1KQMB

Scallop myosin s1-amppnp in the actin-detached conformation
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
142
structure length
142
Chain Sequence
b'PQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKGSGEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYOSIN heavy chain
publication title Crystallographic findings on the internally uncoupled and near-rigor states of myosin: Further insights into the mechanics of the motor
pubmed doi rcsb
molecule tags Contractile protein
total genus 30
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2002-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kqmB01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kqmB02
1PK0D 1IJ5A 4FTGA 1QX5B 2LVJA 1K9KA 4ETOA 4MLWA 1NCXA 4NDBA 5FYXA 3BUWB 1PVBA 3BUNB 3SIBA 2E6WA 1B8CA 4A4CA 1TNPA 1UWOA 5J3XA 1IQ3A 1AP4A 1IG5A 4GPLB 1K9UA 3LK1A 5DKQA 1B47A 1CMFA 1G4YR 3VGOA 2I94A 1YUSA 4XJKA 3PN7C 3SG2A 1TNQA 3E3RA 3I5GC 1UHHA 4N1GA 1K95A 1F4QA 3EVVA 1CLLA 1S26D 1XFYO 4ZCVA 1LA3A 4M2QA 4OCIA 2BBNA 4AOMA 1OOJA 2JXCA 1TOPA 2F33A 1YURA 2MBXA 1XVJA 1CDMA 4PE1A 1LINA 2OTGC 4QJ4B 1NYAA 4PDZA 2AMIA 2M49B 2WCFA 1K93D 5I2LA 1BOCA 2HQWA 1SNLA 3I5FB 1WRZA 1KWOC 2HETA 1CTRA 1L7ZA 1PSRA 1S6CA 1Y1AA 1SL8A 4CLNA 5I2QA 4GGFC 5AEQA 2DOQA 1YX8A 5AXIA 4MZLA 4MRXA 2M97A 2FOTA 1K96A 3KO0A 1YVHA 3A4UB 4DUQA 3I5IB 3JVTB 1FW4A 1R6PA 2JWWA 1KK7Z 1WY9A 2CT9A 1CLBA 1XFWO 2VRGA 3O4YA 2Q4UA 4YGBB 1AJ4A 4N1FA 1KSOA 1KK7Y 2M8UA 1SK6D 2Y5IA 2BCBA 2KI6D 2K7OA 3AKBA 3TDUA 1JBAA 2ISDA 1B8LA 1WRKA 2MJWB 3SJSA 2LLTA 3WNXB 1XO5A 1JC2A 4WRIA 1DJIA 1CM4A 2JC2A 2JTTA 2EHBA 2GGMA 2M0RA 4C0JA 3CR5X 3KF9A 1G8IA 1H8BA 2I7AA 2NCOA 3SG5A 1MQ1A 1J55A 1SR6B 1CM1A 2KHNA 2MLFC 3OX5A 2JOJA 2LVKA 3ICBA 4MBEA 1Y1UA 1NX2A 2M9GA 1IJ6A 2L4HA 4DCKA 1B7TZ 1SRAA 1BT6A 3EK8A 1KCYA 4ICBA 3BXKA 1JFKA 1M39A 2M1KB 5KSZA 2SCPA 3KEVA 4JQ0D 2KAXA 1QTXA 3CTNA 3VRPA 4YI9A 1B7TY 1Y6WA 4ORAB 2PRUA 1PRWA 1W7IB 2LAPA 3NSLA 2Y1MA 2KI6C 3BOWB 1S6IA 4M2PA 3EKHA 5CSFA 2BCXA 1KK8B 1DJXA 3BUOB 3DF0B 1LKJA 4HSZA 2JXLA 1V1FA 4OVNF 2LP2A 1TIZA 2FCEA 2LCPA 3I5FC 1J7QA 1U5IB 1K2HA 2GGZA 1GQMA 5HKZA 1BODA 3D0YA 2JRFA 1QJTA 4YGEB 5CSNA 1OMDA 2OS8B 4JWQA 4I5JA 3FWCA 4Q04A 4I5KA 3I5IC 1UHIA 1NPQA 5IBWA 1XA5A 2AUCA 3LK0A 1K90D 1EXRA 1NSHA 4GFTA 2QPTA 1TNWA 3BQ3A 1SPYA 1MF8B 3D10A 3CGAA 2GV5A 1CFDA 1S3PA 4MSPA 3K21A 2F3YA 2I18A 1QVIZ 5HKWA 3ZWHA 3GK2A 2F8PA 5ER5A 4YI8A 1QLSA 2LHLA 2KBMA 4GNKB 1ZOTB 1SR6C 1Y0VH 1F71A 2JT8A 1B9AA 1QVIY 2K7CA 4PCWA 2K8MB 1JSAA 4WQ3A 2LLUA 4HRGA 3EVUA 5D69A 1DGVA 1J7OA 1OQPA 4ZCUA 3KHEA 2RGIA 5ER4X 1CDNA 2CXJA 4OR9B 3VRQA 3PFVA 3CR4X 1IQ5A 1DGUA 1XYDA 2BL0B 2G2BA 2JULA 1FF1A 1F4OA 2ZKMX 3AAKA 3EK4A 2E30A 1QASA 3H4SE 1ALWA 1K94A 4GGNA 1FI6A 2LMUA 2WOSA 3A8RA 1DJZA 1QV0A 2HF5A 1HT9A 1WDCB 5CSJA 1S6JA 2M3WA 1DF0B 3CZTX 2K61A 5JOLA 1TN4A 1CFCA 1GGZA 1KQMC 2PALA 2M29A 2OS8C 3LLEA 3CS1A 4GGFA 4DS7A 2ZFDA 3TDIA 4AQJA 3CLNA 3I5HB 4PE4A 2F3ZA 1JF0A 2LP3A 3DVKA 3OHMB 3WHUB 2K2AA 4WQ2A 1J1DA 1BF5A 1CDLA 1K9PA 2V53A 3FIAA 1IKUA 1F55A 1CDPA 1QXPA 2NLNA 3BUXB 1YX7A 1SMGA 2KNEA 4I5LB 1CB1A 3PM8A 1L2OC 4D1EA 3KPXA 2L5XB 1BR4B 1IWQA 2KSPA 1AUIB 3IF7A 1B4CA 1YUUA 2WORA 2WCBA 2JT3A 1PULA 3BYAA 4GBAA 5D7FA 5G08A 1KSMA 3IQQA 4GAOA 2KOTA 3NSIA 2F2OA 5K89A 1XK4A 1JF2A 1X02A 1SW8A 3GK1A 1XK4C 1DMOA 1OZOA 1QX2A 2M7LA 1M31A 1SL9A 1NCYA 2Y1NA 5BPJA 1DJHA 4QJ3B 2PASA 1RWYA 1SCMB 2O5GA 2ZRTA 3EK7A 2LMTA 2F2PA 3RM1A 1ODBA 2EC6B 2LV7A 4PE7A 2ZRSA 4E68A 1EG3A 2ZNEA 5AERA 2L51A 1AHRA 1J7PA 1XFVO 1F8HA 1PSBA 1SKTA 2OPOA 3PATA 3VRNA 4I5NB 1AK8A 1RROA 1WDCC 3VROA 3TDZA 4AQIA 1JUOA 4OV2A 2L50A 1WLMA 1M63B 2KQ6A 3AAJA 3SIAA 1G33A 5PALA 4PE0A 1B8RA 4HRHA 1FI5A 1DJWA 3I5HC 4CPVA 2JTZA 1JFJA 4USLA 5AANA 1AJ5A 2K7BA 2KQYA 3JVTC 1CNPA 1MWNA 1OMVA 3VRRA 2BKHB 4N5XA 2B1UA 4MRYA 1WRLA 4PHKA 1GJYA 2I2RE 2SASA 3HCMA 1D1OA 3DVJA 3EKJA 5B8IB 2D8NA 2HQ8A 4MVFA 4CFRA 4A4BA 2LVVA 2MHHA 2K2FA 2M1UA 1C7VA 3TS5B 1XFZO 1DJGA 3IQOA 2A4JA 4MEWA 1BJFA 1CLMA 5I8NA 3CWGA 1RJVA 2KDHA 1PALA 1A75B 2KAYA 2H61A 3SG6A 2H61C 1IH0A 1SCMC 1NX3A 1YRUB 1TCFA 3NSOA 1MUXA 2P6BB 4NQGA 2MLEC 2EC6C 5F6TA 1RTP1 1E8AA 2K7DA 4DRWA 2KGBC 4XYNA 5KTYA 2JNXA 1F70A 1NIWA 2KFGA 1A29A 3BOWA 4NDCA 1J7RA 4M2OA 1MR8A 1NCZA 3BUMB 2L0PA 1QATA 2BE4A 1A4PA 1AVSA 2L98A 1HQVA 3WXAA 1KK8C 2KI4B 1S5GZ 3DF0A 3JTDB 2JU0A 2LVIA 1NUBA 3LL8B 1LA0A 2LM5A 1ZMZA 1V1GA 1YRTB 1U5IA 2BKIB 2COLB 3PALA 2L4IA 4NDDA 1N65A 1ZFSA 4ORCB 1ALVA 1S5GY 1SCVA 3NXAA 1S1EA 1BU3A 3TZ1A 1IRJA 1MXEA 1OE9B 2KYFA 1QIVA 2LUXA 5CSIA 1CFFA 5DKRA 3AKAA 3PLFB 1OZSA 4PHJA 3NSKA 1KQVA 3OB2B 2WNDA 2LLSA 2JNFA 1MHOA 1EG4A 1DVIA 4PHNA 1Y1XA 1TRFA 5HLVA 5AFPA 2KGRA 1UUSA 1XFUO 1A03A 1KFXS 2R2IA 1OSAA 2Y4QA 4GUKA 1H4BA 2JZIA 4C0KA 1UHNA 1N0YA 4QJ5B 1S36A 2KBIA 4C0LA 3DD4A 3SG3A 1YVLA 2ZN8A 3O2PA 1BG1A 3TS5C 1SY9A 2WC8A 3ZNIA 1PVAA 3TUYB 4ORBB 4YGDB 4OKHA 1SBJA 1BMOA 2WCEA 1A75A 2K0JA 2KFHA 3GK4X 1DTLA 1IGVA 1KFUS 1XFXO 3FS7A 4BY5A 1QV1A 2KFFA 3WHTB 1YR5A 1LVCD 3D0YB 1CKKA 5KU1A 1ZACA 2TN4A 1DJYA 3EVRA 2AAOA 3MSEB 3RLZA 5HYDA 3CR2A 2QACA 3OX6A 1TCOB 2EGDA 2LMVA 3SG7A 2BE6A 1YTZC 2LE9B 5I2OA 2CTNA 1M46A 2BL0C 2MA2A 5JJGA 1JWDA 1UURA 1R2UA 2KI4C 2BCAA 3JTDC 4HREE 1F54A 3FWBA 2LANA 1WLZA 4P2YB 4YGCB 1C7WA 1DF0A 1M45A 2BECA 3GOFA 2LUCA 1BLQA 1UHJA 3M0WA 1CFPA 2CNPA 1SL7A 2BBMA 2H2KA 2LHIA 2IS9A 1W7JB 5TNCA 1EL4A 1C07A 2JPTA 1Q80A 3QRXA 1BR1B 1QIWA 4IL1A 3OP0A 1DT7B 4U8DA 1NWDA 1GGWA 1K8UA 1EJ3A 1KFXL 2M7NA 2PMYA 5HLOA 1UHKA 3LCPC 3PN7B 4P5OE 4CFQA 1RECA 2LC5A 2KYCA 3I5GB 4XJKB 1A2XA 2O60A 2Q91A 1RFJA 3C1VA 1LXFC 4JPZB 2NXQA 1NX1A 2NZ0A 2ZN9A 4L9MA 5GQQC 4CIDA 4PALA 3OB1B 1CMGA 5DKNA 4DIRA 1FPWA 2FCDA 1SYMA 2ZNDA 4FQOA 3SG4A 1ZUZA 1J1EA 1KFUL 3PSRA 3TUYC 1NX0A 1NP8A 2OTGB 1YUTA 1KQMB 1MXLC 2CBLA 5HKYA 1KWOB 1OMRA 1N2DA 2CCMA 4MZJA 2JQ6A 2G9BA 4YBHB 1TTXA 1RK9A 1EH2A 3O78A 4YRUA 2L2EA 2JT0A 2LNKA 4YGAA 3DVMA 4TNCA 3F45A 4MZKA 3HX4A 2PSRA 2MRDA 2FJUB 2HPSA 4R1EA 1FBVA 4MN0A 3O6BA 2PVBA 1TNXA 3DVEA 1L2OB 2KAVA 2NCPA 4PHMA 4UPGA 1QS7A 1QX7A 1B1GA 1QLKA 1VRKA 2MAZA 5CPVA 1UP5A 4BY4A 4F0ZB
chains in the Genus database with same CATH superfamily
1PK0D 1IJ5A 4IJ7A 4FTGA 1QX5B 2LVJA 1K9KA 4ETOA 4MLWA 1NCXA 4NDBA 5FYXA 3O4XA 3BUWB 1PVBA 3BUNB 3SIBA 2E6WA 1B8CA 4A4CA 1TNPA 1UWOA 5J3XA 2BNXA 1IQ3A 1AP4A 1IG5A 3D77A 4GPLB 1K9UA 3LK1A 5DKQA 1B47A 1CMFA 1G4YR 3VGOA 2I94A 1YUSA 4XJKA 3PN7C 3SG2A 1TNQA 3E3RA 3I5GC 1UHHA 3K1EA 4N1GA 3S0AA 1K95A 1F4QA 3EVVA 1CLLA 1S26D 3D76A 1XFYO 3SS4A 4ZCVA 1LA3A 4M2QA 4OCIA 2BBNA 4AOMA 3FE9A 1OOJA 2JXCA 1TOPA 2F33A 1YURA 2MBXA 1XVJA 3S0FA 1CDMA 4PE1A 1LINA 2OTGC 4QJ4B 3B86A 1NYAA 4PDZA 2AMIA 2M49B 2WCFA 3N7HA 1K93D 5I2LA 1BOCA 2HQWA 1SNLA 3I5FB 1WRZA 1KWOC 2HETA 1CTRA 1L7ZA 1PSRA 1S6CA 1Y1AA 1SL8A 4CLNA 5I2QA 4GGFC 1IIOA 5AEQA 2DOQA 1OOHA 1YX8A 5AXIA 4MZLA 4MRXA 2M97A 2FOTA 1K96A 3KO0A 1YVHA 2WCHA 3A4UB 3I5IB 4DUQA 3JVTB 1FW4A 3B88A 1R6PA 2JWWA 1KK7Z 1WY9A 2CT9A 1CLBA 1XFWO 2VRGA 3FE8A 2KPHA 3IVTA 3O4YA 2Q4UA 4JD9A 4YGBB 1AJ4A 4N1FA 1KSOA 1KK7Y 2M8UA 1SK6D 2Y5IA 2BCBA 2KI6D 2K7OA 3AKBA 3TDUA 1JBAA 2ISDA 1B8LA 1WRKA 2MJWB 3SJSA 2LLTA 3WNXB 1XO5A 1JC2A 4WRIA 1DJIA 1CM4A 2JC2A 2JTTA 3R1OA 2EHBA 2GGMA 2M0RA 4C0JA 3CR5X 3KF9A 1G8IA 1H8BA 2I7AA 2NCOA 5D3OA 3SG5A 1MQ1A 3QMEA 1SR6B 1J55A 1CM1A 2KHNA 2MLFC 3OX5A 2JOJA 2LVKA 3ICBA 4MBEA 1Y1UA 1NX2A 2M9GA 1IJ6A 2L4HA 3DXLA 1B7TZ 1SRAA 1BT6A 3EK8A 4DCKA 1KCYA 3NHTA 4ICBA 3BXKA 1JFKA 1M39A 2M1KB 5KSZA 2SCPA 3KEVA 4JQ0D 2KAXA 1QTXA 3BFHA 3CTNA 3VRPA 4YI9A 1B7TY 1Y6WA 4ORAB 2PRUA 1PRWA 3Q8IA 1W7IB 2LAPA 3NSLA 2Y1MA 2KI6C 3BOWB 1S6IA 4M2PA 3EKHA 5CSFA 2BCXA 1KK8B 1DJXA 3BUOB 1XFRA 3DF0B 1LKJA 4HSZA 2JXLA 1V1FA 4OVNF 2LP2A 1TIZA 2FCEA 2LCPA 3I5FC 3RZSA 1J7QA 1U5IB 1K2HA 2GGZA 1GQMA 5HKZA 1BODA 3D0YA 2JRFA 1QJTA 4YGEB 5CSNA 1OMDA 2OS8B 4JWQA 4I5JA 5FI6A 3FWCA 4Q04A 4I5KA 3I5IC 1UHIA 1NPQA 5IBWA 1XA5A 2QEVA 2AUCA 3LK0A 1K90D 1EXRA 1P28A 1NSHA 4GFTA 2QPTA 1TNWA 3BQ3A 1SPYA 1MF8B 3L4AA 3D10A 3CGAA 2GV5A 1CFDA 1S3PA 4MSPA 3B6XA 3K21A 2F3YA 1LS8A 2GTEA 2I18A 1QVIZ 5HKWA 3ZWHA 3GK2A 2F8PA 5ER5A 4YI8A 1QLSA 2LHLA 2KBMA 4GNKB 3D75A 1ZOTB 4PT1A 1SR6C 1Y0VH 2QEBA 3S0DA 2JT8A 1B9AA 1QVIY 2K7CA 4INWA 4PCWA 1F71A 2K8MB 1JSAA 4WQ3A 2LLUA 4HRGA 3EVUA 5D69A 1DGVA 2H8VA 1J7OA 1OQPA 4ZCUA 3KHEA 2RGIA 5ER4X 1CDNA 2CXJA 4OR9B 3VRQA 2WCMA 3NHIA 3CR4X 3PFVA 1IQ5A 1DGUA 1XYDA 2BL0B 2G2BA 3UNWA 2JULA 1FF1A 1F4OA 2ZKMX 3AAKA 3EK4A 2E30A 1QASA 3H4SE 1ALWA 1K94A 4GGNA 1FI6A 2LMUA 2WOSA 3A8RA 1DJZA 1QV0A 2HF5A 1HT9A 1WDCB 5CSJA 3CYZA 1S6JA 1OW4A 2M3WA 1DF0B 1DC1A 3CZTX 2K61A 5JOLA 1TN4A 1CFCA 1GGZA 1KQMC 2PALA 2M29A 2OS8C 3LLEA 1TWOA 3CS1A 4KYNA 4GGFA 4DS7A 2ZFDA 3TDIA 4AQJA 3CLNA 3I5HB 3L47A 4PE4A 2F3ZA 1JF0A 2LP3A 3DVKA 3OHMB 3WHUB 2K2AA 4WQ2A 1J1DA 1BF5A 1CDLA 1K9PA 1ORGA 2V53A 2WCLA 3FIAA 1IKUA 1F55A 1CDPA 1QXPA 2NLNA 3CABA 3BUXB 1YX7A 1SMGA 2KNEA 4I5LB 1CB1A 3PM8A 1L2OC 4D1EA 3KPXA 2L5XB 1BR4B 1IWQA 2KSPA 1AUIB 4FQTA 3IF7A 1B4CA 1SSEB 1YUUA 2WORA 2WCBA 1Z2CB 2JT3A 1PULA 3BYAA 4GBAA 5D7FA 5G08A 1KSMA 3IQQA 4GAOA 2KOTA 3NSIA 2F2OA 1TUZA 2QEHA 5K89A 1XK4A 3BFAA 5HL1A 1JF2A 1X02A 1SW8A 3GK1A 1XK4C 1DMOA 1OZOA 1QX2A 2M7LA 1M31A 1SL9A 1NCYA 2Y1NA 5BPJA 1DJHA 4QJ3B 2PASA 3OBVA 1RWYA 1SCMB 2O5GA 3B7AA 3OGNA 3VB1A 2PQLA 2ZRTA 3EK7A 2LMTA 2F2PA 3RM1A 1ODBA 2EC6B 2LV7A 4PE7A 2ZRSA 4E68A 1EG3A 2ZNEA 5AERA 1Z4HA 2L51A 3SS3A 1AHRA 1J7PA 1XFVO 1F8HA 1PSBA 1SKTA 2OPOA 3PATA 5DICA 4I5NB 3VRNA 1AK8A 1RROA 1WDCC 3VROA 3TDZA 4AQIA 3D74A 1JUOA 1W9ZA 4OV2A 2L50A 1WLMA 1M63B 2KQ6A 3AAJA 3SIAA 1G33A 5PALA 4PE0A 1B8RA 4HRHA 1FI5A 1DJWA 3S0GA 3I5HC 4CPVA 2JTZA 2FJYA 1JFJA 4USLA 2WC5A 5AANA 1AJ5A 2K7BA 3L4LA 3PM2A 2KQYA 3JVTC 1CNPA 1MWNA 1OMVA 4JKTA 3VRRA 2BKHB 4N5XA 2B1UA 2WCJA 4MRYA 1WRLA 4PHKA 1GJYA 2I2RE 2SASA 3HCMA 5FI2A 1D1OA 3DVJA 3EKJA 4F7FA 3S0BA 5B8IB 2D8NA 2HQ8A 4MVFA 4CFRA 4A4BA 2LVVA 2MHHA 2K2FA 2M1UA 1C7VA 3TS5B 1XFZO 2YGUA 1DJGA 2L5YA 3IQOA 2A4JA 4MEWA 1BJFA 1CLMA 5I8NA 3CWGA 2P71A 1RJVA 2KDHA 1PALA 3FE6A 1A75B 2KLDA 2KAYA 2H61A 3CZ0A 2K60A 3SG6A 2H61C 2QDIA 1IH0A 1SCMC 1NX3A 1YRUB 3DYEA 1TCFA 3NSOA 1MUXA 2P6BB 1DELA 4NQGA 2MLEC 2EC6C 3R1VA 5F6TA 1RTP1 1E8AA 2K7DA 2KLEA 4DRWA 2KGBC 4XYNA 5KTYA 2JNXA 3D73A 1F70A 1NIWA 2KFGA 3V2LA 3EG5B 1A29A 3BOWA 4NDCA 2PYQA 1J7RA 4M2OA 1MR8A 3BJHA 1NCZA 3BUMB 2L0PA 1QATA 2BE4A 1A4PA 1AVSA 2L98A 1HQVA 3WXAA 1KK8C 2KI4B 1S5GZ 3DF0A 3SS5A 3JTDB 3UO9A 2JU0A 2LVIA 1NUBA 3LL8B 1LA0A 2LM5A 3PJIA 1ZMZA 1V1GA 1YRTB 1U5IA 2BKIB 2COLB 3PALA 2L4IA 4NDDA 1ZFSA 1N65A 4ORCB 1ALVA 1S5GY 1SCVA 3NXAA 1S1EA 1BU3A 3TZ1A 1IRJA 1MXEA 3R1PA 1OE9B 2KYFA 1QIVA 2LUXA 2JPOA 5CSIA 1CFFA 5DKRA 3AKAA 3PLFB 1OZSA 4PHJA 3NSKA 1KQVA 3OB2B 2WNDA 2LLSA 2JNFA 1MHOA 1EG4A 2P70A 1DVIA 4PHNA 1Y1XA 2WC6A 1TRFA 5HLVA 1TUJA 5AFPA 2KGRA 1UUSA 1XFUO 1A03A 3D78A 1KFXS 2R2IA 1OSAA 2Y4QA 4GUKA 1H4BA 2JZIA 4INXA 4C0KA 1UHNA 1N0YA 4QJ5B 1S36A 2KBIA 4C0LA 3DD4A 3DZTA 3SG3A 1YVLA 2ZN8A 3O2PA 5EL2A 1BG1A 3TS5C 1SY9A 2WC8A 1QWVA 3ZNIA 1PVAA 3TUYB 4ORBB 4YGDB 4OKHA 1SBJA 1BMOA 2WCEA 1A75A 2K0JA 2KFHA 3GK4X 1DTLA 1T14A 1IGVA 1KFUS 1XFXO 3FS7A 4BY5A 1QV1A 2KFFA 3WHTB 1YR5A 1LVCD 3S0EA 3D0YB 1CKKA 5KU1A 3DY9A 1ZACA 2TN4A 1DJYA 3EVRA 2AAOA 3B87A 2QEOA 3MSEB 3RLZA 5HYDA 1C3YA 3CR2A 2QACA 3OX6A 1TCOB 2EGDA 2LMVA 3SG7A 2BE6A 1YTZC 2LE9B 1DEKA 2CTNA 5I2OA 1M46A 2BL0C 2MA2A 5JJGA 1JWDA 3NGVA 1GM0A 1UURA 1R2UA 2KI4C 3R72A 1OOFA 2BCAA 3JTDC 4HREE 1F54A 3FWBA 1DQEA 2LANA 1WLZA 4P2YB 4YGCB 1C7WA 1DF0A 5FI7A 1M45A 2BECA 3GOFA 2LUCA 4OZDA 1OOIX 1BLQA 1UHJA 3M0WA 1CFPA 2CNPA 1SL7A 2BBMA 2H2KA 2LHIA 2IS9A 1W7JB 5TNCA 1EL4A 1C07A 2JPTA 1Q80A 3QRXA 1BR1B 1QIWA 4IL1A 3OP0A 1DT7B 4U8DA 1NWDA 2BAPA 1GGWA 1K8UA 1EJ3A 1KFXL 2M7NA 2PMYA 5HLOA 1UHKA 3LCPC 3PN7B 4P5OE 4CFQA 1RECA 2LC5A 2KYCA 3I5GB 4XJKB 1A2XA 2O60A 2Q91A 1RFJA 3C1VA 1LXFC 4JPZB 2NXQA 1NX1A 2NZ0A 2ZN9A 4L9MA 5GQQC 4CIDA 4PALA 3OB1B 1CMGA 5DKNA 4DIRA 1FPWA 2FCDA 2ERBA 1SYMA 2ZNDA 4FQOA 3SG4A 1ZUZA 1J1EA 1KFUL 3CZ2A 3PSRA 1NX0A 1NP8A 3TUYC 2OTGB 2L2CA 1YUTA 1KQMB 1MXLC 2CBLA 1C3ZA 5HKYA 1KWOB 1OMRA 1N2DA 2CCMA 4MZJA 2JQ6A 2G9BA 4YBHB 1TTXA 1RK9A 1EH2A 3O78A 4YRUA 5I94A 2L2EA 2JT0A 2LNKA 4YGAA 3DVMA 4TNCA 3F45A 4MZKA 3BFBA 3HX4A 2PSRA 2MRDA 2FJUB 2HPSA 4R1EA 2WCKA 1FBVA 4MN0A 3O6BA 1OOGA 2PVBA 1TNXA 3CZ1A 1L2OB 2KAVA 2NCPA 3DVEA 4PHMA 4UPGA 1QS7A 1QX7A 3CDNA 1B1GA 1QLKA 1VRKA 2MAZA 5CPVA 1UP5A 4BY4A 4F0ZB
chains in the Genus database with same CATH topology
1PK0D 1IJ5A 4FTGA 1QX5B 2LVJA 1K9KA 4ETOA 4MLWA 1NCXA 4NDBA 5FYXA 3BUWB 1PVBA 3BUNB 3SIBA 2E6WA 1B8CA 4A4CA 1TNPA 1UWOA 5J3XA 1IQ3A 1AP4A 1IG5A 4GPLB 1K9UA 3LK1A 5DKQA 1B47A 1CMFA 1G4YR 3VGOA 2I94A 1YUSA 4XJKA 3PN7C 3SG2A 1TNQA 3E3RA 3I5GC 1UHHA 4N1GA 1K95A 1F4QA 3EVVA 1CLLA 1S26D 1XFYO 4ZCVA 1LA3A 4M2QA 4OCIA 2BBNA 4AOMA 1OOJA 2JXCA 1TOPA 2F33A 1YURA 2MBXA 1XVJA 1CDMA 4PE1A 1LINA 2OTGC 4QJ4B 1NYAA 4PDZA 2AMIA 2M49B 2WCFA 1K93D 5I2LA 1BOCA 2HQWA 1SNLA 3I5FB 1WRZA 1KWOC 2HETA 1CTRA 1L7ZA 1PSRA 1S6CA 1Y1AA 1SL8A 4CLNA 5I2QA 4GGFC 5AEQA 2DOQA 1YX8A 5AXIA 4MZLA 4MRXA 2M97A 2FOTA 1K96A 3KO0A 1YVHA 3A4UB 4DUQA 3I5IB 3JVTB 1FW4A 1R6PA 2JWWA 1KK7Z 1WY9A 2CT9A 1CLBA 1XFWO 2VRGA 3O4YA 2Q4UA 4YGBB 1AJ4A 4N1FA 1KSOA 1KK7Y 2M8UA 1SK6D 2Y5IA 2BCBA 2KI6D 2K7OA 3AKBA 3TDUA 1JBAA 2ISDA 1B8LA 1WRKA 2MJWB 3SJSA 2LLTA 3WNXB 1XO5A 1JC2A 4WRIA 1DJIA 1CM4A 2JC2A 2JTTA 2EHBA 2GGMA 2M0RA 4C0JA 3CR5X 3KF9A 1G8IA 1H8BA 2I7AA 2NCOA 3SG5A 1MQ1A 1J55A 1SR6B 1CM1A 2KHNA 2MLFC 3OX5A 2JOJA 2LVKA 3ICBA 4MBEA 1Y1UA 1NX2A 2M9GA 1IJ6A 2L4HA 4DCKA 1B7TZ 1SRAA 1BT6A 3EK8A 1KCYA 4ICBA 3BXKA 1JFKA 1M39A 2M1KB 5KSZA 2SCPA 3KEVA 4JQ0D 2KAXA 1QTXA 3CTNA 3VRPA 4YI9A 1B7TY 1Y6WA 4ORAB 2PRUA 1PRWA 1W7IB 2LAPA 3NSLA 2Y1MA 2KI6C 3BOWB 1S6IA 4M2PA 3EKHA 5CSFA 2BCXA 1KK8B 1DJXA 3BUOB 3DF0B 1LKJA 4HSZA 2JXLA 1V1FA 4OVNF 2LP2A 1TIZA 2FCEA 2LCPA 3I5FC 1J7QA 1U5IB 1K2HA 2GGZA 1GQMA 5HKZA 1BODA 3D0YA 2JRFA 1QJTA 4YGEB 5CSNA 1OMDA 2OS8B 4JWQA 4I5JA 3FWCA 4Q04A 4I5KA 3I5IC 1UHIA 1NPQA 5IBWA 1XA5A 2AUCA 3LK0A 1K90D 1EXRA 1NSHA 4GFTA 2QPTA 1TNWA 3BQ3A 1SPYA 1MF8B 3D10A 3CGAA 2GV5A 1CFDA 1S3PA 4MSPA 3K21A 2F3YA 2I18A 1QVIZ 5HKWA 3ZWHA 3GK2A 2F8PA 5ER5A 4YI8A 1QLSA 2LHLA 2KBMA 4GNKB 1ZOTB 1SR6C 1Y0VH 1F71A 2JT8A 1B9AA 1QVIY 2K7CA 4PCWA 2K8MB 1JSAA 4WQ3A 2LLUA 4HRGA 3EVUA 5D69A 1DGVA 1J7OA 1OQPA 4ZCUA 3KHEA 2RGIA 5ER4X 1CDNA 2CXJA 4OR9B 3VRQA 3PFVA 3CR4X 1IQ5A 1DGUA 1XYDA 2BL0B 2G2BA 2JULA 1FF1A 1F4OA 2ZKMX 3AAKA 3EK4A 2E30A 1QASA 3H4SE 1ALWA 1K94A 4GGNA 1FI6A 2LMUA 2WOSA 3A8RA 1DJZA 1QV0A 2HF5A 1HT9A 1WDCB 5CSJA 1S6JA 2M3WA 1DF0B 3CZTX 2K61A 5JOLA 1TN4A 1CFCA 1GGZA 1KQMC 2PALA 2M29A 2OS8C 3LLEA 3CS1A 4GGFA 4DS7A 2ZFDA 3TDIA 4AQJA 3CLNA 3I5HB 4PE4A 2F3ZA 1JF0A 2LP3A 3DVKA 3OHMB 3WHUB 2K2AA 4WQ2A 1J1DA 1BF5A 1CDLA 1K9PA 2V53A 3FIAA 1IKUA 1F55A 1CDPA 1QXPA 2NLNA 3BUXB 1YX7A 1SMGA 2KNEA 4I5LB 1CB1A 3PM8A 1L2OC 4D1EA 3KPXA 2L5XB 1BR4B 1IWQA 2KSPA 1AUIB 3IF7A 1B4CA 1YUUA 2WORA 2WCBA 2JT3A 1PULA 3BYAA 4GBAA 5D7FA 5G08A 1KSMA 3IQQA 4GAOA 2KOTA 3NSIA 2F2OA 5K89A 1XK4A 1JF2A 1X02A 1SW8A 3GK1A 1XK4C 1DMOA 1OZOA 1QX2A 2M7LA 1M31A 1SL9A 1NCYA 2Y1NA 5BPJA 1DJHA 4QJ3B 2PASA 1RWYA 1SCMB 2O5GA 2ZRTA 3EK7A 2LMTA 2F2PA 3RM1A 1ODBA 2EC6B 2LV7A 4PE7A 2ZRSA 4E68A 1EG3A 2ZNEA 5AERA 2L51A 1AHRA 1J7PA 1XFVO 1F8HA 1PSBA 1SKTA 2OPOA 3PATA 3VRNA 4I5NB 1AK8A 1RROA 1WDCC 3VROA 3TDZA 4AQIA 1JUOA 4OV2A 2L50A 1WLMA 1M63B 2KQ6A 3AAJA 3SIAA 1G33A 5PALA 4PE0A 1B8RA 4HRHA 1FI5A 1DJWA 3I5HC 4CPVA 2JTZA 1JFJA 4USLA 5AANA 1AJ5A 2K7BA 2KQYA 3JVTC 1CNPA 1MWNA 1OMVA 3VRRA 2BKHB 4N5XA 2B1UA 4MRYA 1WRLA 4PHKA 1GJYA 2I2RE 2SASA 3HCMA 1D1OA 3DVJA 3EKJA 5B8IB 2D8NA 2HQ8A 4MVFA 4CFRA 4A4BA 2LVVA 2MHHA 2K2FA 2M1UA 1C7VA 3TS5B 1XFZO 1DJGA 3IQOA 2A4JA 4MEWA 1BJFA 1CLMA 5I8NA 3CWGA 1RJVA 2KDHA 1PALA 1A75B 2KAYA 2H61A 3SG6A 2H61C 1IH0A 1SCMC 1NX3A 1YRUB 1TCFA 3NSOA 1MUXA 2P6BB 4NQGA 2MLEC 2EC6C 5F6TA 1RTP1 1E8AA 2K7DA 4DRWA 2KGBC 4XYNA 5KTYA 2JNXA 1F70A 1NIWA 2KFGA 1A29A 3BOWA 4NDCA 1J7RA 4M2OA 1MR8A 1NCZA 3BUMB 2L0PA 1QATA 2BE4A 1A4PA 1AVSA 2L98A 1HQVA 3WXAA 1KK8C 2KI4B 1S5GZ 3DF0A 3JTDB 2JU0A 2LVIA 1NUBA 3LL8B 1LA0A 2LM5A 1ZMZA 1V1GA 1YRTB 1U5IA 2BKIB 2COLB 3PALA 2L4IA 4NDDA 1N65A 1ZFSA 4ORCB 1ALVA 1S5GY 1SCVA 3NXAA 1S1EA 1BU3A 3TZ1A 1IRJA 1MXEA 1OE9B 2KYFA 1QIVA 2LUXA 5CSIA 1CFFA 5DKRA 3AKAA 3PLFB 1OZSA 4PHJA 3NSKA 1KQVA 3OB2B 2WNDA 2LLSA 2JNFA 1MHOA 1EG4A 1DVIA 4PHNA 1Y1XA 1TRFA 5HLVA 5AFPA 2KGRA 1UUSA 1XFUO 1A03A 1KFXS 2R2IA 1OSAA 2Y4QA 4GUKA 1H4BA 2JZIA 4C0KA 1UHNA 1N0YA 4QJ5B 1S36A 2KBIA 4C0LA 3DD4A 3SG3A 1YVLA 2ZN8A 3O2PA 1BG1A 3TS5C 1SY9A 2WC8A 3ZNIA 1PVAA 3TUYB 4ORBB 4YGDB 4OKHA 1SBJA 1BMOA 2WCEA 1A75A 2K0JA 2KFHA 3GK4X 1DTLA 1IGVA 1KFUS 1XFXO 3FS7A 4BY5A 1QV1A 2KFFA 3WHTB 1YR5A 1LVCD 3D0YB 1CKKA 5KU1A 1ZACA 2TN4A 1DJYA 3EVRA 2AAOA 3MSEB 3RLZA 5HYDA 3CR2A 2QACA 3OX6A 1TCOB 2EGDA 2LMVA 3SG7A 2BE6A 1YTZC 2LE9B 5I2OA 2CTNA 1M46A 2BL0C 2MA2A 5JJGA 1JWDA 1UURA 1R2UA 2KI4C 2BCAA 3JTDC 4HREE 1F54A 3FWBA 2LANA 1WLZA 4P2YB 4YGCB 1C7WA 1DF0A 1M45A 2BECA 3GOFA 2LUCA 1BLQA 1UHJA 3M0WA 1CFPA 2CNPA 1SL7A 2BBMA 2H2KA 2LHIA 2IS9A 1W7JB 5TNCA 1EL4A 1C07A 2JPTA 1Q80A 3QRXA 1BR1B 1QIWA 4IL1A 3OP0A 1DT7B 4U8DA 1NWDA 1GGWA 1K8UA 1EJ3A 1KFXL 2M7NA 2PMYA 5HLOA 1UHKA 3LCPC 3PN7B 4P5OE 4CFQA 1RECA 2LC5A 2KYCA 3I5GB 4XJKB 1A2XA 2O60A 2Q91A 1RFJA 3C1VA 1LXFC 4JPZB 2NXQA 1NX1A 2NZ0A 2ZN9A 4L9MA 5GQQC 4CIDA 4PALA 3OB1B 1CMGA 5DKNA 4DIRA 1FPWA 2FCDA 1SYMA 2ZNDA 4FQOA 3SG4A 1ZUZA 1J1EA 1KFUL 3PSRA 3TUYC 1NX0A 1NP8A 2OTGB 1YUTA 1KQMB 1MXLC 2CBLA 5HKYA 1KWOB 1OMRA 1N2DA 2CCMA 4MZJA 2JQ6A 2G9BA 4YBHB 1TTXA 1RK9A 1EH2A 3O78A 4YRUA 2L2EA 2JT0A 2LNKA 4YGAA 3DVMA 4TNCA 3F45A 4MZKA 3HX4A 2PSRA 2MRDA 2FJUB 2HPSA 4R1EA 1FBVA 4MN0A 3O6BA 2PVBA 1TNXA 3DVEA 1L2OB 2KAVA 2NCPA 4PHMA 4UPGA 1QS7A 1QX7A 1B1GA 1QLKA 1VRKA 2MAZA 5CPVA 1UP5A 4BY4A 4F0ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PK0 D;  1IJ5 A;  4FTG A;  1QX5 B;  2LVJ A;  1K9K A;  4ETO A;  4MLW A;  1NCX A;  4NDB A;  5FYX A;  3BUW B;  1PVB A;  3BUN B;  3SIB A;  2E6W A;  1B8C A;  4A4C A;  1TNP A;  1UWO A;  5J3X A;  1IQ3 A;  1AP4 A;  1IG5 A;  4GPL B;  1K9U A;  3LK1 A;  5DKQ A;  1B47 A;  1CMF A;  1G4Y R;  3VGO A;  2I94 A;  1YUS A;  4XJK A;  3PN7 C;  3SG2 A;  1TNQ A;  3E3R A;  3I5G C;  1UHH A;  4N1G A;  1K95 A;  1F4Q A;  3EVV A;  1CLL A;  1S26 D;  1XFY O;  4ZCV A;  1LA3 A;  4M2Q A;  4OCI A;  2BBN A;  4AOM A;  1OOJ A;  2JXC A;  1TOP A;  2F33 A;  1YUR A;  2MBX A;  1XVJ A;  1CDM A;  4PE1 A;  1LIN A;  2OTG C;  4QJ4 B;  1NYA A;  4PDZ A;  2AMI A;  2M49 B;  2WCF A;  1K93 D;  5I2L A;  1BOC A;  2HQW A;  1SNL A;  3I5F B;  1WRZ A;  1KWO C;  2HET A;  1CTR A;  1L7Z A;  1PSR A;  1S6C A;  1Y1A A;  1SL8 A;  4CLN A;  5I2Q A;  4GGF C;  5AEQ A;  2DOQ A;  1YX8 A;  5AXI A;  4MZL A;  4MRX A;  2M97 A;  2FOT A;  1K96 A;  3KO0 A;  1YVH A;  3A4U B;  4DUQ A;  3I5I B;  3JVT B;  1FW4 A;  1R6P A;  2JWW A;  1KK7 Z;  1WY9 A;  2CT9 A;  1CLB A;  1XFW O;  2VRG A;  3O4Y A;  2Q4U A;  4YGB B;  1AJ4 A;  4N1F A;  1KSO A;  1KK7 Y;  2M8U A;  1SK6 D;  2Y5I A;  2BCB A;  2KI6 D;  2K7O A;  3AKB A;  3TDU A;  1JBA A;  2ISD A;  1B8L A;  1WRK A;  2MJW B;  3SJS A;  2LLT A;  3WNX B;  1XO5 A;  1JC2 A;  4WRI A;  1DJI A;  1CM4 A;  2JC2 A;  2JTT A;  2EHB A;  2GGM A;  2M0R A;  4C0J A;  3CR5 X;  3KF9 A;  1G8I A;  1H8B A;  2I7A A;  2NCO A;  3SG5 A;  1MQ1 A;  1J55 A;  1SR6 B;  1CM1 A;  2KHN A;  2MLF C;  3OX5 A;  2JOJ A;  2LVK A;  3ICB A;  4MBE A;  1Y1U A;  1NX2 A;  2M9G A;  1IJ6 A;  2L4H A;  4DCK A;  1B7T Z;  1SRA A;  1BT6 A;  3EK8 A;  1KCY A;  4ICB A;  3BXK A;  1JFK A;  1M39 A;  2M1K B;  5KSZ A;  2SCP A;  3KEV A;  4JQ0 D;  2KAX A;  1QTX A;  3CTN A;  3VRP A;  4YI9 A;  1B7T Y;  1Y6W A;  4ORA B;  2PRU A;  1PRW A;  1W7I B;  2LAP A;  3NSL A;  2Y1M A;  2KI6 C;  3BOW B;  1S6I A;  4M2P A;  3EKH A;  5CSF A;  2BCX A;  1KK8 B;  1DJX A;  3BUO B;  3DF0 B;  1LKJ A;  4HSZ A;  2JXL A;  1V1F A;  4OVN F;  2LP2 A;  1TIZ A;  2FCE A;  2LCP A;  3I5F C;  1J7Q A;  1U5I B;  1K2H A;  2GGZ A;  1GQM A;  5HKZ A;  1BOD A;  3D0Y A;  2JRF A;  1QJT A;  4YGE B;  5CSN A;  1OMD A;  2OS8 B;  4JWQ A;  4I5J A;  3FWC A;  4Q04 A;  4I5K A;  3I5I C;  1UHI A;  1NPQ A;  5IBW A;  1XA5 A;  2AUC A;  3LK0 A;  1K90 D;  1EXR A;  1NSH A;  4GFT A;  2QPT A;  1TNW A;  3BQ3 A;  1SPY A;  1MF8 B;  3D10 A;  3CGA A;  2GV5 A;  1CFD A;  1S3P A;  4MSP A;  3K21 A;  2F3Y A;  2I18 A;  1QVI Z;  5HKW A;  3ZWH A;  3GK2 A;  2F8P A;  5ER5 A;  4YI8 A;  1QLS A;  2LHL A;  2KBM A;  4GNK B;  1ZOT B;  1SR6 C;  1Y0V H;  1F71 A;  2JT8 A;  1B9A A;  1QVI Y;  2K7C A;  4PCW A;  2K8M B;  1JSA A;  4WQ3 A;  2LLU A;  4HRG A;  3EVU A;  5D69 A;  1DGV A;  1J7O A;  1OQP A;  4ZCU A;  3KHE A;  2RGI A;  5ER4 X;  1CDN A;  2CXJ A;  4OR9 B;  3VRQ A;  3PFV A;  3CR4 X;  1IQ5 A;  1DGU A;  1XYD A;  2BL0 B;  2G2B A;  2JUL A;  1FF1 A;  1F4O A;  2ZKM X;  3AAK A;  3EK4 A;  2E30 A;  1QAS A;  3H4S E;  1ALW A;  1K94 A;  4GGN A;  1FI6 A;  2LMU A;  2WOS A;  3A8R A;  1DJZ A;  1QV0 A;  2HF5 A;  1HT9 A;  1WDC B;  5CSJ A;  1S6J A;  2M3W A;  1DF0 B;  3CZT X;  2K61 A;  5JOL A;  1TN4 A;  1CFC A;  1GGZ A;  1KQM C;  2PAL A;  2M29 A;  2OS8 C;  3LLE A;  3CS1 A;  4GGF A;  4DS7 A;  2ZFD A;  3TDI A;  4AQJ A;  3CLN A;  3I5H B;  4PE4 A;  2F3Z A;  1JF0 A;  2LP3 A;  3DVK A;  3OHM B;  3WHU B;  2K2A A;  4WQ2 A;  1J1D A;  1BF5 A;  1CDL A;  1K9P A;  2V53 A;  3FIA A;  1IKU A;  1F55 A;  1CDP A;  1QXP A;  2NLN A;  3BUX B;  1YX7 A;  1SMG A;  2KNE A;  4I5L B;  1CB1 A;  3PM8 A;  1L2O C;  4D1E A;  3KPX A;  2L5X B;  1BR4 B;  1IWQ A;  2KSP A;  1AUI B;  3IF7 A;  1B4C A;  1YUU A;  2WOR A;  2WCB A;  2JT3 A;  1PUL A;  3BYA A;  4GBA A;  5D7F A;  5G08 A;  1KSM A;  3IQQ A;  4GAO A;  2KOT A;  3NSI A;  2F2O A;  5K89 A;  1XK4 A;  1JF2 A;  1X02 A;  1SW8 A;  3GK1 A;  1XK4 C;  1DMO A;  1OZO A;  1QX2 A;  2M7L A;  1M31 A;  1SL9 A;  1NCY A;  2Y1N A;  5BPJ A;  1DJH A;  4QJ3 B;  2PAS A;  1RWY A;  1SCM B;  2O5G A;  2ZRT A;  3EK7 A;  2LMT A;  2F2P A;  3RM1 A;  1ODB A;  2EC6 B;  2LV7 A;  4PE7 A;  2ZRS A;  4E68 A;  1EG3 A;  2ZNE A;  5AER A;  2L51 A;  1AHR A;  1J7P A;  1XFV O;  1F8H A;  1PSB A;  1SKT A;  2OPO A;  3PAT A;  3VRN A;  4I5N B;  1AK8 A;  1RRO A;  1WDC C;  3VRO A;  3TDZ A;  4AQI A;  1JUO A;  4OV2 A;  2L50 A;  1WLM A;  1M63 B;  2KQ6 A;  3AAJ A;  3SIA A;  1G33 A;  5PAL A;  4PE0 A;  1B8R A;  4HRH A;  1FI5 A;  1DJW A;  3I5H C;  4CPV A;  2JTZ A;  1JFJ A;  4USL A;  5AAN A;  1AJ5 A;  2K7B A;  2KQY A;  3JVT C;  1CNP A;  1MWN A;  1OMV A;  3VRR A;  2BKH B;  4N5X A;  2B1U A;  4MRY A;  1WRL A;  4PHK A;  1GJY A;  2I2R E;  2SAS A;  3HCM A;  1D1O A;  3DVJ A;  3EKJ A;  5B8I B;  2D8N A;  2HQ8 A;  4MVF A;  4CFR A;  4A4B A;  2LVV A;  2MHH A;  2K2F A;  2M1U A;  1C7V A;  3TS5 B;  1XFZ O;  1DJG A;  3IQO A;  2A4J A;  4MEW A;  1BJF A;  1CLM A;  5I8N A;  3CWG A;  1RJV A;  2KDH A;  1PAL A;  1A75 B;  2KAY A;  2H61 A;  3SG6 A;  2H61 C;  1IH0 A;  1SCM C;  1NX3 A;  1YRU B;  1TCF A;  3NSO A;  1MUX A;  2P6B B;  4NQG A;  2MLE C;  2EC6 C;  5F6T A;  1RTP 1;  1E8A A;  2K7D A;  4DRW A;  2KGB C;  4XYN A;  5KTY A;  2JNX A;  1F70 A;  1NIW A;  2KFG A;  1A29 A;  3BOW A;  4NDC A;  1J7R A;  4M2O A;  1MR8 A;  1NCZ A;  3BUM B;  2L0P A;  1QAT A;  2BE4 A;  1A4P A;  1AVS A;  2L98 A;  1HQV A;  3WXA A;  1KK8 C;  2KI4 B;  1S5G Z;  3DF0 A;  3JTD B;  2JU0 A;  2LVI A;  1NUB A;  3LL8 B;  1LA0 A;  2LM5 A;  1ZMZ A;  1V1G A;  1YRT B;  1U5I A;  2BKI B;  2COL B;  3PAL A;  2L4I A;  4NDD A;  1N65 A;  1ZFS A;  4ORC B;  1ALV A;  1S5G Y;  1SCV A;  3NXA A;  1S1E A;  1BU3 A;  3TZ1 A;  1IRJ A;  1MXE A;  1OE9 B;  2KYF A;  1QIV A;  2LUX A;  5CSI A;  1CFF A;  5DKR A;  3AKA A;  3PLF B;  1OZS A;  4PHJ A;  3NSK A;  1KQV A;  3OB2 B;  2WND A;  2LLS A;  2JNF A;  1MHO A;  1EG4 A;  1DVI A;  4PHN A;  1Y1X A;  1TRF A;  5HLV A;  5AFP A;  2KGR A;  1UUS A;  1XFU O;  1A03 A;  1KFX S;  2R2I A;  1OSA A;  2Y4Q A;  4GUK A;  1H4B A;  2JZI A;  4C0K A;  1UHN A;  1N0Y A;  4QJ5 B;  1S36 A;  2KBI A;  4C0L A;  3DD4 A;  3SG3 A;  1YVL A;  2ZN8 A;  3O2P A;  1BG1 A;  3TS5 C;  1SY9 A;  2WC8 A;  3ZNI A;  1PVA A;  3TUY B;  4ORB B;  4YGD B;  4OKH A;  1SBJ A;  1BMO A;  2WCE A;  1A75 A;  2K0J A;  2KFH A;  3GK4 X;  1DTL A;  1IGV A;  1KFU S;  1XFX O;  3FS7 A;  4BY5 A;  1QV1 A;  2KFF A;  3WHT B;  1YR5 A;  1LVC D;  3D0Y B;  1CKK A;  5KU1 A;  1ZAC A;  2TN4 A;  1DJY A;  3EVR A;  2AAO A;  3MSE B;  3RLZ A;  5HYD A;  3CR2 A;  2QAC A;  3OX6 A;  1TCO B;  2EGD A;  2LMV A;  3SG7 A;  2BE6 A;  1YTZ C;  2LE9 B;  5I2O A;  2CTN A;  1M46 A;  2BL0 C;  2MA2 A;  5JJG A;  1JWD A;  1UUR A;  1R2U A;  2KI4 C;  2BCA A;  3JTD C;  4HRE E;  1F54 A;  3FWB A;  2LAN A;  1WLZ A;  4P2Y B;  4YGC B;  1C7W A;  1DF0 A;  1M45 A;  2BEC A;  3GOF A;  2LUC A;  1BLQ A;  1UHJ A;  3M0W A;  1CFP A;  2CNP A;  1SL7 A;  2BBM A;  2H2K A;  2LHI A;  2IS9 A;  1W7J B;  5TNC A;  1EL4 A;  1C07 A;  2JPT A;  1Q80 A;  3QRX A;  1BR1 B;  1QIW A;  4IL1 A;  3OP0 A;  1DT7 B;  4U8D A;  1NWD A;  1GGW A;  1K8U A;  1EJ3 A;  1KFX L;  2M7N A;  2PMY A;  5HLO A;  1UHK A;  3LCP C;  3PN7 B;  4P5O E;  4CFQ A;  1REC A;  2LC5 A;  2KYC A;  3I5G B;  4XJK B;  1A2X A;  2O60 A;  2Q91 A;  1RFJ A;  3C1V A;  1LXF C;  4JPZ B;  2NXQ A;  1NX1 A;  2NZ0 A;  2ZN9 A;  4L9M A;  5GQQ C;  4CID A;  4PAL A;  3OB1 B;  1CMG A;  5DKN A;  4DIR A;  1FPW A;  2FCD A;  1SYM A;  2ZND A;  4FQO A;  3SG4 A;  1ZUZ A;  1J1E A;  1KFU L;  3PSR A;  3TUY C;  1NX0 A;  1NP8 A;  2OTG B;  1YUT A;  1KQM B;  1MXL C;  2CBL A;  5HKY A;  1KWO B;  1OMR A;  1N2D A;  2CCM A;  4MZJ A;  2JQ6 A;  2G9B A;  4YBH B;  1TTX A;  1RK9 A;  1EH2 A;  3O78 A;  4YRU A;  2L2E A;  2JT0 A;  2LNK A;  4YGA A;  3DVM A;  4TNC A;  3F45 A;  4MZK A;  3HX4 A;  2PSR A;  2MRD A;  2FJU B;  2HPS A;  4R1E A;  1FBV A;  4MN0 A;  3O6B A;  2PVB A;  1TNX A;  3DVE A;  1L2O B;  2KAV A;  2NCP A;  4PHM A;  4UPG A;  1QS7 A;  1QX7 A;  1B1G A;  1QLK A;  1VRK A;  2MAZ A;  5CPV A;  1UP5 A;  4BY4 A;  4F0Z B; 
#chains in the Genus database with same CATH topology
 1PK0 D;  1IJ5 A;  4IJ7 A;  4FTG A;  1QX5 B;  2LVJ A;  1K9K A;  4ETO A;  4MLW A;  1NCX A;  4NDB A;  5FYX A;  3O4X A;  3BUW B;  1PVB A;  3BUN B;  3SIB A;  2E6W A;  1B8C A;  4A4C A;  1TNP A;  1UWO A;  5J3X A;  2BNX A;  1IQ3 A;  1AP4 A;  1IG5 A;  3D77 A;  4GPL B;  1K9U A;  3LK1 A;  5DKQ A;  1B47 A;  1CMF A;  1G4Y R;  3VGO A;  2I94 A;  1YUS A;  4XJK A;  3PN7 C;  3SG2 A;  1TNQ A;  3E3R A;  3I5G C;  1UHH A;  3K1E A;  4N1G A;  3S0A A;  1K95 A;  1F4Q A;  3EVV A;  1CLL A;  1S26 D;  3D76 A;  1XFY O;  3SS4 A;  4ZCV A;  1LA3 A;  4M2Q A;  4OCI A;  2BBN A;  4AOM A;  3FE9 A;  1OOJ A;  2JXC A;  1TOP A;  2F33 A;  1YUR A;  2MBX A;  1XVJ A;  3S0F A;  1CDM A;  4PE1 A;  1LIN A;  2OTG C;  4QJ4 B;  3B86 A;  1NYA A;  4PDZ A;  2AMI A;  2M49 B;  2WCF A;  3N7H A;  1K93 D;  5I2L A;  1BOC A;  2HQW A;  1SNL A;  3I5F B;  1WRZ A;  1KWO C;  2HET A;  1CTR A;  1L7Z A;  1PSR A;  1S6C A;  1Y1A A;  1SL8 A;  4CLN A;  5I2Q A;  4GGF C;  1IIO A;  5AEQ A;  2DOQ A;  1OOH A;  1YX8 A;  5AXI A;  4MZL A;  4MRX A;  2M97 A;  2FOT A;  1K96 A;  3KO0 A;  1YVH A;  2WCH A;  3A4U B;  3I5I B;  4DUQ A;  3JVT B;  1FW4 A;  3B88 A;  1R6P A;  2JWW A;  1KK7 Z;  1WY9 A;  2CT9 A;  1CLB A;  1XFW O;  2VRG A;  3FE8 A;  2KPH A;  3IVT A;  3O4Y A;  2Q4U A;  4JD9 A;  4YGB B;  1AJ4 A;  4N1F A;  1KSO A;  1KK7 Y;  2M8U A;  1SK6 D;  2Y5I A;  2BCB A;  2KI6 D;  2K7O A;  3AKB A;  3TDU A;  1JBA A;  2ISD A;  1B8L A;  1WRK A;  2MJW B;  3SJS A;  2LLT A;  3WNX B;  1XO5 A;  1JC2 A;  4WRI A;  1DJI A;  1CM4 A;  2JC2 A;  2JTT A;  3R1O A;  2EHB A;  2GGM A;  2M0R A;  4C0J A;  3CR5 X;  3KF9 A;  1G8I A;  1H8B A;  2I7A A;  2NCO A;  5D3O A;  3SG5 A;  1MQ1 A;  3QME A;  1SR6 B;  1J55 A;  1CM1 A;  2KHN A;  2MLF C;  3OX5 A;  2JOJ A;  2LVK A;  3ICB A;  4MBE A;  1Y1U A;  1NX2 A;  2M9G A;  1IJ6 A;  2L4H A;  3DXL A;  1B7T Z;  1SRA A;  1BT6 A;  3EK8 A;  4DCK A;  1KCY A;  3NHT A;  4ICB A;  3BXK A;  1JFK A;  1M39 A;  2M1K B;  5KSZ A;  2SCP A;  3KEV A;  4JQ0 D;  2KAX A;  1QTX A;  3BFH A;  3CTN A;  3VRP A;  4YI9 A;  1B7T Y;  1Y6W A;  4ORA B;  2PRU A;  1PRW A;  3Q8I A;  1W7I B;  2LAP A;  3NSL A;  2Y1M A;  2KI6 C;  3BOW B;  1S6I A;  4M2P A;  3EKH A;  5CSF A;  2BCX A;  1KK8 B;  1DJX A;  3BUO B;  1XFR A;  3DF0 B;  1LKJ A;  4HSZ A;  2JXL A;  1V1F A;  4OVN F;  2LP2 A;  1TIZ A;  2FCE A;  2LCP A;  3I5F C;  3RZS A;  1J7Q A;  1U5I B;  1K2H A;  2GGZ A;  1GQM A;  5HKZ A;  1BOD A;  3D0Y A;  2JRF A;  1QJT A;  4YGE B;  5CSN A;  1OMD A;  2OS8 B;  4JWQ A;  4I5J A;  5FI6 A;  3FWC A;  4Q04 A;  4I5K A;  3I5I C;  1UHI A;  1NPQ A;  5IBW A;  1XA5 A;  2QEV A;  2AUC A;  3LK0 A;  1K90 D;  1EXR A;  1P28 A;  1NSH A;  4GFT A;  2QPT A;  1TNW A;  3BQ3 A;  1SPY A;  1MF8 B;  3L4A A;  3D10 A;  3CGA A;  2GV5 A;  1CFD A;  1S3P A;  4MSP A;  3B6X A;  3K21 A;  2F3Y A;  1LS8 A;  2GTE A;  2I18 A;  1QVI Z;  5HKW A;  3ZWH A;  3GK2 A;  2F8P A;  5ER5 A;  4YI8 A;  1QLS A;  2LHL A;  2KBM A;  4GNK B;  3D75 A;  1ZOT B;  4PT1 A;  1SR6 C;  1Y0V H;  2QEB A;  3S0D A;  2JT8 A;  1B9A A;  1QVI Y;  2K7C A;  4INW A;  4PCW A;  1F71 A;  2K8M B;  1JSA A;  4WQ3 A;  2LLU A;  4HRG A;  3EVU A;  5D69 A;  1DGV A;  2H8V A;  1J7O A;  1OQP A;  4ZCU A;  3KHE A;  2RGI A;  5ER4 X;  1CDN A;  2CXJ A;  4OR9 B;  3VRQ A;  2WCM A;  3NHI A;  3CR4 X;  3PFV A;  1IQ5 A;  1DGU A;  1XYD A;  2BL0 B;  2G2B A;  3UNW A;  2JUL A;  1FF1 A;  1F4O A;  2ZKM X;  3AAK A;  3EK4 A;  2E30 A;  1QAS A;  3H4S E;  1ALW A;  1K94 A;  4GGN A;  1FI6 A;  2LMU A;  2WOS A;  3A8R A;  1DJZ A;  1QV0 A;  2HF5 A;  1HT9 A;  1WDC B;  5CSJ A;  3CYZ A;  1S6J A;  1OW4 A;  2M3W A;  1DF0 B;  1DC1 A;  3CZT X;  2K61 A;  5JOL A;  1TN4 A;  1CFC A;  1GGZ A;  1KQM C;  2PAL A;  2M29 A;  2OS8 C;  3LLE A;  1TWO A;  3CS1 A;  4KYN A;  4GGF A;  4DS7 A;  2ZFD A;  3TDI A;  4AQJ A;  3CLN A;  3I5H B;  3L47 A;  4PE4 A;  2F3Z A;  1JF0 A;  2LP3 A;  3DVK A;  3OHM B;  3WHU B;  2K2A A;  4WQ2 A;  1J1D A;  1BF5 A;  1CDL A;  1K9P A;  1ORG A;  2V53 A;  2WCL A;  3FIA A;  1IKU A;  1F55 A;  1CDP A;  1QXP A;  2NLN A;  3CAB A;  3BUX B;  1YX7 A;  1SMG A;  2KNE A;  4I5L B;  1CB1 A;  3PM8 A;  1L2O C;  4D1E A;  3KPX A;  2L5X B;  1BR4 B;  1IWQ A;  2KSP A;  1AUI B;  4FQT A;  3IF7 A;  1B4C A;  1SSE B;  1YUU A;  2WOR A;  2WCB A;  1Z2C B;  2JT3 A;  1PUL A;  3BYA A;  4GBA A;  5D7F A;  5G08 A;  1KSM A;  3IQQ A;  4GAO A;  2KOT A;  3NSI A;  2F2O A;  1TUZ A;  2QEH A;  5K89 A;  1XK4 A;  3BFA A;  5HL1 A;  1JF2 A;  1X02 A;  1SW8 A;  3GK1 A;  1XK4 C;  1DMO A;  1OZO A;  1QX2 A;  2M7L A;  1M31 A;  1SL9 A;  1NCY A;  2Y1N A;  5BPJ A;  1DJH A;  4QJ3 B;  2PAS A;  3OBV A;  1RWY A;  1SCM B;  2O5G A;  3B7A A;  3OGN A;  3VB1 A;  2PQL A;  2ZRT A;  3EK7 A;  2LMT A;  2F2P A;  3RM1 A;  1ODB A;  2EC6 B;  2LV7 A;  4PE7 A;  2ZRS A;  4E68 A;  1EG3 A;  2ZNE A;  5AER A;  1Z4H A;  2L51 A;  3SS3 A;  1AHR A;  1J7P A;  1XFV O;  1F8H A;  1PSB A;  1SKT A;  2OPO A;  3PAT A;  5DIC A;  4I5N B;  3VRN A;  1AK8 A;  1RRO A;  1WDC C;  3VRO A;  3TDZ A;  4AQI A;  3D74 A;  1JUO A;  1W9Z A;  4OV2 A;  2L50 A;  1WLM A;  1M63 B;  2KQ6 A;  3AAJ A;  3SIA A;  1G33 A;  5PAL A;  4PE0 A;  1B8R A;  4HRH A;  1FI5 A;  1DJW A;  3S0G A;  3I5H C;  4CPV A;  2JTZ A;  2FJY A;  1JFJ A;  4USL A;  2WC5 A;  5AAN A;  1AJ5 A;  2K7B A;  3L4L A;  3PM2 A;  2KQY A;  3JVT C;  1CNP A;  1MWN A;  1OMV A;  4JKT A;  3VRR A;  2BKH B;  4N5X A;  2B1U A;  2WCJ A;  4MRY A;  1WRL A;  4PHK A;  1GJY A;  2I2R E;  2SAS A;  3HCM A;  5FI2 A;  1D1O A;  3DVJ A;  3EKJ A;  4F7F A;  3S0B A;  5B8I B;  2D8N A;  2HQ8 A;  4MVF A;  4CFR A;  4A4B A;  2LVV A;  2MHH A;  2K2F A;  2M1U A;  1C7V A;  3TS5 B;  1XFZ O;  2YGU A;  1DJG A;  2L5Y A;  3IQO A;  2A4J A;  4MEW A;  1BJF A;  1CLM A;  5I8N A;  3CWG A;  2P71 A;  1RJV A;  2KDH A;  1PAL A;  3FE6 A;  1A75 B;  2KLD A;  2KAY A;  2H61 A;  3CZ0 A;  2K60 A;  3SG6 A;  2H61 C;  2QDI A;  1IH0 A;  1SCM C;  1NX3 A;  1YRU B;  3DYE A;  1TCF A;  3NSO A;  1MUX A;  2P6B B;  1DEL A;  4NQG A;  2MLE C;  2EC6 C;  3R1V A;  5F6T A;  1RTP 1;  1E8A A;  2K7D A;  2KLE A;  4DRW A;  2KGB C;  4XYN A;  5KTY A;  2JNX A;  3D73 A;  1F70 A;  1NIW A;  2KFG A;  3V2L A;  3EG5 B;  1A29 A;  3BOW A;  4NDC A;  2PYQ A;  1J7R A;  4M2O A;  1MR8 A;  3BJH A;  1NCZ A;  3BUM B;  2L0P A;  1QAT A;  2BE4 A;  1A4P A;  1AVS A;  2L98 A;  1HQV A;  3WXA A;  1KK8 C;  2KI4 B;  1S5G Z;  3DF0 A;  3SS5 A;  3JTD B;  3UO9 A;  2JU0 A;  2LVI A;  1NUB A;  3LL8 B;  1LA0 A;  2LM5 A;  3PJI A;  1ZMZ A;  1V1G A;  1YRT B;  1U5I A;  2BKI B;  2COL B;  3PAL A;  2L4I A;  4NDD A;  1ZFS A;  1N65 A;  4ORC B;  1ALV A;  1S5G Y;  1SCV A;  3NXA A;  1S1E A;  1BU3 A;  3TZ1 A;  1IRJ A;  1MXE A;  3R1P A;  1OE9 B;  2KYF A;  1QIV A;  2LUX A;  2JPO A;  5CSI A;  1CFF A;  5DKR A;  3AKA A;  3PLF B;  1OZS A;  4PHJ A;  3NSK A;  1KQV A;  3OB2 B;  2WND A;  2LLS A;  2JNF A;  1MHO A;  1EG4 A;  2P70 A;  1DVI A;  4PHN A;  1Y1X A;  2WC6 A;  1TRF A;  5HLV A;  1TUJ A;  5AFP A;  2KGR A;  1UUS A;  1XFU O;  1A03 A;  3D78 A;  1KFX S;  2R2I A;  1OSA A;  2Y4Q A;  4GUK A;  1H4B A;  2JZI A;  4INX A;  4C0K A;  1UHN A;  1N0Y A;  4QJ5 B;  1S36 A;  2KBI A;  4C0L A;  3DD4 A;  3DZT A;  3SG3 A;  1YVL A;  2ZN8 A;  3O2P A;  5EL2 A;  1BG1 A;  3TS5 C;  1SY9 A;  2WC8 A;  1QWV A;  3ZNI A;  1PVA A;  3TUY B;  4ORB B;  4YGD B;  4OKH A;  1SBJ A;  1BMO A;  2WCE A;  1A75 A;  2K0J A;  2KFH A;  3GK4 X;  1DTL A;  1T14 A;  1IGV A;  1KFU S;  1XFX O;  3FS7 A;  4BY5 A;  1QV1 A;  2KFF A;  3WHT B;  1YR5 A;  1LVC D;  3S0E A;  3D0Y B;  1CKK A;  5KU1 A;  3DY9 A;  1ZAC A;  2TN4 A;  1DJY A;  3EVR A;  2AAO A;  3B87 A;  2QEO A;  3MSE B;  3RLZ A;  5HYD A;  1C3Y A;  3CR2 A;  2QAC A;  3OX6 A;  1TCO B;  2EGD A;  2LMV A;  3SG7 A;  2BE6 A;  1YTZ C;  2LE9 B;  1DEK A;  2CTN A;  5I2O A;  1M46 A;  2BL0 C;  2MA2 A;  5JJG A;  1JWD A;  3NGV A;  1GM0 A;  1UUR A;  1R2U A;  2KI4 C;  3R72 A;  1OOF A;  2BCA A;  3JTD C;  4HRE E;  1F54 A;  3FWB A;  1DQE A;  2LAN A;  1WLZ A;  4P2Y B;  4YGC B;  1C7W A;  1DF0 A;  5FI7 A;  1M45 A;  2BEC A;  3GOF A;  2LUC A;  4OZD A;  1OOI X;  1BLQ A;  1UHJ A;  3M0W A;  1CFP A;  2CNP A;  1SL7 A;  2BBM A;  2H2K A;  2LHI A;  2IS9 A;  1W7J B;  5TNC A;  1EL4 A;  1C07 A;  2JPT A;  1Q80 A;  3QRX A;  1BR1 B;  1QIW A;  4IL1 A;  3OP0 A;  1DT7 B;  4U8D A;  1NWD A;  2BAP A;  1GGW A;  1K8U A;  1EJ3 A;  1KFX L;  2M7N A;  2PMY A;  5HLO A;  1UHK A;  3LCP C;  3PN7 B;  4P5O E;  4CFQ A;  1REC A;  2LC5 A;  2KYC A;  3I5G B;  4XJK B;  1A2X A;  2O60 A;  2Q91 A;  1RFJ A;  3C1V A;  1LXF C;  4JPZ B;  2NXQ A;  1NX1 A;  2NZ0 A;  2ZN9 A;  4L9M A;  5GQQ C;  4CID A;  4PAL A;  3OB1 B;  1CMG A;  5DKN A;  4DIR A;  1FPW A;  2FCD A;  2ERB A;  1SYM A;  2ZND A;  4FQO A;  3SG4 A;  1ZUZ A;  1J1E A;  1KFU L;  3CZ2 A;  3PSR A;  1NX0 A;  1NP8 A;  3TUY C;  2OTG B;  2L2C A;  1YUT A;  1KQM B;  1MXL C;  2CBL A;  1C3Z A;  5HKY A;  1KWO B;  1OMR A;  1N2D A;  2CCM A;  4MZJ A;  2JQ6 A;  2G9B A;  4YBH B;  1TTX A;  1RK9 A;  1EH2 A;  3O78 A;  4YRU A;  5I94 A;  2L2E A;  2JT0 A;  2LNK A;  4YGA A;  3DVM A;  4TNC A;  3F45 A;  4MZK A;  3BFB A;  3HX4 A;  2PSR A;  2MRD A;  2FJU B;  2HPS A;  4R1E A;  2WCK A;  1FBV A;  4MN0 A;  3O6B A;  1OOG A;  2PVB A;  1TNX A;  3CZ1 A;  1L2O B;  2KAV A;  2NCP A;  3DVE A;  4PHM A;  4UPG A;  1QS7 A;  1QX7 A;  3CDN A;  1B1G A;  1QLK A;  1VRK A;  2MAZ A;  5CPV A;  1UP5 A;  4BY4 A;  4F0Z B; 
#chains in the Genus database with same CATH homology
 1PK0 D;  1IJ5 A;  4FTG A;  1QX5 B;  2LVJ A;  1K9K A;  4ETO A;  4MLW A;  1NCX A;  4NDB A;  5FYX A;  3BUW B;  1PVB A;  3BUN B;  3SIB A;  2E6W A;  1B8C A;  4A4C A;  1TNP A;  1UWO A;  5J3X A;  1IQ3 A;  1AP4 A;  1IG5 A;  4GPL B;  1K9U A;  3LK1 A;  5DKQ A;  1B47 A;  1CMF A;  1G4Y R;  3VGO A;  2I94 A;  1YUS A;  4XJK A;  3PN7 C;  3SG2 A;  1TNQ A;  3E3R A;  3I5G C;  1UHH A;  4N1G A;  1K95 A;  1F4Q A;  3EVV A;  1CLL A;  1S26 D;  1XFY O;  4ZCV A;  1LA3 A;  4M2Q A;  4OCI A;  2BBN A;  4AOM A;  1OOJ A;  2JXC A;  1TOP A;  2F33 A;  1YUR A;  2MBX A;  1XVJ A;  1CDM A;  4PE1 A;  1LIN A;  2OTG C;  4QJ4 B;  1NYA A;  4PDZ A;  2AMI A;  2M49 B;  2WCF A;  1K93 D;  5I2L A;  1BOC A;  2HQW A;  1SNL A;  3I5F B;  1WRZ A;  1KWO C;  2HET A;  1CTR A;  1L7Z A;  1PSR A;  1S6C A;  1Y1A A;  1SL8 A;  4CLN A;  5I2Q A;  4GGF C;  5AEQ A;  2DOQ A;  1YX8 A;  5AXI A;  4MZL A;  4MRX A;  2M97 A;  2FOT A;  1K96 A;  3KO0 A;  1YVH A;  3A4U B;  4DUQ A;  3I5I B;  3JVT B;  1FW4 A;  1R6P A;  2JWW A;  1KK7 Z;  1WY9 A;  2CT9 A;  1CLB A;  1XFW O;  2VRG A;  3O4Y A;  2Q4U A;  4YGB B;  1AJ4 A;  4N1F A;  1KSO A;  1KK7 Y;  2M8U A;  1SK6 D;  2Y5I A;  2BCB A;  2KI6 D;  2K7O A;  3AKB A;  3TDU A;  1JBA A;  2ISD A;  1B8L A;  1WRK A;  2MJW B;  3SJS A;  2LLT A;  3WNX B;  1XO5 A;  1JC2 A;  4WRI A;  1DJI A;  1CM4 A;  2JC2 A;  2JTT A;  2EHB A;  2GGM A;  2M0R A;  4C0J A;  3CR5 X;  3KF9 A;  1G8I A;  1H8B A;  2I7A A;  2NCO A;  3SG5 A;  1MQ1 A;  1J55 A;  1SR6 B;  1CM1 A;  2KHN A;  2MLF C;  3OX5 A;  2JOJ A;  2LVK A;  3ICB A;  4MBE A;  1Y1U A;  1NX2 A;  2M9G A;  1IJ6 A;  2L4H A;  4DCK A;  1B7T Z;  1SRA A;  1BT6 A;  3EK8 A;  1KCY A;  4ICB A;  3BXK A;  1JFK A;  1M39 A;  2M1K B;  5KSZ A;  2SCP A;  3KEV A;  4JQ0 D;  2KAX A;  1QTX A;  3CTN A;  3VRP A;  4YI9 A;  1B7T Y;  1Y6W A;  4ORA B;  2PRU A;  1PRW A;  1W7I B;  2LAP A;  3NSL A;  2Y1M A;  2KI6 C;  3BOW B;  1S6I A;  4M2P A;  3EKH A;  5CSF A;  2BCX A;  1KK8 B;  1DJX A;  3BUO B;  3DF0 B;  1LKJ A;  4HSZ A;  2JXL A;  1V1F A;  4OVN F;  2LP2 A;  1TIZ A;  2FCE A;  2LCP A;  3I5F C;  1J7Q A;  1U5I B;  1K2H A;  2GGZ A;  1GQM A;  5HKZ A;  1BOD A;  3D0Y A;  2JRF A;  1QJT A;  4YGE B;  5CSN A;  1OMD A;  2OS8 B;  4JWQ A;  4I5J A;  3FWC A;  4Q04 A;  4I5K A;  3I5I C;  1UHI A;  1NPQ A;  5IBW A;  1XA5 A;  2AUC A;  3LK0 A;  1K90 D;  1EXR A;  1NSH A;  4GFT A;  2QPT A;  1TNW A;  3BQ3 A;  1SPY A;  1MF8 B;  3D10 A;  3CGA A;  2GV5 A;  1CFD A;  1S3P A;  4MSP A;  3K21 A;  2F3Y A;  2I18 A;  1QVI Z;  5HKW A;  3ZWH A;  3GK2 A;  2F8P A;  5ER5 A;  4YI8 A;  1QLS A;  2LHL A;  2KBM A;  4GNK B;  1ZOT B;  1SR6 C;  1Y0V H;  1F71 A;  2JT8 A;  1B9A A;  1QVI Y;  2K7C A;  4PCW A;  2K8M B;  1JSA A;  4WQ3 A;  2LLU A;  4HRG A;  3EVU A;  5D69 A;  1DGV A;  1J7O A;  1OQP A;  4ZCU A;  3KHE A;  2RGI A;  5ER4 X;  1CDN A;  2CXJ A;  4OR9 B;  3VRQ A;  3PFV A;  3CR4 X;  1IQ5 A;  1DGU A;  1XYD A;  2BL0 B;  2G2B A;  2JUL A;  1FF1 A;  1F4O A;  2ZKM X;  3AAK A;  3EK4 A;  2E30 A;  1QAS A;  3H4S E;  1ALW A;  1K94 A;  4GGN A;  1FI6 A;  2LMU A;  2WOS A;  3A8R A;  1DJZ A;  1QV0 A;  2HF5 A;  1HT9 A;  1WDC B;  5CSJ A;  1S6J A;  2M3W A;  1DF0 B;  3CZT X;  2K61 A;  5JOL A;  1TN4 A;  1CFC A;  1GGZ A;  1KQM C;  2PAL A;  2M29 A;  2OS8 C;  3LLE A;  3CS1 A;  4GGF A;  4DS7 A;  2ZFD A;  3TDI A;  4AQJ A;  3CLN A;  3I5H B;  4PE4 A;  2F3Z A;  1JF0 A;  2LP3 A;  3DVK A;  3OHM B;  3WHU B;  2K2A A;  4WQ2 A;  1J1D A;  1BF5 A;  1CDL A;  1K9P A;  2V53 A;  3FIA A;  1IKU A;  1F55 A;  1CDP A;  1QXP A;  2NLN A;  3BUX B;  1YX7 A;  1SMG A;  2KNE A;  4I5L B;  1CB1 A;  3PM8 A;  1L2O C;  4D1E A;  3KPX A;  2L5X B;  1BR4 B;  1IWQ A;  2KSP A;  1AUI B;  3IF7 A;  1B4C A;  1YUU A;  2WOR A;  2WCB A;  2JT3 A;  1PUL A;  3BYA A;  4GBA A;  5D7F A;  5G08 A;  1KSM A;  3IQQ A;  4GAO A;  2KOT A;  3NSI A;  2F2O A;  5K89 A;  1XK4 A;  1JF2 A;  1X02 A;  1SW8 A;  3GK1 A;  1XK4 C;  1DMO A;  1OZO A;  1QX2 A;  2M7L A;  1M31 A;  1SL9 A;  1NCY A;  2Y1N A;  5BPJ A;  1DJH A;  4QJ3 B;  2PAS A;  1RWY A;  1SCM B;  2O5G A;  2ZRT A;  3EK7 A;  2LMT A;  2F2P A;  3RM1 A;  1ODB A;  2EC6 B;  2LV7 A;  4PE7 A;  2ZRS A;  4E68 A;  1EG3 A;  2ZNE A;  5AER A;  2L51 A;  1AHR A;  1J7P A;  1XFV O;  1F8H A;  1PSB A;  1SKT A;  2OPO A;  3PAT A;  3VRN A;  4I5N B;  1AK8 A;  1RRO A;  1WDC C;  3VRO A;  3TDZ A;  4AQI A;  1JUO A;  4OV2 A;  2L50 A;  1WLM A;  1M63 B;  2KQ6 A;  3AAJ A;  3SIA A;  1G33 A;  5PAL A;  4PE0 A;  1B8R A;  4HRH A;  1FI5 A;  1DJW A;  3I5H C;  4CPV A;  2JTZ A;  1JFJ A;  4USL A;  5AAN A;  1AJ5 A;  2K7B A;  2KQY A;  3JVT C;  1CNP A;  1MWN A;  1OMV A;  3VRR A;  2BKH B;  4N5X A;  2B1U A;  4MRY A;  1WRL A;  4PHK A;  1GJY A;  2I2R E;  2SAS A;  3HCM A;  1D1O A;  3DVJ A;  3EKJ A;  5B8I B;  2D8N A;  2HQ8 A;  4MVF A;  4CFR A;  4A4B A;  2LVV A;  2MHH A;  2K2F A;  2M1U A;  1C7V A;  3TS5 B;  1XFZ O;  1DJG A;  3IQO A;  2A4J A;  4MEW A;  1BJF A;  1CLM A;  5I8N A;  3CWG A;  1RJV A;  2KDH A;  1PAL A;  1A75 B;  2KAY A;  2H61 A;  3SG6 A;  2H61 C;  1IH0 A;  1SCM C;  1NX3 A;  1YRU B;  1TCF A;  3NSO A;  1MUX A;  2P6B B;  4NQG A;  2MLE C;  2EC6 C;  5F6T A;  1RTP 1;  1E8A A;  2K7D A;  4DRW A;  2KGB C;  4XYN A;  5KTY A;  2JNX A;  1F70 A;  1NIW A;  2KFG A;  1A29 A;  3BOW A;  4NDC A;  1J7R A;  4M2O A;  1MR8 A;  1NCZ A;  3BUM B;  2L0P A;  1QAT A;  2BE4 A;  1A4P A;  1AVS A;  2L98 A;  1HQV A;  3WXA A;  1KK8 C;  2KI4 B;  1S5G Z;  3DF0 A;  3JTD B;  2JU0 A;  2LVI A;  1NUB A;  3LL8 B;  1LA0 A;  2LM5 A;  1ZMZ A;  1V1G A;  1YRT B;  1U5I A;  2BKI B;  2COL B;  3PAL A;  2L4I A;  4NDD A;  1N65 A;  1ZFS A;  4ORC B;  1ALV A;  1S5G Y;  1SCV A;  3NXA A;  1S1E A;  1BU3 A;  3TZ1 A;  1IRJ A;  1MXE A;  1OE9 B;  2KYF A;  1QIV A;  2LUX A;  5CSI A;  1CFF A;  5DKR A;  3AKA A;  3PLF B;  1OZS A;  4PHJ A;  3NSK A;  1KQV A;  3OB2 B;  2WND A;  2LLS A;  2JNF A;  1MHO A;  1EG4 A;  1DVI A;  4PHN A;  1Y1X A;  1TRF A;  5HLV A;  5AFP A;  2KGR A;  1UUS A;  1XFU O;  1A03 A;  1KFX S;  2R2I A;  1OSA A;  2Y4Q A;  4GUK A;  1H4B A;  2JZI A;  4C0K A;  1UHN A;  1N0Y A;  4QJ5 B;  1S36 A;  2KBI A;  4C0L A;  3DD4 A;  3SG3 A;  1YVL A;  2ZN8 A;  3O2P A;  1BG1 A;  3TS5 C;  1SY9 A;  2WC8 A;  3ZNI A;  1PVA A;  3TUY B;  4ORB B;  4YGD B;  4OKH A;  1SBJ A;  1BMO A;  2WCE A;  1A75 A;  2K0J A;  2KFH A;  3GK4 X;  1DTL A;  1IGV A;  1KFU S;  1XFX O;  3FS7 A;  4BY5 A;  1QV1 A;  2KFF A;  3WHT B;  1YR5 A;  1LVC D;  3D0Y B;  1CKK A;  5KU1 A;  1ZAC A;  2TN4 A;  1DJY A;  3EVR A;  2AAO A;  3MSE B;  3RLZ A;  5HYD A;  3CR2 A;  2QAC A;  3OX6 A;  1TCO B;  2EGD A;  2LMV A;  3SG7 A;  2BE6 A;  1YTZ C;  2LE9 B;  5I2O A;  2CTN A;  1M46 A;  2BL0 C;  2MA2 A;  5JJG A;  1JWD A;  1UUR A;  1R2U A;  2KI4 C;  2BCA A;  3JTD C;  4HRE E;  1F54 A;  3FWB A;  2LAN A;  1WLZ A;  4P2Y B;  4YGC B;  1C7W A;  1DF0 A;  1M45 A;  2BEC A;  3GOF A;  2LUC A;  1BLQ A;  1UHJ A;  3M0W A;  1CFP A;  2CNP A;  1SL7 A;  2BBM A;  2H2K A;  2LHI A;  2IS9 A;  1W7J B;  5TNC A;  1EL4 A;  1C07 A;  2JPT A;  1Q80 A;  3QRX A;  1BR1 B;  1QIW A;  4IL1 A;  3OP0 A;  1DT7 B;  4U8D A;  1NWD A;  1GGW A;  1K8U A;  1EJ3 A;  1KFX L;  2M7N A;  2PMY A;  5HLO A;  1UHK A;  3LCP C;  3PN7 B;  4P5O E;  4CFQ A;  1REC A;  2LC5 A;  2KYC A;  3I5G B;  4XJK B;  1A2X A;  2O60 A;  2Q91 A;  1RFJ A;  3C1V A;  1LXF C;  4JPZ B;  2NXQ A;  1NX1 A;  2NZ0 A;  2ZN9 A;  4L9M A;  5GQQ C;  4CID A;  4PAL A;  3OB1 B;  1CMG A;  5DKN A;  4DIR A;  1FPW A;  2FCD A;  1SYM A;  2ZND A;  4FQO A;  3SG4 A;  1ZUZ A;  1J1E A;  1KFU L;  3PSR A;  3TUY C;  1NX0 A;  1NP8 A;  2OTG B;  1YUT A;  1KQM B;  1MXL C;  2CBL A;  5HKY A;  1KWO B;  1OMR A;  1N2D A;  2CCM A;  4MZJ A;  2JQ6 A;  2G9B A;  4YBH B;  1TTX A;  1RK9 A;  1EH2 A;  3O78 A;  4YRU A;  2L2E A;  2JT0 A;  2LNK A;  4YGA A;  3DVM A;  4TNC A;  3F45 A;  4MZK A;  3HX4 A;  2PSR A;  2MRD A;  2FJU B;  2HPS A;  4R1E A;  1FBV A;  4MN0 A;  3O6B A;  2PVB A;  1TNX A;  3DVE A;  1L2O B;  2KAV A;  2NCP A;  4PHM A;  4UPG A;  1QS7 A;  1QX7 A;  1B1G A;  1QLK A;  1VRK A;  2MAZ A;  5CPV A;  1UP5 A;  4BY4 A;  4F0Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...