1KQMB

Scallop myosin s1-amppnp in the actin-detached conformation
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
142
structure length
142
Chain Sequence
PQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKGSGEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic findings on the internally uncoupled and near-rigor states of myosin: Further insights into the mechanics of the motor
pubmed doi rcsb
molecule tags Contractile protein
molecule keywords MYOSIN heavy chain
total genus 30
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2002-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kqmB01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kqmB02
1A29A 1DJXA 1KK7Y 1CM4A 1KQMC 1VRKA 2WOSA 4IL1A 2EC6B 3DVJA 4DS7A 1PALA 2LMVA 1XVJA 4MVFA 1OZOA 1QV1A 1H4BA 1RFJA 1JBAA 1RECA 1RK9A 2BECA 3EVRA 1CM1A 2M8UA 1QX7A 4USLA 2LHIA 2IS9A 4A4CA 2MLFC 3O78A 4CFRA 1CFFA 1JSAA 4R1EA 2QACA 3CTNA 1NX3A 1UHIA 1WRZA 2LP2A 1J7OA 3A8RA 3BUMB 1YUUA 1CLMA 2LHLA 2O5GA 4PE7A 5AEQA 1UHHA 1LVCD 3ZNIA 4ZCUA 4PDZA 1IQ5A 2BKHB 1TCOB 5PALA 1SR6C 3ZWHA 5DKNA 1BODA 1KFXS 1WY9A 4I5JA 4DIRA 4AQIA 2KAVA 3KO0A 3PLFB 4PHMA 1MWNA 2F8PA 3OB1B 5AANA 1F54A 1XK4A 3C1VA 5IBWA 1IG5A 2R2IA 3CLNA 5ER5A 2KAYA 3VRPA 4I5KA 3CWGA 5I2LA 1YURA 4PE1A 5HYDA 4WQ2A 1FPWA 2KNEA 3AKAA 4E68A 3TS5C 1XFVO 1XYDA 5TNCA 2LUXA 2ISDA 1J7RA 1CTRA 2CNPA 4PALA 2NXQA 3PSRA 4M2PA 5G08A 1RTP1 1WLZA 5D69A 1S6IA 4JQ0D 1WLMA 2LMUA 2A4JA 2V53A 4CLNA 1CDNA 2LVKA 2M0RA 3SG2A 1NSHA 4OKHA 2BBNA 4NDDA 2WCBA 1AVSA 2MRDA 1MUXA 3DF0A 1UHKA 2JNXA 3I5HB 1OMRA 1YVHA 2CXJA 2LAPA 1YUTA 2JC2A 2LP3A 2M49B 2FJUB 1NX2A 4PHJA 3CR2A 2BE6A 3WNXB 3PATA 4DUQA 4OVNF 3I5FB 1K93D 1WDCB 3SG3A 3LLEA 3BOWB 1ALVA 2B1UA 3PN7B 1J1EA 3SG4A 3O6BA 1KK8C 1B4CA 4BY4A 5KTYA 4C0KA 4N1FA 2ZFDA 4XJKB 4U8DA 1B47A 1XA5A 1IH0A 1DJHA 1JFKA 2L51A 1DJYA 2Y4QA 1S1EA 1XFYO 1IWQA 1GGZA 3TUYC 5F6TA 2JTTA 1JUOA 1NCYA 2LE9B 2JT3A 3D0YB 1YTZC 1KQMB 1X02A 2KSPA 1SL7A 1S5GZ 2KGRA 1DJZA 1M39A 2ZRTA 1DGVA 4C0JA 1UWOA 3DVEA 1K9PA 1LXFC 1R6PA 3PM8A 1UHNA 1U5IA 1KK8B 1HQVA 2AUCA 1CDPA 2KYFA 2LVVA 3KPXA 1YX8A 1TIZA 4YGDB 5CSIA 2JXCA 1SR6B 3JVTC 2GV5A 1XFUO 1DTLA 1K95A 4UPGA 3EK4A 2ZNDA 2L4HA 5HKWA 1AJ4A 2K7CA 4YI9A 5DKRA 3K21A 3SG6A 2SASA 1XFWO 2OS8B 1HT9A 2L4IA 1F70A 3OP0A 2KBIA 5JOLA 1BG1A 3BUOB 3EVVA 4NQGA 3KF9A 1OMVA 4MLWA 1DJIA 1YRTB 1IJ5A 1K8UA 2KDHA 5GQQC 1IRJA 1QVIZ 1TNPA 3BUNB 3HX4A 4GBAA 2JT0A 3E3RA 4DCKA 1EH2A 4HRHA 2KAXA 4OV2A 1NX1A 5J3XA 1DT7B 1B8RA 2KOTA 2H61A 1DF0B 1GGWA 2JTZA 4YBHB 2I18A 2LVIA 1PVAA 2L98A 1WRLA 1FI5A 1KCYA 1PVBA 1L7ZA 4CIDA 2L50A 2M7LA 3TDZA 4D1EA 3BOWA 1NIWA 4MRXA 5CSJA 4YGBB 2I94A 1TNQA 1QTXA 1CLBA 1XFXO 1S26D 1GJYA 1KSMA 2NLNA 3M0WA 3SJSA 2F3ZA 2ZKMX 2NZ0A 2MBXA 2JRFA 1KK7Z 1BMOA 3F45A 3BUXB 3I5GC 3I5IC 3RM1A 2MA2A 4A4BA 4CFQA 3JTDC 2KFFA 2OPOA 3QRXA 2M3WA 2KGBC 1JWDA 2KHNA 1YUSA 1L2OB 1OE9B 1ZACA 4P5OE 3VROA 3OB2B 4P2YB 3HCMA 4YGEB 3KEVA 1F8HA 4PE4A 4ETOA 2BL0C 3DVKA 1NP8A 1QIVA 1Y6WA 2E30A 2JXLA 2LLSA 3TDUA 4CPVA 1YRUB 2JU0A 2LVJA 1ZOTB 2M1UA 1FBVA 1BT6A 2HF5A 4PE0A 1RJVA 2JULA 3NSLA 4MZJA 3EKJA 4YRUA 1G33A 3I5HC 2KFGA 1KWOB 3LK1A 2H61C 1XO5A 1MR8A 1TOPA 4QJ4B 2L5XB 1ZMZA 2LC5A 4QJ5B 2K2AA 3VRRA 5CSNA 3NXAA 1V1FA 1N65A 2L2EA 1G8IA 2M1KB 2KBMA 2VRGA 2PALA 2G2BA 5I2OA 2FCDA 4WQ3A 3WHUB 1BOCA 3GK1A 2L0PA 1QV0A 2F33A 2MLEC 4ZCVA 5AXIA 5D7FA 3VGOA 1B8LA 1PSBA 4C0LA 1AK8A 2BCBA 3CR5X 1N2DA 2JOJA 2G9BA 2KYCA 1BJFA 1FW4A 1NCXA 1SYMA 2GGZA 5ER4X 3SIAA 2WORA 2P6BB 1LINA 3CZTX 3GOFA 2H2KA 1QX5B 1F55A 3I5GB 3I5IB 1AUIB 1JFJA 2LNKA 1J7PA 5FYXA 2HETA 1ODBA 2BKIB 1Y1XA 2AAOA 2JQ6A 1KSOA 2QPTA 3EKHA 2KFHA 1QATA 3AAJA 4I5LB 2BCAA 3O2PA 3BQ3A 5CPVA 5AFPA 1Q80A 3TDIA 1G4YR 4ICBA 5HLOA 1J55A 1QIWA 2K7BA 1SBJA 4MRYA 4OCIA 1JF0A 2Q91A 3H4SE 2ZN8A 1TCFA 3ICBA 1W7JB 2Y1NA 3CR4X 3SIBA 2WNDA 4ORBB 1K2HA 1FF1A 1EG4A 2LANA 3EVUA 1CFPA 4FTGA 2LCPA 1S36A 3NSOA 4AOMA 1NX0A 2CCMA 5BPJA 1K90D 4GGFA 1NWDA 1S3PA 3AKBA 3BXKA 1QS7A 1CFDA 1AP4A 4OR9B 1LA3A 3A4UB 3OX5A 1EXRA 1SKTA 2PMYA 2WC8A 2LUCA 2LV7A 1TRFA 2LLUA 1SY9A 1Y1UA 1OOJA 2RGIA 4NDCA 4YGCB 4BY5A 1QLKA 2MJWB 1FI6A 1BLQA 1F4OA 1B1GA 2I7AA 2WCFA 1CB1A 1R2UA 2JT8A 1YR5A 2KI4C 3FS7A 3RLZA 2FCEA 4GPLB 5HLVA 1SMGA 1CDLA 1BU3A 2CT9A 1EG3A 1JC2A 2K2FA 2SCPA 1PULA 2WCEA 3VRQA 1PK0D 2KQ6A 1SNLA 4FQOA 1M45A 1CFCA 4GAOA 1A03A 2K7DA 4ORCB 1ZFSA 1CDMA 2Y1MA 2MHHA 4ORAB 1DF0A 4GFTA 1DJGA 5KU1A 1K9UA 1CMGA 2JNFA 1QLSA 1QVIY 1DGUA 1A2XA 2KI4B 1A75A 5AERA 1D1OA 2BBMA 1AJ5A 1LA0A 2LM5A 3FIAA 2K61A 2BCXA 1RWYA 1CMFA 3NSKA 4N5XA 4MEWA 2OTGB 1BR1B 1E8AA 2LMTA 2M9GA 2EC6C 1MQ1A 1GQMA 2AMIA 2F2PA 3SG7A 3EK7A 2TN4A 3I5FC 1QASA 2NCOA 3OHMB 1PSRA 1TNWA 1TN4A 1C7WA 2NCPA 5HKYA 1IGVA 1OMDA 3LL8B 1IKUA 3AAKA 3JVTB 2CTNA 4YGAA 3GK4X 3WHTB 1EL4A 2D8NA 1NYAA 1CLLA 1Y0VH 2CBLA 3JTDB 1F71A 4AQJA 4F0ZB 1C07A 2EHBA 3MSEB 1OQPA 1S6CA 1S6JA 2HPSA 2K7OA 3FWBA 4WRIA 1Y1AA 3KHEA 4JPZB 3D10A 3TS5B 1DVIA 2JPTA 1UUSA 2FOTA 2LLTA 1KFUL 4GNKB 1WDCC 1WRKA 2Y5IA 5JJGA 1LKJA 1DMOA 1M46A 3PFVA 4GGFC 1SW8A 3SG5A 3WXAA 4NDBA 1CNPA 2COLB 1ALWA 4QJ3B 1UURA 1UHJA 2M29A 3CS1A 1J7QA 3NSIA 4Q04A 1XK4C 2JWWA 3PN7C 2K8MB 3EK8A 3FWCA 3GK2A 1NUBA 4XYNA 1MF8B 1YVLA 1QXPA 5KSZA 1SL9A 1QJTA 2ZNEA 3CGAA 2BE4A 2PASA 1SCMB 3DF0B 1TNXA 2KQYA 2ZN9A 3BYAA 1SCVA 1V1GA 3IQOA 5B8IB 5I2QA 4HRGA 2KI6C 2DOQA 1B8CA 1A4PA 3LK0A 2I2RE 2PVBA 1MHOA 2OS8C 1L2OC 3DD4A 1M31A 1B7TZ 1A75B 3IQQA 4HREE 3TUYB 1S5GY 1N0YA 4I5NB 1K9KA 1MXEA 2E6WA 1RROA 4MZLA 4PHKA 1AHRA 1K96A 4M2OA 5K89A 1H8BA 1M63B 3DVMA 1KFXL 4JWQA 2MAZA 1UP5A 2ZRSA 2HQWA 5DKQA 2M97A 1KWOC 2HQ8A 1F4QA 4MZKA 1OZSA 1NCZA 2OTGC 1W7IB 1J1DA 4TNCA 3BUWB 4MN0A 4M2QA 2PRUA 2M7NA 3IF7A 1YX7A 3O4YA 4L9MA 1OSAA 1SPYA 4DRWA 1IQ3A 4XJKA 1K94A 4PHNA 3VRNA 1PRWA 3PALA 4GUKA 4YI8A 1B7TY 3D0YA 1DJWA 5I8NA 2JZIA 1SK6D 4MBEA 3TZ1A 2BL0B 2PSRA 1BF5A 1NPQA 4PCWA 1KQVA 1SL8A 1MXLC 4MSPA 3OX6A 2F2OA 4HSZA 3LCPC 1ZUZA 1BR4B 1XFZO 2F3YA 1TTXA 1IJ6A 1U5IB 2K0JA 2KI6D 4GGNA 2GGMA 5CSFA 1C7VA 5HKZA 1B9AA 2O60A 1JF2A 1CKKA 1EJ3A 1KFUS 1SCMC 1SRAA 1QX2A 2Q4UA 2EGDA 4N1GA
chains in the Genus database with same CATH superfamily
1A29A 1DJXA 1KK7Y 1CM4A 1KQMC 1VRKA 2WOSA 4IL1A 2EC6B 3DVJA 4DS7A 1PALA 2LMVA 1XVJA 4MVFA 1OZOA 1QV1A 1H4BA 1RFJA 1JBAA 1RECA 1RK9A 2BECA 3EVRA 1CM1A 2M8UA 1QX7A 3R1OA 2LHIA 2IS9A 4USLA 2MLFC 3O78A 4A4CA 4CFRA 1JSAA 4R1EA 1C3YA 2QACA 3IVTA 3D73A 3BJHA 3CTNA 1NX3A 1UHIA 1WRZA 2LP2A 5FI6A 1J7OA 3A8RA 3BUMB 3OBVA 1YUUA 1CLMA 2LHLA 2O5GA 4PE7A 5AEQA 1UHHA 1LVCD 3ZNIA 2P70A 4ZCUA 4PDZA 2BKHB 1IQ5A 1TCOB 3Q8IA 1SR6C 5PALA 3ZWHA 5DKNA 1BODA 1KFXS 1WY9A 4I5JA 4DIRA 4AQIA 2KAVA 3KO0A 3PLFB 2JPOA 3CABA 4PHMA 1MWNA 2F8PA 3OB1B 5AANA 1F54A 1XK4A 3C1VA 5IBWA 1IG5A 3NHTA 2R2IA 3CLNA 5ER5A 2KAYA 3VRPA 3CZ1A 3CWGA 4I5KA 1YURA 4PE1A 5I2LA 5HYDA 4WQ2A 1FPWA 2KNEA 3AKAA 4E68A 3TS5C 3S0BA 1DELA 1W9ZA 1XFVO 1XYDA 2LUXA 5TNCA 2ISDA 1J7RA 1CTRA 2CNPA 4PALA 2NXQA 3PSRA 4M2PA 5G08A 1OOGA 1RTP1 1WLZA 5D69A 1TUZA 1S6IA 4JQ0D 1WLMA 2LMUA 2A4JA 2V53A 4CLNA 1CDNA 2LVKA 2M0RA 1T14A 2PQLA 3V2LA 3SG2A 1NSHA 4OKHA 2BBNA 3L4AA 4NDDA 2WCBA 1OOHA 1AVSA 2MRDA 1MUXA 3DF0A 1UHKA 2JNXA 3DYEA 3I5HB 1OMRA 1YVHA 2CXJA 2LAPA 1YUTA 2JC2A 2LP3A 3CZ2A 2M49B 2FJUB 1NX2A 4PHJA 3CR2A 2BE6A 3WNXB 3NHIA 3PATA 4DUQA 4OZDA 4OVNF 3I5FB 1K93D 1WDCB 4JKTA 3SG3A 3LLEA 3BOWB 1ALVA 2B1UA 3PN7B 1J1EA 3SG4A 3O6BA 1KK8C 1B4CA 4BY4A 5KTYA 4C0KA 4N1FA 2ZFDA 4XJKB 4U8DA 1B47A 1XA5A 3S0GA 1DJHA 1JFKA 2L51A 1DJYA 2Y4QA 1IH0A 1S1EA 1XFYO 1IWQA 1GGZA 3TUYC 5F6TA 2JTTA 1JUOA 1NCYA 2LE9B 2JT3A 3BFHA 3D0YB 1YTZC 1KQMB 1X02A 2P71A 2KSPA 2BNXA 1SL7A 1S5GZ 2KGRA 1DJZA 1M39A 2ZRTA 1DGVA 3D77A 4C0JA 1UWOA 4IJ7A 3DVEA 1K9PA 1LXFC 1R6PA 3PM8A 1UHNA 1U5IA 1KK8B 1HQVA 2AUCA 1CDPA 2KYFA 2LVVA 3KPXA 1YX8A 1TIZA 4YGDB 5CSIA 2JXCA 1SR6B 3JVTC 2GV5A 1XFUO 3D75A 1DTLA 5HL1A 1K95A 4UPGA 3EK4A 2ZNDA 2L4HA 5HKWA 1AJ4A 2K7CA 4YI9A 5DKRA 4F7FA 3K21A 3SG6A 2SASA 1XFWO 2OS8B 1HT9A 1TUJA 2L4IA 1F70A 2WCLA 3OP0A 2KBIA 5JOLA 1BG1A 3BUOB 3EVVA 4NQGA 3KF9A 1CFCA 1OMVA 2QEBA 1DJIA 1YRTB 1IJ5A 1K8UA 2KDHA 3D74A 4MLWA 5GQQC 1IRJA 1QVIZ 1TNPA 2ERBA 3BUNB 3HX4A 4GBAA 2JT0A 3E3RA 4DCKA 3FE6A 1EH2A 4HRHA 2KAXA 4OV2A 1NX1A 5J3XA 1DT7B 1B8RA 2KOTA 2H61A 1DF0B 1GGWA 5D3OA 2JTZA 4YBHB 2I18A 2LVIA 1PVAA 2L98A 1WRLA 1FI5A 1KCYA 1PVBA 1L7ZA 4CIDA 2L50A 2M7LA 3TDZA 4D1EA 3BOWA 1NIWA 1P28A 2WCKA 4MRXA 5CSJA 4YGBB 2I94A 1TNQA 3UO9A 1QTXA 1CLBA 1XFXO 1S26D 1GJYA 1KSMA 2NLNA 3M0WA 3SJSA 2F3ZA 2ZKMX 2NZ0A 2MBXA 2JRFA 1KK7Z 1BMOA 3F45A 3BUXB 2WC5A 3I5GC 3I5IC 2MA2A 3RM1A 4A4BA 4CFQA 3JTDC 2KFFA 2OPOA 3QRXA 2M3WA 2KGBC 1JWDA 2KHNA 1YUSA 1L2OB 1OE9B 1ZACA 5EL2A 4P5OE 3VROA 3OB2B 4P2YB 3HCMA 4YGEB 3CZ0A 3KEVA 1F8HA 2KLDA 4PE4A 1QWVA 2BL0C 3DVKA 4ETOA 1NP8A 1QIVA 1Y6WA 2E30A 2JXLA 2LLSA 3BFAA 3TDUA 4CPVA 1YRUB 2JU0A 2LVJA 2H8VA 1ZOTB 2M1UA 1FBVA 1BT6A 2HF5A 4PE0A 1RJVA 2WCMA 2JULA 3NSLA 4MZJA 3EKJA 4YRUA 1G33A 3I5HC 2BAPA 1TWOA 2KFGA 1KWOB 3D78A 2QDIA 3LK1A 2H61C 1XO5A 1MR8A 1TOPA 1Z2CB 4QJ4B 2L5XB 1ZMZA 2LC5A 4QJ5B 2K2AA 3VRRA 2KPHA 5CSNA 3NXAA 3S0DA 1V1FA 1N65A 2L2EA 1G8IA 2M1KB 2KBMA 2VRGA 2PALA 2G2BA 5I2OA 2FCDA 4WQ3A 3R72A 3D76A 3WHUB 1BOCA 3GK1A 2L0PA 1QV0A 2F33A 2MLEC 4ZCVA 5AXIA 5D7FA 3VGOA 1B8LA 1PSBA 4C0LA 3EG5B 1AK8A 2BCBA 3CR5X 1N2DA 2JOJA 2G9BA 2KYCA 1BJFA 1FW4A 1NCXA 1SYMA 2GGZA 5ER4X 3B6XA 2WORA 2P6BB 3SIAA 5I94A 1LINA 3CZTX 3GOFA 2H2KA 1QX5B 1F55A 3I5GB 3I5IB 1AUIB 1JFJA 2LNKA 1J7PA 3OGNA 3DZTA 5FYXA 3DY9A 2HETA 1ODBA 2BKIB 1Y1XA 2AAOA 2JQ6A 1KSOA 2QPTA 3EKHA 2KFHA 1QATA 3AAJA 1DEKA 4I5LB 2BCAA 2KLEA 3BQ3A 3O2PA 5CPVA 1Q80A 3TDIA 1G4YR 5AFPA 4ICBA 5HLOA 3CYZA 1J55A 1QIWA 2K7BA 1SBJA 4KYNA 4MRYA 4OCIA 3UNWA 1JF0A 2Q91A 3RZSA 3H4SE 2ZN8A 1TCFA 3ICBA 1W7JB 2Y1NA 3CR4X 3SIBA 5DICA 2WNDA 4ORBB 1K2HA 1FF1A 1EG4A 2LANA 3EVUA 3L4LA 1CFPA 4FTGA 2LCPA 1S36A 3NSOA 4AOMA 1NX0A 2CCMA 5BPJA 1K90D 4GGFA 1NWDA 1S3PA 3AKBA 3BXKA 3O4XA 1QS7A 1CFDA 1AP4A 4OR9B 1LA3A 3A4UB 3OX5A 1EXRA 1SKTA 2PMYA 2WC6A 2WC8A 2LUCA 2LV7A 1TRFA 2LLUA 1SY9A 1Y1UA 1OOJA 2RGIA 4NDCA 4YGCB 4BY5A 1QLKA 2MJWB 1FI6A 1BLQA 1F4OA 1B1GA 2I7AA 2WCFA 1CB1A 1LS8A 1R2UA 2JT8A 1YR5A 2KI4C 3S0AA 3FS7A 3RLZA 2FCEA 4GPLB 3DXLA 5HLVA 1SMGA 1CDLA 1BU3A 2CT9A 1EG3A 1JC2A 2K2FA 2SCPA 1PULA 2WCEA 3VRQA 1PK0D 2KQ6A 1SNLA 4FQOA 1M45A 4JD9A 4GAOA 1A03A 2K7DA 4ORCB 1GM0A 1ZFSA 1CDMA 4INWA 2Y1MA 2MHHA 2WCHA 4ORAB 1DF0A 4GFTA 1DJGA 5KU1A 1K9UA 2QEVA 1CMGA 2JNFA 1QLSA 1QVIY 1DGUA 1A2XA 2KI4B 1A75A 5AERA 1D1OA 2BBMA 1AJ5A 1LA0A 2LM5A 3N7HA 3PJIA 3PM2A 3FIAA 3R1PA 2K61A 2BCXA 1RWYA 1CMFA 3NSKA 4N5XA 2L5YA 4MEWA 2OTGB 1BR1B 1E8AA 2LMTA 2M9GA 2EC6C 1MQ1A 1GQMA 2AMIA 2F2PA 3SG7A 3EK7A 2TN4A 3I5FC 1QASA 2NCOA 3OHMB 1Z4HA 1PSRA 1TNWA 3FE8A 1TN4A 1C7WA 2NCPA 3SS5A 5HKYA 1IGVA 1OMDA 3LL8B 1IKUA 3AAKA 3JVTB 2CTNA 4YGAA 3GK4X 3WHTB 1EL4A 2D8NA 1NYAA 1CLLA 1Y0VH 2CBLA 3JTDB 1F71A 4AQJA 4F0ZB 2K60A 1C07A 2EHBA 3MSEB 1OQPA 1S6CA 1S6JA 2HPSA 2K7OA 3FWBA 4WRIA 1Y1AA 3KHEA 4JPZB 3D10A 3TS5B 1DVIA 2JPTA 1UUSA 2FOTA 2LLTA 1KFUL 4GNKB 1WDCC 1WRKA 2Y5IA 5JJGA 1LKJA 1DMOA 1M46A 3PFVA 4GGFC 1SW8A 3SG5A 3WXAA 4NDBA 1CNPA 2COLB 1ALWA 4QJ3B 1UURA 1IIOA 1UHJA 2M29A 3CS1A 1J7QA 1CFFA 3B7AA 3NSIA 4Q04A 1XK4C 2JWWA 3PN7C 2K8MB 3EK8A 3FWCA 1C3ZA 1DC1A 1XFRA 1DQEA 3GK2A 1NUBA 3B87A 1MF8B 4XYNA 1YVLA 1QXPA 5KSZA 1SL9A 1QJTA 2ZNEA 3SS3A 3CGAA 2BE4A 2PASA 1SCMB 3DF0B 1TNXA 2KQYA 2ZN9A 3BYAA 1SCVA 1V1GA 3IQOA 5B8IB 3VB1A 4HRGA 2KI6C 5I2QA 2DOQA 1B8CA 1A4PA 3LK0A 2I2RE 1ORGA 2PVBA 5FI2A 2QEHA 1MHOA 3S0FA 2OS8C 3BFBA 1L2OC 3DD4A 1M31A 1B7TZ 1A75B 3IQQA 4HREE 3TUYB 1S5GY 3R1VA 1N0YA 1OOIX 2FJYA 4I5NB 1K9KA 1MXEA 2E6WA 1RROA 4INXA 4MZLA 1AHRA 1K96A 4PHKA 4M2OA 3L47A 5K89A 1H8BA 1M63B 3S0EA 3DVMA 1KFXL 4JWQA 2MAZA 1UP5A 2ZRSA 2HQWA 2YGUA 5DKQA 2M97A 1KWOC 2HQ8A 1F4QA 4MZKA 1OZSA 1NCZA 2OTGC 1W7IB 1J1DA 4TNCA 3BUWB 4MN0A 3CDNA 4M2QA 2PRUA 2M7NA 2QEOA 1YX7A 3IF7A 3O4YA 4L9MA 1OSAA 1SPYA 4DRWA 1IQ3A 4XJKA 1K94A 4PHNA 3VRNA 1PRWA 3PALA 4GUKA 4YI8A 1OW4A 1B7TY 3D0YA 1DJWA 5I8NA 3B88A 2JZIA 1SK6D 4MBEA 3TZ1A 2BL0B 3QMEA 2PSRA 1OOFA 1BF5A 1NPQA 4PCWA 1KQVA 1SL8A 1MXLC 4MSPA 2WCJA 3OX6A 3NGVA 2F2OA 4HSZA 3LCPC 1ZUZA 1BR4B 1XFZO 4FQTA 1U5IB 1TTXA 1IJ6A 2F3YA 2GTEA 2K0JA 2KI6D 2GGMA 2L2CA 4GGNA 5CSFA 5HKZA 1C7VA 3SS4A 1B9AA 4PT1A 2O60A 3B86A 1JF2A 5FI7A 1CKKA 1EJ3A 1KFUS 3FE9A 3K1EA 1SCMC 1SRAA 2PYQA 1QX2A 2Q4UA 1SSEB 2EGDA 4N1GA
chains in the Genus database with same CATH topology
1A29A 1DJXA 1KK7Y 1CM4A 1KQMC 1VRKA 2WOSA 4IL1A 2EC6B 3DVJA 4DS7A 1PALA 2LMVA 1XVJA 4MVFA 1OZOA 1QV1A 1H4BA 1RFJA 1JBAA 1RECA 1RK9A 2BECA 3EVRA 1CM1A 2M8UA 1QX7A 4USLA 2LHIA 2IS9A 4A4CA 2MLFC 3O78A 4CFRA 1CFFA 1JSAA 4R1EA 2QACA 3CTNA 1NX3A 1UHIA 1WRZA 2LP2A 1J7OA 3A8RA 3BUMB 1YUUA 1CLMA 2LHLA 2O5GA 4PE7A 5AEQA 1UHHA 1LVCD 3ZNIA 4ZCUA 4PDZA 1IQ5A 2BKHB 1TCOB 5PALA 1SR6C 3ZWHA 5DKNA 1BODA 1KFXS 1WY9A 4I5JA 4DIRA 4AQIA 2KAVA 3KO0A 3PLFB 4PHMA 1MWNA 2F8PA 3OB1B 5AANA 1F54A 1XK4A 3C1VA 5IBWA 1IG5A 2R2IA 3CLNA 5ER5A 2KAYA 3VRPA 4I5KA 3CWGA 5I2LA 1YURA 4PE1A 5HYDA 4WQ2A 1FPWA 2KNEA 3AKAA 4E68A 3TS5C 1XFVO 1XYDA 5TNCA 2LUXA 2ISDA 1J7RA 1CTRA 2CNPA 4PALA 2NXQA 3PSRA 4M2PA 5G08A 1RTP1 1WLZA 5D69A 1S6IA 4JQ0D 1WLMA 2LMUA 2A4JA 2V53A 4CLNA 1CDNA 2LVKA 2M0RA 3SG2A 1NSHA 4OKHA 2BBNA 4NDDA 2WCBA 1AVSA 2MRDA 1MUXA 3DF0A 1UHKA 2JNXA 3I5HB 1OMRA 1YVHA 2CXJA 2LAPA 1YUTA 2JC2A 2LP3A 2M49B 2FJUB 1NX2A 4PHJA 3CR2A 2BE6A 3WNXB 3PATA 4DUQA 4OVNF 3I5FB 1K93D 1WDCB 3SG3A 3LLEA 3BOWB 1ALVA 2B1UA 3PN7B 1J1EA 3SG4A 3O6BA 1KK8C 1B4CA 4BY4A 5KTYA 4C0KA 4N1FA 2ZFDA 4XJKB 4U8DA 1B47A 1XA5A 1IH0A 1DJHA 1JFKA 2L51A 1DJYA 2Y4QA 1S1EA 1XFYO 1IWQA 1GGZA 3TUYC 5F6TA 2JTTA 1JUOA 1NCYA 2LE9B 2JT3A 3D0YB 1YTZC 1KQMB 1X02A 2KSPA 1SL7A 1S5GZ 2KGRA 1DJZA 1M39A 2ZRTA 1DGVA 4C0JA 1UWOA 3DVEA 1K9PA 1LXFC 1R6PA 3PM8A 1UHNA 1U5IA 1KK8B 1HQVA 2AUCA 1CDPA 2KYFA 2LVVA 3KPXA 1YX8A 1TIZA 4YGDB 5CSIA 2JXCA 1SR6B 3JVTC 2GV5A 1XFUO 1DTLA 1K95A 4UPGA 3EK4A 2ZNDA 2L4HA 5HKWA 1AJ4A 2K7CA 4YI9A 5DKRA 3K21A 3SG6A 2SASA 1XFWO 2OS8B 1HT9A 2L4IA 1F70A 3OP0A 2KBIA 5JOLA 1BG1A 3BUOB 3EVVA 4NQGA 3KF9A 1OMVA 4MLWA 1DJIA 1YRTB 1IJ5A 1K8UA 2KDHA 5GQQC 1IRJA 1QVIZ 1TNPA 3BUNB 3HX4A 4GBAA 2JT0A 3E3RA 4DCKA 1EH2A 4HRHA 2KAXA 4OV2A 1NX1A 5J3XA 1DT7B 1B8RA 2KOTA 2H61A 1DF0B 1GGWA 2JTZA 4YBHB 2I18A 2LVIA 1PVAA 2L98A 1WRLA 1FI5A 1KCYA 1PVBA 1L7ZA 4CIDA 2L50A 2M7LA 3TDZA 4D1EA 3BOWA 1NIWA 4MRXA 5CSJA 4YGBB 2I94A 1TNQA 1QTXA 1CLBA 1XFXO 1S26D 1GJYA 1KSMA 2NLNA 3M0WA 3SJSA 2F3ZA 2ZKMX 2NZ0A 2MBXA 2JRFA 1KK7Z 1BMOA 3F45A 3BUXB 3I5GC 3I5IC 3RM1A 2MA2A 4A4BA 4CFQA 3JTDC 2KFFA 2OPOA 3QRXA 2M3WA 2KGBC 1JWDA 2KHNA 1YUSA 1L2OB 1OE9B 1ZACA 4P5OE 3VROA 3OB2B 4P2YB 3HCMA 4YGEB 3KEVA 1F8HA 4PE4A 4ETOA 2BL0C 3DVKA 1NP8A 1QIVA 1Y6WA 2E30A 2JXLA 2LLSA 3TDUA 4CPVA 1YRUB 2JU0A 2LVJA 1ZOTB 2M1UA 1FBVA 1BT6A 2HF5A 4PE0A 1RJVA 2JULA 3NSLA 4MZJA 3EKJA 4YRUA 1G33A 3I5HC 2KFGA 1KWOB 3LK1A 2H61C 1XO5A 1MR8A 1TOPA 4QJ4B 2L5XB 1ZMZA 2LC5A 4QJ5B 2K2AA 3VRRA 5CSNA 3NXAA 1V1FA 1N65A 2L2EA 1G8IA 2M1KB 2KBMA 2VRGA 2PALA 2G2BA 5I2OA 2FCDA 4WQ3A 3WHUB 1BOCA 3GK1A 2L0PA 1QV0A 2F33A 2MLEC 4ZCVA 5AXIA 5D7FA 3VGOA 1B8LA 1PSBA 4C0LA 1AK8A 2BCBA 3CR5X 1N2DA 2JOJA 2G9BA 2KYCA 1BJFA 1FW4A 1NCXA 1SYMA 2GGZA 5ER4X 3SIAA 2WORA 2P6BB 1LINA 3CZTX 3GOFA 2H2KA 1QX5B 1F55A 3I5GB 3I5IB 1AUIB 1JFJA 2LNKA 1J7PA 5FYXA 2HETA 1ODBA 2BKIB 1Y1XA 2AAOA 2JQ6A 1KSOA 2QPTA 3EKHA 2KFHA 1QATA 3AAJA 4I5LB 2BCAA 3O2PA 3BQ3A 5CPVA 5AFPA 1Q80A 3TDIA 1G4YR 4ICBA 5HLOA 1J55A 1QIWA 2K7BA 1SBJA 4MRYA 4OCIA 1JF0A 2Q91A 3H4SE 2ZN8A 1TCFA 3ICBA 1W7JB 2Y1NA 3CR4X 3SIBA 2WNDA 4ORBB 1K2HA 1FF1A 1EG4A 2LANA 3EVUA 1CFPA 4FTGA 2LCPA 1S36A 3NSOA 4AOMA 1NX0A 2CCMA 5BPJA 1K90D 4GGFA 1NWDA 1S3PA 3AKBA 3BXKA 1QS7A 1CFDA 1AP4A 4OR9B 1LA3A 3A4UB 3OX5A 1EXRA 1SKTA 2PMYA 2WC8A 2LUCA 2LV7A 1TRFA 2LLUA 1SY9A 1Y1UA 1OOJA 2RGIA 4NDCA 4YGCB 4BY5A 1QLKA 2MJWB 1FI6A 1BLQA 1F4OA 1B1GA 2I7AA 2WCFA 1CB1A 1R2UA 2JT8A 1YR5A 2KI4C 3FS7A 3RLZA 2FCEA 4GPLB 5HLVA 1SMGA 1CDLA 1BU3A 2CT9A 1EG3A 1JC2A 2K2FA 2SCPA 1PULA 2WCEA 3VRQA 1PK0D 2KQ6A 1SNLA 4FQOA 1M45A 1CFCA 4GAOA 1A03A 2K7DA 4ORCB 1ZFSA 1CDMA 2Y1MA 2MHHA 4ORAB 1DF0A 4GFTA 1DJGA 5KU1A 1K9UA 1CMGA 2JNFA 1QLSA 1QVIY 1DGUA 1A2XA 2KI4B 1A75A 5AERA 1D1OA 2BBMA 1AJ5A 1LA0A 2LM5A 3FIAA 2K61A 2BCXA 1RWYA 1CMFA 3NSKA 4N5XA 4MEWA 2OTGB 1BR1B 1E8AA 2LMTA 2M9GA 2EC6C 1MQ1A 1GQMA 2AMIA 2F2PA 3SG7A 3EK7A 2TN4A 3I5FC 1QASA 2NCOA 3OHMB 1PSRA 1TNWA 1TN4A 1C7WA 2NCPA 5HKYA 1IGVA 1OMDA 3LL8B 1IKUA 3AAKA 3JVTB 2CTNA 4YGAA 3GK4X 3WHTB 1EL4A 2D8NA 1NYAA 1CLLA 1Y0VH 2CBLA 3JTDB 1F71A 4AQJA 4F0ZB 1C07A 2EHBA 3MSEB 1OQPA 1S6CA 1S6JA 2HPSA 2K7OA 3FWBA 4WRIA 1Y1AA 3KHEA 4JPZB 3D10A 3TS5B 1DVIA 2JPTA 1UUSA 2FOTA 2LLTA 1KFUL 4GNKB 1WDCC 1WRKA 2Y5IA 5JJGA 1LKJA 1DMOA 1M46A 3PFVA 4GGFC 1SW8A 3SG5A 3WXAA 4NDBA 1CNPA 2COLB 1ALWA 4QJ3B 1UURA 1UHJA 2M29A 3CS1A 1J7QA 3NSIA 4Q04A 1XK4C 2JWWA 3PN7C 2K8MB 3EK8A 3FWCA 3GK2A 1NUBA 4XYNA 1MF8B 1YVLA 1QXPA 5KSZA 1SL9A 1QJTA 2ZNEA 3CGAA 2BE4A 2PASA 1SCMB 3DF0B 1TNXA 2KQYA 2ZN9A 3BYAA 1SCVA 1V1GA 3IQOA 5B8IB 5I2QA 4HRGA 2KI6C 2DOQA 1B8CA 1A4PA 3LK0A 2I2RE 2PVBA 1MHOA 2OS8C 1L2OC 3DD4A 1M31A 1B7TZ 1A75B 3IQQA 4HREE 3TUYB 1S5GY 1N0YA 4I5NB 1K9KA 1MXEA 2E6WA 1RROA 4MZLA 4PHKA 1AHRA 1K96A 4M2OA 5K89A 1H8BA 1M63B 3DVMA 1KFXL 4JWQA 2MAZA 1UP5A 2ZRSA 2HQWA 5DKQA 2M97A 1KWOC 2HQ8A 1F4QA 4MZKA 1OZSA 1NCZA 2OTGC 1W7IB 1J1DA 4TNCA 3BUWB 4MN0A 4M2QA 2PRUA 2M7NA 3IF7A 1YX7A 3O4YA 4L9MA 1OSAA 1SPYA 4DRWA 1IQ3A 4XJKA 1K94A 4PHNA 3VRNA 1PRWA 3PALA 4GUKA 4YI8A 1B7TY 3D0YA 1DJWA 5I8NA 2JZIA 1SK6D 4MBEA 3TZ1A 2BL0B 2PSRA 1BF5A 1NPQA 4PCWA 1KQVA 1SL8A 1MXLC 4MSPA 3OX6A 2F2OA 4HSZA 3LCPC 1ZUZA 1BR4B 1XFZO 2F3YA 1TTXA 1IJ6A 1U5IB 2K0JA 2KI6D 4GGNA 2GGMA 5CSFA 1C7VA 5HKZA 1B9AA 2O60A 1JF2A 1CKKA 1EJ3A 1KFUS 1SCMC 1SRAA 1QX2A 2Q4UA 2EGDA 4N1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A29 A;  1DJX A;  1KK7 Y;  1CM4 A;  1KQM C;  1VRK A;  2WOS A;  4IL1 A;  2EC6 B;  3DVJ A;  4DS7 A;  1PAL A;  2LMV A;  1XVJ A;  4MVF A;  1OZO A;  1QV1 A;  1H4B A;  1RFJ A;  1JBA A;  1REC A;  1RK9 A;  2BEC A;  3EVR A;  1CM1 A;  2M8U A;  1QX7 A;  4USL A;  2LHI A;  2IS9 A;  4A4C A;  2MLF C;  3O78 A;  4CFR A;  1CFF A;  1JSA A;  4R1E A;  2QAC A;  3CTN A;  1NX3 A;  1UHI A;  1WRZ A;  2LP2 A;  1J7O A;  3A8R A;  3BUM B;  1YUU A;  1CLM A;  2LHL A;  2O5G A;  4PE7 A;  5AEQ A;  1UHH A;  1LVC D;  3ZNI A;  4ZCU A;  4PDZ A;  1IQ5 A;  2BKH B;  1TCO B;  5PAL A;  1SR6 C;  3ZWH A;  5DKN A;  1BOD A;  1KFX S;  1WY9 A;  4I5J A;  4DIR A;  4AQI A;  2KAV A;  3KO0 A;  3PLF B;  4PHM A;  1MWN A;  2F8P A;  3OB1 B;  5AAN A;  1F54 A;  1XK4 A;  3C1V A;  5IBW A;  1IG5 A;  2R2I A;  3CLN A;  5ER5 A;  2KAY A;  3VRP A;  4I5K A;  3CWG A;  5I2L A;  1YUR A;  4PE1 A;  5HYD A;  4WQ2 A;  1FPW A;  2KNE A;  3AKA A;  4E68 A;  3TS5 C;  1XFV O;  1XYD A;  5TNC A;  2LUX A;  2ISD A;  1J7R A;  1CTR A;  2CNP A;  4PAL A;  2NXQ A;  3PSR A;  4M2P A;  5G08 A;  1RTP 1;  1WLZ A;  5D69 A;  1S6I A;  4JQ0 D;  1WLM A;  2LMU A;  2A4J A;  2V53 A;  4CLN A;  1CDN A;  2LVK A;  2M0R A;  3SG2 A;  1NSH A;  4OKH A;  2BBN A;  4NDD A;  2WCB A;  1AVS A;  2MRD A;  1MUX A;  3DF0 A;  1UHK A;  2JNX A;  3I5H B;  1OMR A;  1YVH A;  2CXJ A;  2LAP A;  1YUT A;  2JC2 A;  2LP3 A;  2M49 B;  2FJU B;  1NX2 A;  4PHJ A;  3CR2 A;  2BE6 A;  3WNX B;  3PAT A;  4DUQ A;  4OVN F;  3I5F B;  1K93 D;  1WDC B;  3SG3 A;  3LLE A;  3BOW B;  1ALV A;  2B1U A;  3PN7 B;  1J1E A;  3SG4 A;  3O6B A;  1KK8 C;  1B4C A;  4BY4 A;  5KTY A;  4C0K A;  4N1F A;  2ZFD A;  4XJK B;  4U8D A;  1B47 A;  1XA5 A;  1IH0 A;  1DJH A;  1JFK A;  2L51 A;  1DJY A;  2Y4Q A;  1S1E A;  1XFY O;  1IWQ A;  1GGZ A;  3TUY C;  5F6T A;  2JTT A;  1JUO A;  1NCY A;  2LE9 B;  2JT3 A;  3D0Y B;  1YTZ C;  1KQM B;  1X02 A;  2KSP A;  1SL7 A;  1S5G Z;  2KGR A;  1DJZ A;  1M39 A;  2ZRT A;  1DGV A;  4C0J A;  1UWO A;  3DVE A;  1K9P A;  1LXF C;  1R6P A;  3PM8 A;  1UHN A;  1U5I A;  1KK8 B;  1HQV A;  2AUC A;  1CDP A;  2KYF A;  2LVV A;  3KPX A;  1YX8 A;  1TIZ A;  4YGD B;  5CSI A;  2JXC A;  1SR6 B;  3JVT C;  2GV5 A;  1XFU O;  1DTL A;  1K95 A;  4UPG A;  3EK4 A;  2ZND A;  2L4H A;  5HKW A;  1AJ4 A;  2K7C A;  4YI9 A;  5DKR A;  3K21 A;  3SG6 A;  2SAS A;  1XFW O;  2OS8 B;  1HT9 A;  2L4I A;  1F70 A;  3OP0 A;  2KBI A;  5JOL A;  1BG1 A;  3BUO B;  3EVV A;  4NQG A;  3KF9 A;  1OMV A;  4MLW A;  1DJI A;  1YRT B;  1IJ5 A;  1K8U A;  2KDH A;  5GQQ C;  1IRJ A;  1QVI Z;  1TNP A;  3BUN B;  3HX4 A;  4GBA A;  2JT0 A;  3E3R A;  4DCK A;  1EH2 A;  4HRH A;  2KAX A;  4OV2 A;  1NX1 A;  5J3X A;  1DT7 B;  1B8R A;  2KOT A;  2H61 A;  1DF0 B;  1GGW A;  2JTZ A;  4YBH B;  2I18 A;  2LVI A;  1PVA A;  2L98 A;  1WRL A;  1FI5 A;  1KCY A;  1PVB A;  1L7Z A;  4CID A;  2L50 A;  2M7L A;  3TDZ A;  4D1E A;  3BOW A;  1NIW A;  4MRX A;  5CSJ A;  4YGB B;  2I94 A;  1TNQ A;  1QTX A;  1CLB A;  1XFX O;  1S26 D;  1GJY A;  1KSM A;  2NLN A;  3M0W A;  3SJS A;  2F3Z A;  2ZKM X;  2NZ0 A;  2MBX A;  2JRF A;  1KK7 Z;  1BMO A;  3F45 A;  3BUX B;  3I5G C;  3I5I C;  3RM1 A;  2MA2 A;  4A4B A;  4CFQ A;  3JTD C;  2KFF A;  2OPO A;  3QRX A;  2M3W A;  2KGB C;  1JWD A;  2KHN A;  1YUS A;  1L2O B;  1OE9 B;  1ZAC A;  4P5O E;  3VRO A;  3OB2 B;  4P2Y B;  3HCM A;  4YGE B;  3KEV A;  1F8H A;  4PE4 A;  4ETO A;  2BL0 C;  3DVK A;  1NP8 A;  1QIV A;  1Y6W A;  2E30 A;  2JXL A;  2LLS A;  3TDU A;  4CPV A;  1YRU B;  2JU0 A;  2LVJ A;  1ZOT B;  2M1U A;  1FBV A;  1BT6 A;  2HF5 A;  4PE0 A;  1RJV A;  2JUL A;  3NSL A;  4MZJ A;  3EKJ A;  4YRU A;  1G33 A;  3I5H C;  2KFG A;  1KWO B;  3LK1 A;  2H61 C;  1XO5 A;  1MR8 A;  1TOP A;  4QJ4 B;  2L5X B;  1ZMZ A;  2LC5 A;  4QJ5 B;  2K2A A;  3VRR A;  5CSN A;  3NXA A;  1V1F A;  1N65 A;  2L2E A;  1G8I A;  2M1K B;  2KBM A;  2VRG A;  2PAL A;  2G2B A;  5I2O A;  2FCD A;  4WQ3 A;  3WHU B;  1BOC A;  3GK1 A;  2L0P A;  1QV0 A;  2F33 A;  2MLE C;  4ZCV A;  5AXI A;  5D7F A;  3VGO A;  1B8L A;  1PSB A;  4C0L A;  1AK8 A;  2BCB A;  3CR5 X;  1N2D A;  2JOJ A;  2G9B A;  2KYC A;  1BJF A;  1FW4 A;  1NCX A;  1SYM A;  2GGZ A;  5ER4 X;  3SIA A;  2WOR A;  2P6B B;  1LIN A;  3CZT X;  3GOF A;  2H2K A;  1QX5 B;  1F55 A;  3I5G B;  3I5I B;  1AUI B;  1JFJ A;  2LNK A;  1J7P A;  5FYX A;  2HET A;  1ODB A;  2BKI B;  1Y1X A;  2AAO A;  2JQ6 A;  1KSO A;  2QPT A;  3EKH A;  2KFH A;  1QAT A;  3AAJ A;  4I5L B;  2BCA A;  3O2P A;  3BQ3 A;  5CPV A;  5AFP A;  1Q80 A;  3TDI A;  1G4Y R;  4ICB A;  5HLO A;  1J55 A;  1QIW A;  2K7B A;  1SBJ A;  4MRY A;  4OCI A;  1JF0 A;  2Q91 A;  3H4S E;  2ZN8 A;  1TCF A;  3ICB A;  1W7J B;  2Y1N A;  3CR4 X;  3SIB A;  2WND A;  4ORB B;  1K2H A;  1FF1 A;  1EG4 A;  2LAN A;  3EVU A;  1CFP A;  4FTG A;  2LCP A;  1S36 A;  3NSO A;  4AOM A;  1NX0 A;  2CCM A;  5BPJ A;  1K90 D;  4GGF A;  1NWD A;  1S3P A;  3AKB A;  3BXK A;  1QS7 A;  1CFD A;  1AP4 A;  4OR9 B;  1LA3 A;  3A4U B;  3OX5 A;  1EXR A;  1SKT A;  2PMY A;  2WC8 A;  2LUC A;  2LV7 A;  1TRF A;  2LLU A;  1SY9 A;  1Y1U A;  1OOJ A;  2RGI A;  4NDC A;  4YGC B;  4BY5 A;  1QLK A;  2MJW B;  1FI6 A;  1BLQ A;  1F4O A;  1B1G A;  2I7A A;  2WCF A;  1CB1 A;  1R2U A;  2JT8 A;  1YR5 A;  2KI4 C;  3FS7 A;  3RLZ A;  2FCE A;  4GPL B;  5HLV A;  1SMG A;  1CDL A;  1BU3 A;  2CT9 A;  1EG3 A;  1JC2 A;  2K2F A;  2SCP A;  1PUL A;  2WCE A;  3VRQ A;  1PK0 D;  2KQ6 A;  1SNL A;  4FQO A;  1M45 A;  1CFC A;  4GAO A;  1A03 A;  2K7D A;  4ORC B;  1ZFS A;  1CDM A;  2Y1M A;  2MHH A;  4ORA B;  1DF0 A;  4GFT A;  1DJG A;  5KU1 A;  1K9U A;  1CMG A;  2JNF A;  1QLS A;  1QVI Y;  1DGU A;  1A2X A;  2KI4 B;  1A75 A;  5AER A;  1D1O A;  2BBM A;  1AJ5 A;  1LA0 A;  2LM5 A;  3FIA A;  2K61 A;  2BCX A;  1RWY A;  1CMF A;  3NSK A;  4N5X A;  4MEW A;  2OTG B;  1BR1 B;  1E8A A;  2LMT A;  2M9G A;  2EC6 C;  1MQ1 A;  1GQM A;  2AMI A;  2F2P A;  3SG7 A;  3EK7 A;  2TN4 A;  3I5F C;  1QAS A;  2NCO A;  3OHM B;  1PSR A;  1TNW A;  1TN4 A;  1C7W A;  2NCP A;  5HKY A;  1IGV A;  1OMD A;  3LL8 B;  1IKU A;  3AAK A;  3JVT B;  2CTN A;  4YGA A;  3GK4 X;  3WHT B;  1EL4 A;  2D8N A;  1NYA A;  1CLL A;  1Y0V H;  2CBL A;  3JTD B;  1F71 A;  4AQJ A;  4F0Z B;  1C07 A;  2EHB A;  3MSE B;  1OQP A;  1S6C A;  1S6J A;  2HPS A;  2K7O A;  3FWB A;  4WRI A;  1Y1A A;  3KHE A;  4JPZ B;  3D10 A;  3TS5 B;  1DVI A;  2JPT A;  1UUS A;  2FOT A;  2LLT A;  1KFU L;  4GNK B;  1WDC C;  1WRK A;  2Y5I A;  5JJG A;  1LKJ A;  1DMO A;  1M46 A;  3PFV A;  4GGF C;  1SW8 A;  3SG5 A;  3WXA A;  4NDB A;  1CNP A;  2COL B;  1ALW A;  4QJ3 B;  1UUR A;  1UHJ A;  2M29 A;  3CS1 A;  1J7Q A;  3NSI A;  4Q04 A;  1XK4 C;  2JWW A;  3PN7 C;  2K8M B;  3EK8 A;  3FWC A;  3GK2 A;  1NUB A;  4XYN A;  1MF8 B;  1YVL A;  1QXP A;  5KSZ A;  1SL9 A;  1QJT A;  2ZNE A;  3CGA A;  2BE4 A;  2PAS A;  1SCM B;  3DF0 B;  1TNX A;  2KQY A;  2ZN9 A;  3BYA A;  1SCV A;  1V1G A;  3IQO A;  5B8I B;  5I2Q A;  4HRG A;  2KI6 C;  2DOQ A;  1B8C A;  1A4P A;  3LK0 A;  2I2R E;  2PVB A;  1MHO A;  2OS8 C;  1L2O C;  3DD4 A;  1M31 A;  1B7T Z;  1A75 B;  3IQQ A;  4HRE E;  3TUY B;  1S5G Y;  1N0Y A;  4I5N B;  1K9K A;  1MXE A;  2E6W A;  1RRO A;  4MZL A;  4PHK A;  1AHR A;  1K96 A;  4M2O A;  5K89 A;  1H8B A;  1M63 B;  3DVM A;  1KFX L;  4JWQ A;  2MAZ A;  1UP5 A;  2ZRS A;  2HQW A;  5DKQ A;  2M97 A;  1KWO C;  2HQ8 A;  1F4Q A;  4MZK A;  1OZS A;  1NCZ A;  2OTG C;  1W7I B;  1J1D A;  4TNC A;  3BUW B;  4MN0 A;  4M2Q A;  2PRU A;  2M7N A;  3IF7 A;  1YX7 A;  3O4Y A;  4L9M A;  1OSA A;  1SPY A;  4DRW A;  1IQ3 A;  4XJK A;  1K94 A;  4PHN A;  3VRN A;  1PRW A;  3PAL A;  4GUK A;  4YI8 A;  1B7T Y;  3D0Y A;  1DJW A;  5I8N A;  2JZI A;  1SK6 D;  4MBE A;  3TZ1 A;  2BL0 B;  2PSR A;  1BF5 A;  1NPQ A;  4PCW A;  1KQV A;  1SL8 A;  1MXL C;  4MSP A;  3OX6 A;  2F2O A;  4HSZ A;  3LCP C;  1ZUZ A;  1BR4 B;  1XFZ O;  2F3Y A;  1TTX A;  1IJ6 A;  1U5I B;  2K0J A;  2KI6 D;  4GGN A;  2GGM A;  5CSF A;  1C7V A;  5HKZ A;  1B9A A;  2O60 A;  1JF2 A;  1CKK A;  1EJ3 A;  1KFU S;  1SCM C;  1SRA A;  1QX2 A;  2Q4U A;  2EGD A;  4N1G A; 
#chains in the Genus database with same CATH topology
 1A29 A;  1DJX A;  1KK7 Y;  1CM4 A;  1KQM C;  1VRK A;  2WOS A;  4IL1 A;  2EC6 B;  3DVJ A;  4DS7 A;  1PAL A;  2LMV A;  1XVJ A;  4MVF A;  1OZO A;  1QV1 A;  1H4B A;  1RFJ A;  1JBA A;  1REC A;  1RK9 A;  2BEC A;  3EVR A;  1CM1 A;  2M8U A;  1QX7 A;  3R1O A;  2LHI A;  2IS9 A;  4USL A;  2MLF C;  3O78 A;  4A4C A;  4CFR A;  1JSA A;  4R1E A;  1C3Y A;  2QAC A;  3IVT A;  3D73 A;  3BJH A;  3CTN A;  1NX3 A;  1UHI A;  1WRZ A;  2LP2 A;  5FI6 A;  1J7O A;  3A8R A;  3BUM B;  3OBV A;  1YUU A;  1CLM A;  2LHL A;  2O5G A;  4PE7 A;  5AEQ A;  1UHH A;  1LVC D;  3ZNI A;  2P70 A;  4ZCU A;  4PDZ A;  2BKH B;  1IQ5 A;  1TCO B;  3Q8I A;  1SR6 C;  5PAL A;  3ZWH A;  5DKN A;  1BOD A;  1KFX S;  1WY9 A;  4I5J A;  4DIR A;  4AQI A;  2KAV A;  3KO0 A;  3PLF B;  2JPO A;  3CAB A;  4PHM A;  1MWN A;  2F8P A;  3OB1 B;  5AAN A;  1F54 A;  1XK4 A;  3C1V A;  5IBW A;  1IG5 A;  3NHT A;  2R2I A;  3CLN A;  5ER5 A;  2KAY A;  3VRP A;  3CZ1 A;  3CWG A;  4I5K A;  1YUR A;  4PE1 A;  5I2L A;  5HYD A;  4WQ2 A;  1FPW A;  2KNE A;  3AKA A;  4E68 A;  3TS5 C;  3S0B A;  1DEL A;  1W9Z A;  1XFV O;  1XYD A;  2LUX A;  5TNC A;  2ISD A;  1J7R A;  1CTR A;  2CNP A;  4PAL A;  2NXQ A;  3PSR A;  4M2P A;  5G08 A;  1OOG A;  1RTP 1;  1WLZ A;  5D69 A;  1TUZ A;  1S6I A;  4JQ0 D;  1WLM A;  2LMU A;  2A4J A;  2V53 A;  4CLN A;  1CDN A;  2LVK A;  2M0R A;  1T14 A;  2PQL A;  3V2L A;  3SG2 A;  1NSH A;  4OKH A;  2BBN A;  3L4A A;  4NDD A;  2WCB A;  1OOH A;  1AVS A;  2MRD A;  1MUX A;  3DF0 A;  1UHK A;  2JNX A;  3DYE A;  3I5H B;  1OMR A;  1YVH A;  2CXJ A;  2LAP A;  1YUT A;  2JC2 A;  2LP3 A;  3CZ2 A;  2M49 B;  2FJU B;  1NX2 A;  4PHJ A;  3CR2 A;  2BE6 A;  3WNX B;  3NHI A;  3PAT A;  4DUQ A;  4OZD A;  4OVN F;  3I5F B;  1K93 D;  1WDC B;  4JKT A;  3SG3 A;  3LLE A;  3BOW B;  1ALV A;  2B1U A;  3PN7 B;  1J1E A;  3SG4 A;  3O6B A;  1KK8 C;  1B4C A;  4BY4 A;  5KTY A;  4C0K A;  4N1F A;  2ZFD A;  4XJK B;  4U8D A;  1B47 A;  1XA5 A;  3S0G A;  1DJH A;  1JFK A;  2L51 A;  1DJY A;  2Y4Q A;  1IH0 A;  1S1E A;  1XFY O;  1IWQ A;  1GGZ A;  3TUY C;  5F6T A;  2JTT A;  1JUO A;  1NCY A;  2LE9 B;  2JT3 A;  3BFH A;  3D0Y B;  1YTZ C;  1KQM B;  1X02 A;  2P71 A;  2KSP A;  2BNX A;  1SL7 A;  1S5G Z;  2KGR A;  1DJZ A;  1M39 A;  2ZRT A;  1DGV A;  3D77 A;  4C0J A;  1UWO A;  4IJ7 A;  3DVE A;  1K9P A;  1LXF C;  1R6P A;  3PM8 A;  1UHN A;  1U5I A;  1KK8 B;  1HQV A;  2AUC A;  1CDP A;  2KYF A;  2LVV A;  3KPX A;  1YX8 A;  1TIZ A;  4YGD B;  5CSI A;  2JXC A;  1SR6 B;  3JVT C;  2GV5 A;  1XFU O;  3D75 A;  1DTL A;  5HL1 A;  1K95 A;  4UPG A;  3EK4 A;  2ZND A;  2L4H A;  5HKW A;  1AJ4 A;  2K7C A;  4YI9 A;  5DKR A;  4F7F A;  3K21 A;  3SG6 A;  2SAS A;  1XFW O;  2OS8 B;  1HT9 A;  1TUJ A;  2L4I A;  1F70 A;  2WCL A;  3OP0 A;  2KBI A;  5JOL A;  1BG1 A;  3BUO B;  3EVV A;  4NQG A;  3KF9 A;  1CFC A;  1OMV A;  2QEB A;  1DJI A;  1YRT B;  1IJ5 A;  1K8U A;  2KDH A;  3D74 A;  4MLW A;  5GQQ C;  1IRJ A;  1QVI Z;  1TNP A;  2ERB A;  3BUN B;  3HX4 A;  4GBA A;  2JT0 A;  3E3R A;  4DCK A;  3FE6 A;  1EH2 A;  4HRH A;  2KAX A;  4OV2 A;  1NX1 A;  5J3X A;  1DT7 B;  1B8R A;  2KOT A;  2H61 A;  1DF0 B;  1GGW A;  5D3O A;  2JTZ A;  4YBH B;  2I18 A;  2LVI A;  1PVA A;  2L98 A;  1WRL A;  1FI5 A;  1KCY A;  1PVB A;  1L7Z A;  4CID A;  2L50 A;  2M7L A;  3TDZ A;  4D1E A;  3BOW A;  1NIW A;  1P28 A;  2WCK A;  4MRX A;  5CSJ A;  4YGB B;  2I94 A;  1TNQ A;  3UO9 A;  1QTX A;  1CLB A;  1XFX O;  1S26 D;  1GJY A;  1KSM A;  2NLN A;  3M0W A;  3SJS A;  2F3Z A;  2ZKM X;  2NZ0 A;  2MBX A;  2JRF A;  1KK7 Z;  1BMO A;  3F45 A;  3BUX B;  2WC5 A;  3I5G C;  3I5I C;  2MA2 A;  3RM1 A;  4A4B A;  4CFQ A;  3JTD C;  2KFF A;  2OPO A;  3QRX A;  2M3W A;  2KGB C;  1JWD A;  2KHN A;  1YUS A;  1L2O B;  1OE9 B;  1ZAC A;  5EL2 A;  4P5O E;  3VRO A;  3OB2 B;  4P2Y B;  3HCM A;  4YGE B;  3CZ0 A;  3KEV A;  1F8H A;  2KLD A;  4PE4 A;  1QWV A;  2BL0 C;  3DVK A;  4ETO A;  1NP8 A;  1QIV A;  1Y6W A;  2E30 A;  2JXL A;  2LLS A;  3BFA A;  3TDU A;  4CPV A;  1YRU B;  2JU0 A;  2LVJ A;  2H8V A;  1ZOT B;  2M1U A;  1FBV A;  1BT6 A;  2HF5 A;  4PE0 A;  1RJV A;  2WCM A;  2JUL A;  3NSL A;  4MZJ A;  3EKJ A;  4YRU A;  1G33 A;  3I5H C;  2BAP A;  1TWO A;  2KFG A;  1KWO B;  3D78 A;  2QDI A;  3LK1 A;  2H61 C;  1XO5 A;  1MR8 A;  1TOP A;  1Z2C B;  4QJ4 B;  2L5X B;  1ZMZ A;  2LC5 A;  4QJ5 B;  2K2A A;  3VRR A;  2KPH A;  5CSN A;  3NXA A;  3S0D A;  1V1F A;  1N65 A;  2L2E A;  1G8I A;  2M1K B;  2KBM A;  2VRG A;  2PAL A;  2G2B A;  5I2O A;  2FCD A;  4WQ3 A;  3R72 A;  3D76 A;  3WHU B;  1BOC A;  3GK1 A;  2L0P A;  1QV0 A;  2F33 A;  2MLE C;  4ZCV A;  5AXI A;  5D7F A;  3VGO A;  1B8L A;  1PSB A;  4C0L A;  3EG5 B;  1AK8 A;  2BCB A;  3CR5 X;  1N2D A;  2JOJ A;  2G9B A;  2KYC A;  1BJF A;  1FW4 A;  1NCX A;  1SYM A;  2GGZ A;  5ER4 X;  3B6X A;  2WOR A;  2P6B B;  3SIA A;  5I94 A;  1LIN A;  3CZT X;  3GOF A;  2H2K A;  1QX5 B;  1F55 A;  3I5G B;  3I5I B;  1AUI B;  1JFJ A;  2LNK A;  1J7P A;  3OGN A;  3DZT A;  5FYX A;  3DY9 A;  2HET A;  1ODB A;  2BKI B;  1Y1X A;  2AAO A;  2JQ6 A;  1KSO A;  2QPT A;  3EKH A;  2KFH A;  1QAT A;  3AAJ A;  1DEK A;  4I5L B;  2BCA A;  2KLE A;  3BQ3 A;  3O2P A;  5CPV A;  1Q80 A;  3TDI A;  1G4Y R;  5AFP A;  4ICB A;  5HLO A;  3CYZ A;  1J55 A;  1QIW A;  2K7B A;  1SBJ A;  4KYN A;  4MRY A;  4OCI A;  3UNW A;  1JF0 A;  2Q91 A;  3RZS A;  3H4S E;  2ZN8 A;  1TCF A;  3ICB A;  1W7J B;  2Y1N A;  3CR4 X;  3SIB A;  5DIC A;  2WND A;  4ORB B;  1K2H A;  1FF1 A;  1EG4 A;  2LAN A;  3EVU A;  3L4L A;  1CFP A;  4FTG A;  2LCP A;  1S36 A;  3NSO A;  4AOM A;  1NX0 A;  2CCM A;  5BPJ A;  1K90 D;  4GGF A;  1NWD A;  1S3P A;  3AKB A;  3BXK A;  3O4X A;  1QS7 A;  1CFD A;  1AP4 A;  4OR9 B;  1LA3 A;  3A4U B;  3OX5 A;  1EXR A;  1SKT A;  2PMY A;  2WC6 A;  2WC8 A;  2LUC A;  2LV7 A;  1TRF A;  2LLU A;  1SY9 A;  1Y1U A;  1OOJ A;  2RGI A;  4NDC A;  4YGC B;  4BY5 A;  1QLK A;  2MJW B;  1FI6 A;  1BLQ A;  1F4O A;  1B1G A;  2I7A A;  2WCF A;  1CB1 A;  1LS8 A;  1R2U A;  2JT8 A;  1YR5 A;  2KI4 C;  3S0A A;  3FS7 A;  3RLZ A;  2FCE A;  4GPL B;  3DXL A;  5HLV A;  1SMG A;  1CDL A;  1BU3 A;  2CT9 A;  1EG3 A;  1JC2 A;  2K2F A;  2SCP A;  1PUL A;  2WCE A;  3VRQ A;  1PK0 D;  2KQ6 A;  1SNL A;  4FQO A;  1M45 A;  4JD9 A;  4GAO A;  1A03 A;  2K7D A;  4ORC B;  1GM0 A;  1ZFS A;  1CDM A;  4INW A;  2Y1M A;  2MHH A;  2WCH A;  4ORA B;  1DF0 A;  4GFT A;  1DJG A;  5KU1 A;  1K9U A;  2QEV A;  1CMG A;  2JNF A;  1QLS A;  1QVI Y;  1DGU A;  1A2X A;  2KI4 B;  1A75 A;  5AER A;  1D1O A;  2BBM A;  1AJ5 A;  1LA0 A;  2LM5 A;  3N7H A;  3PJI A;  3PM2 A;  3FIA A;  3R1P A;  2K61 A;  2BCX A;  1RWY A;  1CMF A;  3NSK A;  4N5X A;  2L5Y A;  4MEW A;  2OTG B;  1BR1 B;  1E8A A;  2LMT A;  2M9G A;  2EC6 C;  1MQ1 A;  1GQM A;  2AMI A;  2F2P A;  3SG7 A;  3EK7 A;  2TN4 A;  3I5F C;  1QAS A;  2NCO A;  3OHM B;  1Z4H A;  1PSR A;  1TNW A;  3FE8 A;  1TN4 A;  1C7W A;  2NCP A;  3SS5 A;  5HKY A;  1IGV A;  1OMD A;  3LL8 B;  1IKU A;  3AAK A;  3JVT B;  2CTN A;  4YGA A;  3GK4 X;  3WHT B;  1EL4 A;  2D8N A;  1NYA A;  1CLL A;  1Y0V H;  2CBL A;  3JTD B;  1F71 A;  4AQJ A;  4F0Z B;  2K60 A;  1C07 A;  2EHB A;  3MSE B;  1OQP A;  1S6C A;  1S6J A;  2HPS A;  2K7O A;  3FWB A;  4WRI A;  1Y1A A;  3KHE A;  4JPZ B;  3D10 A;  3TS5 B;  1DVI A;  2JPT A;  1UUS A;  2FOT A;  2LLT A;  1KFU L;  4GNK B;  1WDC C;  1WRK A;  2Y5I A;  5JJG A;  1LKJ A;  1DMO A;  1M46 A;  3PFV A;  4GGF C;  1SW8 A;  3SG5 A;  3WXA A;  4NDB A;  1CNP A;  2COL B;  1ALW A;  4QJ3 B;  1UUR A;  1IIO A;  1UHJ A;  2M29 A;  3CS1 A;  1J7Q A;  1CFF A;  3B7A A;  3NSI A;  4Q04 A;  1XK4 C;  2JWW A;  3PN7 C;  2K8M B;  3EK8 A;  3FWC A;  1C3Z A;  1DC1 A;  1XFR A;  1DQE A;  3GK2 A;  1NUB A;  3B87 A;  1MF8 B;  4XYN A;  1YVL A;  1QXP A;  5KSZ A;  1SL9 A;  1QJT A;  2ZNE A;  3SS3 A;  3CGA A;  2BE4 A;  2PAS A;  1SCM B;  3DF0 B;  1TNX A;  2KQY A;  2ZN9 A;  3BYA A;  1SCV A;  1V1G A;  3IQO A;  5B8I B;  3VB1 A;  4HRG A;  2KI6 C;  5I2Q A;  2DOQ A;  1B8C A;  1A4P A;  3LK0 A;  2I2R E;  1ORG A;  2PVB A;  5FI2 A;  2QEH A;  1MHO A;  3S0F A;  2OS8 C;  3BFB A;  1L2O C;  3DD4 A;  1M31 A;  1B7T Z;  1A75 B;  3IQQ A;  4HRE E;  3TUY B;  1S5G Y;  3R1V A;  1N0Y A;  1OOI X;  2FJY A;  4I5N B;  1K9K A;  1MXE A;  2E6W A;  1RRO A;  4INX A;  4MZL A;  1AHR A;  1K96 A;  4PHK A;  4M2O A;  3L47 A;  5K89 A;  1H8B A;  1M63 B;  3S0E A;  3DVM A;  1KFX L;  4JWQ A;  2MAZ A;  1UP5 A;  2ZRS A;  2HQW A;  2YGU A;  5DKQ A;  2M97 A;  1KWO C;  2HQ8 A;  1F4Q A;  4MZK A;  1OZS A;  1NCZ A;  2OTG C;  1W7I B;  1J1D A;  4TNC A;  3BUW B;  4MN0 A;  3CDN A;  4M2Q A;  2PRU A;  2M7N A;  2QEO A;  1YX7 A;  3IF7 A;  3O4Y A;  4L9M A;  1OSA A;  1SPY A;  4DRW A;  1IQ3 A;  4XJK A;  1K94 A;  4PHN A;  3VRN A;  1PRW A;  3PAL A;  4GUK A;  4YI8 A;  1OW4 A;  1B7T Y;  3D0Y A;  1DJW A;  5I8N A;  3B88 A;  2JZI A;  1SK6 D;  4MBE A;  3TZ1 A;  2BL0 B;  3QME A;  2PSR A;  1OOF A;  1BF5 A;  1NPQ A;  4PCW A;  1KQV A;  1SL8 A;  1MXL C;  4MSP A;  2WCJ A;  3OX6 A;  3NGV A;  2F2O A;  4HSZ A;  3LCP C;  1ZUZ A;  1BR4 B;  1XFZ O;  4FQT A;  1U5I B;  1TTX A;  1IJ6 A;  2F3Y A;  2GTE A;  2K0J A;  2KI6 D;  2GGM A;  2L2C A;  4GGN A;  5CSF A;  5HKZ A;  1C7V A;  3SS4 A;  1B9A A;  4PT1 A;  2O60 A;  3B86 A;  1JF2 A;  5FI7 A;  1CKK A;  1EJ3 A;  1KFU S;  3FE9 A;  3K1E A;  1SCM C;  1SRA A;  2PYQ A;  1QX2 A;  2Q4U A;  1SSE B;  2EGD A;  4N1G A; 
#chains in the Genus database with same CATH homology
 1A29 A;  1DJX A;  1KK7 Y;  1CM4 A;  1KQM C;  1VRK A;  2WOS A;  4IL1 A;  2EC6 B;  3DVJ A;  4DS7 A;  1PAL A;  2LMV A;  1XVJ A;  4MVF A;  1OZO A;  1QV1 A;  1H4B A;  1RFJ A;  1JBA A;  1REC A;  1RK9 A;  2BEC A;  3EVR A;  1CM1 A;  2M8U A;  1QX7 A;  4USL A;  2LHI A;  2IS9 A;  4A4C A;  2MLF C;  3O78 A;  4CFR A;  1CFF A;  1JSA A;  4R1E A;  2QAC A;  3CTN A;  1NX3 A;  1UHI A;  1WRZ A;  2LP2 A;  1J7O A;  3A8R A;  3BUM B;  1YUU A;  1CLM A;  2LHL A;  2O5G A;  4PE7 A;  5AEQ A;  1UHH A;  1LVC D;  3ZNI A;  4ZCU A;  4PDZ A;  1IQ5 A;  2BKH B;  1TCO B;  5PAL A;  1SR6 C;  3ZWH A;  5DKN A;  1BOD A;  1KFX S;  1WY9 A;  4I5J A;  4DIR A;  4AQI A;  2KAV A;  3KO0 A;  3PLF B;  4PHM A;  1MWN A;  2F8P A;  3OB1 B;  5AAN A;  1F54 A;  1XK4 A;  3C1V A;  5IBW A;  1IG5 A;  2R2I A;  3CLN A;  5ER5 A;  2KAY A;  3VRP A;  4I5K A;  3CWG A;  5I2L A;  1YUR A;  4PE1 A;  5HYD A;  4WQ2 A;  1FPW A;  2KNE A;  3AKA A;  4E68 A;  3TS5 C;  1XFV O;  1XYD A;  5TNC A;  2LUX A;  2ISD A;  1J7R A;  1CTR A;  2CNP A;  4PAL A;  2NXQ A;  3PSR A;  4M2P A;  5G08 A;  1RTP 1;  1WLZ A;  5D69 A;  1S6I A;  4JQ0 D;  1WLM A;  2LMU A;  2A4J A;  2V53 A;  4CLN A;  1CDN A;  2LVK A;  2M0R A;  3SG2 A;  1NSH A;  4OKH A;  2BBN A;  4NDD A;  2WCB A;  1AVS A;  2MRD A;  1MUX A;  3DF0 A;  1UHK A;  2JNX A;  3I5H B;  1OMR A;  1YVH A;  2CXJ A;  2LAP A;  1YUT A;  2JC2 A;  2LP3 A;  2M49 B;  2FJU B;  1NX2 A;  4PHJ A;  3CR2 A;  2BE6 A;  3WNX B;  3PAT A;  4DUQ A;  4OVN F;  3I5F B;  1K93 D;  1WDC B;  3SG3 A;  3LLE A;  3BOW B;  1ALV A;  2B1U A;  3PN7 B;  1J1E A;  3SG4 A;  3O6B A;  1KK8 C;  1B4C A;  4BY4 A;  5KTY A;  4C0K A;  4N1F A;  2ZFD A;  4XJK B;  4U8D A;  1B47 A;  1XA5 A;  1IH0 A;  1DJH A;  1JFK A;  2L51 A;  1DJY A;  2Y4Q A;  1S1E A;  1XFY O;  1IWQ A;  1GGZ A;  3TUY C;  5F6T A;  2JTT A;  1JUO A;  1NCY A;  2LE9 B;  2JT3 A;  3D0Y B;  1YTZ C;  1KQM B;  1X02 A;  2KSP A;  1SL7 A;  1S5G Z;  2KGR A;  1DJZ A;  1M39 A;  2ZRT A;  1DGV A;  4C0J A;  1UWO A;  3DVE A;  1K9P A;  1LXF C;  1R6P A;  3PM8 A;  1UHN A;  1U5I A;  1KK8 B;  1HQV A;  2AUC A;  1CDP A;  2KYF A;  2LVV A;  3KPX A;  1YX8 A;  1TIZ A;  4YGD B;  5CSI A;  2JXC A;  1SR6 B;  3JVT C;  2GV5 A;  1XFU O;  1DTL A;  1K95 A;  4UPG A;  3EK4 A;  2ZND A;  2L4H A;  5HKW A;  1AJ4 A;  2K7C A;  4YI9 A;  5DKR A;  3K21 A;  3SG6 A;  2SAS A;  1XFW O;  2OS8 B;  1HT9 A;  2L4I A;  1F70 A;  3OP0 A;  2KBI A;  5JOL A;  1BG1 A;  3BUO B;  3EVV A;  4NQG A;  3KF9 A;  1OMV A;  4MLW A;  1DJI A;  1YRT B;  1IJ5 A;  1K8U A;  2KDH A;  5GQQ C;  1IRJ A;  1QVI Z;  1TNP A;  3BUN B;  3HX4 A;  4GBA A;  2JT0 A;  3E3R A;  4DCK A;  1EH2 A;  4HRH A;  2KAX A;  4OV2 A;  1NX1 A;  5J3X A;  1DT7 B;  1B8R A;  2KOT A;  2H61 A;  1DF0 B;  1GGW A;  2JTZ A;  4YBH B;  2I18 A;  2LVI A;  1PVA A;  2L98 A;  1WRL A;  1FI5 A;  1KCY A;  1PVB A;  1L7Z A;  4CID A;  2L50 A;  2M7L A;  3TDZ A;  4D1E A;  3BOW A;  1NIW A;  4MRX A;  5CSJ A;  4YGB B;  2I94 A;  1TNQ A;  1QTX A;  1CLB A;  1XFX O;  1S26 D;  1GJY A;  1KSM A;  2NLN A;  3M0W A;  3SJS A;  2F3Z A;  2ZKM X;  2NZ0 A;  2MBX A;  2JRF A;  1KK7 Z;  1BMO A;  3F45 A;  3BUX B;  3I5G C;  3I5I C;  3RM1 A;  2MA2 A;  4A4B A;  4CFQ A;  3JTD C;  2KFF A;  2OPO A;  3QRX A;  2M3W A;  2KGB C;  1JWD A;  2KHN A;  1YUS A;  1L2O B;  1OE9 B;  1ZAC A;  4P5O E;  3VRO A;  3OB2 B;  4P2Y B;  3HCM A;  4YGE B;  3KEV A;  1F8H A;  4PE4 A;  4ETO A;  2BL0 C;  3DVK A;  1NP8 A;  1QIV A;  1Y6W A;  2E30 A;  2JXL A;  2LLS A;  3TDU A;  4CPV A;  1YRU B;  2JU0 A;  2LVJ A;  1ZOT B;  2M1U A;  1FBV A;  1BT6 A;  2HF5 A;  4PE0 A;  1RJV A;  2JUL A;  3NSL A;  4MZJ A;  3EKJ A;  4YRU A;  1G33 A;  3I5H C;  2KFG A;  1KWO B;  3LK1 A;  2H61 C;  1XO5 A;  1MR8 A;  1TOP A;  4QJ4 B;  2L5X B;  1ZMZ A;  2LC5 A;  4QJ5 B;  2K2A A;  3VRR A;  5CSN A;  3NXA A;  1V1F A;  1N65 A;  2L2E A;  1G8I A;  2M1K B;  2KBM A;  2VRG A;  2PAL A;  2G2B A;  5I2O A;  2FCD A;  4WQ3 A;  3WHU B;  1BOC A;  3GK1 A;  2L0P A;  1QV0 A;  2F33 A;  2MLE C;  4ZCV A;  5AXI A;  5D7F A;  3VGO A;  1B8L A;  1PSB A;  4C0L A;  1AK8 A;  2BCB A;  3CR5 X;  1N2D A;  2JOJ A;  2G9B A;  2KYC A;  1BJF A;  1FW4 A;  1NCX A;  1SYM A;  2GGZ A;  5ER4 X;  3SIA A;  2WOR A;  2P6B B;  1LIN A;  3CZT X;  3GOF A;  2H2K A;  1QX5 B;  1F55 A;  3I5G B;  3I5I B;  1AUI B;  1JFJ A;  2LNK A;  1J7P A;  5FYX A;  2HET A;  1ODB A;  2BKI B;  1Y1X A;  2AAO A;  2JQ6 A;  1KSO A;  2QPT A;  3EKH A;  2KFH A;  1QAT A;  3AAJ A;  4I5L B;  2BCA A;  3O2P A;  3BQ3 A;  5CPV A;  5AFP A;  1Q80 A;  3TDI A;  1G4Y R;  4ICB A;  5HLO A;  1J55 A;  1QIW A;  2K7B A;  1SBJ A;  4MRY A;  4OCI A;  1JF0 A;  2Q91 A;  3H4S E;  2ZN8 A;  1TCF A;  3ICB A;  1W7J B;  2Y1N A;  3CR4 X;  3SIB A;  2WND A;  4ORB B;  1K2H A;  1FF1 A;  1EG4 A;  2LAN A;  3EVU A;  1CFP A;  4FTG A;  2LCP A;  1S36 A;  3NSO A;  4AOM A;  1NX0 A;  2CCM A;  5BPJ A;  1K90 D;  4GGF A;  1NWD A;  1S3P A;  3AKB A;  3BXK A;  1QS7 A;  1CFD A;  1AP4 A;  4OR9 B;  1LA3 A;  3A4U B;  3OX5 A;  1EXR A;  1SKT A;  2PMY A;  2WC8 A;  2LUC A;  2LV7 A;  1TRF A;  2LLU A;  1SY9 A;  1Y1U A;  1OOJ A;  2RGI A;  4NDC A;  4YGC B;  4BY5 A;  1QLK A;  2MJW B;  1FI6 A;  1BLQ A;  1F4O A;  1B1G A;  2I7A A;  2WCF A;  1CB1 A;  1R2U A;  2JT8 A;  1YR5 A;  2KI4 C;  3FS7 A;  3RLZ A;  2FCE A;  4GPL B;  5HLV A;  1SMG A;  1CDL A;  1BU3 A;  2CT9 A;  1EG3 A;  1JC2 A;  2K2F A;  2SCP A;  1PUL A;  2WCE A;  3VRQ A;  1PK0 D;  2KQ6 A;  1SNL A;  4FQO A;  1M45 A;  1CFC A;  4GAO A;  1A03 A;  2K7D A;  4ORC B;  1ZFS A;  1CDM A;  2Y1M A;  2MHH A;  4ORA B;  1DF0 A;  4GFT A;  1DJG A;  5KU1 A;  1K9U A;  1CMG A;  2JNF A;  1QLS A;  1QVI Y;  1DGU A;  1A2X A;  2KI4 B;  1A75 A;  5AER A;  1D1O A;  2BBM A;  1AJ5 A;  1LA0 A;  2LM5 A;  3FIA A;  2K61 A;  2BCX A;  1RWY A;  1CMF A;  3NSK A;  4N5X A;  4MEW A;  2OTG B;  1BR1 B;  1E8A A;  2LMT A;  2M9G A;  2EC6 C;  1MQ1 A;  1GQM A;  2AMI A;  2F2P A;  3SG7 A;  3EK7 A;  2TN4 A;  3I5F C;  1QAS A;  2NCO A;  3OHM B;  1PSR A;  1TNW A;  1TN4 A;  1C7W A;  2NCP A;  5HKY A;  1IGV A;  1OMD A;  3LL8 B;  1IKU A;  3AAK A;  3JVT B;  2CTN A;  4YGA A;  3GK4 X;  3WHT B;  1EL4 A;  2D8N A;  1NYA A;  1CLL A;  1Y0V H;  2CBL A;  3JTD B;  1F71 A;  4AQJ A;  4F0Z B;  1C07 A;  2EHB A;  3MSE B;  1OQP A;  1S6C A;  1S6J A;  2HPS A;  2K7O A;  3FWB A;  4WRI A;  1Y1A A;  3KHE A;  4JPZ B;  3D10 A;  3TS5 B;  1DVI A;  2JPT A;  1UUS A;  2FOT A;  2LLT A;  1KFU L;  4GNK B;  1WDC C;  1WRK A;  2Y5I A;  5JJG A;  1LKJ A;  1DMO A;  1M46 A;  3PFV A;  4GGF C;  1SW8 A;  3SG5 A;  3WXA A;  4NDB A;  1CNP A;  2COL B;  1ALW A;  4QJ3 B;  1UUR A;  1UHJ A;  2M29 A;  3CS1 A;  1J7Q A;  3NSI A;  4Q04 A;  1XK4 C;  2JWW A;  3PN7 C;  2K8M B;  3EK8 A;  3FWC A;  3GK2 A;  1NUB A;  4XYN A;  1MF8 B;  1YVL A;  1QXP A;  5KSZ A;  1SL9 A;  1QJT A;  2ZNE A;  3CGA A;  2BE4 A;  2PAS A;  1SCM B;  3DF0 B;  1TNX A;  2KQY A;  2ZN9 A;  3BYA A;  1SCV A;  1V1G A;  3IQO A;  5B8I B;  5I2Q A;  4HRG A;  2KI6 C;  2DOQ A;  1B8C A;  1A4P A;  3LK0 A;  2I2R E;  2PVB A;  1MHO A;  2OS8 C;  1L2O C;  3DD4 A;  1M31 A;  1B7T Z;  1A75 B;  3IQQ A;  4HRE E;  3TUY B;  1S5G Y;  1N0Y A;  4I5N B;  1K9K A;  1MXE A;  2E6W A;  1RRO A;  4MZL A;  4PHK A;  1AHR A;  1K96 A;  4M2O A;  5K89 A;  1H8B A;  1M63 B;  3DVM A;  1KFX L;  4JWQ A;  2MAZ A;  1UP5 A;  2ZRS A;  2HQW A;  5DKQ A;  2M97 A;  1KWO C;  2HQ8 A;  1F4Q A;  4MZK A;  1OZS A;  1NCZ A;  2OTG C;  1W7I B;  1J1D A;  4TNC A;  3BUW B;  4MN0 A;  4M2Q A;  2PRU A;  2M7N A;  3IF7 A;  1YX7 A;  3O4Y A;  4L9M A;  1OSA A;  1SPY A;  4DRW A;  1IQ3 A;  4XJK A;  1K94 A;  4PHN A;  3VRN A;  1PRW A;  3PAL A;  4GUK A;  4YI8 A;  1B7T Y;  3D0Y A;  1DJW A;  5I8N A;  2JZI A;  1SK6 D;  4MBE A;  3TZ1 A;  2BL0 B;  2PSR A;  1BF5 A;  1NPQ A;  4PCW A;  1KQV A;  1SL8 A;  1MXL C;  4MSP A;  3OX6 A;  2F2O A;  4HSZ A;  3LCP C;  1ZUZ A;  1BR4 B;  1XFZ O;  2F3Y A;  1TTX A;  1IJ6 A;  1U5I B;  2K0J A;  2KI6 D;  4GGN A;  2GGM A;  5CSF A;  1C7V A;  5HKZ A;  1B9A A;  2O60 A;  1JF2 A;  1CKK A;  1EJ3 A;  1KFU S;  1SCM C;  1SRA A;  1QX2 A;  2Q4U A;  2EGD A;  4N1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...