1KQMB

Scallop myosin s1-amppnp in the actin-detached conformation
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
142
structure length
142
Chain Sequence
PQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKGSGEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYOSIN heavy chain
publication title Crystallographic findings on the internally uncoupled and near-rigor states of myosin: Further insights into the mechanics of the motor
pubmed doi rcsb
molecule tags Contractile protein
total genus 30
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2002-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kqmB01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kqmB02
1X02A 3A4UB 1BR4B 1KFUL 3NSOA 4CIDA 1QJTA 5B8IB 2HQWA 3D0YB 3NSLA 2CCMA 1AJ5A 1K96A 4MN0A 2GGMA 3CZTX 5JJGA 2LHIA 1IKUA 2WNDA 1S1EA 3DF0B 3FWBA 4MEWA 1GJYA 1A75B 1TRFA 1TNWA 1OMDA 2OS8C 1CDPA 1MHOA 1AVSA 1BLQA 2MA2A 1J1EA 2BE4A 3DVMA 1IGVA 4YI9A 4A4BA 1F4QA 2M8UA 3OP0A 3AAKA 2WC8A 3NXAA 4C0KA 2E30A 2NCPA 2ISDA 2ZRTA 1BG1A 1F4OA 2H2KA 4OKHA 1NX0A 2CNPA 1UHHA 3VROA 2K7CA 1TOPA 1L7ZA 3HCMA 4YGDB 3A8RA 1DJXA 3BXKA 2M0RA 5AERA 5IBWA 1TIZA 2R2IA 1QTXA 4R1EA 2B1UA 3BUWB 4BY5A 2O60A 2H61C 4PHKA 3CR5X 3DD4A 2BE6A 3LL8B 1F54A 1RROA 3CR4X 3M0WA 4N5XA 4XJKB 1IH0A 2AUCA 2I18A 5I2QA 1S6JA 1HQVA 2K2FA 2NLNA 2H61A 2KOTA 5HYDA 1QS7A 1XA5A 1UHNA 1XFWO 2Q91A 2LANA 1FW4A 1SCMC 2ZKMX 1M31A 4PHMA 1S6IA 4PHNA 1V1FA 4I5KA 1NX2A 1D1OA 1JUOA 4AOMA 2LVIA 4ORBB 1F71A 2L51A 1SCVA 4MBEA 1SY9A 3HX4A 2HF5A 3VGOA 2JNXA 2KI4C 1NX3A 1BJFA 2G9BA 4GNKB 1QVIY 1QX2A 3CTNA 1FF1A 2CT9A 4MZJA 2JNFA 2LLUA 3JTDC 4YGBB 1CFDA 3BUMB 2EC6B 4GPLB 3AKAA 3TUYC 3ICBA 4P2YB 2ZNDA 2OTGB 1AUIB 1K94A 2JZIA 1CM4A 2LMVA 3CR2A 3K21A 4NDCA 4ORAB 2TN4A 2ZRSA 1K2HA 1GGZA 1TNXA 1DJYA 3GOFA 1NYAA 2K7DA 4MRYA 2VRGA 4DS7A 2LV7A 1S36A 5K89A 3EK4A 2JT0A 2K7OA 1C7WA 2KYCA 2BCXA 1OMRA 3CWGA 3MSEB 2JPTA 1KQMC 3IF7A 2KSPA 2BBNA 2KFHA 2EHBA 4PHJA 1UP5A 1YVHA 2MAZA 3WHTB 2LVKA 1ZOTB 5I2OA 1YR5A 1RECA 1EL4A 1KK7Y 5HKZA 3TZ1A 4CLNA 4I5NB 2M29A 1CDNA 1K95A 5D69A 1NCYA 2LP2A 2OPOA 1SMGA 2PASA 3DVEA 1MF8B 4NDDA 2BKHB 1K8UA 5ER5A 4F0ZB 1CMFA 2JOJA 1A29A 2I7AA 1DMOA 3GK4X 3F45A 2IS9A 3BOWB 1XFYO 5CSFA 1CFFA 1MWNA 2ZN9A 1JFJA 1CLMA 2AAOA 1QIVA 4NDBA 3KO0A 4U8DA 1CDMA 1L2OB 2L4HA 1AP4A 2JTTA 1SR6B 2JU0A 4GUKA 1DF0B 1FBVA 1EXRA 1PALA 2I2RE 4HRHA 1Y1UA 1RWYA 5HKWA 1B47A 1N2DA 1S6CA 4USLA 2JULA 2WCFA 1NIWA 2LHLA 2M49B 2L0PA 3NSIA 1RFJA 1TCFA 2BL0B 2V53A 1CTRA 1JFKA 1J7OA 1MXLC 1MR8A 1XFZO 4YI8A 1WDCB 1FI6A 3RLZA 4PALA 3ZWHA 1XFUO 1KWOB 4A4CA 3AAJA 3I5HC 2FCDA 1YRUB 4DCKA 1UWOA 3PN7C 1VRKA 2KGBC 1AK8A 2JXLA 4DRWA 3I5IB 2KDHA 1TCOB 3KPXA 4GGNA 5FYXA 2ZNEA 1ALWA 2MBXA 2F2OA 2L5XB 4N1GA 1A03A 1OMVA 2LP3A 5JOLA 3WXAA 1SL7A 3BUOB 3IQQA 4DUQA 1AHRA 1QASA 2LUCA 2PVBA 3I5GB 4MZLA 3TS5B 3OB1B 1BODA 1BOCA 3D10A 2KFGA 2KI6D 4WRIA 1SKTA 3SIBA 1QXPA 3BUNB 5TNCA 1KSOA 1YUSA 3TDUA 3CLNA 2NZ0A 1IQ5A 3EKHA 1BF5A 4YGAA 3BQ3A 2BECA 3PALA 1WLZA 2KI6C 1S3PA 3SG4A 4QJ4B 3RM1A 1SL8A 4CPVA 4MSPA 4FTGA 4JWQA 1WRZA 3D0YA 3SG6A 1OOJA 2JTZA 1ALVA 2KAVA 3JTDB 1BMOA 1XFXO 4OVNF 5AXIA 1BU3A 1DJIA 3DF0A 3EVVA 4HSZA 1DTLA 2F8PA 1JSAA 1A75A 2M7NA 1RTP1 1QLSA 4JQ0D 3SG3A 1RJVA 2LAPA 2FCEA 2QACA 1WRKA 4YGEB 4ZCVA 1CLLA 1PSBA 3JVTB 5CSJA 2GGZA 3LK0A 3I5FB 5CPVA 2QPTA 1F55A 5G08A 1OE9B 2SCPA 1GGWA 4OV2A 1JWDA 3OX5A 3VRQA 2BBMA 1QV1A 4MVFA 4QJ3B 1KQVA 4YBHB 3O78A 1S5GZ 1TNPA 4TNCA 1K9KA 2F3YA 1QLKA 2KBMA 1M46A 4M2QA 1ODBA 4M2PA 1CNPA 1OZSA 2WCEA 4GGFC 1FI5A 3O6BA 2E6WA 1U5IB 1JF0A 4CFRA 1UURA 3FWCA 1KK8B 3NSKA 2M9GA 2K8MB 4D1EA 4XJKA 3KHEA 1PULA 2HQ8A 1YVLA 4GGFA 4I5JA 2L98A 1TTXA 1W7JB 1LA0A 4PE4A 1PVBA 1B7TZ 1B8LA 1WLMA 2MLFC 1SW8A 1NSHA 1C07A 2MHHA 1S26D 1UHIA 2M1UA 4PE0A 2F33A 2LUXA 2O5GA 4I5LB 1QATA 1DJHA 2BKIB 1BR1B 2LLSA 2PSRA 2F3ZA 4YRUA 2Y1MA 2KGRA 2Y1NA 2KFFA 4CFQA 2NXQA 1PSRA 3EVUA 4PDZA 1LVCD 1QV0A 3PSRA 2CXJA 1A2XA 1E8AA 4M2OA 4ICBA 4AQIA 1QX7A 1KFXS 2EC6C 5DKQA 2Y4QA 1ZFSA 2OTGC 1Q80A 2LMUA 2OS8B 1DGVA 1XFVO 2LC5A 1DJZA 3VRNA 1PK0D 1UHJA 3ZNIA 1XK4C 1J7PA 4E68A 3QRXA 3FS7A 1YUUA 1OSAA 3IQOA 1B8CA 4HRGA 5D7FA 3CGAA 2JC2A 1EH2A 3KF9A 2ZFDA 1G33A 1XK4A 1N65A 1XVJA 1KSMA 5ER4X 2Y5IA 4JPZB 1U5IA 1WRLA 4C0JA 2MRDA 3E3RA 1M45A 4GFTA 3TDZA 3DVJA 5KTYA 2EGDA 3CS1A 2KNEA 4BY4A 2JT3A 2FOTA 1LA3A 2KAXA 2HETA 4Q04A 3OB2B 4OCIA 1K93D 2AMIA 4C0LA 4PE1A 4WQ2A 3WNXB 1YURA 1B8RA 2K7BA 1CDLA 3EKJA 3PATA 3EK8A 1YUTA 4XYNA 1B9AA 1DGUA 2M7LA 1F70A 1J55A 1L2OC 5KSZA 3C1VA 1SRAA 5J3XA 1B1GA 1TN4A 1HT9A 1SR6C 2JXCA 2LMTA 3BOWA 3H4SE 1SCMB 1Y1XA 2L4IA 1TNQA 2KAYA 1M39A 3LCPC 1CFCA 1LXFC 2P6BB 3SG7A 2PMYA 1XO5A 5DKRA 5AFPA 1DF0A 1KFUS 2K2AA 1Y1AA 3AKBA 2ZN8A 2F2PA 1CB1A 2KBIA 3SJSA 3LLEA 1CMGA 2BL0C 5AEQA 1W7IB 2A4JA 2FJUB 2KI4B 1K9PA 1MUXA 1NCZA 5F6TA 4ZCUA 4ORCB 5BPJA 1CKKA 1IJ5A 2JQ6A 1WDCC 5KU1A 2LCPA 4N1FA 3VRPA 1SBJA 5DKNA 1ZACA 1KWOC 1AJ4A 1SK6D 2GV5A 4ETOA 2K61A 2LVJA 2M97A 5HLOA 3TUYB 1K90D 2LE9B 3GK1A 2WORA 1UHKA 2D8NA 3GK2A 1SNLA 3LK1A 3I5IC 2MLEC 4MRXA 4GAOA 1H4BA 1EJ3A 4NQGA 2LNKA 2BCBA 1EG3A 2BCAA 1J7QA 1FPWA 2KQ6A 3WHUB 1SL9A 2KHNA 1QX5B 5CSNA 2JRFA 2Q4UA 2JT8A 4MLWA 1QIWA 4P5OE 2M3WA 4WQ3A 3PLFB 1KQMB 1SYMA 2PALA 3I5GC 5CSIA 1WY9A 3TS5C 2G2BA 4IL1A 2WOSA 1J1DA 1R2UA 1R6PA 5AANA 1YX7A 2K0JA 1QVIZ 3VRRA 1F8HA 1YX8A 3PFVA 4UPGA 5HLVA 4QJ5B 2JWWA 1JC2A 1DVIA 1NCXA 2RGIA 2SASA 1CFPA 4HREE 1KFXL 1Y0VH 4MZKA 4DIRA 1NP8A 5GQQC 1NWDA 2L2EA 1S5GY 2NCOA 2HPSA 2LM5A 2DOQA 1ZMZA 3OHMB 1G4YR 5I8NA 4L9MA 1NX1A 5I2LA 2CTNA 3TDIA 4PCWA 1IQ3A 3KEVA 3O4YA 4AQJA 1CM1A 1IG5A 3DVKA 3SG5A 2LVVA 3OX6A 1MXEA 1G8IA 4PE7A 5HKYA 1NUBA 1Y6WA 3JVTC 3BYAA 3EVRA 1B7TY 1LINA 1RK9A 3I5FC 1KK7Z 1PVAA 2M1KB 1YTZC 3SIAA 1MQ1A 3EK7A 2KQYA 1C7VA 1V1GA 1IWQA 1A4PA 1K9UA 1M63B 2L50A 2PRUA 1N0YA 1B4CA 2LLTA 3SG2A 1OZOA 1J7RA 3I5HB 2WCBA 1NPQA 2CBLA 1PRWA 3BUXB 4YGCB 1KCYA 2COLB 1YRTB 1DJGA 3PN7B 1UUSA 1DT7B 1OQPA 3PM8A 4OR9B 1LKJA 1BT6A 4GBAA 1DJWA 1JBAA 1GQMA 1KK8C 2MJWB 4FQOA 2I94A 1JF2A 5PALA 1XYDA 1SPYA 1IJ6A 3FIAA 1H8BA 2KYFA 1EG4A 1CLBA 1IRJA 1ZUZA 3O2PA
chains in the Genus database with same CATH superfamily
1X02A 3S0GA 2K60A 3A4UB 1BR4B 1KFUL 3NSOA 4INXA 4CIDA 1QJTA 5B8IB 2HQWA 3D0YB 3DXLA 2BNXA 3NSLA 2CCMA 1AJ5A 1K96A 4MN0A 2GGMA 3CZTX 5JJGA 2LHIA 1IKUA 2WNDA 3NHIA 1S1EA 3DF0B 3FWBA 4MEWA 1GJYA 1A75B 1TRFA 1TNWA 1OMDA 2OS8C 1QWVA 1CDPA 1MHOA 1AVSA 1BLQA 2MA2A 1J1EA 2BE4A 3DVMA 1IGVA 4YI9A 4A4BA 1F4QA 2M8UA 3OP0A 3AAKA 2WC8A 3NXAA 4C0KA 2E30A 2NCPA 2ISDA 2ZRTA 1BG1A 1F4OA 2H2KA 4OKHA 1NX0A 3D74A 2CNPA 1UHHA 1OOHA 3VROA 2K7CA 1TOPA 1L7ZA 3HCMA 4YGDB 3A8RA 1DJXA 3BXKA 2M0RA 5AERA 5IBWA 1TIZA 2R2IA 1QTXA 4R1EA 2B1UA 3BUWB 2FJYA 4BY5A 2O60A 2H61C 4PHKA 3CR5X 3DD4A 3OGNA 2BE6A 3LL8B 1F54A 1RROA 3CR4X 3M0WA 4N5XA 4XJKB 1IH0A 2AUCA 2I18A 5I2QA 1S6JA 1HQVA 2K2FA 2NLNA 2H61A 2KOTA 5HYDA 1QS7A 1XA5A 1UHNA 1XFWO 2Q91A 3CABA 5FI6A 2LANA 2WCHA 1FW4A 1SCMC 2ZKMX 1M31A 4PHMA 1S6IA 4PHNA 1V1FA 4I5KA 1NX2A 1D1OA 1JUOA 4AOMA 2LVIA 4ORBB 1F71A 2L51A 1SCVA 4MBEA 1SY9A 3HX4A 2HF5A 2QEVA 3VGOA 2KLEA 2JNXA 3D77A 2KI4C 1NX3A 1BJFA 2G9BA 4GNKB 1QVIY 1QX2A 3R1VA 3CTNA 1FF1A 1LS8A 1W9ZA 2CT9A 4MZJA 1TUZA 4JKTA 2JNFA 2LLUA 3JTDC 4YGBB 1CFDA 3BFHA 3BUMB 2EC6B 4GPLB 3AKAA 3TUYC 3ICBA 4P2YB 2ZNDA 2OTGB 1AUIB 1K94A 2JZIA 1CM4A 1DELA 2LMVA 3CR2A 3K21A 4NDCA 2TN4A 2ZRSA 3CDNA 1GGZA 4ORAB 1K2HA 1TNXA 1DJYA 3R72A 3GOFA 1NYAA 2K7DA 3IVTA 4MRYA 2VRGA 4DS7A 2LV7A 3B88A 1S36A 5K89A 3EK4A 3B7AA 2JT0A 3SS5A 2K7OA 1C7WA 1Z2CB 2KYCA 2BCXA 1OMRA 3CWGA 3D76A 2JPTA 3MSEB 1KQMC 3S0AA 3NHTA 3IF7A 2KSPA 2BBNA 2KFHA 2EHBA 4PHJA 1UP5A 1YVHA 2MAZA 3WHTB 2LVKA 1ZOTB 5I2OA 1YR5A 1OOFA 1RECA 1EL4A 1KK7Y 5HKZA 3TZ1A 4CLNA 4I5NB 2M29A 2P71A 1CDNA 1K95A 5D69A 1NCYA 2LP2A 2OPOA 1SMGA 2PASA 3DVEA 1MF8B 4NDDA 2BKHB 1K8UA 5ER5A 4F0ZB 1CMFA 2JOJA 1A29A 1DEKA 2I7AA 1DMOA 3GK4X 2YGUA 3F45A 4PT1A 2IS9A 3BOWB 1XFYO 3R1OA 5CSFA 1MWNA 2ZN9A 1CFFA 1JFJA 1CLMA 2AAOA 1QIVA 4NDBA 3KO0A 4U8DA 1CDMA 1L2OB 2L4HA 1AP4A 2JTTA 1SR6B 2JU0A 4GUKA 1DF0B 1FBVA 1EXRA 1PALA 2I2RE 4HRHA 1Y1UA 1RWYA 5HKWA 1B47A 1N2DA 1S6CA 4USLA 2JULA 2WCFA 1NIWA 2LHLA 2M49B 2L0PA 3NSIA 1RFJA 1TCFA 2BL0B 2V53A 1CTRA 2ERBA 1JFKA 1J7OA 1MXLC 1MR8A 1XFZO 4YI8A 1WDCB 1FI6A 3RLZA 4IJ7A 4PALA 3ZWHA 1XFUO 2WC5A 1KWOB 3EG5B 4A4CA 3AAJA 3I5HC 2FCDA 1YRUB 4DCKA 1UWOA 1TUJA 3PN7C 1VRKA 2KGBC 1AK8A 2JXLA 4DRWA 3I5IB 2KDHA 1TCOB 3KPXA 4GGNA 5FYXA 2ZNEA 1ALWA 2MBXA 2F2OA 2L5XB 4N1GA 3FE9A 1A03A 1OMVA 2LP3A 5JOLA 5I94A 3WXAA 1SL7A 3BUOB 3IQQA 4DUQA 1AHRA 1QASA 2LUCA 2PVBA 3I5GB 3PJIA 1C3ZA 4MZLA 3OB1B 3TS5B 1BODA 3D10A 1BOCA 2KFGA 2KI6D 4WRIA 1SKTA 3SIBA 1QXPA 2L2CA 3BUNB 5TNCA 1KSOA 1YUSA 3TDUA 3CLNA 2NZ0A 1IQ5A 3EKHA 1BF5A 4YGAA 3BQ3A 2BECA 1XFRA 3PALA 1WLZA 2KI6C 1S3PA 3SG4A 4QJ4B 3RM1A 1SL8A 4CPVA 4MSPA 2L5YA 4FTGA 4JWQA 1WRZA 3D0YA 5D3OA 3SG6A 1OOJA 2JTZA 1ALVA 2KAVA 3DY9A 3QMEA 3JTDB 1BMOA 1XFXO 4OVNF 5AXIA 1BU3A 1DJIA 1C3YA 3DF0A 3EVVA 4HSZA 1DTLA 2F8PA 3DZTA 3DYEA 1JSAA 1A75A 2M7NA 1RTP1 1QLSA 4JQ0D 3SG3A 1RJVA 3FE6A 2LAPA 2FCEA 2QACA 1WRKA 4YGEB 4ZCVA 1CLLA 2GTEA 1PSBA 3JVTB 1DC1A 5CSJA 2GGZA 3LK0A 3I5FB 5CPVA 2QPTA 1F55A 3UO9A 3RZSA 5G08A 1OE9B 2SCPA 1GGWA 4OV2A 1JWDA 1OOGA 3OX5A 3VRQA 2BAPA 2BBMA 1QV1A 4MVFA 4QJ3B 1KQVA 4YBHB 3O78A 1S5GZ 1TNPA 4TNCA 1K9KA 1GM0A 2F3YA 1QLKA 2KBMA 1M46A 4M2QA 1ODBA 4M2PA 5HL1A 1CNPA 1OZSA 2WCEA 4GGFC 1FI5A 3O6BA 2E6WA 1U5IB 1JF0A 4CFRA 1UURA 3FWCA 1KK8B 3NSKA 2M9GA 2K8MB 4D1EA 4XJKA 3KHEA 1PULA 2HQ8A 1YVLA 3K1EA 4GGFA 2L98A 4I5JA 1TTXA 1W7JB 1LA0A 4PE4A 1PVBA 1B7TZ 1B8LA 1WLMA 2MLFC 1SW8A 1NSHA 1C07A 2MHHA 1S26D 1UHIA 2M1UA 4PE0A 2KLDA 2F33A 2LUXA 2O5GA 4I5LB 1QATA 1DJHA 3B86A 2BKIB 1BR1B 2LLSA 3BFBA 2PSRA 2F3ZA 4YRUA 2Y1MA 1IIOA 2KGRA 3OBVA 2Y1NA 2KFFA 4CFQA 1ORGA 2NXQA 1PSRA 3EVUA 4PDZA 1LVCD 1QV0A 3PSRA 2CXJA 1A2XA 1E8AA 4M2OA 4ICBA 4AQIA 1QX7A 3L4LA 1KFXS 2EC6C 5DKQA 3VB1A 2Y4QA 1ZFSA 2OTGC 1Q80A 2LMUA 2OS8B 3CZ2A 1DGVA 1XFVO 2LC5A 3D78A 5DICA 1DJZA 3VRNA 1PK0D 1UHJA 3ZNIA 1XK4C 3L47A 1J7PA 4E68A 3QRXA 3FS7A 1YUUA 1OSAA 3BJHA 1B8CA 3IQOA 4HRGA 5D7FA 3CGAA 2JC2A 1EH2A 3KF9A 2ZFDA 1G33A 1XK4A 1N65A 1XVJA 1KSMA 5ER4X 2Y5IA 3S0FA 4JPZB 1U5IA 1WRLA 4C0JA 3B87A 2MRDA 3E3RA 1M45A 4GFTA 3TDZA 3DVJA 5KTYA 2EGDA 3CS1A 2KNEA 4BY4A 2JT3A 2FOTA 1LA3A 2KAXA 2HETA 4Q04A 3OB2B 3BFAA 4OCIA 1K93D 2AMIA 4C0LA 4PE1A 4WQ2A 3WNXB 1YURA 2KPHA 1B8RA 2QEBA 2K7BA 1CDLA 2PYQA 3EKJA 3N7HA 3EK8A 1YUTA 3PATA 3S0EA 4XYNA 1B9AA 1DGUA 2M7LA 1F70A 2QEHA 1J55A 1L2OC 5KSZA 3C1VA 1SRAA 3L4AA 5J3XA 1TN4A 1B1GA 1HT9A 1SR6C 2JXCA 2LMTA 3BOWA 3H4SE 1SCMB 1Y1XA 3Q8IA 3D73A 2L4IA 1TNQA 2KAYA 1M39A 2WCJA 3LCPC 1LXFC 2P6BB 1CFCA 3SG7A 2PMYA 1XO5A 5DKRA 5AFPA 1DF0A 1KFUS 2K2AA 1Y1AA 3AKBA 2ZN8A 2F2PA 1CB1A 2WCKA 2KBIA 3SJSA 3LLEA 1CMGA 2BL0C 5AEQA 1W7IB 2A4JA 2FJUB 2KI4B 1K9PA 1MUXA 1NCZA 5F6TA 4ZCUA 4ORCB 5BPJA 1CKKA 1IJ5A 2JQ6A 1WDCC 5KU1A 1DQEA 2LCPA 4N1FA 3VRPA 1SBJA 3SS4A 3CYZA 1ZACA 5DKNA 4INWA 1KWOC 1AJ4A 1SK6D 2GV5A 4ETOA 3UNWA 2K61A 3O4XA 2LVJA 2M97A 5FI7A 5HLOA 3TUYB 1K90D 2LE9B 3GK1A 2WORA 1UHKA 2D8NA 3GK2A 1SNLA 3LK1A 3I5IC 2MLEC 4MRXA 3V2LA 4GAOA 1H4BA 1EJ3A 4NQGA 2WCLA 2LNKA 2BCBA 2QDIA 1EG3A 2BCAA 1J7QA 2P70A 2KQ6A 3WHUB 1FPWA 1SL9A 2KHNA 2PQLA 3CZ0A 1QX5B 5CSNA 2JRFA 2Q4UA 2JT8A 4MLWA 1QIWA 4P5OE 2M3WA 4WQ3A 3PLFB 1KQMB 1SYMA 2PALA 3I5GC 5CSIA 1WY9A 3TS5C 2G2BA 4IL1A 2WOSA 1J1DA 1R2UA 1R6PA 5AANA 1YX7A 2K0JA 1QVIZ 1SSEB 3VRRA 3R1PA 1YX8A 1F8HA 3PFVA 4UPGA 3B6XA 5HLVA 4QJ5B 2JWWA 1JC2A 1DVIA 1Z4HA 1NCXA 5FI2A 2RGIA 2SASA 1CFPA 4HREE 1KFXL 1OW4A 1TWOA 1Y0VH 4MZKA 4DIRA 1NP8A 2QEOA 5GQQC 1NWDA 2L2EA 4KYNA 1S5GY 2NCOA 2HPSA 2LM5A 2DOQA 1ZMZA 3OHMB 1G4YR 3S0DA 5I8NA 4L9MA 1NX1A 2WC6A 5I2LA 2CTNA 3TDIA 4PCWA 1IQ3A 3KEVA 3O4YA 4AQJA 1CM1A 1IG5A 3D75A 3NGVA 2JPOA 3DVKA 3SG5A 2LVVA 3OX6A 1P28A 1MXEA 1G8IA 4PE7A 5HKYA 1NUBA 1Y6WA 3JVTC 3BYAA 3EVRA 1B7TY 1LINA 1RK9A 3I5FC 2H8VA 1KK7Z 1PVAA 2M1KB 1YTZC 3SIAA 1MQ1A 2WCMA 3CZ1A 3EK7A 2KQYA 1C7VA 3S0BA 1V1GA 1IWQA 1A4PA 3PM2A 4JD9A 1K9UA 1M63B 1OOIX 2L50A 2PRUA 1N0YA 1B4CA 2LLTA 3SG2A 1OZOA 1J7RA 3I5HB 2WCBA 1NPQA 2CBLA 1PRWA 3BUXB 4YGCB 1KCYA 2COLB 1YRTB 1DJGA 3PN7B 1UUSA 1DT7B 1OQPA 3PM8A 4OR9B 4OZDA 1LKJA 1BT6A 4FQTA 1T14A 4GBAA 1DJWA 1JBAA 1GQMA 3SS3A 1KK8C 5EL2A 2MJWB 4FQOA 2I94A 1JF2A 5PALA 4F7FA 1XYDA 1SPYA 1IJ6A 3FIAA 1H8BA 2KYFA 3FE8A 1EG4A 1CLBA 1IRJA 1ZUZA 3O2PA
chains in the Genus database with same CATH topology
1X02A 3A4UB 1BR4B 1KFUL 3NSOA 4CIDA 1QJTA 5B8IB 2HQWA 3D0YB 3NSLA 2CCMA 1AJ5A 1K96A 4MN0A 2GGMA 3CZTX 5JJGA 2LHIA 1IKUA 2WNDA 1S1EA 3DF0B 3FWBA 4MEWA 1GJYA 1A75B 1TRFA 1TNWA 1OMDA 2OS8C 1CDPA 1MHOA 1AVSA 1BLQA 2MA2A 1J1EA 2BE4A 3DVMA 1IGVA 4YI9A 4A4BA 1F4QA 2M8UA 3OP0A 3AAKA 2WC8A 3NXAA 4C0KA 2E30A 2NCPA 2ISDA 2ZRTA 1BG1A 1F4OA 2H2KA 4OKHA 1NX0A 2CNPA 1UHHA 3VROA 2K7CA 1TOPA 1L7ZA 3HCMA 4YGDB 3A8RA 1DJXA 3BXKA 2M0RA 5AERA 5IBWA 1TIZA 2R2IA 1QTXA 4R1EA 2B1UA 3BUWB 4BY5A 2O60A 2H61C 4PHKA 3CR5X 3DD4A 2BE6A 3LL8B 1F54A 1RROA 3CR4X 3M0WA 4N5XA 4XJKB 1IH0A 2AUCA 2I18A 5I2QA 1S6JA 1HQVA 2K2FA 2NLNA 2H61A 2KOTA 5HYDA 1QS7A 1XA5A 1UHNA 1XFWO 2Q91A 2LANA 1FW4A 1SCMC 2ZKMX 1M31A 4PHMA 1S6IA 4PHNA 1V1FA 4I5KA 1NX2A 1D1OA 1JUOA 4AOMA 2LVIA 4ORBB 1F71A 2L51A 1SCVA 4MBEA 1SY9A 3HX4A 2HF5A 3VGOA 2JNXA 2KI4C 1NX3A 1BJFA 2G9BA 4GNKB 1QVIY 1QX2A 3CTNA 1FF1A 2CT9A 4MZJA 2JNFA 2LLUA 3JTDC 4YGBB 1CFDA 3BUMB 2EC6B 4GPLB 3AKAA 3TUYC 3ICBA 4P2YB 2ZNDA 2OTGB 1AUIB 1K94A 2JZIA 1CM4A 2LMVA 3CR2A 3K21A 4NDCA 4ORAB 2TN4A 2ZRSA 1K2HA 1GGZA 1TNXA 1DJYA 3GOFA 1NYAA 2K7DA 4MRYA 2VRGA 4DS7A 2LV7A 1S36A 5K89A 3EK4A 2JT0A 2K7OA 1C7WA 2KYCA 2BCXA 1OMRA 3CWGA 3MSEB 2JPTA 1KQMC 3IF7A 2KSPA 2BBNA 2KFHA 2EHBA 4PHJA 1UP5A 1YVHA 2MAZA 3WHTB 2LVKA 1ZOTB 5I2OA 1YR5A 1RECA 1EL4A 1KK7Y 5HKZA 3TZ1A 4CLNA 4I5NB 2M29A 1CDNA 1K95A 5D69A 1NCYA 2LP2A 2OPOA 1SMGA 2PASA 3DVEA 1MF8B 4NDDA 2BKHB 1K8UA 5ER5A 4F0ZB 1CMFA 2JOJA 1A29A 2I7AA 1DMOA 3GK4X 3F45A 2IS9A 3BOWB 1XFYO 5CSFA 1CFFA 1MWNA 2ZN9A 1JFJA 1CLMA 2AAOA 1QIVA 4NDBA 3KO0A 4U8DA 1CDMA 1L2OB 2L4HA 1AP4A 2JTTA 1SR6B 2JU0A 4GUKA 1DF0B 1FBVA 1EXRA 1PALA 2I2RE 4HRHA 1Y1UA 1RWYA 5HKWA 1B47A 1N2DA 1S6CA 4USLA 2JULA 2WCFA 1NIWA 2LHLA 2M49B 2L0PA 3NSIA 1RFJA 1TCFA 2BL0B 2V53A 1CTRA 1JFKA 1J7OA 1MXLC 1MR8A 1XFZO 4YI8A 1WDCB 1FI6A 3RLZA 4PALA 3ZWHA 1XFUO 1KWOB 4A4CA 3AAJA 3I5HC 2FCDA 1YRUB 4DCKA 1UWOA 3PN7C 1VRKA 2KGBC 1AK8A 2JXLA 4DRWA 3I5IB 2KDHA 1TCOB 3KPXA 4GGNA 5FYXA 2ZNEA 1ALWA 2MBXA 2F2OA 2L5XB 4N1GA 1A03A 1OMVA 2LP3A 5JOLA 3WXAA 1SL7A 3BUOB 3IQQA 4DUQA 1AHRA 1QASA 2LUCA 2PVBA 3I5GB 4MZLA 3TS5B 3OB1B 1BODA 1BOCA 3D10A 2KFGA 2KI6D 4WRIA 1SKTA 3SIBA 1QXPA 3BUNB 5TNCA 1KSOA 1YUSA 3TDUA 3CLNA 2NZ0A 1IQ5A 3EKHA 1BF5A 4YGAA 3BQ3A 2BECA 3PALA 1WLZA 2KI6C 1S3PA 3SG4A 4QJ4B 3RM1A 1SL8A 4CPVA 4MSPA 4FTGA 4JWQA 1WRZA 3D0YA 3SG6A 1OOJA 2JTZA 1ALVA 2KAVA 3JTDB 1BMOA 1XFXO 4OVNF 5AXIA 1BU3A 1DJIA 3DF0A 3EVVA 4HSZA 1DTLA 2F8PA 1JSAA 1A75A 2M7NA 1RTP1 1QLSA 4JQ0D 3SG3A 1RJVA 2LAPA 2FCEA 2QACA 1WRKA 4YGEB 4ZCVA 1CLLA 1PSBA 3JVTB 5CSJA 2GGZA 3LK0A 3I5FB 5CPVA 2QPTA 1F55A 5G08A 1OE9B 2SCPA 1GGWA 4OV2A 1JWDA 3OX5A 3VRQA 2BBMA 1QV1A 4MVFA 4QJ3B 1KQVA 4YBHB 3O78A 1S5GZ 1TNPA 4TNCA 1K9KA 2F3YA 1QLKA 2KBMA 1M46A 4M2QA 1ODBA 4M2PA 1CNPA 1OZSA 2WCEA 4GGFC 1FI5A 3O6BA 2E6WA 1U5IB 1JF0A 4CFRA 1UURA 3FWCA 1KK8B 3NSKA 2M9GA 2K8MB 4D1EA 4XJKA 3KHEA 1PULA 2HQ8A 1YVLA 4GGFA 4I5JA 2L98A 1TTXA 1W7JB 1LA0A 4PE4A 1PVBA 1B7TZ 1B8LA 1WLMA 2MLFC 1SW8A 1NSHA 1C07A 2MHHA 1S26D 1UHIA 2M1UA 4PE0A 2F33A 2LUXA 2O5GA 4I5LB 1QATA 1DJHA 2BKIB 1BR1B 2LLSA 2PSRA 2F3ZA 4YRUA 2Y1MA 2KGRA 2Y1NA 2KFFA 4CFQA 2NXQA 1PSRA 3EVUA 4PDZA 1LVCD 1QV0A 3PSRA 2CXJA 1A2XA 1E8AA 4M2OA 4ICBA 4AQIA 1QX7A 1KFXS 2EC6C 5DKQA 2Y4QA 1ZFSA 2OTGC 1Q80A 2LMUA 2OS8B 1DGVA 1XFVO 2LC5A 1DJZA 3VRNA 1PK0D 1UHJA 3ZNIA 1XK4C 1J7PA 4E68A 3QRXA 3FS7A 1YUUA 1OSAA 3IQOA 1B8CA 4HRGA 5D7FA 3CGAA 2JC2A 1EH2A 3KF9A 2ZFDA 1G33A 1XK4A 1N65A 1XVJA 1KSMA 5ER4X 2Y5IA 4JPZB 1U5IA 1WRLA 4C0JA 2MRDA 3E3RA 1M45A 4GFTA 3TDZA 3DVJA 5KTYA 2EGDA 3CS1A 2KNEA 4BY4A 2JT3A 2FOTA 1LA3A 2KAXA 2HETA 4Q04A 3OB2B 4OCIA 1K93D 2AMIA 4C0LA 4PE1A 4WQ2A 3WNXB 1YURA 1B8RA 2K7BA 1CDLA 3EKJA 3PATA 3EK8A 1YUTA 4XYNA 1B9AA 1DGUA 2M7LA 1F70A 1J55A 1L2OC 5KSZA 3C1VA 1SRAA 5J3XA 1B1GA 1TN4A 1HT9A 1SR6C 2JXCA 2LMTA 3BOWA 3H4SE 1SCMB 1Y1XA 2L4IA 1TNQA 2KAYA 1M39A 3LCPC 1CFCA 1LXFC 2P6BB 3SG7A 2PMYA 1XO5A 5DKRA 5AFPA 1DF0A 1KFUS 2K2AA 1Y1AA 3AKBA 2ZN8A 2F2PA 1CB1A 2KBIA 3SJSA 3LLEA 1CMGA 2BL0C 5AEQA 1W7IB 2A4JA 2FJUB 2KI4B 1K9PA 1MUXA 1NCZA 5F6TA 4ZCUA 4ORCB 5BPJA 1CKKA 1IJ5A 2JQ6A 1WDCC 5KU1A 2LCPA 4N1FA 3VRPA 1SBJA 5DKNA 1ZACA 1KWOC 1AJ4A 1SK6D 2GV5A 4ETOA 2K61A 2LVJA 2M97A 5HLOA 3TUYB 1K90D 2LE9B 3GK1A 2WORA 1UHKA 2D8NA 3GK2A 1SNLA 3LK1A 3I5IC 2MLEC 4MRXA 4GAOA 1H4BA 1EJ3A 4NQGA 2LNKA 2BCBA 1EG3A 2BCAA 1J7QA 1FPWA 2KQ6A 3WHUB 1SL9A 2KHNA 1QX5B 5CSNA 2JRFA 2Q4UA 2JT8A 4MLWA 1QIWA 4P5OE 2M3WA 4WQ3A 3PLFB 1KQMB 1SYMA 2PALA 3I5GC 5CSIA 1WY9A 3TS5C 2G2BA 4IL1A 2WOSA 1J1DA 1R2UA 1R6PA 5AANA 1YX7A 2K0JA 1QVIZ 3VRRA 1F8HA 1YX8A 3PFVA 4UPGA 5HLVA 4QJ5B 2JWWA 1JC2A 1DVIA 1NCXA 2RGIA 2SASA 1CFPA 4HREE 1KFXL 1Y0VH 4MZKA 4DIRA 1NP8A 5GQQC 1NWDA 2L2EA 1S5GY 2NCOA 2HPSA 2LM5A 2DOQA 1ZMZA 3OHMB 1G4YR 5I8NA 4L9MA 1NX1A 5I2LA 2CTNA 3TDIA 4PCWA 1IQ3A 3KEVA 3O4YA 4AQJA 1CM1A 1IG5A 3DVKA 3SG5A 2LVVA 3OX6A 1MXEA 1G8IA 4PE7A 5HKYA 1NUBA 1Y6WA 3JVTC 3BYAA 3EVRA 1B7TY 1LINA 1RK9A 3I5FC 1KK7Z 1PVAA 2M1KB 1YTZC 3SIAA 1MQ1A 3EK7A 2KQYA 1C7VA 1V1GA 1IWQA 1A4PA 1K9UA 1M63B 2L50A 2PRUA 1N0YA 1B4CA 2LLTA 3SG2A 1OZOA 1J7RA 3I5HB 2WCBA 1NPQA 2CBLA 1PRWA 3BUXB 4YGCB 1KCYA 2COLB 1YRTB 1DJGA 3PN7B 1UUSA 1DT7B 1OQPA 3PM8A 4OR9B 1LKJA 1BT6A 4GBAA 1DJWA 1JBAA 1GQMA 1KK8C 2MJWB 4FQOA 2I94A 1JF2A 5PALA 1XYDA 1SPYA 1IJ6A 3FIAA 1H8BA 2KYFA 1EG4A 1CLBA 1IRJA 1ZUZA 3O2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X02 A;  3A4U B;  1BR4 B;  1KFU L;  3NSO A;  4CID A;  1QJT A;  5B8I B;  2HQW A;  3D0Y B;  3NSL A;  2CCM A;  1AJ5 A;  1K96 A;  4MN0 A;  2GGM A;  3CZT X;  5JJG A;  2LHI A;  1IKU A;  2WND A;  1S1E A;  3DF0 B;  3FWB A;  4MEW A;  1GJY A;  1A75 B;  1TRF A;  1TNW A;  1OMD A;  2OS8 C;  1CDP A;  1MHO A;  1AVS A;  1BLQ A;  2MA2 A;  1J1E A;  2BE4 A;  3DVM A;  1IGV A;  4YI9 A;  4A4B A;  1F4Q A;  2M8U A;  3OP0 A;  3AAK A;  2WC8 A;  3NXA A;  4C0K A;  2E30 A;  2NCP A;  2ISD A;  2ZRT A;  1BG1 A;  1F4O A;  2H2K A;  4OKH A;  1NX0 A;  2CNP A;  1UHH A;  3VRO A;  2K7C A;  1TOP A;  1L7Z A;  3HCM A;  4YGD B;  3A8R A;  1DJX A;  3BXK A;  2M0R A;  5AER A;  5IBW A;  1TIZ A;  2R2I A;  1QTX A;  4R1E A;  2B1U A;  3BUW B;  4BY5 A;  2O60 A;  2H61 C;  4PHK A;  3CR5 X;  3DD4 A;  2BE6 A;  3LL8 B;  1F54 A;  1RRO A;  3CR4 X;  3M0W A;  4N5X A;  4XJK B;  1IH0 A;  2AUC A;  2I18 A;  5I2Q A;  1S6J A;  1HQV A;  2K2F A;  2NLN A;  2H61 A;  2KOT A;  5HYD A;  1QS7 A;  1XA5 A;  1UHN A;  1XFW O;  2Q91 A;  2LAN A;  1FW4 A;  1SCM C;  2ZKM X;  1M31 A;  4PHM A;  1S6I A;  4PHN A;  1V1F A;  4I5K A;  1NX2 A;  1D1O A;  1JUO A;  4AOM A;  2LVI A;  4ORB B;  1F71 A;  2L51 A;  1SCV A;  4MBE A;  1SY9 A;  3HX4 A;  2HF5 A;  3VGO A;  2JNX A;  2KI4 C;  1NX3 A;  1BJF A;  2G9B A;  4GNK B;  1QVI Y;  1QX2 A;  3CTN A;  1FF1 A;  2CT9 A;  4MZJ A;  2JNF A;  2LLU A;  3JTD C;  4YGB B;  1CFD A;  3BUM B;  2EC6 B;  4GPL B;  3AKA A;  3TUY C;  3ICB A;  4P2Y B;  2ZND A;  2OTG B;  1AUI B;  1K94 A;  2JZI A;  1CM4 A;  2LMV A;  3CR2 A;  3K21 A;  4NDC A;  4ORA B;  2TN4 A;  2ZRS A;  1K2H A;  1GGZ A;  1TNX A;  1DJY A;  3GOF A;  1NYA A;  2K7D A;  4MRY A;  2VRG A;  4DS7 A;  2LV7 A;  1S36 A;  5K89 A;  3EK4 A;  2JT0 A;  2K7O A;  1C7W A;  2KYC A;  2BCX A;  1OMR A;  3CWG A;  3MSE B;  2JPT A;  1KQM C;  3IF7 A;  2KSP A;  2BBN A;  2KFH A;  2EHB A;  4PHJ A;  1UP5 A;  1YVH A;  2MAZ A;  3WHT B;  2LVK A;  1ZOT B;  5I2O A;  1YR5 A;  1REC A;  1EL4 A;  1KK7 Y;  5HKZ A;  3TZ1 A;  4CLN A;  4I5N B;  2M29 A;  1CDN A;  1K95 A;  5D69 A;  1NCY A;  2LP2 A;  2OPO A;  1SMG A;  2PAS A;  3DVE A;  1MF8 B;  4NDD A;  2BKH B;  1K8U A;  5ER5 A;  4F0Z B;  1CMF A;  2JOJ A;  1A29 A;  2I7A A;  1DMO A;  3GK4 X;  3F45 A;  2IS9 A;  3BOW B;  1XFY O;  5CSF A;  1CFF A;  1MWN A;  2ZN9 A;  1JFJ A;  1CLM A;  2AAO A;  1QIV A;  4NDB A;  3KO0 A;  4U8D A;  1CDM A;  1L2O B;  2L4H A;  1AP4 A;  2JTT A;  1SR6 B;  2JU0 A;  4GUK A;  1DF0 B;  1FBV A;  1EXR A;  1PAL A;  2I2R E;  4HRH A;  1Y1U A;  1RWY A;  5HKW A;  1B47 A;  1N2D A;  1S6C A;  4USL A;  2JUL A;  2WCF A;  1NIW A;  2LHL A;  2M49 B;  2L0P A;  3NSI A;  1RFJ A;  1TCF A;  2BL0 B;  2V53 A;  1CTR A;  1JFK A;  1J7O A;  1MXL C;  1MR8 A;  1XFZ O;  4YI8 A;  1WDC B;  1FI6 A;  3RLZ A;  4PAL A;  3ZWH A;  1XFU O;  1KWO B;  4A4C A;  3AAJ A;  3I5H C;  2FCD A;  1YRU B;  4DCK A;  1UWO A;  3PN7 C;  1VRK A;  2KGB C;  1AK8 A;  2JXL A;  4DRW A;  3I5I B;  2KDH A;  1TCO B;  3KPX A;  4GGN A;  5FYX A;  2ZNE A;  1ALW A;  2MBX A;  2F2O A;  2L5X B;  4N1G A;  1A03 A;  1OMV A;  2LP3 A;  5JOL A;  3WXA A;  1SL7 A;  3BUO B;  3IQQ A;  4DUQ A;  1AHR A;  1QAS A;  2LUC A;  2PVB A;  3I5G B;  4MZL A;  3TS5 B;  3OB1 B;  1BOD A;  1BOC A;  3D10 A;  2KFG A;  2KI6 D;  4WRI A;  1SKT A;  3SIB A;  1QXP A;  3BUN B;  5TNC A;  1KSO A;  1YUS A;  3TDU A;  3CLN A;  2NZ0 A;  1IQ5 A;  3EKH A;  1BF5 A;  4YGA A;  3BQ3 A;  2BEC A;  3PAL A;  1WLZ A;  2KI6 C;  1S3P A;  3SG4 A;  4QJ4 B;  3RM1 A;  1SL8 A;  4CPV A;  4MSP A;  4FTG A;  4JWQ A;  1WRZ A;  3D0Y A;  3SG6 A;  1OOJ A;  2JTZ A;  1ALV A;  2KAV A;  3JTD B;  1BMO A;  1XFX O;  4OVN F;  5AXI A;  1BU3 A;  1DJI A;  3DF0 A;  3EVV A;  4HSZ A;  1DTL A;  2F8P A;  1JSA A;  1A75 A;  2M7N A;  1RTP 1;  1QLS A;  4JQ0 D;  3SG3 A;  1RJV A;  2LAP A;  2FCE A;  2QAC A;  1WRK A;  4YGE B;  4ZCV A;  1CLL A;  1PSB A;  3JVT B;  5CSJ A;  2GGZ A;  3LK0 A;  3I5F B;  5CPV A;  2QPT A;  1F55 A;  5G08 A;  1OE9 B;  2SCP A;  1GGW A;  4OV2 A;  1JWD A;  3OX5 A;  3VRQ A;  2BBM A;  1QV1 A;  4MVF A;  4QJ3 B;  1KQV A;  4YBH B;  3O78 A;  1S5G Z;  1TNP A;  4TNC A;  1K9K A;  2F3Y A;  1QLK A;  2KBM A;  1M46 A;  4M2Q A;  1ODB A;  4M2P A;  1CNP A;  1OZS A;  2WCE A;  4GGF C;  1FI5 A;  3O6B A;  2E6W A;  1U5I B;  1JF0 A;  4CFR A;  1UUR A;  3FWC A;  1KK8 B;  3NSK A;  2M9G A;  2K8M B;  4D1E A;  4XJK A;  3KHE A;  1PUL A;  2HQ8 A;  1YVL A;  4GGF A;  4I5J A;  2L98 A;  1TTX A;  1W7J B;  1LA0 A;  4PE4 A;  1PVB A;  1B7T Z;  1B8L A;  1WLM A;  2MLF C;  1SW8 A;  1NSH A;  1C07 A;  2MHH A;  1S26 D;  1UHI A;  2M1U A;  4PE0 A;  2F33 A;  2LUX A;  2O5G A;  4I5L B;  1QAT A;  1DJH A;  2BKI B;  1BR1 B;  2LLS A;  2PSR A;  2F3Z A;  4YRU A;  2Y1M A;  2KGR A;  2Y1N A;  2KFF A;  4CFQ A;  2NXQ A;  1PSR A;  3EVU A;  4PDZ A;  1LVC D;  1QV0 A;  3PSR A;  2CXJ A;  1A2X A;  1E8A A;  4M2O A;  4ICB A;  4AQI A;  1QX7 A;  1KFX S;  2EC6 C;  5DKQ A;  2Y4Q A;  1ZFS A;  2OTG C;  1Q80 A;  2LMU A;  2OS8 B;  1DGV A;  1XFV O;  2LC5 A;  1DJZ A;  3VRN A;  1PK0 D;  1UHJ A;  3ZNI A;  1XK4 C;  1J7P A;  4E68 A;  3QRX A;  3FS7 A;  1YUU A;  1OSA A;  3IQO A;  1B8C A;  4HRG A;  5D7F A;  3CGA A;  2JC2 A;  1EH2 A;  3KF9 A;  2ZFD A;  1G33 A;  1XK4 A;  1N65 A;  1XVJ A;  1KSM A;  5ER4 X;  2Y5I A;  4JPZ B;  1U5I A;  1WRL A;  4C0J A;  2MRD A;  3E3R A;  1M45 A;  4GFT A;  3TDZ A;  3DVJ A;  5KTY A;  2EGD A;  3CS1 A;  2KNE A;  4BY4 A;  2JT3 A;  2FOT A;  1LA3 A;  2KAX A;  2HET A;  4Q04 A;  3OB2 B;  4OCI A;  1K93 D;  2AMI A;  4C0L A;  4PE1 A;  4WQ2 A;  3WNX B;  1YUR A;  1B8R A;  2K7B A;  1CDL A;  3EKJ A;  3PAT A;  3EK8 A;  1YUT A;  4XYN A;  1B9A A;  1DGU A;  2M7L A;  1F70 A;  1J55 A;  1L2O C;  5KSZ A;  3C1V A;  1SRA A;  5J3X A;  1B1G A;  1TN4 A;  1HT9 A;  1SR6 C;  2JXC A;  2LMT A;  3BOW A;  3H4S E;  1SCM B;  1Y1X A;  2L4I A;  1TNQ A;  2KAY A;  1M39 A;  3LCP C;  1CFC A;  1LXF C;  2P6B B;  3SG7 A;  2PMY A;  1XO5 A;  5DKR A;  5AFP A;  1DF0 A;  1KFU S;  2K2A A;  1Y1A A;  3AKB A;  2ZN8 A;  2F2P A;  1CB1 A;  2KBI A;  3SJS A;  3LLE A;  1CMG A;  2BL0 C;  5AEQ A;  1W7I B;  2A4J A;  2FJU B;  2KI4 B;  1K9P A;  1MUX A;  1NCZ A;  5F6T A;  4ZCU A;  4ORC B;  5BPJ A;  1CKK A;  1IJ5 A;  2JQ6 A;  1WDC C;  5KU1 A;  2LCP A;  4N1F A;  3VRP A;  1SBJ A;  5DKN A;  1ZAC A;  1KWO C;  1AJ4 A;  1SK6 D;  2GV5 A;  4ETO A;  2K61 A;  2LVJ A;  2M97 A;  5HLO A;  3TUY B;  1K90 D;  2LE9 B;  3GK1 A;  2WOR A;  1UHK A;  2D8N A;  3GK2 A;  1SNL A;  3LK1 A;  3I5I C;  2MLE C;  4MRX A;  4GAO A;  1H4B A;  1EJ3 A;  4NQG A;  2LNK A;  2BCB A;  1EG3 A;  2BCA A;  1J7Q A;  1FPW A;  2KQ6 A;  3WHU B;  1SL9 A;  2KHN A;  1QX5 B;  5CSN A;  2JRF A;  2Q4U A;  2JT8 A;  4MLW A;  1QIW A;  4P5O E;  2M3W A;  4WQ3 A;  3PLF B;  1KQM B;  1SYM A;  2PAL A;  3I5G C;  5CSI A;  1WY9 A;  3TS5 C;  2G2B A;  4IL1 A;  2WOS A;  1J1D A;  1R2U A;  1R6P A;  5AAN A;  1YX7 A;  2K0J A;  1QVI Z;  3VRR A;  1F8H A;  1YX8 A;  3PFV A;  4UPG A;  5HLV A;  4QJ5 B;  2JWW A;  1JC2 A;  1DVI A;  1NCX A;  2RGI A;  2SAS A;  1CFP A;  4HRE E;  1KFX L;  1Y0V H;  4MZK A;  4DIR A;  1NP8 A;  5GQQ C;  1NWD A;  2L2E A;  1S5G Y;  2NCO A;  2HPS A;  2LM5 A;  2DOQ A;  1ZMZ A;  3OHM B;  1G4Y R;  5I8N A;  4L9M A;  1NX1 A;  5I2L A;  2CTN A;  3TDI A;  4PCW A;  1IQ3 A;  3KEV A;  3O4Y A;  4AQJ A;  1CM1 A;  1IG5 A;  3DVK A;  3SG5 A;  2LVV A;  3OX6 A;  1MXE A;  1G8I A;  4PE7 A;  5HKY A;  1NUB A;  1Y6W A;  3JVT C;  3BYA A;  3EVR A;  1B7T Y;  1LIN A;  1RK9 A;  3I5F C;  1KK7 Z;  1PVA A;  2M1K B;  1YTZ C;  3SIA A;  1MQ1 A;  3EK7 A;  2KQY A;  1C7V A;  1V1G A;  1IWQ A;  1A4P A;  1K9U A;  1M63 B;  2L50 A;  2PRU A;  1N0Y A;  1B4C A;  2LLT A;  3SG2 A;  1OZO A;  1J7R A;  3I5H B;  2WCB A;  1NPQ A;  2CBL A;  1PRW A;  3BUX B;  4YGC B;  1KCY A;  2COL B;  1YRT B;  1DJG A;  3PN7 B;  1UUS A;  1DT7 B;  1OQP A;  3PM8 A;  4OR9 B;  1LKJ A;  1BT6 A;  4GBA A;  1DJW A;  1JBA A;  1GQM A;  1KK8 C;  2MJW B;  4FQO A;  2I94 A;  1JF2 A;  5PAL A;  1XYD A;  1SPY A;  1IJ6 A;  3FIA A;  1H8B A;  2KYF A;  1EG4 A;  1CLB A;  1IRJ A;  1ZUZ A;  3O2P A; 
#chains in the Genus database with same CATH topology
 1X02 A;  3S0G A;  2K60 A;  3A4U B;  1BR4 B;  1KFU L;  3NSO A;  4INX A;  4CID A;  1QJT A;  5B8I B;  2HQW A;  3D0Y B;  3DXL A;  2BNX A;  3NSL A;  2CCM A;  1AJ5 A;  1K96 A;  4MN0 A;  2GGM A;  3CZT X;  5JJG A;  2LHI A;  1IKU A;  2WND A;  3NHI A;  1S1E A;  3DF0 B;  3FWB A;  4MEW A;  1GJY A;  1A75 B;  1TRF A;  1TNW A;  1OMD A;  2OS8 C;  1QWV A;  1CDP A;  1MHO A;  1AVS A;  1BLQ A;  2MA2 A;  1J1E A;  2BE4 A;  3DVM A;  1IGV A;  4YI9 A;  4A4B A;  1F4Q A;  2M8U A;  3OP0 A;  3AAK A;  2WC8 A;  3NXA A;  4C0K A;  2E30 A;  2NCP A;  2ISD A;  2ZRT A;  1BG1 A;  1F4O A;  2H2K A;  4OKH A;  1NX0 A;  3D74 A;  2CNP A;  1UHH A;  1OOH A;  3VRO A;  2K7C A;  1TOP A;  1L7Z A;  3HCM A;  4YGD B;  3A8R A;  1DJX A;  3BXK A;  2M0R A;  5AER A;  5IBW A;  1TIZ A;  2R2I A;  1QTX A;  4R1E A;  2B1U A;  3BUW B;  2FJY A;  4BY5 A;  2O60 A;  2H61 C;  4PHK A;  3CR5 X;  3DD4 A;  3OGN A;  2BE6 A;  3LL8 B;  1F54 A;  1RRO A;  3CR4 X;  3M0W A;  4N5X A;  4XJK B;  1IH0 A;  2AUC A;  2I18 A;  5I2Q A;  1S6J A;  1HQV A;  2K2F A;  2NLN A;  2H61 A;  2KOT A;  5HYD A;  1QS7 A;  1XA5 A;  1UHN A;  1XFW O;  2Q91 A;  3CAB A;  5FI6 A;  2LAN A;  2WCH A;  1FW4 A;  1SCM C;  2ZKM X;  1M31 A;  4PHM A;  1S6I A;  4PHN A;  1V1F A;  4I5K A;  1NX2 A;  1D1O A;  1JUO A;  4AOM A;  2LVI A;  4ORB B;  1F71 A;  2L51 A;  1SCV A;  4MBE A;  1SY9 A;  3HX4 A;  2HF5 A;  2QEV A;  3VGO A;  2KLE A;  2JNX A;  3D77 A;  2KI4 C;  1NX3 A;  1BJF A;  2G9B A;  4GNK B;  1QVI Y;  1QX2 A;  3R1V A;  3CTN A;  1FF1 A;  1LS8 A;  1W9Z A;  2CT9 A;  4MZJ A;  1TUZ A;  4JKT A;  2JNF A;  2LLU A;  3JTD C;  4YGB B;  1CFD A;  3BFH A;  3BUM B;  2EC6 B;  4GPL B;  3AKA A;  3TUY C;  3ICB A;  4P2Y B;  2ZND A;  2OTG B;  1AUI B;  1K94 A;  2JZI A;  1CM4 A;  1DEL A;  2LMV A;  3CR2 A;  3K21 A;  4NDC A;  2TN4 A;  2ZRS A;  3CDN A;  1GGZ A;  4ORA B;  1K2H A;  1TNX A;  1DJY A;  3R72 A;  3GOF A;  1NYA A;  2K7D A;  3IVT A;  4MRY A;  2VRG A;  4DS7 A;  2LV7 A;  3B88 A;  1S36 A;  5K89 A;  3EK4 A;  3B7A A;  2JT0 A;  3SS5 A;  2K7O A;  1C7W A;  1Z2C B;  2KYC A;  2BCX A;  1OMR A;  3CWG A;  3D76 A;  2JPT A;  3MSE B;  1KQM C;  3S0A A;  3NHT A;  3IF7 A;  2KSP A;  2BBN A;  2KFH A;  2EHB A;  4PHJ A;  1UP5 A;  1YVH A;  2MAZ A;  3WHT B;  2LVK A;  1ZOT B;  5I2O A;  1YR5 A;  1OOF A;  1REC A;  1EL4 A;  1KK7 Y;  5HKZ A;  3TZ1 A;  4CLN A;  4I5N B;  2M29 A;  2P71 A;  1CDN A;  1K95 A;  5D69 A;  1NCY A;  2LP2 A;  2OPO A;  1SMG A;  2PAS A;  3DVE A;  1MF8 B;  4NDD A;  2BKH B;  1K8U A;  5ER5 A;  4F0Z B;  1CMF A;  2JOJ A;  1A29 A;  1DEK A;  2I7A A;  1DMO A;  3GK4 X;  2YGU A;  3F45 A;  4PT1 A;  2IS9 A;  3BOW B;  1XFY O;  3R1O A;  5CSF A;  1MWN A;  2ZN9 A;  1CFF A;  1JFJ A;  1CLM A;  2AAO A;  1QIV A;  4NDB A;  3KO0 A;  4U8D A;  1CDM A;  1L2O B;  2L4H A;  1AP4 A;  2JTT A;  1SR6 B;  2JU0 A;  4GUK A;  1DF0 B;  1FBV A;  1EXR A;  1PAL A;  2I2R E;  4HRH A;  1Y1U A;  1RWY A;  5HKW A;  1B47 A;  1N2D A;  1S6C A;  4USL A;  2JUL A;  2WCF A;  1NIW A;  2LHL A;  2M49 B;  2L0P A;  3NSI A;  1RFJ A;  1TCF A;  2BL0 B;  2V53 A;  1CTR A;  2ERB A;  1JFK A;  1J7O A;  1MXL C;  1MR8 A;  1XFZ O;  4YI8 A;  1WDC B;  1FI6 A;  3RLZ A;  4IJ7 A;  4PAL A;  3ZWH A;  1XFU O;  2WC5 A;  1KWO B;  3EG5 B;  4A4C A;  3AAJ A;  3I5H C;  2FCD A;  1YRU B;  4DCK A;  1UWO A;  1TUJ A;  3PN7 C;  1VRK A;  2KGB C;  1AK8 A;  2JXL A;  4DRW A;  3I5I B;  2KDH A;  1TCO B;  3KPX A;  4GGN A;  5FYX A;  2ZNE A;  1ALW A;  2MBX A;  2F2O A;  2L5X B;  4N1G A;  3FE9 A;  1A03 A;  1OMV A;  2LP3 A;  5JOL A;  5I94 A;  3WXA A;  1SL7 A;  3BUO B;  3IQQ A;  4DUQ A;  1AHR A;  1QAS A;  2LUC A;  2PVB A;  3I5G B;  3PJI A;  1C3Z A;  4MZL A;  3OB1 B;  3TS5 B;  1BOD A;  3D10 A;  1BOC A;  2KFG A;  2KI6 D;  4WRI A;  1SKT A;  3SIB A;  1QXP A;  2L2C A;  3BUN B;  5TNC A;  1KSO A;  1YUS A;  3TDU A;  3CLN A;  2NZ0 A;  1IQ5 A;  3EKH A;  1BF5 A;  4YGA A;  3BQ3 A;  2BEC A;  1XFR A;  3PAL A;  1WLZ A;  2KI6 C;  1S3P A;  3SG4 A;  4QJ4 B;  3RM1 A;  1SL8 A;  4CPV A;  4MSP A;  2L5Y A;  4FTG A;  4JWQ A;  1WRZ A;  3D0Y A;  5D3O A;  3SG6 A;  1OOJ A;  2JTZ A;  1ALV A;  2KAV A;  3DY9 A;  3QME A;  3JTD B;  1BMO A;  1XFX O;  4OVN F;  5AXI A;  1BU3 A;  1DJI A;  1C3Y A;  3DF0 A;  3EVV A;  4HSZ A;  1DTL A;  2F8P A;  3DZT A;  3DYE A;  1JSA A;  1A75 A;  2M7N A;  1RTP 1;  1QLS A;  4JQ0 D;  3SG3 A;  1RJV A;  3FE6 A;  2LAP A;  2FCE A;  2QAC A;  1WRK A;  4YGE B;  4ZCV A;  1CLL A;  2GTE A;  1PSB A;  3JVT B;  1DC1 A;  5CSJ A;  2GGZ A;  3LK0 A;  3I5F B;  5CPV A;  2QPT A;  1F55 A;  3UO9 A;  3RZS A;  5G08 A;  1OE9 B;  2SCP A;  1GGW A;  4OV2 A;  1JWD A;  1OOG A;  3OX5 A;  3VRQ A;  2BAP A;  2BBM A;  1QV1 A;  4MVF A;  4QJ3 B;  1KQV A;  4YBH B;  3O78 A;  1S5G Z;  1TNP A;  4TNC A;  1K9K A;  1GM0 A;  2F3Y A;  1QLK A;  2KBM A;  1M46 A;  4M2Q A;  1ODB A;  4M2P A;  5HL1 A;  1CNP A;  1OZS A;  2WCE A;  4GGF C;  1FI5 A;  3O6B A;  2E6W A;  1U5I B;  1JF0 A;  4CFR A;  1UUR A;  3FWC A;  1KK8 B;  3NSK A;  2M9G A;  2K8M B;  4D1E A;  4XJK A;  3KHE A;  1PUL A;  2HQ8 A;  1YVL A;  3K1E A;  4GGF A;  2L98 A;  4I5J A;  1TTX A;  1W7J B;  1LA0 A;  4PE4 A;  1PVB A;  1B7T Z;  1B8L A;  1WLM A;  2MLF C;  1SW8 A;  1NSH A;  1C07 A;  2MHH A;  1S26 D;  1UHI A;  2M1U A;  4PE0 A;  2KLD A;  2F33 A;  2LUX A;  2O5G A;  4I5L B;  1QAT A;  1DJH A;  3B86 A;  2BKI B;  1BR1 B;  2LLS A;  3BFB A;  2PSR A;  2F3Z A;  4YRU A;  2Y1M A;  1IIO A;  2KGR A;  3OBV A;  2Y1N A;  2KFF A;  4CFQ A;  1ORG A;  2NXQ A;  1PSR A;  3EVU A;  4PDZ A;  1LVC D;  1QV0 A;  3PSR A;  2CXJ A;  1A2X A;  1E8A A;  4M2O A;  4ICB A;  4AQI A;  1QX7 A;  3L4L A;  1KFX S;  2EC6 C;  5DKQ A;  3VB1 A;  2Y4Q A;  1ZFS A;  2OTG C;  1Q80 A;  2LMU A;  2OS8 B;  3CZ2 A;  1DGV A;  1XFV O;  2LC5 A;  3D78 A;  5DIC A;  1DJZ A;  3VRN A;  1PK0 D;  1UHJ A;  3ZNI A;  1XK4 C;  3L47 A;  1J7P A;  4E68 A;  3QRX A;  3FS7 A;  1YUU A;  1OSA A;  3BJH A;  1B8C A;  3IQO A;  4HRG A;  5D7F A;  3CGA A;  2JC2 A;  1EH2 A;  3KF9 A;  2ZFD A;  1G33 A;  1XK4 A;  1N65 A;  1XVJ A;  1KSM A;  5ER4 X;  2Y5I A;  3S0F A;  4JPZ B;  1U5I A;  1WRL A;  4C0J A;  3B87 A;  2MRD A;  3E3R A;  1M45 A;  4GFT A;  3TDZ A;  3DVJ A;  5KTY A;  2EGD A;  3CS1 A;  2KNE A;  4BY4 A;  2JT3 A;  2FOT A;  1LA3 A;  2KAX A;  2HET A;  4Q04 A;  3OB2 B;  3BFA A;  4OCI A;  1K93 D;  2AMI A;  4C0L A;  4PE1 A;  4WQ2 A;  3WNX B;  1YUR A;  2KPH A;  1B8R A;  2QEB A;  2K7B A;  1CDL A;  2PYQ A;  3EKJ A;  3N7H A;  3EK8 A;  1YUT A;  3PAT A;  3S0E A;  4XYN A;  1B9A A;  1DGU A;  2M7L A;  1F70 A;  2QEH A;  1J55 A;  1L2O C;  5KSZ A;  3C1V A;  1SRA A;  3L4A A;  5J3X A;  1TN4 A;  1B1G A;  1HT9 A;  1SR6 C;  2JXC A;  2LMT A;  3BOW A;  3H4S E;  1SCM B;  1Y1X A;  3Q8I A;  3D73 A;  2L4I A;  1TNQ A;  2KAY A;  1M39 A;  2WCJ A;  3LCP C;  1LXF C;  2P6B B;  1CFC A;  3SG7 A;  2PMY A;  1XO5 A;  5DKR A;  5AFP A;  1DF0 A;  1KFU S;  2K2A A;  1Y1A A;  3AKB A;  2ZN8 A;  2F2P A;  1CB1 A;  2WCK A;  2KBI A;  3SJS A;  3LLE A;  1CMG A;  2BL0 C;  5AEQ A;  1W7I B;  2A4J A;  2FJU B;  2KI4 B;  1K9P A;  1MUX A;  1NCZ A;  5F6T A;  4ZCU A;  4ORC B;  5BPJ A;  1CKK A;  1IJ5 A;  2JQ6 A;  1WDC C;  5KU1 A;  1DQE A;  2LCP A;  4N1F A;  3VRP A;  1SBJ A;  3SS4 A;  3CYZ A;  1ZAC A;  5DKN A;  4INW A;  1KWO C;  1AJ4 A;  1SK6 D;  2GV5 A;  4ETO A;  3UNW A;  2K61 A;  3O4X A;  2LVJ A;  2M97 A;  5FI7 A;  5HLO A;  3TUY B;  1K90 D;  2LE9 B;  3GK1 A;  2WOR A;  1UHK A;  2D8N A;  3GK2 A;  1SNL A;  3LK1 A;  3I5I C;  2MLE C;  4MRX A;  3V2L A;  4GAO A;  1H4B A;  1EJ3 A;  4NQG A;  2WCL A;  2LNK A;  2BCB A;  2QDI A;  1EG3 A;  2BCA A;  1J7Q A;  2P70 A;  2KQ6 A;  3WHU B;  1FPW A;  1SL9 A;  2KHN A;  2PQL A;  3CZ0 A;  1QX5 B;  5CSN A;  2JRF A;  2Q4U A;  2JT8 A;  4MLW A;  1QIW A;  4P5O E;  2M3W A;  4WQ3 A;  3PLF B;  1KQM B;  1SYM A;  2PAL A;  3I5G C;  5CSI A;  1WY9 A;  3TS5 C;  2G2B A;  4IL1 A;  2WOS A;  1J1D A;  1R2U A;  1R6P A;  5AAN A;  1YX7 A;  2K0J A;  1QVI Z;  1SSE B;  3VRR A;  3R1P A;  1YX8 A;  1F8H A;  3PFV A;  4UPG A;  3B6X A;  5HLV A;  4QJ5 B;  2JWW A;  1JC2 A;  1DVI A;  1Z4H A;  1NCX A;  5FI2 A;  2RGI A;  2SAS A;  1CFP A;  4HRE E;  1KFX L;  1OW4 A;  1TWO A;  1Y0V H;  4MZK A;  4DIR A;  1NP8 A;  2QEO A;  5GQQ C;  1NWD A;  2L2E A;  4KYN A;  1S5G Y;  2NCO A;  2HPS A;  2LM5 A;  2DOQ A;  1ZMZ A;  3OHM B;  1G4Y R;  3S0D A;  5I8N A;  4L9M A;  1NX1 A;  2WC6 A;  5I2L A;  2CTN A;  3TDI A;  4PCW A;  1IQ3 A;  3KEV A;  3O4Y A;  4AQJ A;  1CM1 A;  1IG5 A;  3D75 A;  3NGV A;  2JPO A;  3DVK A;  3SG5 A;  2LVV A;  3OX6 A;  1P28 A;  1MXE A;  1G8I A;  4PE7 A;  5HKY A;  1NUB A;  1Y6W A;  3JVT C;  3BYA A;  3EVR A;  1B7T Y;  1LIN A;  1RK9 A;  3I5F C;  2H8V A;  1KK7 Z;  1PVA A;  2M1K B;  1YTZ C;  3SIA A;  1MQ1 A;  2WCM A;  3CZ1 A;  3EK7 A;  2KQY A;  1C7V A;  3S0B A;  1V1G A;  1IWQ A;  1A4P A;  3PM2 A;  4JD9 A;  1K9U A;  1M63 B;  1OOI X;  2L50 A;  2PRU A;  1N0Y A;  1B4C A;  2LLT A;  3SG2 A;  1OZO A;  1J7R A;  3I5H B;  2WCB A;  1NPQ A;  2CBL A;  1PRW A;  3BUX B;  4YGC B;  1KCY A;  2COL B;  1YRT B;  1DJG A;  3PN7 B;  1UUS A;  1DT7 B;  1OQP A;  3PM8 A;  4OR9 B;  4OZD A;  1LKJ A;  1BT6 A;  4FQT A;  1T14 A;  4GBA A;  1DJW A;  1JBA A;  1GQM A;  3SS3 A;  1KK8 C;  5EL2 A;  2MJW B;  4FQO A;  2I94 A;  1JF2 A;  5PAL A;  4F7F A;  1XYD A;  1SPY A;  1IJ6 A;  3FIA A;  1H8B A;  2KYF A;  3FE8 A;  1EG4 A;  1CLB A;  1IRJ A;  1ZUZ A;  3O2P A; 
#chains in the Genus database with same CATH homology
 1X02 A;  3A4U B;  1BR4 B;  1KFU L;  3NSO A;  4CID A;  1QJT A;  5B8I B;  2HQW A;  3D0Y B;  3NSL A;  2CCM A;  1AJ5 A;  1K96 A;  4MN0 A;  2GGM A;  3CZT X;  5JJG A;  2LHI A;  1IKU A;  2WND A;  1S1E A;  3DF0 B;  3FWB A;  4MEW A;  1GJY A;  1A75 B;  1TRF A;  1TNW A;  1OMD A;  2OS8 C;  1CDP A;  1MHO A;  1AVS A;  1BLQ A;  2MA2 A;  1J1E A;  2BE4 A;  3DVM A;  1IGV A;  4YI9 A;  4A4B A;  1F4Q A;  2M8U A;  3OP0 A;  3AAK A;  2WC8 A;  3NXA A;  4C0K A;  2E30 A;  2NCP A;  2ISD A;  2ZRT A;  1BG1 A;  1F4O A;  2H2K A;  4OKH A;  1NX0 A;  2CNP A;  1UHH A;  3VRO A;  2K7C A;  1TOP A;  1L7Z A;  3HCM A;  4YGD B;  3A8R A;  1DJX A;  3BXK A;  2M0R A;  5AER A;  5IBW A;  1TIZ A;  2R2I A;  1QTX A;  4R1E A;  2B1U A;  3BUW B;  4BY5 A;  2O60 A;  2H61 C;  4PHK A;  3CR5 X;  3DD4 A;  2BE6 A;  3LL8 B;  1F54 A;  1RRO A;  3CR4 X;  3M0W A;  4N5X A;  4XJK B;  1IH0 A;  2AUC A;  2I18 A;  5I2Q A;  1S6J A;  1HQV A;  2K2F A;  2NLN A;  2H61 A;  2KOT A;  5HYD A;  1QS7 A;  1XA5 A;  1UHN A;  1XFW O;  2Q91 A;  2LAN A;  1FW4 A;  1SCM C;  2ZKM X;  1M31 A;  4PHM A;  1S6I A;  4PHN A;  1V1F A;  4I5K A;  1NX2 A;  1D1O A;  1JUO A;  4AOM A;  2LVI A;  4ORB B;  1F71 A;  2L51 A;  1SCV A;  4MBE A;  1SY9 A;  3HX4 A;  2HF5 A;  3VGO A;  2JNX A;  2KI4 C;  1NX3 A;  1BJF A;  2G9B A;  4GNK B;  1QVI Y;  1QX2 A;  3CTN A;  1FF1 A;  2CT9 A;  4MZJ A;  2JNF A;  2LLU A;  3JTD C;  4YGB B;  1CFD A;  3BUM B;  2EC6 B;  4GPL B;  3AKA A;  3TUY C;  3ICB A;  4P2Y B;  2ZND A;  2OTG B;  1AUI B;  1K94 A;  2JZI A;  1CM4 A;  2LMV A;  3CR2 A;  3K21 A;  4NDC A;  4ORA B;  2TN4 A;  2ZRS A;  1K2H A;  1GGZ A;  1TNX A;  1DJY A;  3GOF A;  1NYA A;  2K7D A;  4MRY A;  2VRG A;  4DS7 A;  2LV7 A;  1S36 A;  5K89 A;  3EK4 A;  2JT0 A;  2K7O A;  1C7W A;  2KYC A;  2BCX A;  1OMR A;  3CWG A;  3MSE B;  2JPT A;  1KQM C;  3IF7 A;  2KSP A;  2BBN A;  2KFH A;  2EHB A;  4PHJ A;  1UP5 A;  1YVH A;  2MAZ A;  3WHT B;  2LVK A;  1ZOT B;  5I2O A;  1YR5 A;  1REC A;  1EL4 A;  1KK7 Y;  5HKZ A;  3TZ1 A;  4CLN A;  4I5N B;  2M29 A;  1CDN A;  1K95 A;  5D69 A;  1NCY A;  2LP2 A;  2OPO A;  1SMG A;  2PAS A;  3DVE A;  1MF8 B;  4NDD A;  2BKH B;  1K8U A;  5ER5 A;  4F0Z B;  1CMF A;  2JOJ A;  1A29 A;  2I7A A;  1DMO A;  3GK4 X;  3F45 A;  2IS9 A;  3BOW B;  1XFY O;  5CSF A;  1CFF A;  1MWN A;  2ZN9 A;  1JFJ A;  1CLM A;  2AAO A;  1QIV A;  4NDB A;  3KO0 A;  4U8D A;  1CDM A;  1L2O B;  2L4H A;  1AP4 A;  2JTT A;  1SR6 B;  2JU0 A;  4GUK A;  1DF0 B;  1FBV A;  1EXR A;  1PAL A;  2I2R E;  4HRH A;  1Y1U A;  1RWY A;  5HKW A;  1B47 A;  1N2D A;  1S6C A;  4USL A;  2JUL A;  2WCF A;  1NIW A;  2LHL A;  2M49 B;  2L0P A;  3NSI A;  1RFJ A;  1TCF A;  2BL0 B;  2V53 A;  1CTR A;  1JFK A;  1J7O A;  1MXL C;  1MR8 A;  1XFZ O;  4YI8 A;  1WDC B;  1FI6 A;  3RLZ A;  4PAL A;  3ZWH A;  1XFU O;  1KWO B;  4A4C A;  3AAJ A;  3I5H C;  2FCD A;  1YRU B;  4DCK A;  1UWO A;  3PN7 C;  1VRK A;  2KGB C;  1AK8 A;  2JXL A;  4DRW A;  3I5I B;  2KDH A;  1TCO B;  3KPX A;  4GGN A;  5FYX A;  2ZNE A;  1ALW A;  2MBX A;  2F2O A;  2L5X B;  4N1G A;  1A03 A;  1OMV A;  2LP3 A;  5JOL A;  3WXA A;  1SL7 A;  3BUO B;  3IQQ A;  4DUQ A;  1AHR A;  1QAS A;  2LUC A;  2PVB A;  3I5G B;  4MZL A;  3TS5 B;  3OB1 B;  1BOD A;  1BOC A;  3D10 A;  2KFG A;  2KI6 D;  4WRI A;  1SKT A;  3SIB A;  1QXP A;  3BUN B;  5TNC A;  1KSO A;  1YUS A;  3TDU A;  3CLN A;  2NZ0 A;  1IQ5 A;  3EKH A;  1BF5 A;  4YGA A;  3BQ3 A;  2BEC A;  3PAL A;  1WLZ A;  2KI6 C;  1S3P A;  3SG4 A;  4QJ4 B;  3RM1 A;  1SL8 A;  4CPV A;  4MSP A;  4FTG A;  4JWQ A;  1WRZ A;  3D0Y A;  3SG6 A;  1OOJ A;  2JTZ A;  1ALV A;  2KAV A;  3JTD B;  1BMO A;  1XFX O;  4OVN F;  5AXI A;  1BU3 A;  1DJI A;  3DF0 A;  3EVV A;  4HSZ A;  1DTL A;  2F8P A;  1JSA A;  1A75 A;  2M7N A;  1RTP 1;  1QLS A;  4JQ0 D;  3SG3 A;  1RJV A;  2LAP A;  2FCE A;  2QAC A;  1WRK A;  4YGE B;  4ZCV A;  1CLL A;  1PSB A;  3JVT B;  5CSJ A;  2GGZ A;  3LK0 A;  3I5F B;  5CPV A;  2QPT A;  1F55 A;  5G08 A;  1OE9 B;  2SCP A;  1GGW A;  4OV2 A;  1JWD A;  3OX5 A;  3VRQ A;  2BBM A;  1QV1 A;  4MVF A;  4QJ3 B;  1KQV A;  4YBH B;  3O78 A;  1S5G Z;  1TNP A;  4TNC A;  1K9K A;  2F3Y A;  1QLK A;  2KBM A;  1M46 A;  4M2Q A;  1ODB A;  4M2P A;  1CNP A;  1OZS A;  2WCE A;  4GGF C;  1FI5 A;  3O6B A;  2E6W A;  1U5I B;  1JF0 A;  4CFR A;  1UUR A;  3FWC A;  1KK8 B;  3NSK A;  2M9G A;  2K8M B;  4D1E A;  4XJK A;  3KHE A;  1PUL A;  2HQ8 A;  1YVL A;  4GGF A;  4I5J A;  2L98 A;  1TTX A;  1W7J B;  1LA0 A;  4PE4 A;  1PVB A;  1B7T Z;  1B8L A;  1WLM A;  2MLF C;  1SW8 A;  1NSH A;  1C07 A;  2MHH A;  1S26 D;  1UHI A;  2M1U A;  4PE0 A;  2F33 A;  2LUX A;  2O5G A;  4I5L B;  1QAT A;  1DJH A;  2BKI B;  1BR1 B;  2LLS A;  2PSR A;  2F3Z A;  4YRU A;  2Y1M A;  2KGR A;  2Y1N A;  2KFF A;  4CFQ A;  2NXQ A;  1PSR A;  3EVU A;  4PDZ A;  1LVC D;  1QV0 A;  3PSR A;  2CXJ A;  1A2X A;  1E8A A;  4M2O A;  4ICB A;  4AQI A;  1QX7 A;  1KFX S;  2EC6 C;  5DKQ A;  2Y4Q A;  1ZFS A;  2OTG C;  1Q80 A;  2LMU A;  2OS8 B;  1DGV A;  1XFV O;  2LC5 A;  1DJZ A;  3VRN A;  1PK0 D;  1UHJ A;  3ZNI A;  1XK4 C;  1J7P A;  4E68 A;  3QRX A;  3FS7 A;  1YUU A;  1OSA A;  3IQO A;  1B8C A;  4HRG A;  5D7F A;  3CGA A;  2JC2 A;  1EH2 A;  3KF9 A;  2ZFD A;  1G33 A;  1XK4 A;  1N65 A;  1XVJ A;  1KSM A;  5ER4 X;  2Y5I A;  4JPZ B;  1U5I A;  1WRL A;  4C0J A;  2MRD A;  3E3R A;  1M45 A;  4GFT A;  3TDZ A;  3DVJ A;  5KTY A;  2EGD A;  3CS1 A;  2KNE A;  4BY4 A;  2JT3 A;  2FOT A;  1LA3 A;  2KAX A;  2HET A;  4Q04 A;  3OB2 B;  4OCI A;  1K93 D;  2AMI A;  4C0L A;  4PE1 A;  4WQ2 A;  3WNX B;  1YUR A;  1B8R A;  2K7B A;  1CDL A;  3EKJ A;  3PAT A;  3EK8 A;  1YUT A;  4XYN A;  1B9A A;  1DGU A;  2M7L A;  1F70 A;  1J55 A;  1L2O C;  5KSZ A;  3C1V A;  1SRA A;  5J3X A;  1B1G A;  1TN4 A;  1HT9 A;  1SR6 C;  2JXC A;  2LMT A;  3BOW A;  3H4S E;  1SCM B;  1Y1X A;  2L4I A;  1TNQ A;  2KAY A;  1M39 A;  3LCP C;  1CFC A;  1LXF C;  2P6B B;  3SG7 A;  2PMY A;  1XO5 A;  5DKR A;  5AFP A;  1DF0 A;  1KFU S;  2K2A A;  1Y1A A;  3AKB A;  2ZN8 A;  2F2P A;  1CB1 A;  2KBI A;  3SJS A;  3LLE A;  1CMG A;  2BL0 C;  5AEQ A;  1W7I B;  2A4J A;  2FJU B;  2KI4 B;  1K9P A;  1MUX A;  1NCZ A;  5F6T A;  4ZCU A;  4ORC B;  5BPJ A;  1CKK A;  1IJ5 A;  2JQ6 A;  1WDC C;  5KU1 A;  2LCP A;  4N1F A;  3VRP A;  1SBJ A;  5DKN A;  1ZAC A;  1KWO C;  1AJ4 A;  1SK6 D;  2GV5 A;  4ETO A;  2K61 A;  2LVJ A;  2M97 A;  5HLO A;  3TUY B;  1K90 D;  2LE9 B;  3GK1 A;  2WOR A;  1UHK A;  2D8N A;  3GK2 A;  1SNL A;  3LK1 A;  3I5I C;  2MLE C;  4MRX A;  4GAO A;  1H4B A;  1EJ3 A;  4NQG A;  2LNK A;  2BCB A;  1EG3 A;  2BCA A;  1J7Q A;  1FPW A;  2KQ6 A;  3WHU B;  1SL9 A;  2KHN A;  1QX5 B;  5CSN A;  2JRF A;  2Q4U A;  2JT8 A;  4MLW A;  1QIW A;  4P5O E;  2M3W A;  4WQ3 A;  3PLF B;  1KQM B;  1SYM A;  2PAL A;  3I5G C;  5CSI A;  1WY9 A;  3TS5 C;  2G2B A;  4IL1 A;  2WOS A;  1J1D A;  1R2U A;  1R6P A;  5AAN A;  1YX7 A;  2K0J A;  1QVI Z;  3VRR A;  1F8H A;  1YX8 A;  3PFV A;  4UPG A;  5HLV A;  4QJ5 B;  2JWW A;  1JC2 A;  1DVI A;  1NCX A;  2RGI A;  2SAS A;  1CFP A;  4HRE E;  1KFX L;  1Y0V H;  4MZK A;  4DIR A;  1NP8 A;  5GQQ C;  1NWD A;  2L2E A;  1S5G Y;  2NCO A;  2HPS A;  2LM5 A;  2DOQ A;  1ZMZ A;  3OHM B;  1G4Y R;  5I8N A;  4L9M A;  1NX1 A;  5I2L A;  2CTN A;  3TDI A;  4PCW A;  1IQ3 A;  3KEV A;  3O4Y A;  4AQJ A;  1CM1 A;  1IG5 A;  3DVK A;  3SG5 A;  2LVV A;  3OX6 A;  1MXE A;  1G8I A;  4PE7 A;  5HKY A;  1NUB A;  1Y6W A;  3JVT C;  3BYA A;  3EVR A;  1B7T Y;  1LIN A;  1RK9 A;  3I5F C;  1KK7 Z;  1PVA A;  2M1K B;  1YTZ C;  3SIA A;  1MQ1 A;  3EK7 A;  2KQY A;  1C7V A;  1V1G A;  1IWQ A;  1A4P A;  1K9U A;  1M63 B;  2L50 A;  2PRU A;  1N0Y A;  1B4C A;  2LLT A;  3SG2 A;  1OZO A;  1J7R A;  3I5H B;  2WCB A;  1NPQ A;  2CBL A;  1PRW A;  3BUX B;  4YGC B;  1KCY A;  2COL B;  1YRT B;  1DJG A;  3PN7 B;  1UUS A;  1DT7 B;  1OQP A;  3PM8 A;  4OR9 B;  1LKJ A;  1BT6 A;  4GBA A;  1DJW A;  1JBA A;  1GQM A;  1KK8 C;  2MJW B;  4FQO A;  2I94 A;  1JF2 A;  5PAL A;  1XYD A;  1SPY A;  1IJ6 A;  3FIA A;  1H8B A;  2KYF A;  1EG4 A;  1CLB A;  1IRJ A;  1ZUZ A;  3O2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...