1KQMB

Scallop myosin s1-amppnp in the actin-detached conformation
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
142
structure length
142
Chain Sequence
PQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKGSGEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic findings on the internally uncoupled and near-rigor states of myosin: Further insights into the mechanics of the motor
pubmed doi rcsb
molecule tags Contractile protein
molecule keywords MYOSIN heavy chain
total genus 30
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2002-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kqmB01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kqmB02
3BUNB 3O78A 1FPWA 2M9GA 1OZSA 3PN7B 5AANA 1WY9A 1YUUA 2P6BB 1LKJA 2E30A 2QACA 2F3YA 2GGMA 4ZCVA 2K61A 3GK4X 3KPXA 1K2HA 4M2PA 1J7PA 1S26D 2CT9A 3I5GC 4GNKB 1Y0VH 1S6JA 1ALWA 5KTYA 2AUCA 2I2RE 1UHKA 2JT0A 1OZOA 2CCMA 2WNDA 1CLMA 4NDCA 4AQIA 4MRXA 3IQOA 3DF0A 3RLZA 1IRJA 2BBNA 1DF0A 4XJKA 1KK7Z 2PVBA 1IG5A 3NSOA 4NDBA 2ZKMX 1AP4A 2BL0C 2Q91A 3IF7A 1KSMA 4OKHA 4M2QA 2LV7A 2OPOA 1DJZA 1K9PA 2L2EA 3SIAA 2HF5A 1CMFA 1QATA 2OTGB 3I5GB 1LA0A 1CNPA 4OR9B 4ORBB 3LL8B 2ZN8A 1Y6WA 2KNEA 1B8RA 2PSRA 3I5HB 1KSOA 2I7AA 2KYCA 2PMYA 2Y5IA 2KI6D 3EVRA 3HCMA 3M0WA 4P5OE 1J7QA 1F55A 1DF0B 4XJKB 4M2OA 1GGZA 4N1FA 1B1GA 1OMVA 1A75B 2KI4B 4AQJA 2SCPA 2Q4UA 2BECA 4WQ3A 1TIZA 4YGAA 2LNKA 4N5XA 3NSLA 3OP0A 2ZN9A 2LCPA 5CSFA 1BF5A 1KFXS 1ZOTB 3SJSA 4YI8A 2L50A 4ORCB 1FI6A 2M7NA 1DTLA 1F54A 2GGZA 1SW8A 2B1UA 1DJIA 3I5FC 2LP3A 1A29A 3TUYC 2JOJA 1SMGA 1L7ZA 1KQMB 1JWDA 1ZUZA 1MXLC 2PRUA 4BY4A 3SG6A 3LLEA 1XFVO 3D10A 4YI9A 1NCZA 4C0KA 1QS7A 2M1KB 1LVCD 1SCMC 1WRLA 1DT7B 1IQ5A 1OSAA 1MR8A 4PHNA 5I2OA 2KAYA 1B7TZ 2KHNA 1FF1A 1QIVA 2I18A 3SIBA 2K7CA 2KI6C 2RGIA 3I5FB 3TUYB 1W7JB 3OB1B 2ZRSA 1W7IB 3EK8A 3SG5A 1S1EA 1B8CA 1IJ6A 2JRFA 2JT3A 4PHMA 1EL4A 1K9UA 3CR2A 3AAJA 4WQ2A 3FS7A 1JFJA 2MRDA 1FW4A 1RECA 3GK2A 2KFHA 2LUCA 2FCDA 1WRKA 2AMIA 1TTXA 3F45A 3BQ3A 1TNQA 1WDCB 5KSZA 5I2LA 3SG3A 1CMGA 3D0YA 4NDDA 3LK0A 1EG4A 1QV0A 2M97A 5CSNA 1U5IB 1X02A 1B47A 2MA2A 5I8NA 1CLBA 1TOPA 2G2BA 2BCBA 2EC6C 3CS1A 2KGRA 1SY9A 2ZNDA 4GFTA 4DIRA 1XYDA 4MVFA 3SG7A 3TDIA 1F71A 1CB1A 1XFXO 3I5HC 1DJHA 4I5LB 4YGCB 2QPTA 1NX1A 4DCKA 4GGFC 1S5GZ 2KFFA 1J1EA 1G8IA 3LCPC 1A4PA 1K90D 1LXFC 1UHHA 1J1DA 2K8MB 3EKJA 2LVIA 3OX6A 1JBAA 1QLKA 2JNXA 1YR5A 4P2YB 1AJ4A 1NSHA 1A03A 1AUIB 1QX7A 3TS5C 1CFDA 1KK8B 1AHRA 2R2IA 2L98A 4OCIA 5BPJA 2BKHB 3A8RA 2KBIA 2JXLA 1MUXA 2Y1NA 3WHTB 1NPQA 1CFCA 1AJ5A 3BUXB 1UP5A 2EC6B 1JFKA 1TCOB 1KCYA 1SNLA 2BCAA 2KOTA 1EH2A 1B4CA 4MLWA 4DUQA 4CLNA 3JVTC 2LANA 5DKRA 4QJ4B 2F3ZA 1SBJA 2O5GA 1FBVA 1DJXA 1YVLA 1RTP1 2KBMA 2LHLA 4ETOA 3AKAA 3D0YB 1C7VA 2KAXA 4QJ3B 2CBLA 3E3RA 5J3XA 1DMOA 3EVUA 2JNFA 1D1OA 2L0PA 2ZFDA 2M7LA 1DJWA 2F33A 2KGBC 1OQPA 2WCFA 5JOLA 1JC2A 1HT9A 2JQ6A 1DGVA 1R2UA 2M8UA 1CKKA 3H4SE 4CFRA 1Q80A 1CDPA 4USLA 3LK1A 1ALVA 2M3WA 4F0ZB 3AKBA 4YRUA 1B8LA 2TN4A 1F4QA 2OTGC 1CM1A 1SL8A 1XA5A 2NCOA 5CSJA 2LVKA 3VRNA 4A4BA 4UPGA 5I2QA 4YGBB 1JF0A 1QVIY 4MBEA 3WXAA 1BG1A 2BL0B 1YUSA 4I5KA 2MJWB 1SRAA 1S3PA 3KEVA 1HQVA 2JWWA 1OMDA 3EK7A 3KF9A 2HETA 4OV2A 1KWOC 1K95A 1QTXA 5ER5A 2I94A 1B7TY 2M1UA 2BE4A 4DRWA 2JC2A 1MHOA 3BOWB 1CLLA 1IJ5A 2K7BA 1YRTB 2CNPA 4U8DA 1V1GA 2GV5A 4PE7A 2AAOA 4ZCUA 4IL1A 2PASA 3GOFA 2JXCA 3KO0A 3SG4A 2D8NA 4YGDB 2ISDA 3TDUA 3O2PA 2G9BA 4FQOA 4HSZA 2K0JA 1H4BA 5AXIA 2LM5A 4JQ0D 3DVJA 3OHMB 5D7FA 1G4YR 3K21A 1TN4A 1PK0D 2LLUA 3JVTB 2MLFC 3PSRA 3MSEB 5B8IB 1KQMC 3BUWB 2KAVA 3DVKA 3TDZA 1V1FA 2MAZA 1B9AA 1F4OA 1UHJA 1L2OB 1QIWA 1JF2A 4ICBA 3SG2A 4C0JA 4I5JA 1F70A 2JULA 1SR6C 2LC5A 3PALA 1BOCA 1C07A 4FTGA 3NSKA 4HREE 4GPLB 4C0LA 2L51A 2WC8A 1M63B 5FYXA 2HQWA 3NXAA 4PE0A 1YURA 5K89A 5GQQC 3CGAA 2LP2A 5IBWA 1K93D 3C1VA 1NCYA 1YTZC 3PATA 3VROA 1IKUA 1A2XA 2L5XB 1XO5A 1S5GY 2K2FA 1BR4B 5TNCA 1IQ3A 4PCWA 5AERA 4HRGA 5HYDA 1SR6B 1BJFA 2KSPA 1SYMA 4WRIA 1EJ3A 1N0YA 1MXEA 1NYAA 1UUSA 2IS9A 1JUOA 2OS8C 2PALA 3BOWA 1CFPA 4Q04A 1DJYA 3OB2B 1XK4A 1M46A 3ICBA 4JWQA 1YX7A 1CDMA 1DGUA 1QX5B 2CTNA 1XK4C 2FCEA 4DS7A 1PSRA 1RFJA 2MLEC 1KFXL 3HX4A 3DF0B 2JU0A 3BUOB 3FWBA 4MEWA 1BLQA 2KYFA 1XFWO 4GAOA 2NZ0A 1DVIA 1S6CA 2LMUA 1J7OA 1PALA 1IH0A 2BKIB 2H61C 2FOTA 1NX3A 1OMRA 2WCBA 4GGNA 3BXKA 1SPYA 4PE4A 1TNPA 2K7OA 1NWDA 4MSPA 1KFUS 3VRQA 2ZNEA 5HKYA 1PSBA 1N2DA 4GBAA 3TZ1A 2K2AA 2NCPA 1GJYA 3O6BA 2V53A 1A75A 1SL7A 2Y1MA 1UHIA 4CPVA 1DJGA 1ZMZA 1G33A 5D69A 1WLZA 2HQ8A 1KFUL 1XFYO 3PM8A 4R1EA 3VGOA 3VRPA 2NLNA 1Y1UA 3AAKA 1PRWA 3O4YA 1KWOB 2KI4C 2EHBA 1RWYA 2L4HA 1NCXA 1CDNA 5F6TA 2LMVA 2NXQA 2KFGA 1QVIZ 1CM4A 1QLSA 3CLNA 5AEQA 4OVNF 1IWQA 3DVEA 1CTRA 1UHNA 1WLMA 3EVVA 1OOJA 1SKTA 4PDZA 1FI5A 2L4IA 3CZTX 3A4UB 4MZLA 1NX0A 3WHUB 1K94A 2WCEA 5DKNA 1VRKA 1J55A 2BE6A 1N65A 1LA3A 5CSIA 1M31A 2ZRTA 5PALA 1E8AA 2JPTA 2O60A 3PFVA 1M39A 1BR1B 1KQVA 2BCXA 1M45A 3CR4X 5DKQA 1XFZO 5HLOA 1NUBA 2M49B 1L2OC 1XFUO 3DVMA 1BODA 4GUKA 1K96A 1TNWA 2LVVA 1UURA 3ZNIA 4YGEB 2KQYA 5JJGA 2LVJA 4A4CA 1AK8A 3JTDB 2JTTA 1ZFSA 1GGWA 5HKWA 1AVSA 2DOQA 5CPVA 1NIWA 1PULA 1JSAA 4PE1A 1NP8A 1SCMB 2E6WA 2LE9B 4N1GA 5G08A 4XYNA 2LLSA 2WORA 1CDLA 2A4JA 1MQ1A 1J7RA 1KK7Y 2JZIA 1QXPA 2KQ6A 2COLB 1YRUB 3BYAA 4NQGA 1PVBA 3OX5A 2M29A 3IQQA 4PHJA 2MBXA 4D1EA 3CWGA 1ZACA 3TS5B 2F2OA 1PVAA 3JTDC 3KHEA 3RM1A 4AOMA 4CIDA 1QV1A 4QJ5B 3I5IB 1CFFA 2VRGA 1WDCC 1RJVA 4YBHB 3PN7C 3BUMB 4MN0A 1GQMA 2F8PA 5AFPA 1EXRA 1U5IA 2EGDA 4TNCA 1SL9A 1TCFA 2MHHA 1QASA 3QRXA 2KDHA 2FJUB 2Y4QA 1SK6D 1TNXA 1ODBA 1NX2A 2H61A 4MZKA 1UWOA 1R6PA 2CXJA 1BU3A 4CFQA 1S6IA 3EKHA 5ER4X 1KK8C 1QJTA 1YUTA 4BY5A 4I5NB 3EK4A 3VRRA 2F2PA 4GGFA 4MZJA 3DD4A 1RROA 3CR5X 1H8BA 1TRFA 4JPZB 2JTZA 1WRZA 1YVHA 1K8UA 4L9MA 1YX8A 1OE9B 5HLVA 2WOSA 1MWNA 4PALA 1LINA 2LMTA 1XVJA 3GK1A 1MF8B 5HKZA 1F8HA 1K9KA 4E68A 1IGVA 1RK9A 2H2KA 2LAPA 3PLFB 2BBMA 2LLTA 3CTNA 3FIAA 1Y1AA 2SASA 1BT6A 3I5IC 1QX2A 1EG3A 3NSIA 1C7WA 3FWCA 4PHKA 1S36A 3WNXB 4HRHA 2LUXA 2JT8A 2M0RA 3ZWHA 5KU1A 2K7DA 2HPSA 2LHIA 1SCVA 1Y1XA 2OS8B 1BMOA 4ORAB 4MRYA
chains in the Genus database with same CATH superfamily
3BUNB 3O78A 1FPWA 2M9GA 1OZSA 1T14A 3DY9A 3PN7B 5AANA 1WY9A 1YUUA 1IIOA 2P6BB 1LKJA 2E30A 2QACA 2F3YA 2GGMA 4ZCVA 2K61A 2KLDA 3D75A 3GK4X 3KPXA 4KYNA 1K2HA 1C3ZA 4M2PA 1J7PA 1S26D 2CT9A 3I5GC 4GNKB 1Y0VH 1S6JA 1ALWA 5KTYA 2AUCA 2I2RE 1UHKA 2JT0A 1OZOA 2CCMA 2WNDA 1CLMA 3B86A 4NDCA 4AQIA 4MRXA 3IQOA 3DF0A 3RLZA 1IRJA 2BBNA 1DF0A 4XJKA 1KK7Z 2PVBA 1IG5A 3NSOA 4NDBA 2ZKMX 1AP4A 2WC5A 2BL0C 2Q91A 3FE8A 3IF7A 1KSMA 4OKHA 3Q8IA 3NHTA 4M2QA 2LV7A 2OPOA 1DJZA 1K9PA 2L2EA 3SIAA 2HF5A 1CMFA 5FI7A 1QATA 2OTGB 3I5GB 1LA0A 1CNPA 4OR9B 4ORBB 1DC1A 3LL8B 2ZN8A 1Y6WA 2KNEA 1B8RA 2PSRA 3I5HB 1KSOA 2I7AA 2KYCA 2PMYA 2Y5IA 2KI6D 3EVRA 3HCMA 3M0WA 4P5OE 3S0BA 1J7QA 5FI6A 1F55A 1DF0B 4XJKB 4M2OA 1GGZA 4N1FA 1B1GA 1OMVA 1A75B 2KI4B 4AQJA 2SCPA 2Q4UA 2BECA 4WQ3A 1TIZA 4YGAA 2QDIA 2LNKA 4N5XA 3NSLA 3OP0A 1XFRA 2ZN9A 2LCPA 5CSFA 1BF5A 1KFXS 1ZOTB 3SJSA 4OZDA 4YI8A 2L50A 4ORCB 1FI6A 2M7NA 1DTLA 1F54A 2GGZA 1SW8A 2B1UA 1DJIA 3I5FC 2LP3A 1A29A 3TUYC 2JOJA 1SMGA 1L7ZA 1KQMB 1JWDA 3CYZA 1ZUZA 1MXLC 2PRUA 2WCMA 4BY4A 3SG6A 3UO9A 3LLEA 3S0GA 1XFVO 3D10A 4YI9A 1NCZA 4C0KA 1QS7A 2M1KB 1LVCD 1SCMC 1WRLA 1DT7B 1IQ5A 1OSAA 1MR8A 2P71A 4PHNA 5I2OA 2KAYA 1B7TZ 2KHNA 1FF1A 1QIVA 2I18A 3SIBA 2K7CA 2KI6C 2RGIA 3I5FB 3TUYB 1W7JB 3OB1B 2ZRSA 1W7IB 2YGUA 3EK8A 4JD9A 3SG5A 1S1EA 1B8CA 1IJ6A 5HL1A 2JRFA 3SS4A 2JT3A 4PHMA 1EL4A 1K9UA 3CR2A 3AAJA 4WQ2A 3FS7A 1JFJA 2MRDA 3SS3A 1ORGA 1FW4A 1RECA 2JPOA 3GK2A 2KFHA 2LUCA 2FCDA 1WRKA 2AMIA 1TTXA 3D76A 1GM0A 3F45A 3BQ3A 2K60A 1TNQA 1WDCB 5KSZA 5I2LA 3SG3A 2WCHA 1CMGA 3D0YA 4NDDA 3LK0A 1EG4A 1QV0A 3R1OA 2M97A 5CSNA 1U5IB 1X02A 1B47A 2MA2A 5I8NA 1CLBA 1TOPA 2G2BA 2BCBA 4INWA 2EC6C 3CS1A 2KGRA 1SY9A 2ZNDA 3L4LA 1LS8A 4GFTA 4DIRA 1XYDA 4MVFA 3SG7A 3TDIA 1F71A 1CB1A 1XFXO 3I5HC 4INXA 1DJHA 4I5LB 4YGCB 2QPTA 1NX1A 4DCKA 4GGFC 1S5GZ 2KFFA 1J1EA 1G8IA 3LCPC 3D77A 1A4PA 1K90D 1LXFC 1UHHA 1J1DA 2K8MB 3EKJA 2LVIA 3OX6A 1JBAA 1QLKA 2JNXA 1YR5A 4P2YB 1AJ4A 1NSHA 1A03A 1AUIB 1QX7A 3TS5C 1CFDA 1KK8B 1AHRA 2R2IA 2L98A 4OCIA 2KLEA 2BKHB 3A8RA 5BPJA 2KBIA 3R72A 2JXLA 1MUXA 2Y1NA 3WHTB 1NPQA 1CFCA 1AJ5A 3BUXB 1UP5A 2EC6B 1JFKA 1TCOB 2BNXA 2QEHA 2QEOA 1SNLA 1KCYA 2BCAA 2KOTA 1EH2A 1B4CA 3V2LA 4MLWA 4DUQA 4CLNA 3D73A 2ERBA 3JVTC 2LANA 5DKRA 3S0EA 4QJ4B 2F3ZA 1SBJA 2O5GA 3NGVA 1FBVA 1DJXA 1YVLA 5DICA 1RTP1 2KBMA 2LHLA 4ETOA 3AKAA 2L5YA 3D0YB 1C7VA 2KAXA 4QJ3B 2CBLA 3E3RA 3RZSA 5J3XA 1DMOA 3EVUA 2JNFA 1D1OA 3VB1A 2L0PA 2ZFDA 2M7LA 1DJWA 2F33A 2KGBC 1OQPA 1Z4HA 2WCFA 5JOLA 1JC2A 3DZTA 3PM2A 1HT9A 2JQ6A 1DGVA 1R2UA 2M8UA 3L4AA 1CKKA 3H4SE 4CFRA 3OBVA 2QEVA 1Q80A 1CDPA 4IJ7A 3S0AA 4USLA 3LK1A 1ALVA 2M3WA 4F0ZB 3AKBA 4YRUA 1B8LA 2TN4A 1F4QA 2OTGC 1CM1A 1SL8A 1XA5A 2NCOA 3L47A 2LVKA 5CSJA 3VRNA 4A4BA 4UPGA 5I2QA 4YGBB 3FE9A 3QMEA 1JF0A 3R1VA 1QVIY 4MBEA 3WXAA 1BG1A 2BL0B 1YUSA 4I5KA 2MJWB 1SRAA 1S3PA 3KEVA 1HQVA 2JWWA 3EG5B 1OMDA 3EK7A 3KF9A 2HETA 4OV2A 1KWOC 2BAPA 2H8VA 1K95A 1QTXA 5ER5A 2I94A 1B7TY 2M1UA 1DELA 2BE4A 4DRWA 2JC2A 1MHOA 3BOWB 1CLLA 1IJ5A 2K7BA 1YRTB 2CNPA 4U8DA 1V1GA 2GV5A 4PE7A 2AAOA 4ZCUA 4IL1A 2PASA 3GOFA 2JXCA 3KO0A 3SG4A 2D8NA 4YGDB 2ISDA 3TDUA 3O2PA 2G9BA 4FQOA 4HSZA 2K0JA 1H4BA 5AXIA 2LM5A 4JQ0D 3DVJA 3OHMB 5D7FA 1G4YR 3K21A 1TN4A 1PK0D 2LLUA 3JVTB 2MLFC 3PSRA 3MSEB 5B8IB 1KQMC 3BUWB 2KAVA 3DVKA 3TDZA 1V1FA 2MAZA 1B9AA 1F4OA 1UHJA 1L2OB 1QIWA 1JF2A 4ICBA 3SG2A 4C0JA 4I5JA 1F70A 2JULA 2P70A 1OOFA 3CZ2A 1SR6C 2LC5A 2WCLA 3PALA 1BOCA 3D74A 1C07A 4FTGA 3NSKA 4HREE 4GPLB 4C0LA 3B87A 2L51A 3CZ0A 2WC8A 1M63B 5FYXA 2HQWA 3NXAA 4PE0A 1YURA 5K89A 5GQQC 3CGAA 2LP2A 5IBWA 1K93D 2PQLA 3C1VA 1NCYA 1YTZC 3PATA 3VROA 1IKUA 1Z2CB 1A2XA 5KU1A 2L5XB 1XO5A 1S5GY 2K2FA 1BR4B 5TNCA 1IQ3A 4PCWA 5AERA 3BFBA 4HRGA 5HYDA 1SR6B 1BJFA 2KSPA 1SYMA 4WRIA 1EJ3A 1N0YA 1MXEA 1NYAA 1UUSA 2IS9A 1JUOA 2OS8C 2PALA 3BOWA 1CFPA 4Q04A 1DJYA 3OB2B 4FQTA 1XK4A 1M46A 3ICBA 4JWQA 1YX7A 3R1PA 1CDMA 1DGUA 1QX5B 2CTNA 1XK4C 2FCEA 4DS7A 1PSRA 3BFHA 1RFJA 2MLEC 1KFXL 3HX4A 3DF0B 2JU0A 3BUOB 3DXLA 3FWBA 4MEWA 1BLQA 2KYFA 1SSEB 1XFWO 4GAOA 2NZ0A 1DVIA 1S6CA 3B88A 2WCKA 2LMUA 1J7OA 1PALA 1TUZA 2BKIB 2H61C 1IH0A 2FOTA 1NX3A 1DEKA 1OMRA 4JKTA 2WCBA 4GGNA 3BXKA 1SPYA 4PE4A 1TNPA 2K7OA 5FI2A 1NWDA 4MSPA 1KFUS 3VRQA 2ZNEA 5HKYA 1PSBA 2PYQA 1P28A 1N2DA 4GBAA 3TZ1A 2K2AA 2NCPA 1GJYA 3O6BA 1OW4A 2V53A 1A75A 2KPHA 1SL7A 2Y1MA 1UHIA 5EL2A 4CPVA 1DJGA 1ZMZA 1G33A 5D69A 1WLZA 2HQ8A 1KFUL 1XFYO 3PM8A 4R1EA 3VGOA 3VRPA 2NLNA 2WCJA 1Y1UA 3AAKA 1PRWA 3O4YA 1KWOB 2KI4C 2EHBA 1RWYA 3FE6A 2L4HA 1NCXA 1CDNA 5F6TA 2LMVA 3BJHA 2NXQA 2KFGA 1QVIZ 1QWVA 1CM4A 1QLSA 3CLNA 3PJIA 5AEQA 1DQEA 4OVNF 1IWQA 3DVEA 1CTRA 1UHNA 1WLMA 3EVVA 1OOJA 1SKTA 4PDZA 1FI5A 2L4IA 3CZTX 3A4UB 4MZLA 1NX0A 3WHUB 1K94A 2WCEA 5DKNA 1VRKA 1TWOA 1J55A 2BE6A 1N65A 1OOHA 3NHIA 1LA3A 5CSIA 2GTEA 1M31A 2ZRTA 5PALA 1E8AA 2JPTA 2O60A 3PFVA 1M39A 1BR1B 1OOIX 3CDNA 5I94A 2BCXA 1M45A 1KQVA 3CR4X 5DKQA 1XFZO 3D78A 1NUBA 2M49B 5HLOA 1L2OC 1XFUO 3DVMA 1BODA 4GUKA 1K96A 1TNWA 2LVVA 1OOGA 1UURA 3ZNIA 4YGEB 2KQYA 5JJGA 2LVJA 3BFAA 4A4CA 1AK8A 3JTDB 2JTTA 1ZFSA 3B7AA 1GGWA 5HKWA 1AVSA 2DOQA 2QEBA 1NIWA 5CPVA 2FJYA 1PULA 1JSAA 4PE1A 1NP8A 1SCMB 2E6WA 2LE9B 4N1GA 5G08A 4XYNA 2LLSA 2WORA 1CDLA 2A4JA 1MQ1A 2L2CA 1J7RA 1KK7Y 2JZIA 1QXPA 2KQ6A 3IVTA 2COLB 3O4XA 1YRUB 3BYAA 4NQGA 4F7FA 1PVBA 2WC6A 3OX5A 2M29A 3CABA 3OGNA 1C3YA 3IQQA 4PHJA 2MBXA 4D1EA 3CWGA 1ZACA 5D3OA 4PT1A 3TS5B 2F2OA 1PVAA 3JTDC 3KHEA 3RM1A 4AOMA 4CIDA 1QV1A 4QJ5B 3I5IB 1CFFA 2VRGA 1WDCC 1RJVA 4YBHB 3PN7C 3BUMB 4MN0A 1GQMA 2F8PA 5AFPA 1EXRA 1U5IA 2EGDA 4TNCA 1SL9A 1TCFA 2MHHA 3DYEA 1QASA 3QRXA 2KDHA 2FJUB 2Y4QA 1SK6D 1TNXA 1ODBA 1NX2A 2H61A 4MZKA 1UWOA 1R6PA 2CXJA 1BU3A 4CFQA 1S6IA 3EKHA 5ER4X 1KK8C 1QJTA 1YUTA 4BY5A 4I5NB 3EK4A 3VRRA 2F2PA 4GGFA 4MZJA 3DD4A 3B6XA 1RROA 3S0DA 3CR5X 1H8BA 1TRFA 4JPZB 2JTZA 1WRZA 1YVHA 1K8UA 4L9MA 1YX8A 1OE9B 5HLVA 2WOSA 1MWNA 3SS5A 3UNWA 4PALA 1LINA 2LMTA 1XVJA 3GK1A 1MF8B 5HKZA 1F8HA 1K9KA 4E68A 1IGVA 1TUJA 1RK9A 2H2KA 2LAPA 3S0FA 3PLFB 2BBMA 2LLTA 3CTNA 3FIAA 1Y1AA 2SASA 1BT6A 3I5IC 3N7HA 1QX2A 1EG3A 3K1EA 3NSIA 1C7WA 3FWCA 4PHKA 1S36A 3WNXB 4HRHA 1W9ZA 2JT8A 2LUXA 2M0RA 3ZWHA 2K7DA 3CZ1A 2HPSA 2LHIA 1SCVA 1Y1XA 2OS8B 1BMOA 4ORAB 4MRYA
chains in the Genus database with same CATH topology
3BUNB 3O78A 1FPWA 2M9GA 1OZSA 3PN7B 5AANA 1WY9A 1YUUA 2P6BB 1LKJA 2E30A 2QACA 2F3YA 2GGMA 4ZCVA 2K61A 3GK4X 3KPXA 1K2HA 4M2PA 1J7PA 1S26D 2CT9A 3I5GC 4GNKB 1Y0VH 1S6JA 1ALWA 5KTYA 2AUCA 2I2RE 1UHKA 2JT0A 1OZOA 2CCMA 2WNDA 1CLMA 4NDCA 4AQIA 4MRXA 3IQOA 3DF0A 3RLZA 1IRJA 2BBNA 1DF0A 4XJKA 1KK7Z 2PVBA 1IG5A 3NSOA 4NDBA 2ZKMX 1AP4A 2BL0C 2Q91A 3IF7A 1KSMA 4OKHA 4M2QA 2LV7A 2OPOA 1DJZA 1K9PA 2L2EA 3SIAA 2HF5A 1CMFA 1QATA 2OTGB 3I5GB 1LA0A 1CNPA 4OR9B 4ORBB 3LL8B 2ZN8A 1Y6WA 2KNEA 1B8RA 2PSRA 3I5HB 1KSOA 2I7AA 2KYCA 2PMYA 2Y5IA 2KI6D 3EVRA 3HCMA 3M0WA 4P5OE 1J7QA 1F55A 1DF0B 4XJKB 4M2OA 1GGZA 4N1FA 1B1GA 1OMVA 1A75B 2KI4B 4AQJA 2SCPA 2Q4UA 2BECA 4WQ3A 1TIZA 4YGAA 2LNKA 4N5XA 3NSLA 3OP0A 2ZN9A 2LCPA 5CSFA 1BF5A 1KFXS 1ZOTB 3SJSA 4YI8A 2L50A 4ORCB 1FI6A 2M7NA 1DTLA 1F54A 2GGZA 1SW8A 2B1UA 1DJIA 3I5FC 2LP3A 1A29A 3TUYC 2JOJA 1SMGA 1L7ZA 1KQMB 1JWDA 1ZUZA 1MXLC 2PRUA 4BY4A 3SG6A 3LLEA 1XFVO 3D10A 4YI9A 1NCZA 4C0KA 1QS7A 2M1KB 1LVCD 1SCMC 1WRLA 1DT7B 1IQ5A 1OSAA 1MR8A 4PHNA 5I2OA 2KAYA 1B7TZ 2KHNA 1FF1A 1QIVA 2I18A 3SIBA 2K7CA 2KI6C 2RGIA 3I5FB 3TUYB 1W7JB 3OB1B 2ZRSA 1W7IB 3EK8A 3SG5A 1S1EA 1B8CA 1IJ6A 2JRFA 2JT3A 4PHMA 1EL4A 1K9UA 3CR2A 3AAJA 4WQ2A 3FS7A 1JFJA 2MRDA 1FW4A 1RECA 3GK2A 2KFHA 2LUCA 2FCDA 1WRKA 2AMIA 1TTXA 3F45A 3BQ3A 1TNQA 1WDCB 5KSZA 5I2LA 3SG3A 1CMGA 3D0YA 4NDDA 3LK0A 1EG4A 1QV0A 2M97A 5CSNA 1U5IB 1X02A 1B47A 2MA2A 5I8NA 1CLBA 1TOPA 2G2BA 2BCBA 2EC6C 3CS1A 2KGRA 1SY9A 2ZNDA 4GFTA 4DIRA 1XYDA 4MVFA 3SG7A 3TDIA 1F71A 1CB1A 1XFXO 3I5HC 1DJHA 4I5LB 4YGCB 2QPTA 1NX1A 4DCKA 4GGFC 1S5GZ 2KFFA 1J1EA 1G8IA 3LCPC 1A4PA 1K90D 1LXFC 1UHHA 1J1DA 2K8MB 3EKJA 2LVIA 3OX6A 1JBAA 1QLKA 2JNXA 1YR5A 4P2YB 1AJ4A 1NSHA 1A03A 1AUIB 1QX7A 3TS5C 1CFDA 1KK8B 1AHRA 2R2IA 2L98A 4OCIA 5BPJA 2BKHB 3A8RA 2KBIA 2JXLA 1MUXA 2Y1NA 3WHTB 1NPQA 1CFCA 1AJ5A 3BUXB 1UP5A 2EC6B 1JFKA 1TCOB 1KCYA 1SNLA 2BCAA 2KOTA 1EH2A 1B4CA 4MLWA 4DUQA 4CLNA 3JVTC 2LANA 5DKRA 4QJ4B 2F3ZA 1SBJA 2O5GA 1FBVA 1DJXA 1YVLA 1RTP1 2KBMA 2LHLA 4ETOA 3AKAA 3D0YB 1C7VA 2KAXA 4QJ3B 2CBLA 3E3RA 5J3XA 1DMOA 3EVUA 2JNFA 1D1OA 2L0PA 2ZFDA 2M7LA 1DJWA 2F33A 2KGBC 1OQPA 2WCFA 5JOLA 1JC2A 1HT9A 2JQ6A 1DGVA 1R2UA 2M8UA 1CKKA 3H4SE 4CFRA 1Q80A 1CDPA 4USLA 3LK1A 1ALVA 2M3WA 4F0ZB 3AKBA 4YRUA 1B8LA 2TN4A 1F4QA 2OTGC 1CM1A 1SL8A 1XA5A 2NCOA 5CSJA 2LVKA 3VRNA 4A4BA 4UPGA 5I2QA 4YGBB 1JF0A 1QVIY 4MBEA 3WXAA 1BG1A 2BL0B 1YUSA 4I5KA 2MJWB 1SRAA 1S3PA 3KEVA 1HQVA 2JWWA 1OMDA 3EK7A 3KF9A 2HETA 4OV2A 1KWOC 1K95A 1QTXA 5ER5A 2I94A 1B7TY 2M1UA 2BE4A 4DRWA 2JC2A 1MHOA 3BOWB 1CLLA 1IJ5A 2K7BA 1YRTB 2CNPA 4U8DA 1V1GA 2GV5A 4PE7A 2AAOA 4ZCUA 4IL1A 2PASA 3GOFA 2JXCA 3KO0A 3SG4A 2D8NA 4YGDB 2ISDA 3TDUA 3O2PA 2G9BA 4FQOA 4HSZA 2K0JA 1H4BA 5AXIA 2LM5A 4JQ0D 3DVJA 3OHMB 5D7FA 1G4YR 3K21A 1TN4A 1PK0D 2LLUA 3JVTB 2MLFC 3PSRA 3MSEB 5B8IB 1KQMC 3BUWB 2KAVA 3DVKA 3TDZA 1V1FA 2MAZA 1B9AA 1F4OA 1UHJA 1L2OB 1QIWA 1JF2A 4ICBA 3SG2A 4C0JA 4I5JA 1F70A 2JULA 1SR6C 2LC5A 3PALA 1BOCA 1C07A 4FTGA 3NSKA 4HREE 4GPLB 4C0LA 2L51A 2WC8A 1M63B 5FYXA 2HQWA 3NXAA 4PE0A 1YURA 5K89A 5GQQC 3CGAA 2LP2A 5IBWA 1K93D 3C1VA 1NCYA 1YTZC 3PATA 3VROA 1IKUA 1A2XA 2L5XB 1XO5A 1S5GY 2K2FA 1BR4B 5TNCA 1IQ3A 4PCWA 5AERA 4HRGA 5HYDA 1SR6B 1BJFA 2KSPA 1SYMA 4WRIA 1EJ3A 1N0YA 1MXEA 1NYAA 1UUSA 2IS9A 1JUOA 2OS8C 2PALA 3BOWA 1CFPA 4Q04A 1DJYA 3OB2B 1XK4A 1M46A 3ICBA 4JWQA 1YX7A 1CDMA 1DGUA 1QX5B 2CTNA 1XK4C 2FCEA 4DS7A 1PSRA 1RFJA 2MLEC 1KFXL 3HX4A 3DF0B 2JU0A 3BUOB 3FWBA 4MEWA 1BLQA 2KYFA 1XFWO 4GAOA 2NZ0A 1DVIA 1S6CA 2LMUA 1J7OA 1PALA 1IH0A 2BKIB 2H61C 2FOTA 1NX3A 1OMRA 2WCBA 4GGNA 3BXKA 1SPYA 4PE4A 1TNPA 2K7OA 1NWDA 4MSPA 1KFUS 3VRQA 2ZNEA 5HKYA 1PSBA 1N2DA 4GBAA 3TZ1A 2K2AA 2NCPA 1GJYA 3O6BA 2V53A 1A75A 1SL7A 2Y1MA 1UHIA 4CPVA 1DJGA 1ZMZA 1G33A 5D69A 1WLZA 2HQ8A 1KFUL 1XFYO 3PM8A 4R1EA 3VGOA 3VRPA 2NLNA 1Y1UA 3AAKA 1PRWA 3O4YA 1KWOB 2KI4C 2EHBA 1RWYA 2L4HA 1NCXA 1CDNA 5F6TA 2LMVA 2NXQA 2KFGA 1QVIZ 1CM4A 1QLSA 3CLNA 5AEQA 4OVNF 1IWQA 3DVEA 1CTRA 1UHNA 1WLMA 3EVVA 1OOJA 1SKTA 4PDZA 1FI5A 2L4IA 3CZTX 3A4UB 4MZLA 1NX0A 3WHUB 1K94A 2WCEA 5DKNA 1VRKA 1J55A 2BE6A 1N65A 1LA3A 5CSIA 1M31A 2ZRTA 5PALA 1E8AA 2JPTA 2O60A 3PFVA 1M39A 1BR1B 1KQVA 2BCXA 1M45A 3CR4X 5DKQA 1XFZO 5HLOA 1NUBA 2M49B 1L2OC 1XFUO 3DVMA 1BODA 4GUKA 1K96A 1TNWA 2LVVA 1UURA 3ZNIA 4YGEB 2KQYA 5JJGA 2LVJA 4A4CA 1AK8A 3JTDB 2JTTA 1ZFSA 1GGWA 5HKWA 1AVSA 2DOQA 5CPVA 1NIWA 1PULA 1JSAA 4PE1A 1NP8A 1SCMB 2E6WA 2LE9B 4N1GA 5G08A 4XYNA 2LLSA 2WORA 1CDLA 2A4JA 1MQ1A 1J7RA 1KK7Y 2JZIA 1QXPA 2KQ6A 2COLB 1YRUB 3BYAA 4NQGA 1PVBA 3OX5A 2M29A 3IQQA 4PHJA 2MBXA 4D1EA 3CWGA 1ZACA 3TS5B 2F2OA 1PVAA 3JTDC 3KHEA 3RM1A 4AOMA 4CIDA 1QV1A 4QJ5B 3I5IB 1CFFA 2VRGA 1WDCC 1RJVA 4YBHB 3PN7C 3BUMB 4MN0A 1GQMA 2F8PA 5AFPA 1EXRA 1U5IA 2EGDA 4TNCA 1SL9A 1TCFA 2MHHA 1QASA 3QRXA 2KDHA 2FJUB 2Y4QA 1SK6D 1TNXA 1ODBA 1NX2A 2H61A 4MZKA 1UWOA 1R6PA 2CXJA 1BU3A 4CFQA 1S6IA 3EKHA 5ER4X 1KK8C 1QJTA 1YUTA 4BY5A 4I5NB 3EK4A 3VRRA 2F2PA 4GGFA 4MZJA 3DD4A 1RROA 3CR5X 1H8BA 1TRFA 4JPZB 2JTZA 1WRZA 1YVHA 1K8UA 4L9MA 1YX8A 1OE9B 5HLVA 2WOSA 1MWNA 4PALA 1LINA 2LMTA 1XVJA 3GK1A 1MF8B 5HKZA 1F8HA 1K9KA 4E68A 1IGVA 1RK9A 2H2KA 2LAPA 3PLFB 2BBMA 2LLTA 3CTNA 3FIAA 1Y1AA 2SASA 1BT6A 3I5IC 1QX2A 1EG3A 3NSIA 1C7WA 3FWCA 4PHKA 1S36A 3WNXB 4HRHA 2LUXA 2JT8A 2M0RA 3ZWHA 5KU1A 2K7DA 2HPSA 2LHIA 1SCVA 1Y1XA 2OS8B 1BMOA 4ORAB 4MRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BUN B;  3O78 A;  1FPW A;  2M9G A;  1OZS A;  3PN7 B;  5AAN A;  1WY9 A;  1YUU A;  2P6B B;  1LKJ A;  2E30 A;  2QAC A;  2F3Y A;  2GGM A;  4ZCV A;  2K61 A;  3GK4 X;  3KPX A;  1K2H A;  4M2P A;  1J7P A;  1S26 D;  2CT9 A;  3I5G C;  4GNK B;  1Y0V H;  1S6J A;  1ALW A;  5KTY A;  2AUC A;  2I2R E;  1UHK A;  2JT0 A;  1OZO A;  2CCM A;  2WND A;  1CLM A;  4NDC A;  4AQI A;  4MRX A;  3IQO A;  3DF0 A;  3RLZ A;  1IRJ A;  2BBN A;  1DF0 A;  4XJK A;  1KK7 Z;  2PVB A;  1IG5 A;  3NSO A;  4NDB A;  2ZKM X;  1AP4 A;  2BL0 C;  2Q91 A;  3IF7 A;  1KSM A;  4OKH A;  4M2Q A;  2LV7 A;  2OPO A;  1DJZ A;  1K9P A;  2L2E A;  3SIA A;  2HF5 A;  1CMF A;  1QAT A;  2OTG B;  3I5G B;  1LA0 A;  1CNP A;  4OR9 B;  4ORB B;  3LL8 B;  2ZN8 A;  1Y6W A;  2KNE A;  1B8R A;  2PSR A;  3I5H B;  1KSO A;  2I7A A;  2KYC A;  2PMY A;  2Y5I A;  2KI6 D;  3EVR A;  3HCM A;  3M0W A;  4P5O E;  1J7Q A;  1F55 A;  1DF0 B;  4XJK B;  4M2O A;  1GGZ A;  4N1F A;  1B1G A;  1OMV A;  1A75 B;  2KI4 B;  4AQJ A;  2SCP A;  2Q4U A;  2BEC A;  4WQ3 A;  1TIZ A;  4YGA A;  2LNK A;  4N5X A;  3NSL A;  3OP0 A;  2ZN9 A;  2LCP A;  5CSF A;  1BF5 A;  1KFX S;  1ZOT B;  3SJS A;  4YI8 A;  2L50 A;  4ORC B;  1FI6 A;  2M7N A;  1DTL A;  1F54 A;  2GGZ A;  1SW8 A;  2B1U A;  1DJI A;  3I5F C;  2LP3 A;  1A29 A;  3TUY C;  2JOJ A;  1SMG A;  1L7Z A;  1KQM B;  1JWD A;  1ZUZ A;  1MXL C;  2PRU A;  4BY4 A;  3SG6 A;  3LLE A;  1XFV O;  3D10 A;  4YI9 A;  1NCZ A;  4C0K A;  1QS7 A;  2M1K B;  1LVC D;  1SCM C;  1WRL A;  1DT7 B;  1IQ5 A;  1OSA A;  1MR8 A;  4PHN A;  5I2O A;  2KAY A;  1B7T Z;  2KHN A;  1FF1 A;  1QIV A;  2I18 A;  3SIB A;  2K7C A;  2KI6 C;  2RGI A;  3I5F B;  3TUY B;  1W7J B;  3OB1 B;  2ZRS A;  1W7I B;  3EK8 A;  3SG5 A;  1S1E A;  1B8C A;  1IJ6 A;  2JRF A;  2JT3 A;  4PHM A;  1EL4 A;  1K9U A;  3CR2 A;  3AAJ A;  4WQ2 A;  3FS7 A;  1JFJ A;  2MRD A;  1FW4 A;  1REC A;  3GK2 A;  2KFH A;  2LUC A;  2FCD A;  1WRK A;  2AMI A;  1TTX A;  3F45 A;  3BQ3 A;  1TNQ A;  1WDC B;  5KSZ A;  5I2L A;  3SG3 A;  1CMG A;  3D0Y A;  4NDD A;  3LK0 A;  1EG4 A;  1QV0 A;  2M97 A;  5CSN A;  1U5I B;  1X02 A;  1B47 A;  2MA2 A;  5I8N A;  1CLB A;  1TOP A;  2G2B A;  2BCB A;  2EC6 C;  3CS1 A;  2KGR A;  1SY9 A;  2ZND A;  4GFT A;  4DIR A;  1XYD A;  4MVF A;  3SG7 A;  3TDI A;  1F71 A;  1CB1 A;  1XFX O;  3I5H C;  1DJH A;  4I5L B;  4YGC B;  2QPT A;  1NX1 A;  4DCK A;  4GGF C;  1S5G Z;  2KFF A;  1J1E A;  1G8I A;  3LCP C;  1A4P A;  1K90 D;  1LXF C;  1UHH A;  1J1D A;  2K8M B;  3EKJ A;  2LVI A;  3OX6 A;  1JBA A;  1QLK A;  2JNX A;  1YR5 A;  4P2Y B;  1AJ4 A;  1NSH A;  1A03 A;  1AUI B;  1QX7 A;  3TS5 C;  1CFD A;  1KK8 B;  1AHR A;  2R2I A;  2L98 A;  4OCI A;  5BPJ A;  2BKH B;  3A8R A;  2KBI A;  2JXL A;  1MUX A;  2Y1N A;  3WHT B;  1NPQ A;  1CFC A;  1AJ5 A;  3BUX B;  1UP5 A;  2EC6 B;  1JFK A;  1TCO B;  1KCY A;  1SNL A;  2BCA A;  2KOT A;  1EH2 A;  1B4C A;  4MLW A;  4DUQ A;  4CLN A;  3JVT C;  2LAN A;  5DKR A;  4QJ4 B;  2F3Z A;  1SBJ A;  2O5G A;  1FBV A;  1DJX A;  1YVL A;  1RTP 1;  2KBM A;  2LHL A;  4ETO A;  3AKA A;  3D0Y B;  1C7V A;  2KAX A;  4QJ3 B;  2CBL A;  3E3R A;  5J3X A;  1DMO A;  3EVU A;  2JNF A;  1D1O A;  2L0P A;  2ZFD A;  2M7L A;  1DJW A;  2F33 A;  2KGB C;  1OQP A;  2WCF A;  5JOL A;  1JC2 A;  1HT9 A;  2JQ6 A;  1DGV A;  1R2U A;  2M8U A;  1CKK A;  3H4S E;  4CFR A;  1Q80 A;  1CDP A;  4USL A;  3LK1 A;  1ALV A;  2M3W A;  4F0Z B;  3AKB A;  4YRU A;  1B8L A;  2TN4 A;  1F4Q A;  2OTG C;  1CM1 A;  1SL8 A;  1XA5 A;  2NCO A;  5CSJ A;  2LVK A;  3VRN A;  4A4B A;  4UPG A;  5I2Q A;  4YGB B;  1JF0 A;  1QVI Y;  4MBE A;  3WXA A;  1BG1 A;  2BL0 B;  1YUS A;  4I5K A;  2MJW B;  1SRA A;  1S3P A;  3KEV A;  1HQV A;  2JWW A;  1OMD A;  3EK7 A;  3KF9 A;  2HET A;  4OV2 A;  1KWO C;  1K95 A;  1QTX A;  5ER5 A;  2I94 A;  1B7T Y;  2M1U A;  2BE4 A;  4DRW A;  2JC2 A;  1MHO A;  3BOW B;  1CLL A;  1IJ5 A;  2K7B A;  1YRT B;  2CNP A;  4U8D A;  1V1G A;  2GV5 A;  4PE7 A;  2AAO A;  4ZCU A;  4IL1 A;  2PAS A;  3GOF A;  2JXC A;  3KO0 A;  3SG4 A;  2D8N A;  4YGD B;  2ISD A;  3TDU A;  3O2P A;  2G9B A;  4FQO A;  4HSZ A;  2K0J A;  1H4B A;  5AXI A;  2LM5 A;  4JQ0 D;  3DVJ A;  3OHM B;  5D7F A;  1G4Y R;  3K21 A;  1TN4 A;  1PK0 D;  2LLU A;  3JVT B;  2MLF C;  3PSR A;  3MSE B;  5B8I B;  1KQM C;  3BUW B;  2KAV A;  3DVK A;  3TDZ A;  1V1F A;  2MAZ A;  1B9A A;  1F4O A;  1UHJ A;  1L2O B;  1QIW A;  1JF2 A;  4ICB A;  3SG2 A;  4C0J A;  4I5J A;  1F70 A;  2JUL A;  1SR6 C;  2LC5 A;  3PAL A;  1BOC A;  1C07 A;  4FTG A;  3NSK A;  4HRE E;  4GPL B;  4C0L A;  2L51 A;  2WC8 A;  1M63 B;  5FYX A;  2HQW A;  3NXA A;  4PE0 A;  1YUR A;  5K89 A;  5GQQ C;  3CGA A;  2LP2 A;  5IBW A;  1K93 D;  3C1V A;  1NCY A;  1YTZ C;  3PAT A;  3VRO A;  1IKU A;  1A2X A;  2L5X B;  1XO5 A;  1S5G Y;  2K2F A;  1BR4 B;  5TNC A;  1IQ3 A;  4PCW A;  5AER A;  4HRG A;  5HYD A;  1SR6 B;  1BJF A;  2KSP A;  1SYM A;  4WRI A;  1EJ3 A;  1N0Y A;  1MXE A;  1NYA A;  1UUS A;  2IS9 A;  1JUO A;  2OS8 C;  2PAL A;  3BOW A;  1CFP A;  4Q04 A;  1DJY A;  3OB2 B;  1XK4 A;  1M46 A;  3ICB A;  4JWQ A;  1YX7 A;  1CDM A;  1DGU A;  1QX5 B;  2CTN A;  1XK4 C;  2FCE A;  4DS7 A;  1PSR A;  1RFJ A;  2MLE C;  1KFX L;  3HX4 A;  3DF0 B;  2JU0 A;  3BUO B;  3FWB A;  4MEW A;  1BLQ A;  2KYF A;  1XFW O;  4GAO A;  2NZ0 A;  1DVI A;  1S6C A;  2LMU A;  1J7O A;  1PAL A;  1IH0 A;  2BKI B;  2H61 C;  2FOT A;  1NX3 A;  1OMR A;  2WCB A;  4GGN A;  3BXK A;  1SPY A;  4PE4 A;  1TNP A;  2K7O A;  1NWD A;  4MSP A;  1KFU S;  3VRQ A;  2ZNE A;  5HKY A;  1PSB A;  1N2D A;  4GBA A;  3TZ1 A;  2K2A A;  2NCP A;  1GJY A;  3O6B A;  2V53 A;  1A75 A;  1SL7 A;  2Y1M A;  1UHI A;  4CPV A;  1DJG A;  1ZMZ A;  1G33 A;  5D69 A;  1WLZ A;  2HQ8 A;  1KFU L;  1XFY O;  3PM8 A;  4R1E A;  3VGO A;  3VRP A;  2NLN A;  1Y1U A;  3AAK A;  1PRW A;  3O4Y A;  1KWO B;  2KI4 C;  2EHB A;  1RWY A;  2L4H A;  1NCX A;  1CDN A;  5F6T A;  2LMV A;  2NXQ A;  2KFG A;  1QVI Z;  1CM4 A;  1QLS A;  3CLN A;  5AEQ A;  4OVN F;  1IWQ A;  3DVE A;  1CTR A;  1UHN A;  1WLM A;  3EVV A;  1OOJ A;  1SKT A;  4PDZ A;  1FI5 A;  2L4I A;  3CZT X;  3A4U B;  4MZL A;  1NX0 A;  3WHU B;  1K94 A;  2WCE A;  5DKN A;  1VRK A;  1J55 A;  2BE6 A;  1N65 A;  1LA3 A;  5CSI A;  1M31 A;  2ZRT A;  5PAL A;  1E8A A;  2JPT A;  2O60 A;  3PFV A;  1M39 A;  1BR1 B;  1KQV A;  2BCX A;  1M45 A;  3CR4 X;  5DKQ A;  1XFZ O;  5HLO A;  1NUB A;  2M49 B;  1L2O C;  1XFU O;  3DVM A;  1BOD A;  4GUK A;  1K96 A;  1TNW A;  2LVV A;  1UUR A;  3ZNI A;  4YGE B;  2KQY A;  5JJG A;  2LVJ A;  4A4C A;  1AK8 A;  3JTD B;  2JTT A;  1ZFS A;  1GGW A;  5HKW A;  1AVS A;  2DOQ A;  5CPV A;  1NIW A;  1PUL A;  1JSA A;  4PE1 A;  1NP8 A;  1SCM B;  2E6W A;  2LE9 B;  4N1G A;  5G08 A;  4XYN A;  2LLS A;  2WOR A;  1CDL A;  2A4J A;  1MQ1 A;  1J7R A;  1KK7 Y;  2JZI A;  1QXP A;  2KQ6 A;  2COL B;  1YRU B;  3BYA A;  4NQG A;  1PVB A;  3OX5 A;  2M29 A;  3IQQ A;  4PHJ A;  2MBX A;  4D1E A;  3CWG A;  1ZAC A;  3TS5 B;  2F2O A;  1PVA A;  3JTD C;  3KHE A;  3RM1 A;  4AOM A;  4CID A;  1QV1 A;  4QJ5 B;  3I5I B;  1CFF A;  2VRG A;  1WDC C;  1RJV A;  4YBH B;  3PN7 C;  3BUM B;  4MN0 A;  1GQM A;  2F8P A;  5AFP A;  1EXR A;  1U5I A;  2EGD A;  4TNC A;  1SL9 A;  1TCF A;  2MHH A;  1QAS A;  3QRX A;  2KDH A;  2FJU B;  2Y4Q A;  1SK6 D;  1TNX A;  1ODB A;  1NX2 A;  2H61 A;  4MZK A;  1UWO A;  1R6P A;  2CXJ A;  1BU3 A;  4CFQ A;  1S6I A;  3EKH A;  5ER4 X;  1KK8 C;  1QJT A;  1YUT A;  4BY5 A;  4I5N B;  3EK4 A;  3VRR A;  2F2P A;  4GGF A;  4MZJ A;  3DD4 A;  1RRO A;  3CR5 X;  1H8B A;  1TRF A;  4JPZ B;  2JTZ A;  1WRZ A;  1YVH A;  1K8U A;  4L9M A;  1YX8 A;  1OE9 B;  5HLV A;  2WOS A;  1MWN A;  4PAL A;  1LIN A;  2LMT A;  1XVJ A;  3GK1 A;  1MF8 B;  5HKZ A;  1F8H A;  1K9K A;  4E68 A;  1IGV A;  1RK9 A;  2H2K A;  2LAP A;  3PLF B;  2BBM A;  2LLT A;  3CTN A;  3FIA A;  1Y1A A;  2SAS A;  1BT6 A;  3I5I C;  1QX2 A;  1EG3 A;  3NSI A;  1C7W A;  3FWC A;  4PHK A;  1S36 A;  3WNX B;  4HRH A;  2LUX A;  2JT8 A;  2M0R A;  3ZWH A;  5KU1 A;  2K7D A;  2HPS A;  2LHI A;  1SCV A;  1Y1X A;  2OS8 B;  1BMO A;  4ORA B;  4MRY A; 
#chains in the Genus database with same CATH topology
 3BUN B;  3O78 A;  1FPW A;  2M9G A;  1OZS A;  1T14 A;  3DY9 A;  3PN7 B;  5AAN A;  1WY9 A;  1YUU A;  1IIO A;  2P6B B;  1LKJ A;  2E30 A;  2QAC A;  2F3Y A;  2GGM A;  4ZCV A;  2K61 A;  2KLD A;  3D75 A;  3GK4 X;  3KPX A;  4KYN A;  1K2H A;  1C3Z A;  4M2P A;  1J7P A;  1S26 D;  2CT9 A;  3I5G C;  4GNK B;  1Y0V H;  1S6J A;  1ALW A;  5KTY A;  2AUC A;  2I2R E;  1UHK A;  2JT0 A;  1OZO A;  2CCM A;  2WND A;  1CLM A;  3B86 A;  4NDC A;  4AQI A;  4MRX A;  3IQO A;  3DF0 A;  3RLZ A;  1IRJ A;  2BBN A;  1DF0 A;  4XJK A;  1KK7 Z;  2PVB A;  1IG5 A;  3NSO A;  4NDB A;  2ZKM X;  1AP4 A;  2WC5 A;  2BL0 C;  2Q91 A;  3FE8 A;  3IF7 A;  1KSM A;  4OKH A;  3Q8I A;  3NHT A;  4M2Q A;  2LV7 A;  2OPO A;  1DJZ A;  1K9P A;  2L2E A;  3SIA A;  2HF5 A;  1CMF A;  5FI7 A;  1QAT A;  2OTG B;  3I5G B;  1LA0 A;  1CNP A;  4OR9 B;  4ORB B;  1DC1 A;  3LL8 B;  2ZN8 A;  1Y6W A;  2KNE A;  1B8R A;  2PSR A;  3I5H B;  1KSO A;  2I7A A;  2KYC A;  2PMY A;  2Y5I A;  2KI6 D;  3EVR A;  3HCM A;  3M0W A;  4P5O E;  3S0B A;  1J7Q A;  5FI6 A;  1F55 A;  1DF0 B;  4XJK B;  4M2O A;  1GGZ A;  4N1F A;  1B1G A;  1OMV A;  1A75 B;  2KI4 B;  4AQJ A;  2SCP A;  2Q4U A;  2BEC A;  4WQ3 A;  1TIZ A;  4YGA A;  2QDI A;  2LNK A;  4N5X A;  3NSL A;  3OP0 A;  1XFR A;  2ZN9 A;  2LCP A;  5CSF A;  1BF5 A;  1KFX S;  1ZOT B;  3SJS A;  4OZD A;  4YI8 A;  2L50 A;  4ORC B;  1FI6 A;  2M7N A;  1DTL A;  1F54 A;  2GGZ A;  1SW8 A;  2B1U A;  1DJI A;  3I5F C;  2LP3 A;  1A29 A;  3TUY C;  2JOJ A;  1SMG A;  1L7Z A;  1KQM B;  1JWD A;  3CYZ A;  1ZUZ A;  1MXL C;  2PRU A;  2WCM A;  4BY4 A;  3SG6 A;  3UO9 A;  3LLE A;  3S0G A;  1XFV O;  3D10 A;  4YI9 A;  1NCZ A;  4C0K A;  1QS7 A;  2M1K B;  1LVC D;  1SCM C;  1WRL A;  1DT7 B;  1IQ5 A;  1OSA A;  1MR8 A;  2P71 A;  4PHN A;  5I2O A;  2KAY A;  1B7T Z;  2KHN A;  1FF1 A;  1QIV A;  2I18 A;  3SIB A;  2K7C A;  2KI6 C;  2RGI A;  3I5F B;  3TUY B;  1W7J B;  3OB1 B;  2ZRS A;  1W7I B;  2YGU A;  3EK8 A;  4JD9 A;  3SG5 A;  1S1E A;  1B8C A;  1IJ6 A;  5HL1 A;  2JRF A;  3SS4 A;  2JT3 A;  4PHM A;  1EL4 A;  1K9U A;  3CR2 A;  3AAJ A;  4WQ2 A;  3FS7 A;  1JFJ A;  2MRD A;  3SS3 A;  1ORG A;  1FW4 A;  1REC A;  2JPO A;  3GK2 A;  2KFH A;  2LUC A;  2FCD A;  1WRK A;  2AMI A;  1TTX A;  3D76 A;  1GM0 A;  3F45 A;  3BQ3 A;  2K60 A;  1TNQ A;  1WDC B;  5KSZ A;  5I2L A;  3SG3 A;  2WCH A;  1CMG A;  3D0Y A;  4NDD A;  3LK0 A;  1EG4 A;  1QV0 A;  3R1O A;  2M97 A;  5CSN A;  1U5I B;  1X02 A;  1B47 A;  2MA2 A;  5I8N A;  1CLB A;  1TOP A;  2G2B A;  2BCB A;  4INW A;  2EC6 C;  3CS1 A;  2KGR A;  1SY9 A;  2ZND A;  3L4L A;  1LS8 A;  4GFT A;  4DIR A;  1XYD A;  4MVF A;  3SG7 A;  3TDI A;  1F71 A;  1CB1 A;  1XFX O;  3I5H C;  4INX A;  1DJH A;  4I5L B;  4YGC B;  2QPT A;  1NX1 A;  4DCK A;  4GGF C;  1S5G Z;  2KFF A;  1J1E A;  1G8I A;  3LCP C;  3D77 A;  1A4P A;  1K90 D;  1LXF C;  1UHH A;  1J1D A;  2K8M B;  3EKJ A;  2LVI A;  3OX6 A;  1JBA A;  1QLK A;  2JNX A;  1YR5 A;  4P2Y B;  1AJ4 A;  1NSH A;  1A03 A;  1AUI B;  1QX7 A;  3TS5 C;  1CFD A;  1KK8 B;  1AHR A;  2R2I A;  2L98 A;  4OCI A;  2KLE A;  2BKH B;  3A8R A;  5BPJ A;  2KBI A;  3R72 A;  2JXL A;  1MUX A;  2Y1N A;  3WHT B;  1NPQ A;  1CFC A;  1AJ5 A;  3BUX B;  1UP5 A;  2EC6 B;  1JFK A;  1TCO B;  2BNX A;  2QEH A;  2QEO A;  1SNL A;  1KCY A;  2BCA A;  2KOT A;  1EH2 A;  1B4C A;  3V2L A;  4MLW A;  4DUQ A;  4CLN A;  3D73 A;  2ERB A;  3JVT C;  2LAN A;  5DKR A;  3S0E A;  4QJ4 B;  2F3Z A;  1SBJ A;  2O5G A;  3NGV A;  1FBV A;  1DJX A;  1YVL A;  5DIC A;  1RTP 1;  2KBM A;  2LHL A;  4ETO A;  3AKA A;  2L5Y A;  3D0Y B;  1C7V A;  2KAX A;  4QJ3 B;  2CBL A;  3E3R A;  3RZS A;  5J3X A;  1DMO A;  3EVU A;  2JNF A;  1D1O A;  3VB1 A;  2L0P A;  2ZFD A;  2M7L A;  1DJW A;  2F33 A;  2KGB C;  1OQP A;  1Z4H A;  2WCF A;  5JOL A;  1JC2 A;  3DZT A;  3PM2 A;  1HT9 A;  2JQ6 A;  1DGV A;  1R2U A;  2M8U A;  3L4A A;  1CKK A;  3H4S E;  4CFR A;  3OBV A;  2QEV A;  1Q80 A;  1CDP A;  4IJ7 A;  3S0A A;  4USL A;  3LK1 A;  1ALV A;  2M3W A;  4F0Z B;  3AKB A;  4YRU A;  1B8L A;  2TN4 A;  1F4Q A;  2OTG C;  1CM1 A;  1SL8 A;  1XA5 A;  2NCO A;  3L47 A;  2LVK A;  5CSJ A;  3VRN A;  4A4B A;  4UPG A;  5I2Q A;  4YGB B;  3FE9 A;  3QME A;  1JF0 A;  3R1V A;  1QVI Y;  4MBE A;  3WXA A;  1BG1 A;  2BL0 B;  1YUS A;  4I5K A;  2MJW B;  1SRA A;  1S3P A;  3KEV A;  1HQV A;  2JWW A;  3EG5 B;  1OMD A;  3EK7 A;  3KF9 A;  2HET A;  4OV2 A;  1KWO C;  2BAP A;  2H8V A;  1K95 A;  1QTX A;  5ER5 A;  2I94 A;  1B7T Y;  2M1U A;  1DEL A;  2BE4 A;  4DRW A;  2JC2 A;  1MHO A;  3BOW B;  1CLL A;  1IJ5 A;  2K7B A;  1YRT B;  2CNP A;  4U8D A;  1V1G A;  2GV5 A;  4PE7 A;  2AAO A;  4ZCU A;  4IL1 A;  2PAS A;  3GOF A;  2JXC A;  3KO0 A;  3SG4 A;  2D8N A;  4YGD B;  2ISD A;  3TDU A;  3O2P A;  2G9B A;  4FQO A;  4HSZ A;  2K0J A;  1H4B A;  5AXI A;  2LM5 A;  4JQ0 D;  3DVJ A;  3OHM B;  5D7F A;  1G4Y R;  3K21 A;  1TN4 A;  1PK0 D;  2LLU A;  3JVT B;  2MLF C;  3PSR A;  3MSE B;  5B8I B;  1KQM C;  3BUW B;  2KAV A;  3DVK A;  3TDZ A;  1V1F A;  2MAZ A;  1B9A A;  1F4O A;  1UHJ A;  1L2O B;  1QIW A;  1JF2 A;  4ICB A;  3SG2 A;  4C0J A;  4I5J A;  1F70 A;  2JUL A;  2P70 A;  1OOF A;  3CZ2 A;  1SR6 C;  2LC5 A;  2WCL A;  3PAL A;  1BOC A;  3D74 A;  1C07 A;  4FTG A;  3NSK A;  4HRE E;  4GPL B;  4C0L A;  3B87 A;  2L51 A;  3CZ0 A;  2WC8 A;  1M63 B;  5FYX A;  2HQW A;  3NXA A;  4PE0 A;  1YUR A;  5K89 A;  5GQQ C;  3CGA A;  2LP2 A;  5IBW A;  1K93 D;  2PQL A;  3C1V A;  1NCY A;  1YTZ C;  3PAT A;  3VRO A;  1IKU A;  1Z2C B;  1A2X A;  5KU1 A;  2L5X B;  1XO5 A;  1S5G Y;  2K2F A;  1BR4 B;  5TNC A;  1IQ3 A;  4PCW A;  5AER A;  3BFB A;  4HRG A;  5HYD A;  1SR6 B;  1BJF A;  2KSP A;  1SYM A;  4WRI A;  1EJ3 A;  1N0Y A;  1MXE A;  1NYA A;  1UUS A;  2IS9 A;  1JUO A;  2OS8 C;  2PAL A;  3BOW A;  1CFP A;  4Q04 A;  1DJY A;  3OB2 B;  4FQT A;  1XK4 A;  1M46 A;  3ICB A;  4JWQ A;  1YX7 A;  3R1P A;  1CDM A;  1DGU A;  1QX5 B;  2CTN A;  1XK4 C;  2FCE A;  4DS7 A;  1PSR A;  3BFH A;  1RFJ A;  2MLE C;  1KFX L;  3HX4 A;  3DF0 B;  2JU0 A;  3BUO B;  3DXL A;  3FWB A;  4MEW A;  1BLQ A;  2KYF A;  1SSE B;  1XFW O;  4GAO A;  2NZ0 A;  1DVI A;  1S6C A;  3B88 A;  2WCK A;  2LMU A;  1J7O A;  1PAL A;  1TUZ A;  2BKI B;  2H61 C;  1IH0 A;  2FOT A;  1NX3 A;  1DEK A;  1OMR A;  4JKT A;  2WCB A;  4GGN A;  3BXK A;  1SPY A;  4PE4 A;  1TNP A;  2K7O A;  5FI2 A;  1NWD A;  4MSP A;  1KFU S;  3VRQ A;  2ZNE A;  5HKY A;  1PSB A;  2PYQ A;  1P28 A;  1N2D A;  4GBA A;  3TZ1 A;  2K2A A;  2NCP A;  1GJY A;  3O6B A;  1OW4 A;  2V53 A;  1A75 A;  2KPH A;  1SL7 A;  2Y1M A;  1UHI A;  5EL2 A;  4CPV A;  1DJG A;  1ZMZ A;  1G33 A;  5D69 A;  1WLZ A;  2HQ8 A;  1KFU L;  1XFY O;  3PM8 A;  4R1E A;  3VGO A;  3VRP A;  2NLN A;  2WCJ A;  1Y1U A;  3AAK A;  1PRW A;  3O4Y A;  1KWO B;  2KI4 C;  2EHB A;  1RWY A;  3FE6 A;  2L4H A;  1NCX A;  1CDN A;  5F6T A;  2LMV A;  3BJH A;  2NXQ A;  2KFG A;  1QVI Z;  1QWV A;  1CM4 A;  1QLS A;  3CLN A;  3PJI A;  5AEQ A;  1DQE A;  4OVN F;  1IWQ A;  3DVE A;  1CTR A;  1UHN A;  1WLM A;  3EVV A;  1OOJ A;  1SKT A;  4PDZ A;  1FI5 A;  2L4I A;  3CZT X;  3A4U B;  4MZL A;  1NX0 A;  3WHU B;  1K94 A;  2WCE A;  5DKN A;  1VRK A;  1TWO A;  1J55 A;  2BE6 A;  1N65 A;  1OOH A;  3NHI A;  1LA3 A;  5CSI A;  2GTE A;  1M31 A;  2ZRT A;  5PAL A;  1E8A A;  2JPT A;  2O60 A;  3PFV A;  1M39 A;  1BR1 B;  1OOI X;  3CDN A;  5I94 A;  2BCX A;  1M45 A;  1KQV A;  3CR4 X;  5DKQ A;  1XFZ O;  3D78 A;  1NUB A;  2M49 B;  5HLO A;  1L2O C;  1XFU O;  3DVM A;  1BOD A;  4GUK A;  1K96 A;  1TNW A;  2LVV A;  1OOG A;  1UUR A;  3ZNI A;  4YGE B;  2KQY A;  5JJG A;  2LVJ A;  3BFA A;  4A4C A;  1AK8 A;  3JTD B;  2JTT A;  1ZFS A;  3B7A A;  1GGW A;  5HKW A;  1AVS A;  2DOQ A;  2QEB A;  1NIW A;  5CPV A;  2FJY A;  1PUL A;  1JSA A;  4PE1 A;  1NP8 A;  1SCM B;  2E6W A;  2LE9 B;  4N1G A;  5G08 A;  4XYN A;  2LLS A;  2WOR A;  1CDL A;  2A4J A;  1MQ1 A;  2L2C A;  1J7R A;  1KK7 Y;  2JZI A;  1QXP A;  2KQ6 A;  3IVT A;  2COL B;  3O4X A;  1YRU B;  3BYA A;  4NQG A;  4F7F A;  1PVB A;  2WC6 A;  3OX5 A;  2M29 A;  3CAB A;  3OGN A;  1C3Y A;  3IQQ A;  4PHJ A;  2MBX A;  4D1E A;  3CWG A;  1ZAC A;  5D3O A;  4PT1 A;  3TS5 B;  2F2O A;  1PVA A;  3JTD C;  3KHE A;  3RM1 A;  4AOM A;  4CID A;  1QV1 A;  4QJ5 B;  3I5I B;  1CFF A;  2VRG A;  1WDC C;  1RJV A;  4YBH B;  3PN7 C;  3BUM B;  4MN0 A;  1GQM A;  2F8P A;  5AFP A;  1EXR A;  1U5I A;  2EGD A;  4TNC A;  1SL9 A;  1TCF A;  2MHH A;  3DYE A;  1QAS A;  3QRX A;  2KDH A;  2FJU B;  2Y4Q A;  1SK6 D;  1TNX A;  1ODB A;  1NX2 A;  2H61 A;  4MZK A;  1UWO A;  1R6P A;  2CXJ A;  1BU3 A;  4CFQ A;  1S6I A;  3EKH A;  5ER4 X;  1KK8 C;  1QJT A;  1YUT A;  4BY5 A;  4I5N B;  3EK4 A;  3VRR A;  2F2P A;  4GGF A;  4MZJ A;  3DD4 A;  3B6X A;  1RRO A;  3S0D A;  3CR5 X;  1H8B A;  1TRF A;  4JPZ B;  2JTZ A;  1WRZ A;  1YVH A;  1K8U A;  4L9M A;  1YX8 A;  1OE9 B;  5HLV A;  2WOS A;  1MWN A;  3SS5 A;  3UNW A;  4PAL A;  1LIN A;  2LMT A;  1XVJ A;  3GK1 A;  1MF8 B;  5HKZ A;  1F8H A;  1K9K A;  4E68 A;  1IGV A;  1TUJ A;  1RK9 A;  2H2K A;  2LAP A;  3S0F A;  3PLF B;  2BBM A;  2LLT A;  3CTN A;  3FIA A;  1Y1A A;  2SAS A;  1BT6 A;  3I5I C;  3N7H A;  1QX2 A;  1EG3 A;  3K1E A;  3NSI A;  1C7W A;  3FWC A;  4PHK A;  1S36 A;  3WNX B;  4HRH A;  1W9Z A;  2JT8 A;  2LUX A;  2M0R A;  3ZWH A;  2K7D A;  3CZ1 A;  2HPS A;  2LHI A;  1SCV A;  1Y1X A;  2OS8 B;  1BMO A;  4ORA B;  4MRY A; 
#chains in the Genus database with same CATH homology
 3BUN B;  3O78 A;  1FPW A;  2M9G A;  1OZS A;  3PN7 B;  5AAN A;  1WY9 A;  1YUU A;  2P6B B;  1LKJ A;  2E30 A;  2QAC A;  2F3Y A;  2GGM A;  4ZCV A;  2K61 A;  3GK4 X;  3KPX A;  1K2H A;  4M2P A;  1J7P A;  1S26 D;  2CT9 A;  3I5G C;  4GNK B;  1Y0V H;  1S6J A;  1ALW A;  5KTY A;  2AUC A;  2I2R E;  1UHK A;  2JT0 A;  1OZO A;  2CCM A;  2WND A;  1CLM A;  4NDC A;  4AQI A;  4MRX A;  3IQO A;  3DF0 A;  3RLZ A;  1IRJ A;  2BBN A;  1DF0 A;  4XJK A;  1KK7 Z;  2PVB A;  1IG5 A;  3NSO A;  4NDB A;  2ZKM X;  1AP4 A;  2BL0 C;  2Q91 A;  3IF7 A;  1KSM A;  4OKH A;  4M2Q A;  2LV7 A;  2OPO A;  1DJZ A;  1K9P A;  2L2E A;  3SIA A;  2HF5 A;  1CMF A;  1QAT A;  2OTG B;  3I5G B;  1LA0 A;  1CNP A;  4OR9 B;  4ORB B;  3LL8 B;  2ZN8 A;  1Y6W A;  2KNE A;  1B8R A;  2PSR A;  3I5H B;  1KSO A;  2I7A A;  2KYC A;  2PMY A;  2Y5I A;  2KI6 D;  3EVR A;  3HCM A;  3M0W A;  4P5O E;  1J7Q A;  1F55 A;  1DF0 B;  4XJK B;  4M2O A;  1GGZ A;  4N1F A;  1B1G A;  1OMV A;  1A75 B;  2KI4 B;  4AQJ A;  2SCP A;  2Q4U A;  2BEC A;  4WQ3 A;  1TIZ A;  4YGA A;  2LNK A;  4N5X A;  3NSL A;  3OP0 A;  2ZN9 A;  2LCP A;  5CSF A;  1BF5 A;  1KFX S;  1ZOT B;  3SJS A;  4YI8 A;  2L50 A;  4ORC B;  1FI6 A;  2M7N A;  1DTL A;  1F54 A;  2GGZ A;  1SW8 A;  2B1U A;  1DJI A;  3I5F C;  2LP3 A;  1A29 A;  3TUY C;  2JOJ A;  1SMG A;  1L7Z A;  1KQM B;  1JWD A;  1ZUZ A;  1MXL C;  2PRU A;  4BY4 A;  3SG6 A;  3LLE A;  1XFV O;  3D10 A;  4YI9 A;  1NCZ A;  4C0K A;  1QS7 A;  2M1K B;  1LVC D;  1SCM C;  1WRL A;  1DT7 B;  1IQ5 A;  1OSA A;  1MR8 A;  4PHN A;  5I2O A;  2KAY A;  1B7T Z;  2KHN A;  1FF1 A;  1QIV A;  2I18 A;  3SIB A;  2K7C A;  2KI6 C;  2RGI A;  3I5F B;  3TUY B;  1W7J B;  3OB1 B;  2ZRS A;  1W7I B;  3EK8 A;  3SG5 A;  1S1E A;  1B8C A;  1IJ6 A;  2JRF A;  2JT3 A;  4PHM A;  1EL4 A;  1K9U A;  3CR2 A;  3AAJ A;  4WQ2 A;  3FS7 A;  1JFJ A;  2MRD A;  1FW4 A;  1REC A;  3GK2 A;  2KFH A;  2LUC A;  2FCD A;  1WRK A;  2AMI A;  1TTX A;  3F45 A;  3BQ3 A;  1TNQ A;  1WDC B;  5KSZ A;  5I2L A;  3SG3 A;  1CMG A;  3D0Y A;  4NDD A;  3LK0 A;  1EG4 A;  1QV0 A;  2M97 A;  5CSN A;  1U5I B;  1X02 A;  1B47 A;  2MA2 A;  5I8N A;  1CLB A;  1TOP A;  2G2B A;  2BCB A;  2EC6 C;  3CS1 A;  2KGR A;  1SY9 A;  2ZND A;  4GFT A;  4DIR A;  1XYD A;  4MVF A;  3SG7 A;  3TDI A;  1F71 A;  1CB1 A;  1XFX O;  3I5H C;  1DJH A;  4I5L B;  4YGC B;  2QPT A;  1NX1 A;  4DCK A;  4GGF C;  1S5G Z;  2KFF A;  1J1E A;  1G8I A;  3LCP C;  1A4P A;  1K90 D;  1LXF C;  1UHH A;  1J1D A;  2K8M B;  3EKJ A;  2LVI A;  3OX6 A;  1JBA A;  1QLK A;  2JNX A;  1YR5 A;  4P2Y B;  1AJ4 A;  1NSH A;  1A03 A;  1AUI B;  1QX7 A;  3TS5 C;  1CFD A;  1KK8 B;  1AHR A;  2R2I A;  2L98 A;  4OCI A;  5BPJ A;  2BKH B;  3A8R A;  2KBI A;  2JXL A;  1MUX A;  2Y1N A;  3WHT B;  1NPQ A;  1CFC A;  1AJ5 A;  3BUX B;  1UP5 A;  2EC6 B;  1JFK A;  1TCO B;  1KCY A;  1SNL A;  2BCA A;  2KOT A;  1EH2 A;  1B4C A;  4MLW A;  4DUQ A;  4CLN A;  3JVT C;  2LAN A;  5DKR A;  4QJ4 B;  2F3Z A;  1SBJ A;  2O5G A;  1FBV A;  1DJX A;  1YVL A;  1RTP 1;  2KBM A;  2LHL A;  4ETO A;  3AKA A;  3D0Y B;  1C7V A;  2KAX A;  4QJ3 B;  2CBL A;  3E3R A;  5J3X A;  1DMO A;  3EVU A;  2JNF A;  1D1O A;  2L0P A;  2ZFD A;  2M7L A;  1DJW A;  2F33 A;  2KGB C;  1OQP A;  2WCF A;  5JOL A;  1JC2 A;  1HT9 A;  2JQ6 A;  1DGV A;  1R2U A;  2M8U A;  1CKK A;  3H4S E;  4CFR A;  1Q80 A;  1CDP A;  4USL A;  3LK1 A;  1ALV A;  2M3W A;  4F0Z B;  3AKB A;  4YRU A;  1B8L A;  2TN4 A;  1F4Q A;  2OTG C;  1CM1 A;  1SL8 A;  1XA5 A;  2NCO A;  5CSJ A;  2LVK A;  3VRN A;  4A4B A;  4UPG A;  5I2Q A;  4YGB B;  1JF0 A;  1QVI Y;  4MBE A;  3WXA A;  1BG1 A;  2BL0 B;  1YUS A;  4I5K A;  2MJW B;  1SRA A;  1S3P A;  3KEV A;  1HQV A;  2JWW A;  1OMD A;  3EK7 A;  3KF9 A;  2HET A;  4OV2 A;  1KWO C;  1K95 A;  1QTX A;  5ER5 A;  2I94 A;  1B7T Y;  2M1U A;  2BE4 A;  4DRW A;  2JC2 A;  1MHO A;  3BOW B;  1CLL A;  1IJ5 A;  2K7B A;  1YRT B;  2CNP A;  4U8D A;  1V1G A;  2GV5 A;  4PE7 A;  2AAO A;  4ZCU A;  4IL1 A;  2PAS A;  3GOF A;  2JXC A;  3KO0 A;  3SG4 A;  2D8N A;  4YGD B;  2ISD A;  3TDU A;  3O2P A;  2G9B A;  4FQO A;  4HSZ A;  2K0J A;  1H4B A;  5AXI A;  2LM5 A;  4JQ0 D;  3DVJ A;  3OHM B;  5D7F A;  1G4Y R;  3K21 A;  1TN4 A;  1PK0 D;  2LLU A;  3JVT B;  2MLF C;  3PSR A;  3MSE B;  5B8I B;  1KQM C;  3BUW B;  2KAV A;  3DVK A;  3TDZ A;  1V1F A;  2MAZ A;  1B9A A;  1F4O A;  1UHJ A;  1L2O B;  1QIW A;  1JF2 A;  4ICB A;  3SG2 A;  4C0J A;  4I5J A;  1F70 A;  2JUL A;  1SR6 C;  2LC5 A;  3PAL A;  1BOC A;  1C07 A;  4FTG A;  3NSK A;  4HRE E;  4GPL B;  4C0L A;  2L51 A;  2WC8 A;  1M63 B;  5FYX A;  2HQW A;  3NXA A;  4PE0 A;  1YUR A;  5K89 A;  5GQQ C;  3CGA A;  2LP2 A;  5IBW A;  1K93 D;  3C1V A;  1NCY A;  1YTZ C;  3PAT A;  3VRO A;  1IKU A;  1A2X A;  2L5X B;  1XO5 A;  1S5G Y;  2K2F A;  1BR4 B;  5TNC A;  1IQ3 A;  4PCW A;  5AER A;  4HRG A;  5HYD A;  1SR6 B;  1BJF A;  2KSP A;  1SYM A;  4WRI A;  1EJ3 A;  1N0Y A;  1MXE A;  1NYA A;  1UUS A;  2IS9 A;  1JUO A;  2OS8 C;  2PAL A;  3BOW A;  1CFP A;  4Q04 A;  1DJY A;  3OB2 B;  1XK4 A;  1M46 A;  3ICB A;  4JWQ A;  1YX7 A;  1CDM A;  1DGU A;  1QX5 B;  2CTN A;  1XK4 C;  2FCE A;  4DS7 A;  1PSR A;  1RFJ A;  2MLE C;  1KFX L;  3HX4 A;  3DF0 B;  2JU0 A;  3BUO B;  3FWB A;  4MEW A;  1BLQ A;  2KYF A;  1XFW O;  4GAO A;  2NZ0 A;  1DVI A;  1S6C A;  2LMU A;  1J7O A;  1PAL A;  1IH0 A;  2BKI B;  2H61 C;  2FOT A;  1NX3 A;  1OMR A;  2WCB A;  4GGN A;  3BXK A;  1SPY A;  4PE4 A;  1TNP A;  2K7O A;  1NWD A;  4MSP A;  1KFU S;  3VRQ A;  2ZNE A;  5HKY A;  1PSB A;  1N2D A;  4GBA A;  3TZ1 A;  2K2A A;  2NCP A;  1GJY A;  3O6B A;  2V53 A;  1A75 A;  1SL7 A;  2Y1M A;  1UHI A;  4CPV A;  1DJG A;  1ZMZ A;  1G33 A;  5D69 A;  1WLZ A;  2HQ8 A;  1KFU L;  1XFY O;  3PM8 A;  4R1E A;  3VGO A;  3VRP A;  2NLN A;  1Y1U A;  3AAK A;  1PRW A;  3O4Y A;  1KWO B;  2KI4 C;  2EHB A;  1RWY A;  2L4H A;  1NCX A;  1CDN A;  5F6T A;  2LMV A;  2NXQ A;  2KFG A;  1QVI Z;  1CM4 A;  1QLS A;  3CLN A;  5AEQ A;  4OVN F;  1IWQ A;  3DVE A;  1CTR A;  1UHN A;  1WLM A;  3EVV A;  1OOJ A;  1SKT A;  4PDZ A;  1FI5 A;  2L4I A;  3CZT X;  3A4U B;  4MZL A;  1NX0 A;  3WHU B;  1K94 A;  2WCE A;  5DKN A;  1VRK A;  1J55 A;  2BE6 A;  1N65 A;  1LA3 A;  5CSI A;  1M31 A;  2ZRT A;  5PAL A;  1E8A A;  2JPT A;  2O60 A;  3PFV A;  1M39 A;  1BR1 B;  1KQV A;  2BCX A;  1M45 A;  3CR4 X;  5DKQ A;  1XFZ O;  5HLO A;  1NUB A;  2M49 B;  1L2O C;  1XFU O;  3DVM A;  1BOD A;  4GUK A;  1K96 A;  1TNW A;  2LVV A;  1UUR A;  3ZNI A;  4YGE B;  2KQY A;  5JJG A;  2LVJ A;  4A4C A;  1AK8 A;  3JTD B;  2JTT A;  1ZFS A;  1GGW A;  5HKW A;  1AVS A;  2DOQ A;  5CPV A;  1NIW A;  1PUL A;  1JSA A;  4PE1 A;  1NP8 A;  1SCM B;  2E6W A;  2LE9 B;  4N1G A;  5G08 A;  4XYN A;  2LLS A;  2WOR A;  1CDL A;  2A4J A;  1MQ1 A;  1J7R A;  1KK7 Y;  2JZI A;  1QXP A;  2KQ6 A;  2COL B;  1YRU B;  3BYA A;  4NQG A;  1PVB A;  3OX5 A;  2M29 A;  3IQQ A;  4PHJ A;  2MBX A;  4D1E A;  3CWG A;  1ZAC A;  3TS5 B;  2F2O A;  1PVA A;  3JTD C;  3KHE A;  3RM1 A;  4AOM A;  4CID A;  1QV1 A;  4QJ5 B;  3I5I B;  1CFF A;  2VRG A;  1WDC C;  1RJV A;  4YBH B;  3PN7 C;  3BUM B;  4MN0 A;  1GQM A;  2F8P A;  5AFP A;  1EXR A;  1U5I A;  2EGD A;  4TNC A;  1SL9 A;  1TCF A;  2MHH A;  1QAS A;  3QRX A;  2KDH A;  2FJU B;  2Y4Q A;  1SK6 D;  1TNX A;  1ODB A;  1NX2 A;  2H61 A;  4MZK A;  1UWO A;  1R6P A;  2CXJ A;  1BU3 A;  4CFQ A;  1S6I A;  3EKH A;  5ER4 X;  1KK8 C;  1QJT A;  1YUT A;  4BY5 A;  4I5N B;  3EK4 A;  3VRR A;  2F2P A;  4GGF A;  4MZJ A;  3DD4 A;  1RRO A;  3CR5 X;  1H8B A;  1TRF A;  4JPZ B;  2JTZ A;  1WRZ A;  1YVH A;  1K8U A;  4L9M A;  1YX8 A;  1OE9 B;  5HLV A;  2WOS A;  1MWN A;  4PAL A;  1LIN A;  2LMT A;  1XVJ A;  3GK1 A;  1MF8 B;  5HKZ A;  1F8H A;  1K9K A;  4E68 A;  1IGV A;  1RK9 A;  2H2K A;  2LAP A;  3PLF B;  2BBM A;  2LLT A;  3CTN A;  3FIA A;  1Y1A A;  2SAS A;  1BT6 A;  3I5I C;  1QX2 A;  1EG3 A;  3NSI A;  1C7W A;  3FWC A;  4PHK A;  1S36 A;  3WNX B;  4HRH A;  2LUX A;  2JT8 A;  2M0R A;  3ZWH A;  5KU1 A;  2K7D A;  2HPS A;  2LHI A;  1SCV A;  1Y1X A;  2OS8 B;  1BMO A;  4ORA B;  4MRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...