLA 2NLNA 3ZNIA 1CLMA 2L4HA 5D7FA 1IG5A 1Y0VH 3EK4A 4QJ5B 3DXLA 1WRZA 2K0JA 3M0WA 1K9UA 3SS4A 3R1PA 2BNXA 3QRXA 2P71A 1QASA 2ZRTA 2FJYA 2K7OA 2JRFA 2LVIA 2V53A 2JXLA 3EKJA 3SG5A 2Q91A 1AUIB 2I94A 2LCPA 3QMEA 3BOWA 5I2QA 2NCPA 3OHMB 1QJTA 2L51A 1OMRA 2AUCA 3R1OA 2LP3A 4CPVA 2QACA 4GAOA 4XJKB 4MEWA 1FI6A 2Y5IA 2HPSA 3FWBA 1YVHA 1QXPA 2Y1MA 4JWQA 3SS3A 1CM4A 2KNEA 2D8NA 3F45A 4ORCB 4OV2A 1S5GZ 1EG4A 1DJWA 1N0YA 1S36A 1CDLA 1TNXA 3OP0A 3VRRA 4AQJA 1JFJA 1DTLA 4M2QA 4PE4A 1EL4A 3TDZA 4PALA 5HLVA 1A2XA 1OOGA 1XFXO 2K7BA 4MRYA 3B87A 2E6WA 1U5IA 1SK6D 2NXQA 3BUOB 3DVJA 1SBJA 4HRHA 3CZ2A 1CKKA 3TZ1A 2GTEA 3PLFB 2JQ6A 1DF0A 2JNFA 1PSBA 1A75B 1ALVA 2BAPA 1ZUZA 4I5NB 4ICBA 1QX2A 3B88A 5DKNA 5DICA 3PJIA 5HKYA 3I5IC 1TNWA 4CIDA 3I5IB 1FPWA 1YTZC 2H2KA 3FE6A 3HX4A 3OBVA 4DUQA 1IH0A 1LVCD 1BR4B 5F6TA 2KGBC 2P6BB 1FI5A 4WRIA 1LKJA 3Q8IA 4PDZA 2K2AA 4PE1A 1L7ZA 4ORBB 3IQQA 2KAVA 4M2PA 2M29A 1NWDA 1XYDA 4INXA 1OOHA 4ORAB 4A4CA 1JC2A 2CNPA 3D73A 1B8CA 4YRUA 1UHKA 2MHHA 4OZDA 1CDNA 1KQMC 1OW4A 5I94A 2KHNA 1KQMB 2PSRA 3CZ1A 1SNLA 1AHRA 2L50A 5HKZA 1F55A 2M8UA 2GV5A 1OZSA 2L5YA 2LNKA 2K8MB 2BCXA 2NZ0A 1IRJA 3B86A 2LMUA 2KI6D 1MUXA 1L2OB 1TNPA 3KF9A 2PASA 2BBNA 2Y4QA 4YI8A 3SS5A 1TCOB 1BJFA 2DOQA 2JT8A 3FIAA 3UO9A 1ZACA 4YBHB 2JWWA 2LV7A 3D74A 1UHIA 4L9MA 5GQQC 4CFQA 1AK8A 2JTZA 4PHNA 3EVVA 1NYAA 1JF2A 1RECA 1XFZO 3S0GA 1H8BA 4DIRA 3WHUB 4BY5A 4I5KA 3LK1A 1XK4A 1DJIA 4GPLB 4DS7A 3SG6A 1TTXA 5EL2A 4MN0A 3TDUA 3TUYC 1CNPA 4R1EA 1MR8A 4OR9B 1K96A 3EVUA 1MXLC 2LUCA 2KYFA 2PVBA 1C3ZA 1CFFA 1WLZA 3D77A 1QS7A 4TNCA 1IQ3A 2M49B 1CB1A 1F71A 1FF1A 2LMTA 5FYXA 5ER4X 1Z2CB 2F3YA 3AAKA 1SR6C 5FI2A 5D69A 1UUSA 1SR6B 2K7CA 2LVJA 4BY4A 3TS5C 1JF0A 1DJYA 1C7VA 4YGDB 2CTNA 1K95A 2KLEA 3TS5B 5CPVA 1J7RA 3C1VA 1DGUA 1OE9B 2WCBA 3K21A 1NX1A 3CGAA 2LLTA 2LVVA 1SYMA 4PHMA 4USLA 1QV1A 3BOWB 1J55A 1CFDA 4MZJA 1SKTA 2KQ6A 1ZMZA 4AOMA 1WRKA 4IL1A 3S0DA 1S1EA 1A03A 1KK8B 3EK8A 1UURA 2LM5A 1B1GA 1NP8A 3CZ0A 4MVFA 4P2YB 4F7FA 1B7TZ 1R6PA 3SJSA 1KFXS 5TNCA 1TCFA 3CS1A 3SG2A 5HL1A 1Y1XA 2R2IA 4P5OE 2WC5A 5G08A 4GGNA 3O4YA 4GGFC 4HREE 4WQ3A 4PT1A 1M45A 1SMGA 3K1EA 4NDDA 1VRKA 3D75A 1QVIZ 1WLMA 4C0KA 3DF0A 1KSOA 1M31A 2LP2A 1OMVA 1N65A 1M39A 1C07A 5I2LA 1ZOTB 3A4UB 2OS8C 1RTP1 2BKHB 1KK7Z 2OS8B 3KEVA 1JBAA 1CLLA 2M1UA 3IF7A 1G4YR 5D3OA 2QEOA 5FI6A 5I8NA 5CSIA 2OPOA 1T14A 5KU1A 2Q4UA 1IKUA 1A29A
chains in the Genus database with same CATH topology
1R2UA 2LANA 3CR4X 3RLZA 2KBMA 3A8RA 1YUUA 2WORA 1XFYO 3PM8A 1TRFA 3EVRA 4MSPA 3D0YA 3WNXB 1BF5A 1YRUB 1SCMC 1GQMA 1WY9A 1CFCA 2SCPA 1SCMB 2KI4C 1DJHA 2KI4B 3DVMA 1KFXL 1X02A 1XA5A 1G33A 1QLKA 2WCEA 4OVNF 3NSIA 3LL8B 4MRXA 1PK0D 1FW4A 1V1GA 4YGEB 1CFPA 5DKQA 1F54A 3GK2A 4NQGA 1NX2A 1JFKA 3BUMB 2BE6A 4I5LB 2K61A 5KTYA 4N1GA 3BXKA 2Y1NA 3GOFA 3OX6A 1M46A 2H61C 2O60A 3VRPA 5AANA 1TIZA 2L98A 1KWOC 2G9BA 4FTGA 3SG4A 1KWOB 2L4IA 1N2DA 1GGWA 3I5FC 2AAOA 2I7AA 1MF8B 2JT0A 1YVLA 1HQVA 1BT6A 1TNQA 3I5FB 1F4QA 3BUNB 3O6BA 1XFVO 5HYDA 2BECA 3CR5X 1NPQA 3SIBA 3H4SE 1L2OC 1XFUO 1Q80A 1YUTA 1K93D 2PMYA 1IWQA 4HRGA 2LMVA 3GK4X 2E30A 1DJGA 3RM1A 1A75A 1E8AA 2WNDA 5IBWA 2HETA 1MHOA 4UPGA 3TDIA 1XO5A 2LAPA 4MBEA 3CLNA 1BU3A 1TN4A 2BE4A 4YGAA 1PULA 1PALA 2HQ8A 2KQYA 1MXEA 4M2OA 4YI9A 2M1KB 1OZOA 3CWGA 3PFVA 4NDCA 2COLB 2HF5A 4QJ3B 1ALWA 1PRWA 3JTDC 3FS7A 3OX5A 2B1UA 4WQ2A 4CFRA 4DCKA 3JTDB 3BYAA 4D1EA 2PRUA 5KSZA 2BL0C 1JWDA 1DT7B 2BL0B 1LXFC 3SIAA 2MRDA 1QIWA 1LA0A 4PHJA 2TN4A 2VRGA 1LA3A 2L2EA 2MA2A 1NX0A 1YUSA 2KFGA 1G8IA 3CTNA 5CSFA 1GJYA 2WC8A 2ZRSA 4GNKB 4JPZB 5DKRA 5HLOA 2MBXA 3AAJA 5HKWA 1C7WA 1PVBA 4C0JA 5AEQA 1S26D 1RK9A 1F8HA 4F0ZB 1J1EA 1NX3A 1BODA 4C0LA 3HCMA 1EXRA 2CBLA 2K7DA 1KK8C 2WCFA 1J7PA 1JSAA 3BUWB 1F4OA 1QVIY 3FWCA 2JU0A 1BR1B 1QTXA 2KOTA 2M3WA 2SASA 3I5GC 3BQ3A 1HT9A 5I2OA 1NSHA 3I5GB 1NIWA 5J3XA 1W7JB 1PSRA 5JOLA 1KK7Y 1M63B 5AERA 1EG3A 2FCEA 5JJGA 2BKIB 2LUXA 3SG3A 4NDBA 4ZCUA 2JT3A 1S5GY 1S6CA 1A4PA 1U5IB 1BG1A 3WXAA 1CM1A 1OQPA 1YX7A 1K9KA 1ODBA 2KFHA 3PATA 2KFFA 2ZN8A 1DF0B 4MZLA 1SCVA 1UWOA 2MLFC 1B4CA 4GBAA 1WDCC 1MQ1A 1WDCB 2G2BA 2LLSA 2EGDA 1CTRA 2F3ZA 2QPTA 1RWYA 2JZIA 2KI6C 1S3PA 5CSNA 2F8PA 2KYCA 2RGIA 1KCYA 5ER5A 2EC6C 2AMIA 1IJ5A 1EJ3A 1TOPA 1Y1AA 2EC6B 1XVJA 1J7QA 1YR5A 1J7OA 3DD4A 3MSEB 1BLQA 2PALA 1NUBA 1Y1UA 4I5JA 1DVIA 2FJUB 2ISDA 3CR2A 3I5HC 3BUXB 4N5XA 1UHHA 2KGRA 1YURA 3I5HB 3O78A 1S6IA 3O2PA 4XYNA 4N1FA 2LC5A 1V1FA 2FCDA 2IS9A 3WHTB 1B8LA 1NCYA 3SG7A 4DRWA 4YGBB 4GFTA 4GGFA 3AKAA 1SRAA 4CLNA 1IQ5A 3ZWHA 1UHJA 1ZFSA 1AJ4A 1K8UA 1SW8A 1RROA 1W7IB 1GGZA 2LHIA 1OSAA 3KHEA 3LLEA 1SPYA 2M97A 4XJKA 1KQVA 2O5GA 1FBVA 1XFWO 2GGZA 5AFPA 2ZNEA 1QV0A 2ZNDA 3CZTX 4JQ0D 2ZN9A 2M0RA 4GUKA 3LK0A 2A4JA 1SL9A 2JPTA 4QJ4B 1CMFA 3DVEA 1QIVA 2BCBA 2WOSA 1D1OA 3VRNA 5PALA 1XK4C 1BMOA 3D10A 2JTTA 5AXIA 2F2PA 2BCAA 2LE9B 3KPXA 2K2FA 2MJWB 1B9AA 1K90D 3DVKA 3PALA 4PCWA 1CDMA 2M7LA 4Q04A 1CDPA 4ETOA 4E68A 1CMGA 4MLWA 1MWNA 2ZKMX 1SY9A 1B47A 3OB2B 5BPJA 1AP4A 1K94A 2I2RE 1IJ6A 4A4BA 1DJZA 1Y6WA 1UHNA 2CXJA 3JVTC 3JVTB 2OTGC 4U8DA 2GGMA 2KAXA 5CSJA 2L0PA 3VGOA 2OTGB 2KDHA 3LCPC 1K9PA 2CT9A 4PE0A 1OMDA 2JXCA 3VRQA 4PHKA 2JULA 3KO0A 2I18A 1YRTB 3VROA 2H61A 1J1DA 2KSPA 1BOCA 3PN7C 1KFUS 3PN7B 2JOJA 2LLUA 1DGVA 1WRLA 3NSOA 4MZKA 1AVSA 2NCOA 3NXAA 1IGVA 3NSKA 2JNXA 2M7NA 1NCZA 1QX7A 1RJVA 3EK7A 2EHBA 3EKHA 1B8RA 4OCIA 4HSZA 3TUYB 2KBIA 3ICBA 1EH2A 2JC2A 3DF0B 1AJ5A 2HQWA 5B8IB 1B7TY 3AKBA 4YGCB 4FQOA 1SL8A 1QX5B 2KAYA 4OKHA 3PSRA 1K2HA 3IQOA 1NCXA 2FOTA 1UP5A 1KSMA 5K89A 1PVAA 2L5XB 2BBMA 3NSLA 4ZCVA 1LINA 2MAZA 2F2OA 1QATA 1CLBA 1SL7A 2ZFDA 3E3RA 1OOJA 2MLEC 1JUOA 1QLSA 3GK1A 2CCMA 4PE7A 4AQIA 2M9GA 3OB1B 1F70A 1DJXA 1DMOA 1RFJA 1H4BA 1KFUL 2LVKA 1YX8A 2F33A 1S6JA 3D0YB 3ZNIA 2LHLA 2NLNA 1CLMA 2L4HA 5D7FA 1IG5A 1Y0VH 3EK4A 4QJ5B 1WRZA 2K0JA 3M0WA 1K9UA 3QRXA 1QASA 2ZRTA 2LVIA 2K7OA 2JRFA 2V53A 3EKJA 2JXLA 3SG5A 2Q91A 1AUIB 2I94A 2LCPA 5I2QA 3BOWA 2NCPA 3OHMB 1QJTA 2L51A 1OMRA 2AUCA 2LP3A 4CPVA 2QACA 4GAOA 4XJKB 4MEWA 1FI6A 2Y5IA 2HPSA 3FWBA 1YVHA 1QXPA 2Y1MA 4JWQA 3TDZA 1CM4A 2KNEA 2D8NA 3F45A 4ORCB 4OV2A 1S5GZ 1EG4A 1DJWA 1N0YA 1S36A 1CDLA 1TNXA 3OP0A 3VRRA 4AQJA 1JFJA 1DTLA 4M2QA 4PE4A 1EL4A 4PALA 5HLVA 1A2XA 1XFXO 2K7BA 4MRYA 2E6WA 1U5IA 1SK6D 2NXQA 3BUOB 3DVJA 1SBJA 4HRHA 1CKKA 3TZ1A 3PLFB 2JQ6A 1DF0A 2JNFA 1PSBA 1A75B 1ALVA 1ZUZA 4I5NB 4ICBA 1QX2A 5DKNA 5HKYA 3I5IC 1TNWA 4CIDA 3I5IB 1FPWA 1YTZC 2H2KA 3HX4A 4DUQA 1IH0A 1LVCD 1BR4B 5F6TA 2KGBC 2P6BB 1FI5A 4WRIA 1LKJA 4PDZA 2K2AA 4PE1A 1L7ZA 4ORBB 3IQQA 2KAVA 4M2PA 2M29A 1NWDA 1XYDA 4ORAB 4A4CA 1JC2A 2CNPA 1B8CA 4YRUA 1UHKA 2MHHA 1CDNA 1KQMC 2KHNA 1KQMB 2PSRA 1SNLA 1AHRA 2L50A 5HKZA 1F55A 2M8UA 2GV5A 1OZSA 2LNKA 2NZ0A 2K8MB 2BCXA 1IRJA 2LMUA 2KI6D 1MUXA 1L2OB 1TNPA 3KF9A 2PASA 2BBNA 2Y4QA 4YI8A 1TCOB 1BJFA 2DOQA 2JT8A 3FIAA 1ZACA 4YBHB 2JWWA 2LV7A 5GQQC 1UHIA 4L9MA 4CFQA 1AK8A 2JTZA 4PHNA 3EVVA 1NYAA 1JF2A 1RECA 1XFZO 1H8BA 4DIRA 3WHUB 4BY5A 4I5KA 3LK1A 1XK4A 1DJIA 4GPLB 4DS7A 3SG6A 1TTXA 3TDUA 4MN0A 3TUYC 1CNPA 4R1EA 1MR8A 4OR9B 1K96A 3EVUA 1MXLC 2LUCA 2KYFA 2PVBA 1CFFA 1WLZA 4TNCA 1QS7A 1CB1A 1IQ3A 2M49B 1F71A 1FF1A 2LMTA 5FYXA 5ER4X 2F3YA 3AAKA 1SR6C 5D69A 1UUSA 1SR6B 2K7CA 2LVJA 4BY4A 3TS5C 1JF0A 1DJYA 1C7VA 4YGDB 2CTNA 1K95A 3TS5B 5CPVA 1J7RA 3C1VA 1DGUA 1OE9B 2WCBA 3K21A 1NX1A 3CGAA 2LLTA 2LVVA 1SYMA 4PHMA 4USLA 1QV1A 3BOWB 1J55A 1CFDA 4MZJA 1SKTA 2KQ6A 1ZMZA 4AOMA 1WRKA 4IL1A 1S1EA 1A03A 1KK8B 3EK8A 1UURA 2LM5A 1B1GA 1NP8A 4MVFA 4P2YB 1B7TZ 1R6PA 3SJSA 1KFXS 5TNCA 1TCFA 3CS1A 3SG2A 1Y1XA 2R2IA 4P5OE 5G08A 4GGNA 3O4YA 4GGFC 4HREE 4WQ3A 1M45A 1SMGA 4NDDA 1VRKA 1QVIZ 1WLMA 4C0KA 3DF0A 1KSOA 1M31A 2LP2A 1OMVA 1N65A 1M39A 1C07A 5I2LA 1ZOTB 3A4UB 2OS8C 1RTP1 2BKHB 1KK7Z 2OS8B 3KEVA 1JBAA 1CLLA 2M1UA 3IF7A 1G4YR 5I8NA 5CSIA 2OPOA 5KU1A 2Q4UA 1IKUA 1A29A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R2U A;  2LAN A;  3CR4 X;  3RLZ A;  2KBM A;  3A8R A;  1YUU A;  2WOR A;  1XFY O;  3PM8 A;  1TRF A;  3EVR A;  4MSP A;  3D0Y A;  3WNX B;  1BF5 A;  1YRU B;  1SCM C;  1GQM A;  1WY9 A;  1CFC A;  2SCP A;  1SCM B;  2KI4 C;  1DJH A;  2KI4 B;  3DVM A;  1KFX L;  1X02 A;  1XA5 A;  1G33 A;  1QLK A;  2WCE A;  4OVN F;  3NSI A;  3LL8 B;  4MRX A;  1PK0 D;  1FW4 A;  1V1G A;  4YGE B;  1CFP A;  5DKQ A;  1F54 A;  3GK2 A;  4NQG A;  1NX2 A;  1JFK A;  3BUM B;  2BE6 A;  4I5L B;  2K61 A;  5KTY A;  4N1G A;  3BXK A;  2Y1N A;  3GOF A;  3OX6 A;  1M46 A;  2H61 C;  2O60 A;  3VRP A;  5AAN A;  1TIZ A;  2L98 A;  1KWO C;  2G9B A;  4FTG A;  3SG4 A;  1KWO B;  2L4I A;  1N2D A;  1GGW A;  3I5F C;  2AAO A;  2I7A A;  1MF8 B;  2JT0 A;  1YVL A;  1HQV A;  1BT6 A;  1TNQ A;  3I5F B;  1F4Q A;  3BUN B;  3O6B A;  1XFV O;  5HYD A;  2BEC A;  3CR5 X;  1NPQ A;  3SIB A;  3H4S E;  1L2O C;  1XFU O;  1Q80 A;  1YUT A;  1K93 D;  2PMY A;  1IWQ A;  4HRG A;  2LMV A;  3GK4 X;  2E30 A;  1DJG A;  3RM1 A;  1A75 A;  1E8A A;  2WND A;  5IBW A;  2HET A;  1MHO A;  4UPG A;  3TDI A;  1XO5 A;  2LAP A;  4MBE A;  3CLN A;  1BU3 A;  1TN4 A;  2BE4 A;  4YGA A;  1PUL A;  1PAL A;  2HQ8 A;  2KQY A;  1MXE A;  4M2O A;  4YI9 A;  2M1K B;  1OZO A;  3CWG A;  3PFV A;  4NDC A;  2COL B;  2HF5 A;  4QJ3 B;  1ALW A;  1PRW A;  3JTD C;  3FS7 A;  3OX5 A;  2B1U A;  4WQ2 A;  4CFR A;  4DCK A;  3JTD B;  3BYA A;  4D1E A;  2PRU A;  5KSZ A;  2BL0 C;  1JWD A;  1DT7 B;  2BL0 B;  1LXF C;  3SIA A;  2MRD A;  1QIW A;  1LA0 A;  4PHJ A;  2TN4 A;  2VRG A;  1LA3 A;  2L2E A;  2MA2 A;  1NX0 A;  1YUS A;  2KFG A;  1G8I A;  3CTN A;  5CSF A;  1GJY A;  2WC8 A;  2ZRS A;  4GNK B;  4JPZ B;  5DKR A;  5HLO A;  2MBX A;  3AAJ A;  5HKW A;  1C7W A;  1PVB A;  4C0J A;  5AEQ A;  1S26 D;  1RK9 A;  1F8H A;  4F0Z B;  1J1E A;  1NX3 A;  1BOD A;  4C0L A;  3HCM A;  1EXR A;  2CBL A;  2K7D A;  1KK8 C;  2WCF A;  1J7P A;  1JSA A;  3BUW B;  1F4O A;  1QVI Y;  3FWC A;  2JU0 A;  1BR1 B;  1QTX A;  2KOT A;  2M3W A;  2SAS A;  3I5G C;  3BQ3 A;  1HT9 A;  5I2O A;  1NSH A;  3I5G B;  1NIW A;  5J3X A;  1W7J B;  1PSR A;  5JOL A;  1KK7 Y;  1M63 B;  5AER A;  1EG3 A;  2FCE A;  5JJG A;  2BKI B;  2LUX A;  3SG3 A;  4NDB A;  4ZCU A;  2JT3 A;  1S5G Y;  1S6C A;  1A4P A;  1U5I B;  1BG1 A;  3WXA A;  1CM1 A;  1OQP A;  1YX7 A;  1K9K A;  1ODB A;  2KFH A;  3PAT A;  2KFF A;  2ZN8 A;  1DF0 B;  4MZL A;  1SCV A;  1UWO A;  2MLF C;  1B4C A;  4GBA A;  1WDC C;  1MQ1 A;  1WDC B;  2G2B A;  2LLS A;  2EGD A;  1CTR A;  2F3Z A;  2QPT A;  1RWY A;  2JZI A;  2KI6 C;  1S3P A;  5CSN A;  2F8P A;  2KYC A;  2RGI A;  1KCY A;  5ER5 A;  2EC6 C;  2AMI A;  1IJ5 A;  1EJ3 A;  1TOP A;  1Y1A A;  2EC6 B;  1XVJ A;  1J7Q A;  1YR5 A;  1J7O A;  3DD4 A;  3MSE B;  1BLQ A;  2PAL A;  1NUB A;  1Y1U A;  4I5J A;  1DVI A;  2FJU B;  2ISD A;  3CR2 A;  3I5H C;  3BUX B;  4N5X A;  1UHH A;  2KGR A;  1YUR A;  3I5H B;  3O78 A;  1S6I A;  3O2P A;  4XYN A;  4N1F A;  2LC5 A;  1V1F A;  2FCD A;  2IS9 A;  3WHT B;  1B8L A;  1NCY A;  3SG7 A;  4DRW A;  4YGB B;  4GFT A;  4GGF A;  3AKA A;  1SRA A;  4CLN A;  1IQ5 A;  3ZWH A;  1UHJ A;  1ZFS A;  1AJ4 A;  1K8U A;  1SW8 A;  1RRO A;  1W7I B;  1GGZ A;  2LHI A;  1OSA A;  3KHE A;  3LLE A;  1SPY A;  2M97 A;  4XJK A;  1KQV A;  2O5G A;  1FBV A;  1XFW O;  2GGZ A;  5AFP A;  2ZNE A;  1QV0 A;  2ZND A;  3CZT X;  4JQ0 D;  2ZN9 A;  2M0R A;  4GUK A;  3LK0 A;  2A4J A;  1SL9 A;  2JPT A;  4QJ4 B;  1CMF A;  3DVE A;  1QIV A;  2BCB A;  2WOS A;  1D1O A;  3VRN A;  5PAL A;  1XK4 C;  1BMO A;  3D10 A;  2JTT A;  5AXI A;  2F2P A;  2BCA A;  2LE9 B;  3KPX A;  2K2F A;  2MJW B;  1B9A A;  1K90 D;  3DVK A;  3PAL A;  4PCW A;  1CDM A;  2M7L A;  4Q04 A;  1CDP A;  4ETO A;  4E68 A;  1CMG A;  4MLW A;  1MWN A;  2ZKM X;  1SY9 A;  1B47 A;  3OB2 B;  5BPJ A;  1AP4 A;  1K94 A;  2I2R E;  1IJ6 A;  4A4B A;  1DJZ A;  1Y6W A;  1UHN A;  2CXJ A;  3JVT C;  3JVT B;  2OTG C;  4U8D A;  2GGM A;  2KAX A;  5CSJ A;  2L0P A;  3VGO A;  2OTG B;  2KDH A;  3LCP C;  1K9P A;  2CT9 A;  4PE0 A;  1OMD A;  2JXC A;  3VRQ A;  4PHK A;  2JUL A;  3KO0 A;  2I18 A;  1YRT B;  3VRO A;  2H61 A;  1J1D A;  2KSP A;  1BOC A;  3PN7 C;  1KFU S;  3PN7 B;  2JOJ A;  2LLU A;  1DGV A;  1WRL A;  3NSO A;  4MZK A;  1AVS A;  2NCO A;  3NXA A;  1IGV A;  3NSK A;  2JNX A;  2M7N A;  1NCZ A;  1QX7 A;  1RJV A;  3EK7 A;  2EHB A;  3EKH A;  1B8R A;  4OCI A;  4HSZ A;  3TUY B;  2KBI A;  3ICB A;  1EH2 A;  2JC2 A;  3DF0 B;  1AJ5 A;  2HQW A;  5B8I B;  1B7T Y;  3AKB A;  4YGC B;  4FQO A;  1SL8 A;  1QX5 B;  2KAY A;  4OKH A;  3PSR A;  1K2H A;  3IQO A;  1NCX A;  2FOT A;  1UP5 A;  1KSM A;  5K89 A;  1PVA A;  2L5X B;  2BBM A;  3NSL A;  4ZCV A;  1LIN A;  2MAZ A;  2F2O A;  1QAT A;  1CLB A;  1SL7 A;  2ZFD A;  3E3R A;  1OOJ A;  2MLE C;  1JUO A;  1QLS A;  3GK1 A;  2CCM A;  4PE7 A;  4AQI A;  2M9G A;  3OB1 B;  1F70 A;  1DJX A;  1DMO A;  1RFJ A;  1H4B A;  1KFU L;  2LVK A;  1YX8 A;  2F33 A;  1S6J A;  3D0Y B;  3ZNI A;  2LHL A;  2NLN A;  1CLM A;  2L4H A;  5D7F A;  1IG5 A;  1Y0V H;  3EK4 A;  4QJ5 B;  1WRZ A;  2K0J A;  3M0W A;  1K9U A;  3QRX A;  1QAS A;  2ZRT A;  2LVI A;  2K7O A;  2JRF A;  2V53 A;  3EKJ A;  2JXL A;  3SG5 A;  2Q91 A;  1AUI B;  2I94 A;  2LCP A;  5I2Q A;  3BOW A;  2NCP A;  3OHM B;  1QJT A;  2L51 A;  1OMR A;  2AUC A;  2LP3 A;  4CPV A;  2QAC A;  4GAO A;  4XJK B;  4MEW A;  1FI6 A;  2Y5I A;  2HPS A;  3FWB A;  1YVH A;  1QXP A;  2Y1M A;  4JWQ A;  3TDZ A;  1CM4 A;  2KNE A;  2D8N A;  3F45 A;  4ORC B;  4OV2 A;  1S5G Z;  1EG4 A;  1DJW A;  1N0Y A;  1S36 A;  1CDL A;  1TNX A;  3OP0 A;  3VRR A;  4AQJ A;  1JFJ A;  1DTL A;  4M2Q A;  4PE4 A;  1EL4 A;  4PAL A;  5HLV A;  1A2X A;  1XFX O;  2K7B A;  4MRY A;  2E6W A;  1U5I A;  1SK6 D;  2NXQ A;  3BUO B;  3DVJ A;  1SBJ A;  4HRH A;  1CKK A;  3TZ1 A;  3PLF B;  2JQ6 A;  1DF0 A;  2JNF A;  1PSB A;  1A75 B;  1ALV A;  1ZUZ A;  4I5N B;  4ICB A;  1QX2 A;  5DKN A;  5HKY A;  3I5I C;  1TNW A;  4CID A;  3I5I B;  1FPW A;  1YTZ C;  2H2K A;  3HX4 A;  4DUQ A;  1IH0 A;  1LVC D;  1BR4 B;  5F6T A;  2KGB C;  2P6B B;  1FI5 A;  4WRI A;  1LKJ A;  4PDZ A;  2K2A A;  4PE1 A;  1L7Z A;  4ORB B;  3IQQ A;  2KAV A;  4M2P A;  2M29 A;  1NWD A;  1XYD A;  4ORA B;  4A4C A;  1JC2 A;  2CNP A;  1B8C A;  4YRU A;  1UHK A;  2MHH A;  1CDN A;  1KQM C;  2KHN A;  1KQM B;  2PSR A;  1SNL A;  1AHR A;  2L50 A;  5HKZ A;  1F55 A;  2M8U A;  2GV5 A;  1OZS A;  2LNK A;  2NZ0 A;  2K8M B;  2BCX A;  1IRJ A;  2LMU A;  2KI6 D;  1MUX A;  1L2O B;  1TNP A;  3KF9 A;  2PAS A;  2BBN A;  2Y4Q A;  4YI8 A;  1TCO B;  1BJF A;  2DOQ A;  2JT8 A;  3FIA A;  1ZAC A;  4YBH B;  2JWW A;  2LV7 A;  5GQQ C;  1UHI A;  4L9M A;  4CFQ A;  1AK8 A;  2JTZ A;  4PHN A;  3EVV A;  1NYA A;  1JF2 A;  1REC A;  1XFZ O;  1H8B A;  4DIR A;  3WHU B;  4BY5 A;  4I5K A;  3LK1 A;  1XK4 A;  1DJI A;  4GPL B;  4DS7 A;  3SG6 A;  1TTX A;  3TDU A;  4MN0 A;  3TUY C;  1CNP A;  4R1E A;  1MR8 A;  4OR9 B;  1K96 A;  3EVU A;  1MXL C;  2LUC A;  2KYF A;  2PVB A;  1CFF A;  1WLZ A;  4TNC A;  1QS7 A;  1CB1 A;  1IQ3 A;  2M49 B;  1F71 A;  1FF1 A;  2LMT A;  5FYX A;  5ER4 X;  2F3Y A;  3AAK A;  1SR6 C;  5D69 A;  1UUS A;  1SR6 B;  2K7C A;  2LVJ A;  4BY4 A;  3TS5 C;  1JF0 A;  1DJY A;  1C7V A;  4YGD B;  2CTN A;  1K95 A;  3TS5 B;  5CPV A;  1J7R A;  3C1V A;  1DGU A;  1OE9 B;  2WCB A;  3K21 A;  1NX1 A;  3CGA A;  2LLT A;  2LVV A;  1SYM A;  4PHM A;  4USL A;  1QV1 A;  3BOW B;  1J55 A;  1CFD A;  4MZJ A;  1SKT A;  2KQ6 A;  1ZMZ A;  4AOM A;  1WRK A;  4IL1 A;  1S1E A;  1A03 A;  1KK8 B;  3EK8 A;  1UUR A;  2LM5 A;  1B1G A;  1NP8 A;  4MVF A;  4P2Y B;  1B7T Z;  1R6P A;  3SJS A;  1KFX S;  5TNC A;  1TCF A;  3CS1 A;  3SG2 A;  1Y1X A;  2R2I A;  4P5O E;  5G08 A;  4GGN A;  3O4Y A;  4GGF C;  4HRE E;  4WQ3 A;  1M45 A;  1SMG A;  4NDD A;  1VRK A;  1QVI Z;  1WLM A;  4C0K A;  3DF0 A;  1KSO A;  1M31 A;  2LP2 A;  1OMV A;  1N65 A;  1M39 A;  1C07 A;  5I2L A;  1ZOT B;  3A4U B;  2OS8 C;  1RTP 1;  2BKH B;  1KK7 Z;  2OS8 B;  3KEV A;  1JBA A;  1CLL A;  2M1U A;  3IF7 A;  1G4Y R;  5I8N A;  5CSI A;  2OPO A;  5KU1 A;  2Q4U A;  1IKU A;  1A29 A; 
#chains in the Genus database with same CATH topology
 1R2U A;  2LAN A;  3CR4 X;  3RLZ A;  2WCJ A;  2KBM A;  3A8R A;  1YUU A;  2QDI A;  2WOR A;  3RZS A;  1XFY O;  3PM8 A;  1TRF A;  3EVR A;  4MSP A;  3D0Y A;  3WNX B;  1BF5 A;  3S0B A;  1YRU B;  3NHT A;  1SCM C;  1GQM A;  1WY9 A;  1CFC A;  2SCP A;  1SCM B;  2KI4 C;  1DJH A;  2KI4 B;  3DVM A;  1KFX L;  1X02 A;  1XA5 A;  3CYZ A;  1G33 A;  1QLK A;  1TUJ A;  2WCE A;  4OVN F;  3NSI A;  3LL8 B;  4MRX A;  1PK0 D;  4FQT A;  1FW4 A;  1V1G A;  4YGE B;  1CFP A;  5DKQ A;  1F54 A;  3GK2 A;  4NQG A;  1NX2 A;  1JFK A;  3BUM B;  2BE6 A;  4I5L B;  2K61 A;  5KTY A;  4N1G A;  3BXK A;  2Y1N A;  3GOF A;  3OX6 A;  1DEK A;  1M46 A;  2H61 C;  2O60 A;  3VRP A;  5AAN A;  3BFH A;  1TIZ A;  2L98 A;  1KWO C;  2G9B A;  4FTG A;  3SG4 A;  1KWO B;  2L4I A;  1N2D A;  1GGW A;  3I5F C;  2AAO A;  2I7A A;  1MF8 B;  2JT0 A;  1YVL A;  1BT6 A;  1HQV A;  1TNQ A;  3I5F B;  1F4Q A;  3BUN B;  3O6B A;  1XFV O;  2WCK A;  2BEC A;  5HYD A;  3CR5 X;  1NPQ A;  4INW A;  3SIB A;  3H4S E;  1L2O C;  1XFU O;  1Q80 A;  1YUT A;  1K93 D;  4JD9 A;  2PMY A;  1IWQ A;  4HRG A;  2LMV A;  1XFR A;  2E30 A;  1DJG A;  1DQE A;  3GK4 X;  3RM1 A;  1A75 A;  3S0E A;  1E8A A;  2WND A;  5IBW A;  2HET A;  1MHO A;  3N7H A;  3TDI A;  1XO5 A;  4UPG A;  2QEB A;  2LAP A;  4MBE A;  3CLN A;  1W9Z A;  1BU3 A;  2YGU A;  1TN4 A;  2BE4 A;  4YGA A;  1PUL A;  1PAL A;  2HQ8 A;  2KQY A;  1MXE A;  4M2O A;  4YI9 A;  2KLD A;  2M1K B;  1OZO A;  2WC6 A;  3NHI A;  5FI7 A;  3CWG A;  3PFV A;  4NDC A;  2COL B;  3CAB A;  2HF5 A;  4QJ3 B;  3IVT A;  1ALW A;  1PRW A;  3JTD C;  3FS7 A;  3OX5 A;  2B1U A;  4WQ2 A;  4CFR A;  4DCK A;  3JTD B;  3BYA A;  2PYQ A;  4D1E A;  2PRU A;  5KSZ A;  2BL0 C;  1JWD A;  1DT7 B;  2BL0 B;  3DYE A;  3S0F A;  1LXF C;  3SIA A;  2MRD A;  1GM0 A;  1QIW A;  1LA0 A;  4PHJ A;  2TN4 A;  2VRG A;  1LA3 A;  3UNW A;  1C3Y A;  3R72 A;  2L2E A;  2MA2 A;  1NX0 A;  1OOI X;  1YUS A;  2K60 A;  2KFG A;  1G8I A;  4IJ7 A;  3CTN A;  5CSF A;  1GJY A;  2WC8 A;  2ZRS A;  4GNK B;  4JPZ B;  5DKR A;  5HLO A;  2MBX A;  3AAJ A;  5HKW A;  1C7W A;  1PVB A;  4C0J A;  5AEQ A;  2WCL A;  1S26 D;  1TUZ A;  1RK9 A;  1F8H A;  4F0Z B;  1J1E A;  3L4L A;  1NX3 A;  1BOD A;  4C0L A;  3HCM A;  1EXR A;  2CBL A;  2K7D A;  1KK8 C;  2WCF A;  2ERB A;  2WCH A;  3B6X A;  1J7P A;  2P70 A;  1JSA A;  3BUW B;  1F4O A;  3BFB A;  1QVI Y;  3FWC A;  2JU0 A;  3CDN A;  1BR1 B;  1QTX A;  2KOT A;  2M3W A;  2SAS A;  3I5G C;  3BQ3 A;  1HT9 A;  3O4X A;  3V2L A;  1NSH A;  3I5G B;  1NIW A;  5I2O A;  5J3X A;  1W7J B;  1PSR A;  5JOL A;  1KK7 Y;  1M63 B;  5AER A;  1EG3 A;  2FCE A;  2KPH A;  3L4A A;  5JJG A;  2BKI B;  2LUX A;  3SG3 A;  4NDB A;  4ZCU A;  2JT3 A;  1S5G Y;  1S6C A;  1A4P A;  1U5I B;  1BG1 A;  3WXA A;  1CM1 A;  1OQP A;  1YX7 A;  1K9K A;  1ODB A;  2KFH A;  3PAT A;  2KFF A;  2PQL A;  1DF0 B;  2ZN8 A;  1SCV A;  1UWO A;  2MLF C;  4MZL A;  4GBA A;  1B4C A;  1WDC C;  3B7A A;  1MQ1 A;  3S0A A;  1WDC B;  2G2B A;  2LLS A;  2EGD A;  1CTR A;  3FE9 A;  3L47 A;  2F3Z A;  2QPT A;  1RWY A;  2JZI A;  2KI6 C;  1S3P A;  5CSN A;  2F8P A;  2KYC A;  2RGI A;  1KCY A;  5ER5 A;  2EC6 C;  2AMI A;  1IJ5 A;  1EJ3 A;  1TOP A;  1Y1A A;  2EC6 B;  1XVJ A;  1J7Q A;  1YR5 A;  1J7O A;  3DD4 A;  3MSE B;  1BLQ A;  2PAL A;  1NUB A;  1Y1U A;  4I5J A;  1DVI A;  2FJU B;  2ISD A;  3CR2 A;  3I5H C;  3BUX B;  4N5X A;  1UHH A;  2KGR A;  1YUR A;  3I5H B;  3O78 A;  3PM2 A;  1S6I A;  2WCM A;  3O2P A;  3OGN A;  4N1F A;  4XYN A;  2LC5 A;  1V1F A;  2FCD A;  2L2C A;  2QEV A;  2IS9 A;  3NGV A;  3WHT B;  1B8L A;  3DZT A;  1NCY A;  3SG7 A;  4DRW A;  4YGB B;  4GFT A;  2JPO A;  4GGF A;  3AKA A;  1SRA A;  4CLN A;  1IQ5 A;  3ZWH A;  1OOF A;  1UHJ A;  1ZFS A;  1AJ4 A;  1K8U A;  1SW8 A;  1RRO A;  1W7I B;  1GGZ A;  2LHI A;  1OSA A;  3KHE A;  3LLE A;  1SPY A;  2M97 A;  4XJK A;  1KQV A;  2O5G A;  1FBV A;  1XFW O;  2GGZ A;  5AFP A;  2ZNE A;  1QV0 A;  3BJH A;  2ZND A;  3CZT X;  4JQ0 D;  2ZN9 A;  2M0R A;  4GUK A;  3LK0 A;  2A4J A;  1SL9 A;  2JPT A;  4QJ4 B;  3EG5 B;  1CMF A;  3DVE A;  1QWV A;  3DY9 A;  1QIV A;  2BCB A;  2WOS A;  1D1O A;  3VRN A;  5PAL A;  1XK4 C;  3BFA A;  1DC1 A;  1BMO A;  3D10 A;  2JTT A;  5AXI A;  2F2P A;  2BCA A;  2QEH A;  2LE9 B;  3KPX A;  4KYN A;  2K2F A;  2MJW B;  1B9A A;  1K90 D;  1Z4H A;  3DVK A;  3PAL A;  4PCW A;  1CDM A;  2M7L A;  4Q04 A;  1CDP A;  4ETO A;  4E68 A;  1CMG A;  4MLW A;  1MWN A;  2ZKM X;  1SY9 A;  1B47 A;  3OB2 B;  5BPJ A;  1AP4 A;  1K94 A;  1ORG A;  2I2R E;  4JKT A;  1IJ6 A;  4A4B A;  1DJZ A;  1Y6W A;  1UHN A;  2CXJ A;  3JVT C;  3JVT B;  2OTG C;  4U8D A;  2GGM A;  2KAX A;  5CSJ A;  2L0P A;  3VGO A;  2OTG B;  2KDH A;  3LCP C;  1K9P A;  2CT9 A;  4PE0 A;  1OMD A;  2JXC A;  3VRQ A;  4PHK A;  2JUL A;  3KO0 A;  2I18 A;  1YRT B;  3VRO A;  2H61 A;  1J1D A;  2KSP A;  1BOC A;  3PN7 C;  1KFU S;  2H8V A;  3PN7 B;  2JOJ A;  3D76 A;  2LLU A;  1DGV A;  1WRL A;  1IIO A;  1TWO A;  3NSO A;  4MZK A;  1AVS A;  2NCO A;  3NXA A;  1IGV A;  3NSK A;  2JNX A;  2M7N A;  1NCZ A;  1QX7 A;  1RJV A;  3EK7 A;  2EHB A;  3EKH A;  1B8R A;  3D78 A;  4OCI A;  4HSZ A;  3TUY B;  1P28 A;  2KBI A;  3ICB A;  1DEL A;  2JC2 A;  1EH2 A;  3DF0 B;  1AJ5 A;  2HQW A;  5B8I B;  1B7T Y;  3AKB A;  3FE8 A;  4YGC B;  4FQO A;  1LS8 A;  1SL8 A;  1QX5 B;  1SSE B;  2KAY A;  4OKH A;  3PSR A;  1K2H A;  3IQO A;  1NCX A;  2FOT A;  1UP5 A;  1KSM A;  5K89 A;  1PVA A;  2L5X B;  2BBM A;  3NSL A;  4ZCV A;  1LIN A;  2MAZ A;  2F2O A;  1QAT A;  1CLB A;  1SL7 A;  2ZFD A;  3E3R A;  1OOJ A;  2MLE C;  1JUO A;  1QLS A;  3GK1 A;  2CCM A;  4PE7 A;  4AQI A;  2M9G A;  3OB1 B;  3VB1 A;  1F70 A;  1DJX A;  1DMO A;  1RFJ A;  1H4B A;  1KFU L;  2LVK A;  1YX8 A;  2F33 A;  1S6J A;  3D0Y B;  3R1V A;  2LHL A;  2NLN A;  3ZNI A;  1CLM A;  2L4H A;  5D7F A;  1IG5 A;  1Y0V H;  3EK4 A;  4QJ5 B;  3DXL A;  1WRZ A;  2K0J A;  3M0W A;  1K9U A;  3SS4 A;  3R1P A;  2BNX A;  3QRX A;  2P71 A;  1QAS A;  2ZRT A;  2FJY A;  2K7O A;  2JRF A;  2LVI A;  2V53 A;  2JXL A;  3EKJ A;  3SG5 A;  2Q91 A;  1AUI B;  2I94 A;  2LCP A;  3QME A;  3BOW A;  5I2Q A;  2NCP A;  3OHM B;  1QJT A;  2L51 A;  1OMR A;  2AUC A;  3R1O A;  2LP3 A;  4CPV A;  2QAC A;  4GAO A;  4XJK B;  4MEW A;  1FI6 A;  2Y5I A;  2HPS A;  3FWB A;  1YVH A;  1QXP A;  2Y1M A;  4JWQ A;  3SS3 A;  1CM4 A;  2KNE A;  2D8N A;  3F45 A;  4ORC B;  4OV2 A;  1S5G Z;  1EG4 A;  1DJW A;  1N0Y A;  1S36 A;  1CDL A;  1TNX A;  3OP0 A;  3VRR A;  4AQJ A;  1JFJ A;  1DTL A;  4M2Q A;  4PE4 A;  1EL4 A;  3TDZ A;  4PAL A;  5HLV A;  1A2X A;  1OOG A;  1XFX O;  2K7B A;  4MRY A;  3B87 A;  2E6W A;  1U5I A;  1SK6 D;  2NXQ A;  3BUO B;  3DVJ A;  1SBJ A;  4HRH A;  3CZ2 A;  1CKK A;  3TZ1 A;  2GTE A;  3PLF B;  2JQ6 A;  1DF0 A;  2JNF A;  1PSB A;  1A75 B;  1ALV A;  2BAP A;  1ZUZ A;  4I5N B;  4ICB A;  1QX2 A;  3B88 A;  5DKN A;  5DIC A;  3PJI A;  5HKY A;  3I5I C;  1TNW A;  4CID A;  3I5I B;  1FPW A;  1YTZ C;  2H2K A;  3FE6 A;  3HX4 A;  3OBV A;  4DUQ A;  1IH0 A;  1LVC D;  1BR4 B;  5F6T A;  2KGB C;  2P6B B;  1FI5 A;  4WRI A;  1LKJ A;  3Q8I A;  4PDZ A;  2K2A A;  4PE1 A;  1L7Z A;  4ORB B;  3IQQ A;  2KAV A;  4M2P A;  2M29 A;  1NWD A;  1XYD A;  4INX A;  1OOH A;  4ORA B;  4A4C A;  1JC2 A;  2CNP A;  3D73 A;  1B8C A;  4YRU A;  1UHK A;  2MHH A;  4OZD A;  1CDN A;  1KQM C;  1OW4 A;  5I94 A;  2KHN A;  1KQM B;  2PSR A;  3CZ1 A;  1SNL A;  1AHR A;  2L50 A;  5HKZ A;  1F55 A;  2M8U A;  2GV5 A;  1OZS A;  2L5Y A;  2LNK A;  2K8M B;  2BCX A;  2NZ0 A;  1IRJ A;  3B86 A;  2LMU A;  2KI6 D;  1MUX A;  1L2O B;  1TNP A;  3KF9 A;  2PAS A;  2BBN A;  2Y4Q A;  4YI8 A;  3SS5 A;  1TCO B;  1BJF A;  2DOQ A;  2JT8 A;  3FIA A;  3UO9 A;  1ZAC A;  4YBH B;  2JWW A;  2LV7 A;  3D74 A;  1UHI A;  4L9M A;  5GQQ C;  4CFQ A;  1AK8 A;  2JTZ A;  4PHN A;  3EVV A;  1NYA A;  1JF2 A;  1REC A;  1XFZ O;  3S0G A;  1H8B A;  4DIR A;  3WHU B;  4BY5 A;  4I5K A;  3LK1 A;  1XK4 A;  1DJI A;  4GPL B;  4DS7 A;  3SG6 A;  1TTX A;  5EL2 A;  4MN0 A;  3TDU A;  3TUY C;  1CNP A;  4R1E A;  1MR8 A;  4OR9 B;  1K96 A;  3EVU A;  1MXL C;  2LUC A;  2KYF A;  2PVB A;  1C3Z A;  1CFF A;  1WLZ A;  3D77 A;  1QS7 A;  4TNC A;  1IQ3 A;  2M49 B;  1CB1 A;  1F71 A;  1FF1 A;  2LMT A;  5FYX A;  5ER4 X;  1Z2C B;  2F3Y A;  3AAK A;  1SR6 C;  5FI2 A;  5D69 A;  1UUS A;  1SR6 B;  2K7C A;  2LVJ A;  4BY4 A;  3TS5 C;  1JF0 A;  1DJY A;  1C7V A;  4YGD B;  2CTN A;  1K95 A;  2KLE A;  3TS5 B;  5CPV A;  1J7R A;  3C1V A;  1DGU A;  1OE9 B;  2WCB A;  3K21 A;  1NX1 A;  3CGA A;  2LLT A;  2LVV A;  1SYM A;  4PHM A;  4USL A;  1QV1 A;  3BOW B;  1J55 A;  1CFD A;  4MZJ A;  1SKT A;  2KQ6 A;  1ZMZ A;  4AOM A;  1WRK A;  4IL1 A;  3S0D A;  1S1E A;  1A03 A;  1KK8 B;  3EK8 A;  1UUR A;  2LM5 A;  1B1G A;  1NP8 A;  3CZ0 A;  4MVF A;  4P2Y B;  4F7F A;  1B7T Z;  1R6P A;  3SJS A;  1KFX S;  5TNC A;  1TCF A;  3CS1 A;  3SG2 A;  5HL1 A;  1Y1X A;  2R2I A;  4P5O E;  2WC5 A;  5G08 A;  4GGN A;  3O4Y A;  4GGF C;  4HRE E;  4WQ3 A;  4PT1 A;  1M45 A;  1SMG A;  3K1E A;  4NDD A;  1VRK A;  3D75 A;  1QVI Z;  1WLM A;  4C0K A;  3DF0 A;  1KSO A;  1M31 A;  2LP2 A;  1OMV A;  1N65 A;  1M39 A;  1C07 A;  5I2L A;  1ZOT B;  3A4U B;  2OS8 C;  1RTP 1;  2BKH B;  1KK7 Z;  2OS8 B;  3KEV A;  1JBA A;  1CLL A;  2M1U A;  3IF7 A;  1G4Y R;  5D3O A;  2QEO A;  5FI6 A;  5I8N A;  5CSI A;  2OPO A;  1T14 A;  5KU1 A;  2Q4U A;  1IKU A;  1A29 A; 
#chains in the Genus database with same CATH homology
 1R2U A;  2LAN A;  3CR4 X;  3RLZ A;  2KBM A;  3A8R A;  1YUU A;  2WOR A;  1XFY O;  3PM8 A;  1TRF A;  3EVR A;  4MSP A;  3D0Y A;  3WNX B;  1BF5 A;  1YRU B;  1SCM C;  1GQM A;  1WY9 A;  1CFC A;  2SCP A;  1SCM B;  2KI4 C;  1DJH A;  2KI4 B;  3DVM A;  1KFX L;  1X02 A;  1XA5 A;  1G33 A;  1QLK A;  2WCE A;  4OVN F;  3NSI A;  3LL8 B;  4MRX A;  1PK0 D;  1FW4 A;  1V1G A;  4YGE B;  1CFP A;  5DKQ A;  1F54 A;  3GK2 A;  4NQG A;  1NX2 A;  1JFK A;  3BUM B;  2BE6 A;  4I5L B;  2K61 A;  5KTY A;  4N1G A;  3BXK A;  2Y1N A;  3GOF A;  3OX6 A;  1M46 A;  2H61 C;  2O60 A;  3VRP A;  5AAN A;  1TIZ A;  2L98 A;  1KWO C;  2G9B A;  4FTG A;  3SG4 A;  1KWO B;  2L4I A;  1N2D A;  1GGW A;  3I5F C;  2AAO A;  2I7A A;  1MF8 B;  2JT0 A;  1YVL A;  1HQV A;  1BT6 A;  1TNQ A;  3I5F B;  1F4Q A;  3BUN B;  3O6B A;  1XFV O;  5HYD A;  2BEC A;  3CR5 X;  1NPQ A;  3SIB A;  3H4S E;  1L2O C;  1XFU O;  1Q80 A;  1YUT A;  1K93 D;  2PMY A;  1IWQ A;  4HRG A;  2LMV A;  3GK4 X;  2E30 A;  1DJG A;  3RM1 A;  1A75 A;  1E8A A;  2WND A;  5IBW A;  2HET A;  1MHO A;  4UPG A;  3TDI A;  1XO5 A;  2LAP A;  4MBE A;  3CLN A;  1BU3 A;  1TN4 A;  2BE4 A;  4YGA A;  1PUL A;  1PAL A;  2HQ8 A;  2KQY A;  1MXE A;  4M2O A;  4YI9 A;  2M1K B;  1OZO A;  3CWG A;  3PFV A;  4NDC A;  2COL B;  2HF5 A;  4QJ3 B;  1ALW A;  1PRW A;  3JTD C;  3FS7 A;  3OX5 A;  2B1U A;  4WQ2 A;  4CFR A;  4DCK A;  3JTD B;  3BYA A;  4D1E A;  2PRU A;  5KSZ A;  2BL0 C;  1JWD A;  1DT7 B;  2BL0 B;  1LXF C;  3SIA A;  2MRD A;  1QIW A;  1LA0 A;  4PHJ A;  2TN4 A;  2VRG A;  1LA3 A;  2L2E A;  2MA2 A;  1NX0 A;  1YUS A;  2KFG A;  1G8I A;  3CTN A;  5CSF A;  1GJY A;  2WC8 A;  2ZRS A;  4GNK B;  4JPZ B;  5DKR A;  5HLO A;  2MBX A;  3AAJ A;  5HKW A;  1C7W A;  1PVB A;  4C0J A;  5AEQ A;  1S26 D;  1RK9 A;  1F8H A;  4F0Z B;  1J1E A;  1NX3 A;  1BOD A;  4C0L A;  3HCM A;  1EXR A;  2CBL A;  2K7D A;  1KK8 C;  2WCF A;  1J7P A;  1JSA A;  3BUW B;  1F4O A;  1QVI Y;  3FWC A;  2JU0 A;  1BR1 B;  1QTX A;  2KOT A;  2M3W A;  2SAS A;  3I5G C;  3BQ3 A;  1HT9 A;  5I2O A;  1NSH A;  3I5G B;  1NIW A;  5J3X A;  1W7J B;  1PSR A;  5JOL A;  1KK7 Y;  1M63 B;  5AER A;  1EG3 A;  2FCE A;  5JJG A;  2BKI B;  2LUX A;  3SG3 A;  4NDB A;  4ZCU A;  2JT3 A;  1S5G Y;  1S6C A;  1A4P A;  1U5I B;  1BG1 A;  3WXA A;  1CM1 A;  1OQP A;  1YX7 A;  1K9K A;  1ODB A;  2KFH A;  3PAT A;  2KFF A;  2ZN8 A;  1DF0 B;  4MZL A;  1SCV A;  1UWO A;  2MLF C;  1B4C A;  4GBA A;  1WDC C;  1MQ1 A;  1WDC B;  2G2B A;  2LLS A;  2EGD A;  1CTR A;  2F3Z A;  2QPT A;  1RWY A;  2JZI A;  2KI6 C;  1S3P A;  5CSN A;  2F8P A;  2KYC A;  2RGI A;  1KCY A;  5ER5 A;  2EC6 C;  2AMI A;  1IJ5 A;  1EJ3 A;  1TOP A;  1Y1A A;  2EC6 B;  1XVJ A;  1J7Q A;  1YR5 A;  1J7O A;  3DD4 A;  3MSE B;  1BLQ A;  2PAL A;  1NUB A;  1Y1U A;  4I5J A;  1DVI A;  2FJU B;  2ISD A;  3CR2 A;  3I5H C;  3BUX B;  4N5X A;  1UHH A;  2KGR A;  1YUR A;  3I5H B;  3O78 A;  1S6I A;  3O2P A;  4XYN A;  4N1F A;  2LC5 A;  1V1F A;  2FCD A;  2IS9 A;  3WHT B;  1B8L A;  1NCY A;  3SG7 A;  4DRW A;  4YGB B;  4GFT A;  4GGF A;  3AKA A;  1SRA A;  4CLN A;  1IQ5 A;  3ZWH A;  1UHJ A;  1ZFS A;  1AJ4 A;  1K8U A;  1SW8 A;  1RRO A;  1W7I B;  1GGZ A;  2LHI A;  1OSA A;  3KHE A;  3LLE A;  1SPY A;  2M97 A;  4XJK A;  1KQV A;  2O5G A;  1FBV A;  1XFW O;  2GGZ A;  5AFP A;  2ZNE A;  1QV0 A;  2ZND A;  3CZT X;  4JQ0 D;  2ZN9 A;  2M0R A;  4GUK A;  3LK0 A;  2A4J A;  1SL9 A;  2JPT A;  4QJ4 B;  1CMF A;  3DVE A;  1QIV A;  2BCB A;  2WOS A;  1D1O A;  3VRN A;  5PAL A;  1XK4 C;  1BMO A;  3D10 A;  2JTT A;  5AXI A;  2F2P A;  2BCA A;  2LE9 B;  3KPX A;  2K2F A;  2MJW B;  1B9A A;  1K90 D;  3DVK A;  3PAL A;  4PCW A;  1CDM A;  2M7L A;  4Q04 A;  1CDP A;  4ETO A;  4E68 A;  1CMG A;  4MLW A;  1MWN A;  2ZKM X;  1SY9 A;  1B47 A;  3OB2 B;  5BPJ A;  1AP4 A;  1K94 A;  2I2R E;  1IJ6 A;  4A4B A;  1DJZ A;  1Y6W A;  1UHN A;  2CXJ A;  3JVT C;  3JVT B;  2OTG C;  4U8D A;  2GGM A;  2KAX A;  5CSJ A;  2L0P A;  3VGO A;  2OTG B;  2KDH A;  3LCP C;  1K9P A;  2CT9 A;  4PE0 A;  1OMD A;  2JXC A;  3VRQ A;  4PHK A;  2JUL A;  3KO0 A;  2I18 A;  1YRT B;  3VRO A;  2H61 A;  1J1D A;  2KSP A;  1BOC A;  3PN7 C;  1KFU S;  3PN7 B;  2JOJ A;  2LLU A;  1DGV A;  1WRL A;  3NSO A;  4MZK A;  1AVS A;  2NCO A;  3NXA A;  1IGV A;  3NSK A;  2JNX A;  2M7N A;  1NCZ A;  1QX7 A;  1RJV A;  3EK7 A;  2EHB A;  3EKH A;  1B8R A;  4OCI A;  4HSZ A;  3TUY B;  2KBI A;  3ICB A;  1EH2 A;  2JC2 A;  3DF0 B;  1AJ5 A;  2HQW A;  5B8I B;  1B7T Y;  3AKB A;  4YGC B;  4FQO A;  1SL8 A;  1QX5 B;  2KAY A;  4OKH A;  3PSR A;  1K2H A;  3IQO A;  1NCX A;  2FOT A;  1UP5 A;  1KSM A;  5K89 A;  1PVA A;  2L5X B;  2BBM A;  3NSL A;  4ZCV A;  1LIN A;  2MAZ A;  2F2O A;  1QAT A;  1CLB A;  1SL7 A;  2ZFD A;  3E3R A;  1OOJ A;  2MLE C;  1JUO A;  1QLS A;  3GK1 A;  2CCM A;  4PE7 A;  4AQI A;  2M9G A;  3OB1 B;  1F70 A;  1DJX A;  1DMO A;  1RFJ A;  1H4B A;  1KFU L;  2LVK A;  1YX8 A;  2F33 A;  1S6J A;  3D0Y B;  3ZNI A;  2LHL A;  2NLN A;  1CLM A;  2L4H A;  5D7F A;  1IG5 A;  1Y0V H;  3EK4 A;  4QJ5 B;  1WRZ A;  2K0J A;  3M0W A;  1K9U A;  3QRX A;  1QAS A;  2ZRT A;  2LVI A;  2K7O A;  2JRF A;  2V53 A;  3EKJ A;  2JXL A;  3SG5 A;  2Q91 A;  1AUI B;  2I94 A;  2LCP A;  5I2Q A;  3BOW A;  2NCP A;  3OHM B;  1QJT A;  2L51 A;  1OMR A;  2AUC A;  2LP3 A;  4CPV A;  2QAC A;  4GAO A;  4XJK B;  4MEW A;  1FI6 A;  2Y5I A;  2HPS A;  3FWB A;  1YVH A;  1QXP A;  2Y1M A;  4JWQ A;  3TDZ A;  1CM4 A;  2KNE A;  2D8N A;  3F45 A;  4ORC B;  4OV2 A;  1S5G Z;  1EG4 A;  1DJW A;  1N0Y A;  1S36 A;  1CDL A;  1TNX A;  3OP0 A;  3VRR A;  4AQJ A;  1JFJ A;  1DTL A;  4M2Q A;  4PE4 A;  1EL4 A;  4PAL A;  5HLV A;  1A2X A;  1XFX O;  2K7B A;  4MRY A;  2E6W A;  1U5I A;  1SK6 D;  2NXQ A;  3BUO B;  3DVJ A;  1SBJ A;  4HRH A;  1CKK A;  3TZ1 A;  3PLF B;  2JQ6 A;  1DF0 A;  2JNF A;  1PSB A;  1A75 B;  1ALV A;  1ZUZ A;  4I5N B;  4ICB A;  1QX2 A;  5DKN A;  5HKY A;  3I5I C;  1TNW A;  4CID A;  3I5I B;  1FPW A;  1YTZ C;  2H2K A;  3HX4 A;  4DUQ A;  1IH0 A;  1LVC D;  1BR4 B;  5F6T A;  2KGB C;  2P6B B;  1FI5 A;  4WRI A;  1LKJ A;  4PDZ A;  2K2A A;  4PE1 A;  1L7Z A;  4ORB B;  3IQQ A;  2KAV A;  4M2P A;  2M29 A;  1NWD A;  1XYD A;  4ORA B;  4A4C A;  1JC2 A;  2CNP A;  1B8C A;  4YRU A;  1UHK A;  2MHH A;  1CDN A;  1KQM C;  2KHN A;  1KQM B;  2PSR A;  1SNL A;  1AHR A;  2L50 A;  5HKZ A;  1F55 A;  2M8U A;  2GV5 A;  1OZS A;  2LNK A;  2NZ0 A;  2K8M B;  2BCX A;  1IRJ A;  2LMU A;  2KI6 D;  1MUX A;  1L2O B;  1TNP A;  3KF9 A;  2PAS A;  2BBN A;  2Y4Q A;  4YI8 A;  1TCO B;  1BJF A;  2DOQ A;  2JT8 A;  3FIA A;  1ZAC A;  4YBH B;  2JWW A;  2LV7 A;  5GQQ C;  1UHI A;  4L9M A;  4CFQ A;  1AK8 A;  2JTZ A;  4PHN A;  3EVV A;  1NYA A;  1JF2 A;  1REC A;  1XFZ O;  1H8B A;  4DIR A;  3WHU B;  4BY5 A;  4I5K A;  3LK1 A;  1XK4 A;  1DJI A;  4GPL B;  4DS7 A;  3SG6 A;  1TTX A;  3TDU A;  4MN0 A;  3TUY C;  1CNP A;  4R1E A;  1MR8 A;  4OR9 B;  1K96 A;  3EVU A;  1MXL C;  2LUC A;  2KYF A;  2PVB A;  1CFF A;  1WLZ A;  4TNC A;  1QS7 A;  1CB1 A;  1IQ3 A;  2M49 B;  1F71 A;  1FF1 A;  2LMT A;  5FYX A;  5ER4 X;  2F3Y A;  3AAK A;  1SR6 C;  5D69 A;  1UUS A;  1SR6 B;  2K7C A;  2LVJ A;  4BY4 A;  3TS5 C;  1JF0 A;  1DJY A;  1C7V A;  4YGD B;  2CTN A;  1K95 A;  3TS5 B;  5CPV A;  1J7R A;  3C1V A;  1DGU A;  1OE9 B;  2WCB A;  3K21 A;  1NX1 A;  3CGA A;  2LLT A;  2LVV A;  1SYM A;  4PHM A;  4USL A;  1QV1 A;  3BOW B;  1J55 A;  1CFD A;  4MZJ A;  1SKT A;  2KQ6 A;  1ZMZ A;  4AOM A;  1WRK A;  4IL1 A;  1S1E A;  1A03 A;  1KK8 B;  3EK8 A;  1UUR A;  2LM5 A;  1B1G A;  1NP8 A;  4MVF A;  4P2Y B;  1B7T Z;  1R6P A;  3SJS A;  1KFX S;  5TNC A;  1TCF A;  3CS1 A;  3SG2 A;  1Y1X A;  2R2I A;  4P5O E;  5G08 A;  4GGN A;  3O4Y A;  4GGF C;  4HRE E;  4WQ3 A;  1M45 A;  1SMG A;  4NDD A;  1VRK A;  1QVI Z;  1WLM A;  4C0K A;  3DF0 A;  1KSO A;  1M31 A;  2LP2 A;  1OMV A;  1N65 A;  1M39 A;  1C07 A;  5I2L A;  1ZOT B;  3A4U B;  2OS8 C;  1RTP 1;  2BKH B;  1KK7 Z;  2OS8 B;  3KEV A;  1JBA A;  1CLL A;  2M1U A;  3IF7 A;  1G4Y R;  5I8N A;  5CSI A;  2OPO A;  5KU1 A;  2Q4U A;  1IKU A;  1A29 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...