5HLVA

Crystal structure of calcium and zinc-bound human s100a8 in space group p212121
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
89
structure length
89
Chain Sequence
ALTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Protein S100-A8
publication title Crystal structure of human S100A8 in complex with zinc and calcium.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 89
sequence length 89
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5hlvA00
3DF0B 1IH0A 1ALWA 4U8DA 1X02A 1RECA 1UHKA 3KF9A 1NP8A 3TZ1A 4AQJA 1CMGA 1FF1A 3A4UB 2NXQA 4IL1A 4P2YB 2H61C 2Q91A 2LVKA 2LUCA 2PSRA 3EVVA 1IJ6A 2M97A 1NIWA 3TS5C 3K21A 1SK6D 2LUXA 4CFRA 1Y1UA 1S6CA 1AJ5A 1QVIZ 3VRQA 1FPWA 3I5GB 2AUCA 3CR4X 3VRRA 5I2QA 1YRUB 4CFQA 2HF5A 4WRIA 1LA3A 3PFVA 2CXJA 3OX5A 1CB1A 4PE1A 1EH2A 1QV1A 4JPZB 2ZFDA 3O4YA 1K93D 1NX1A 4PE7A 1B8LA 1K9KA 3FS7A 4WQ3A 5JJGA 1IG5A 1CFCA 1SBJA 4C0JA 2LMTA 1YVLA 1RJVA 2LLUA 1RROA 1N65A 2BKIB 2PALA 1A2XA 1QASA 1U5IB 2BCAA 3I5GC 4DUQA 2KGRA 3EK8A 1A75A 1ZMZA 2KBIA 4N1GA 1SW8A 2KSPA 3OB2B 2LC5A 3WHTB 2GGZA 3NSOA 1DGUA 2MAZA 5FYXA 5B8IB 2Y1MA 3PM8A 4OR9B 4MVFA 4N5XA 4R1EA 3RM1A 1PSRA 1IGVA 3BUNB 2AAOA 3KHEA 4PHNA 1L7ZA 1Y1AA 4YRUA 2KFHA 1ODBA 3QRXA 1AUIB 1K90D 2LANA 2L98A 4DS7A 1M63B 4L9MA 1SR6B 4PHJA 4QJ4B 5DKRA 4UPGA 1CFFA 2F8PA 2QACA 1OZOA 4ZCVA 1B1GA 1TRFA 3NSIA 1UWOA 1SYMA 2MLFC 5HLOA 1JWDA 1B9AA 2EGDA 2WCBA 3SG3A 2WCFA 2EHBA 1TNWA 1FI5A 2M1KB 1DJYA 4N1FA 1DJGA 1XFZO 3SG5A 1B47A 1DF0A 4MSPA 2LCPA 4MZLA 2Y4QA 2Y1NA 2BE4A 2M9GA 4MN0A 2L2EA 1CTRA 1PVAA 5GQQC 1NWDA 2EC6C 2KI6C 4ORCB 1J7PA 1KFXS 2JZIA 3NXAA 1RWYA 2V53A 4BY4A 3EKHA 1QVIY 1WRLA 5G08A 1XFYO 3VGOA 1TCOB 5HKYA 2JWWA 1S26D 2KAYA 4FTGA 4DRWA 1EL4A 1M46A 2LMVA 4DCKA 2I18A 1KFUL 3BQ3A 2WNDA 4CIDA 4YGEB 1S6IA 3DVJA 1GGWA 2OS8B 2ISDA 2PRUA 4PE4A 3AKAA 2KDHA 5I8NA 1BOCA 1KK7Z 4QJ5B 2JNFA 1OMVA 1DTLA 1NSHA 2F2PA 1W7IB 1KWOB 2JNXA 2O5GA 1WDCB 2ZN9A 5BPJA 1AK8A 1J7RA 1CM4A 1CLMA 1G4YR 2KHNA 1YTZC 5AEQA 3CTNA 2BKHB 1CDPA 4NDCA 3JVTB 5ER5A 1TNQA 2BBNA 2L50A 4I5NB 3FWBA 4C0LA 1LA0A 2H2KA 2ZN8A 3PN7B 4YI8A 1QIVA 1J1EA 3AAJA 2OS8C 1QS7A 1FI6A 4GPLB 2NCOA 3SG6A 2JXCA 4MZKA 1QX7A 4M2QA 4GGNA 4BY5A 4AQIA 1JBAA 4ORAB 1NUBA 3AKBA 5F6TA 1KWOC 2A4JA 1WDCC 4I5LB 2K7CA 1AP4A 2I94A 1Y6WA 2CT9A 1BG1A 3EKJA 1EJ3A 3SG2A 1C07A 1F8HA 5DKQA 2NLNA 3JVTC 1CKKA 5CPVA 3NSLA 1UP5A 1XK4C 1KCYA 3PN7C 3PLFB 2JT3A 3HCMA 1SMGA 2ZKMX 3ICBA 2F33A 2JC2A 2KFFA 1XYDA 1XFUO 2K7BA 3C1VA 3EVRA 1J1DA 2CTNA 4YBHB 1YX7A 1BODA 1IQ3A 1B8RA 1SRAA 1CLBA 1MHOA 2L5XB 2ZNEA 1JSAA 3SJSA 1KSOA 4OV2A 1PULA 1YVHA 1SCMB 3WHUB 3I5IB 1SCVA 4GGFA 1K8UA 2KQYA 4PHKA 2JOJA 1OMDA 4YGCB 2CCMA 1PRWA 1GQMA 1OMRA 1WLZA 3LL8B 2HQWA 1DJZA 2F3ZA 1R6PA 2G2BA 3ZWHA 5ER4X 1M31A 1SL8A 1NX3A 1C7WA 1MR8A 2BECA 2KYCA 3HX4A 4XJKB 1SCMC 3I5IC 2LHLA 2OPOA 2RGIA 1ZACA 3D0YA 1S3PA 3A8RA 1H8BA 2HETA 1F4OA 4HRGA 2K61A 3TUYB 1TCFA 2M7LA 1DJXA 2EC6B 1UURA 3BOWA 1KK8B 2H61A 3AAKA 4YGDB 1OSAA 3SIBA 2WCEA 1CLLA 1NPQA 4MRXA 1Q80A 2I2RE 2E6WA 2KYFA 1MF8B 2R2IA 2KOTA 1CFPA 1DJWA 4I5JA 2FJUB 1IQ5A 1BF5A 1CDMA 2WORA 1CDLA 1OE9B 1UUSA 3IQQA 1PSBA 3IF7A 3DF0A 4OKHA 3BUXB 2LVIA 2M7NA 4ETOA 3TUYC 2MHHA 2SCPA 4ORBB 2LLSA 1D1OA 1DJIA 4HREE 2JTTA 2JPTA 1KK8C 1N0YA 3DVMA 5K89A 2FCDA 1BMOA 3FWCA 1C7VA 1PVBA 2HPSA 1QV0A 2M8UA 4PCWA 3CLNA 5CSJA 1JC2A 1KFUS 2F3YA 1SKTA 2G9BA 1DGVA 1JFKA 1OOJA 3DVEA 4QJ3B 5J3XA 1OQPA 2BBMA 3IQOA 1A4PA 2M3WA 1M39A 2LMUA 4JQ0D 3TDIA 5AFPA 1RTP1 1AVSA 2AMIA 2MBXA 3KPXA 3I5HB 1IWQA 2L4IA 2MLEC 5I2OA 4PDZA 1Y1XA 4YGAA 2GGMA 2MRDA 5I2LA 4I5KA 4XYNA 1M45A 2SASA 1GJYA 1U5IA 2JRFA 1WRKA 3SIAA 4MEWA 3CWGA 2K2AA 3CR5X 2KBMA 1K9UA 4CPVA 2K2FA 1TNXA 1B4CA 1SY9A 4P5OE 2KNEA 3I5FC 1LINA 2BE6A 2JXLA 1NCYA 3I5HC 2CNPA 1XA5A 1UHIA 2ZRTA 2MJWB 1L2OC 3LK1A 1S36A 5KU1A 2KQ6A 1BJFA 5HLVA 1TNPA 1JF0A 2VRGA 4ICBA 2LAPA 1XFXO 3BXKA 1G8IA 3KEVA 3SG7A 1J7OA 5AERA 1IJ5A 1KQMB 2LV7A 2QPTA 4YI9A 3H4SE 1NX2A 1PK0D 3DVKA 1CFDA 2LP2A 1RK9A 1A29A 3VROA 1UHNA 1HQVA 3OHMB 3PATA 3MSEB 1F71A 5TNCA 2Y5IA 1XFWO 1NCZA 5HKZA 1Y0VH 4NDDA 1J55A 3OB1B 1DF0B 1JFJA 1S5GZ 3BUWB 2JT8A 5PALA 2K8MB 1VRKA 1N2DA 3O2PA 4ZCUA 2F2OA 3BUMB 5AANA 2LM5A 4A4BA 1K9PA 3D10A 1QXPA 1LXFC 2KFGA 3EVUA 5CSFA 5HKWA 1KQMC 1QJTA 1MWNA 1QTXA 2BCBA 4HRHA 1CMFA 1QLSA 1TTXA 1YUUA 2JU0A 5D69A 4GFTA 3VRPA 3PALA 1DT7B 2BL0B 1CNPA 4F0ZB 2M49B 2FOTA 1SPYA 4GAOA 4OCIA 3PSRA 2O60A 2NCPA 4MBEA 5CSIA 1UHJA 2K0JA 1BT6A 4PALA 1CM1A 1AJ4A 3VRNA 1F55A 1KK7Y 3TDUA 1TN4A 1KSMA 1YUSA 3LCPC 2KI6D 3O78A 2JQ6A 2E30A 4MZJA 4WQ2A 1BR1B 2BL0C 1E8AA 2I7AA 3LLEA 1BU3A 3WXAA 1GGZA 1B7TZ 2K7OA 2D8NA 1YUTA 1JF2A 1DMOA 2TN4A 3O6BA 1QX5B 1PALA 5KSZA 4HSZA 1K96A 2B1UA 2JULA 1EG3A 1XK4A 3NSKA 1BR4B 4NQGA 1BLQA 3M0WA 4MLWA 3GOFA 4A4CA 1ALVA 2LHIA 4Q04A 2P6BB 2LNKA 1ZFSA 1XFVO 1YURA 3SG4A 2LLTA 2LP3A 2ZNDA 3GK1A 1V1GA 1MXLC 3ZNIA 1NCXA 3CS1A 4TNCA 4FQOA 2DOQA 1EXRA 1WRZA 1SL7A 2IS9A 2OTGB 1RFJA 1SL9A 2PVBA 4GBAA 5AXIA 1MUXA 5IBWA 4JWQA 2KAVA 1F54A 1QX2A 1H4BA 2COLB 1XVJA 4PHMA 1FBVA 2KI4B 1AHRA 3EK4A 2JT0A 1DJHA 1QATA 1WLMA 1F70A 3WNXB 1MQ1A 4PE0A 1S5GY 4OVNF 1NYAA 2WOSA 4AOMA 1QIWA 1YX8A 1WY9A 2LE9B 1V1FA 1LVCD 1S6JA 3DD4A 1CDNA 1SR6C 3I5FB 1HT9A 2L0PA 4USLA 1K94A 2OTGC 1XO5A 2MA2A 1K95A 2L4HA 3JTDB 1MXEA 1J7QA 4E68A 1TOPA 1L2OB 3CGAA 2KAXA 4GUKA 2M29A 4GNKB 5HYDA 1OZSA 2M0RA 1ZOTB 2BCXA 2KI4C 3CZTX 1A75B 4DIRA 1K2HA 2CBLA 1KFXL 3CR2A 2LVVA 4MRYA 5JOLA 3GK4X 4D1EA 2NZ0A 2L51A 1EG4A 1YR5A 1LKJA 4GGFC 4NDBA 2ZRSA 1A03A 3D0YB 1S1EA 2JTZA 2M1UA 3BYAA 5DKNA 3JTDC 3TDZA 2K7DA 4XJKA 2HQ8A 3E3RA 5KTYA 1FW4A 2Q4UA 3BUOB 1TIZA 3OX6A 1IKUA 1SNLA 3FIAA 1KQVA 5CSNA 1B7TY 3KO0A 2PASA 2PMYA 2WC8A 1NX0A 4CLNA 4M2OA 5D7FA 1DVIA 1IRJA 2FCEA 1F4QA 3BOWB 3RLZA 3OP0A 2LVJA 4M2PA 1UHHA 1G33A 3LK0A 1W7JB 1ZUZA 3TS5B 3F45A 4C0KA 2KGBC 1YRTB 1QLKA 1B8CA 1JUOA 3EK7A 2GV5A 1R2UA 3GK2A 4YGBB
chains in the Genus database with same CATH superfamily
4OZDA 3DF0B 1IH0A 1ALWA 4U8DA 1X02A 1RECA 1UHKA 3KF9A 1NP8A 3TZ1A 4AQJA 1CMGA 1FF1A 3A4UB 2NXQA 4IL1A 4P2YB 2H61C 2Q91A 2LVKA 2LUCA 2PSRA 3EVVA 1IJ6A 2M97A 1DQEA 1NIWA 3PJIA 3TS5C 3K21A 1SK6D 2LUXA 4CFRA 1Y1UA 1S6CA 1AJ5A 1QVIZ 3VRQA 1FPWA 2KLDA 3I5GB 2AUCA 3CR4X 4IJ7A 3VRRA 2PYQA 5I2QA 1YRUB 3B6XA 4CFQA 2HF5A 4WRIA 1LA3A 3PFVA 2CXJA 3OX5A 3RZSA 1CB1A 4PE1A 1EH2A 1QV1A 3D74A 2L2CA 4JPZB 2ZFDA 3O4YA 1K93D 3D73A 1NX1A 4PE7A 1B8LA 1K9KA 3FS7A 4WQ3A 5JJGA 1IG5A 1CFCA 1SBJA 4C0JA 2LMTA 1YVLA 3R1VA 1RJVA 2LLUA 1RROA 1N65A 2BKIB 2PALA 1A2XA 1QASA 1U5IB 2BCAA 3I5GC 4DUQA 2KGRA 3EK8A 1A75A 1ZMZA 2KBIA 4N1GA 1SW8A 2KSPA 3OB2B 2LC5A 3WHTB 2GGZA 3NSOA 1DGUA 2MAZA 5FYXA 1C3ZA 5B8IB 2Y1MA 3PM8A 4OR9B 4MVFA 4N5XA 4R1EA 4PT1A 2QEVA 3RM1A 1PSRA 1IGVA 3BUNB 4JD9A 5EL2A 2AAOA 3KHEA 4PHNA 1L7ZA 1Y1AA 4YRUA 2KFHA 1ODBA 3QRXA 1AUIB 1K90D 2LANA 2L98A 4DS7A 1M63B 4L9MA 1SR6B 4PHJA 4QJ4B 5DKRA 3IVTA 4UPGA 1CFFA 2F8PA 1LS8A 2QACA 2BNXA 1OZOA 4ZCVA 1B1GA 1TRFA 3NSIA 1UWOA 3CYZA 1SYMA 2MLFC 5HLOA 1JWDA 1B9AA 5FI2A 3PM2A 2EGDA 2WCBA 3SG3A 2WCFA 2EHBA 1TNWA 1FI5A 2M1KB 1DJYA 4N1FA 1DJGA 1XFZO 3NHIA 3SG5A 1B47A 1DF0A 4MSPA 2LCPA 3R72A 4MZLA 2Y4QA 2Y1NA 2BE4A 2M9GA 4MN0A 2L2EA 1CTRA 1PVAA 5GQQC 1NWDA 2EC6C 2KI6C 3D77A 4ORCB 3S0AA 1KFXS 2JZIA 3NXAA 1J7PA 1RWYA 2V53A 4BY4A 3EKHA 1QVIY 1WRLA 5G08A 4FQTA 1XFYO 3VGOA 1TCOB 5HKYA 2JWWA 2WC5A 1S26D 2KAYA 4FTGA 4DRWA 1EL4A 1M46A 2LMVA 3DXLA 4DCKA 2I18A 1KFUL 3BQ3A 2WNDA 4CIDA 1XFRA 4YGEB 1S6IA 3DVJA 4INWA 2YGUA 1GGWA 2OS8B 2ISDA 2PRUA 4PE4A 3AKAA 2KDHA 5I8NA 1BOCA 1KK7Z 4QJ5B 2JNFA 1OMVA 3S0EA 1DTLA 1NSHA 2F2PA 1W7IB 1KWOB 2JNXA 2O5GA 1WDCB 2ZN9A 5BPJA 1AK8A 5D3OA 1J7RA 1CM4A 1CLMA 1G4YR 2WCLA 2KHNA 1YTZC 5AEQA 3CTNA 2BKHB 1CDPA 4NDCA 3JVTB 5ER5A 1OOGA 1TNQA 2BBNA 2L50A 4I5NB 3FWBA 3B7AA 4C0LA 1LA0A 2H2KA 2ZN8A 3PN7B 4YI8A 1QIVA 2QEOA 1J1EA 3AAJA 2OS8C 1QS7A 3BFHA 3R1PA 2NCOA 4GPLB 1FI6A 3SG6A 2JXCA 4MZKA 1QX7A 1DEKA 4M2QA 4GGNA 4BY5A 4AQIA 1JBAA 4ORAB 1NUBA 3AKBA 5F6TA 1KWOC 2A4JA 1WDCC 2WC6A 4I5LB 3SS4A 3FE6A 2K7CA 2WCMA 1AP4A 2I94A 3QMEA 1Y6WA 2CT9A 1BG1A 3EKJA 1EJ3A 3SG2A 1C07A 1F8HA 5DKQA 2NLNA 3JVTC 3B88A 1CKKA 2QDIA 3CABA 5CPVA 3N7HA 3NSLA 1UP5A 1XK4C 1KCYA 3PN7C 3PLFB 2JT3A 3HCMA 1SMGA 2ZKMX 3ICBA 2F33A 2JC2A 2KFFA 1XYDA 1XFUO 2K7BA 3CDNA 5FI7A 3C1VA 3EVRA 1J1DA 2CTNA 4YBHB 1YX7A 1BODA 1IQ3A 1B8RA 1SRAA 2KLEA 1CLBA 1MHOA 2L5XB 2ZNEA 3UNWA 1JSAA 3SJSA 1KSOA 1GM0A 1ORGA 4OV2A 1PULA 1YVHA 1SCMB 3WHUB 3I5IB 1SCVA 4GGFA 1K8UA 2KQYA 3S0FA 4PHKA 2JOJA 1OMDA 4YGCB 2CCMA 2KPHA 1PRWA 1GQMA 1OMRA 1WLZA 3LL8B 2HQWA 3S0GA 1DJZA 2F3ZA 1R6PA 1TWOA 2G2BA 3ZWHA 5ER4X 1M31A 1SL8A 1NX3A 1C7WA 1MR8A 2BECA 2KYCA 3HX4A 4XJKB 1Z2CB 1SCMC 3I5IC 2LHLA 2OPOA 2RGIA 3R1OA 1ZACA 3O4XA 3D0YA 1S3PA 2WCJA 3A8RA 1QWVA 2JPOA 3CZ1A 1C3YA 2HETA 1F4OA 1H8BA 3B86A 4HRGA 1T14A 2K61A 3TUYB 1TCFA 3FE8A 2M7LA 1DJXA 2EC6B 1UURA 3BOWA 5FI6A 1KK8B 2H61A 3AAKA 4YGDB 1OSAA 3SIBA 2WCEA 1CLLA 1NPQA 4MRXA 1Q80A 2I2RE 2E6WA 2KYFA 1MF8B 2R2IA 2KOTA 3NGVA 1CFPA 1DJWA 3SS3A 1IIOA 3EG5B 4I5JA 2FJUB 1IQ5A 1BF5A 1CDMA 2WORA 1CDLA 1OE9B 1UUSA 3IQQA 1PSBA 3IF7A 3DF0A 4OKHA 3BUXB 2LVIA 2M7NA 4ETOA 3TUYC 2MHHA 2SCPA 4ORBB 2LLSA 1D1OA 3CZ0A 1DJIA 4HREE 2JTTA 2JPTA 1OW4A 1KK8C 1N0YA 3DVMA 5K89A 2FCDA 1BMOA 3FWCA 1C7VA 1PVBA 2HPSA 1QV0A 2M8UA 4PCWA 3CLNA 5CSJA 1JC2A 1KFUS 2F3YA 1SKTA 2G9BA 2H8VA 1DGVA 1JFKA 3BJHA 1OOJA 3DVEA 4QJ3B 5J3XA 1OQPA 2BBMA 3IQOA 1A4PA 2M3WA 1M39A 2LMUA 2K60A 4JQ0D 3TDIA 1RTP1 5AFPA 1AVSA 2AMIA 2MBXA 3KPXA 3I5HB 1IWQA 2L4IA 2MLEC 3DY9A 5I2OA 4PDZA 1Y1XA 4YGAA 2GGMA 2MRDA 5I2LA 4I5KA 1OOFA 4XYNA 1M45A 2SASA 1GJYA 1U5IA 2JRFA 1WRKA 3SIAA 4MEWA 3CWGA 2K2AA 3CR5X 2KBMA 1TUZA 1K9UA 4CPVA 2K2FA 1TNXA 1B4CA 1SY9A 4P5OE 2KNEA 3I5FC 1LINA 2BE6A 2JXLA 1NCYA 4F7FA 3I5HC 2CNPA 1XA5A 1UHIA 2WCKA 2ZRTA 2MJWB 1L2OC 3LK1A 1S36A 4JKTA 1DELA 5KU1A 2KQ6A 1BJFA 2QEHA 5HLVA 1TNPA 3K1EA 1JF0A 2VRGA 4ICBA 2LAPA 1XFXO 3BFAA 3SS5A 3BXKA 3VB1A 2GTEA 1G8IA 3KEVA 3SG7A 2FJYA 1J7OA 5AERA 1IJ5A 1KQMB 2LV7A 2QPTA 4YI9A 3H4SE 1NX2A 1PK0D 2QEBA 3DVKA 1CFDA 2LP2A 1RK9A 1A29A 3VROA 1DC1A 1UHNA 1HQVA 3OHMB 3PATA 3MSEB 1F71A 5TNCA 2Y5IA 1XFWO 1NCZA 5HKZA 1Y0VH 4NDDA 1J55A 3OB1B 1DF0B 1JFJA 1S5GZ 3BUWB 2JT8A 3CZ2A 2K8MB 2PQLA 1VRKA 5PALA 1N2DA 3B87A 5HL1A 3O2PA 4ZCUA 2F2OA 3BUMB 5AANA 2LM5A 4A4BA 1K9PA 3D10A 1QXPA 1LXFC 2KFGA 3EVUA 5CSFA 5HKWA 1KQMC 1QJTA 1P28A 1MWNA 1QTXA 2BCBA 4HRHA 1CMFA 1QLSA 1TTXA 1YUUA 2JU0A 5D69A 4GFTA 3VRPA 3PALA 1DT7B 2BL0B 1CNPA 3S0BA 3UO9A 4F0ZB 2M49B 2FOTA 1SPYA 4GAOA 4OCIA 2ERBA 3PSRA 2O60A 2NCPA 4MBEA 5CSIA 1UHJA 2K0JA 3V2LA 1BT6A 4PALA 1CM1A 1AJ4A 2L5YA 3VRNA 3OBVA 1KK7Y 1F55A 3TDUA 1TN4A 1KSMA 2P71A 1YUSA 3LCPC 2KI6D 3O78A 2JQ6A 2E30A 4MZJA 4INXA 4KYNA 4WQ2A 3OGNA 1BR1B 2BL0C 1E8AA 2I7AA 3LLEA 1BU3A 3NHTA 3WXAA 1GGZA 3Q8IA 1B7TZ 2K7OA 2D8NA 1OOIX 1YUTA 1JF2A 3D78A 1DMOA 2TN4A 3O6BA 1QX5B 1PALA 5KSZA 4HSZA 1K96A 2B1UA 2JULA 1EG3A 1XK4A 3NSKA 1BR4B 4NQGA 1BLQA 3M0WA 4MLWA 3GOFA 4A4CA 1ALVA 2LHIA 4Q04A 2P6BB 2LNKA 1ZFSA 1XFVO 1YURA 3SG4A 2LLTA 3DZTA 2LP3A 2WCHA 2ZNDA 3GK1A 1Z4HA 1V1GA 1MXLC 5DICA 3ZNIA 1NCXA 3CS1A 4TNCA 4FQOA 2DOQA 1EXRA 1WRZA 1SL7A 2IS9A 2OTGB 1RFJA 1SL9A 2PVBA 4GBAA 5AXIA 1MUXA 5IBWA 4JWQA 2KAVA 1F54A 1QX2A 1H4BA 2COLB 1XVJA 4PHMA 1FBVA 2KI4B 1AHRA 3EK4A 2JT0A 1DJHA 1QATA 1SSEB 1WLMA 1F70A 3WNXB 3FE9A 1MQ1A 4PE0A 1S5GY 4OVNF 1NYAA 2BAPA 2WOSA 4AOMA 1QIWA 1YX8A 1WY9A 2LE9B 1V1FA 1LVCD 1S6JA 3DD4A 1CDNA 1SR6C 3I5FB 1HT9A 2L0PA 4USLA 1K94A 2OTGC 1XO5A 3BFBA 2MA2A 1K95A 2L4HA 3JTDB 1MXEA 3L4LA 1J7QA 4E68A 1TOPA 1L2OB 3CGAA 2KAXA 4GUKA 2M29A 4GNKB 5HYDA 1OZSA 2M0RA 1ZOTB 2BCXA 2KI4C 3CZTX 1A75B 4DIRA 1TUJA 1K2HA 3L4AA 2CBLA 1KFXL 3D75A 3CR2A 2LVVA 4MRYA 3GK2A 5JOLA 3GK4X 2P70A 4D1EA 2NZ0A 2L51A 1EG4A 1YR5A 1LKJA 4GGFC 4NDBA 2ZRSA 1A03A 3D0YB 1S1EA 2JTZA 2M1UA 3BYAA 5DKNA 3JTDC 3TDZA 2K7DA 4XJKA 2HQ8A 3E3RA 5KTYA 1FW4A 2Q4UA 3BUOB 1TIZA 3OX6A 1IKUA 1SNLA 3DYEA 3FIAA 1KQVA 5CSNA 1B7TY 3KO0A 2PASA 2PMYA 2WC8A 1NX0A 1W9ZA 4M2OA 1OOHA 4CLNA 5D7FA 1DVIA 1IRJA 2FCEA 1F4QA 3BOWB 3RLZA 3OP0A 2LVJA 4M2PA 1UHHA 1G33A 3LK0A 1W7JB 1ZUZA 3TS5B 3F45A 4C0KA 2KGBC 1YRTB 1QLKA 1B8CA 3S0DA 1JUOA 3EK7A 2GV5A 5I94A 1R2UA 3D76A 3L47A 4YGBB
chains in the Genus database with same CATH topology
3DF0B 1IH0A 1ALWA 4U8DA 1X02A 1RECA 1UHKA 3KF9A 1NP8A 3TZ1A 4AQJA 1CMGA 1FF1A 3A4UB 2NXQA 4IL1A 4P2YB 2H61C 2Q91A 2LVKA 2LUCA 2PSRA 3EVVA 1IJ6A 2M97A 1NIWA 3TS5C 3K21A 1SK6D 2LUXA 4CFRA 1Y1UA 1S6CA 1AJ5A 1QVIZ 3VRQA 1FPWA 3I5GB 2AUCA 3CR4X 3VRRA 5I2QA 1YRUB 4CFQA 2HF5A 4WRIA 1LA3A 3PFVA 2CXJA 3OX5A 1CB1A 4PE1A 1EH2A 1QV1A 4JPZB 2ZFDA 3O4YA 1K93D 1NX1A 4PE7A 1B8LA 1K9KA 3FS7A 4WQ3A 5JJGA 1IG5A 1CFCA 1SBJA 4C0JA 2LMTA 1YVLA 1RJVA 2LLUA 1RROA 1N65A 2BKIB 2PALA 1A2XA 1QASA 1U5IB 2BCAA 3I5GC 4DUQA 2KGRA 3EK8A 1A75A 1ZMZA 2KBIA 4N1GA 1SW8A 2KSPA 3OB2B 2LC5A 3WHTB 2GGZA 3NSOA 1DGUA 2MAZA 5FYXA 5B8IB 2Y1MA 3PM8A 4OR9B 4MVFA 4N5XA 4R1EA 3RM1A 1PSRA 1IGVA 3BUNB 2AAOA 3KHEA 4PHNA 1L7ZA 1Y1AA 4YRUA 2KFHA 1ODBA 3QRXA 1AUIB 1K90D 2LANA 2L98A 4DS7A 1M63B 4L9MA 1SR6B 4PHJA 4QJ4B 5DKRA 4UPGA 1CFFA 2F8PA 2QACA 1OZOA 4ZCVA 1B1GA 1TRFA 3NSIA 1UWOA 1SYMA 2MLFC 5HLOA 1JWDA 1B9AA 2EGDA 2WCBA 3SG3A 2WCFA 2EHBA 1TNWA 1FI5A 2M1KB 1DJYA 4N1FA 1DJGA 1XFZO 3SG5A 1B47A 1DF0A 4MSPA 2LCPA 4MZLA 2Y4QA 2Y1NA 2BE4A 2M9GA 4MN0A 2L2EA 1CTRA 1PVAA 5GQQC 1NWDA 2EC6C 2KI6C 4ORCB 1J7PA 1KFXS 2JZIA 3NXAA 1RWYA 2V53A 4BY4A 3EKHA 1QVIY 1WRLA 5G08A 1XFYO 3VGOA 1TCOB 5HKYA 2JWWA 1S26D 2KAYA 4FTGA 4DRWA 1EL4A 1M46A 2LMVA 4DCKA 2I18A 1KFUL 3BQ3A 2WNDA 4CIDA 4YGEB 1S6IA 3DVJA 1GGWA 2OS8B 2ISDA 2PRUA 4PE4A 3AKAA 2KDHA 5I8NA 1BOCA 1KK7Z 4QJ5B 2JNFA 1OMVA 1DTLA 1NSHA 2F2PA 1W7IB 1KWOB 2JNXA 2O5GA 1WDCB 2ZN9A 5BPJA 1AK8A 1J7RA 1CM4A 1CLMA 1G4YR 2KHNA 1YTZC 5AEQA 3CTNA 2BKHB 1CDPA 4NDCA 3JVTB 5ER5A 1TNQA 2BBNA 2L50A 4I5NB 3FWBA 4C0LA 1LA0A 2H2KA 2ZN8A 3PN7B 4YI8A 1QIVA 1J1EA 3AAJA 2OS8C 1QS7A 1FI6A 4GPLB 2NCOA 3SG6A 2JXCA 4MZKA 1QX7A 4M2QA 4GGNA 4BY5A 4AQIA 1JBAA 4ORAB 1NUBA 3AKBA 5F6TA 1KWOC 2A4JA 1WDCC 4I5LB 2K7CA 1AP4A 2I94A 1Y6WA 2CT9A 1BG1A 3EKJA 1EJ3A 3SG2A 1C07A 1F8HA 5DKQA 2NLNA 3JVTC 1CKKA 5CPVA 3NSLA 1UP5A 1XK4C 1KCYA 3PN7C 3PLFB 2JT3A 3HCMA 1SMGA 2ZKMX 3ICBA 2F33A 2JC2A 2KFFA 1XYDA 1XFUO 2K7BA 3C1VA 3EVRA 1J1DA 2CTNA 4YBHB 1YX7A 1BODA 1IQ3A 1B8RA 1SRAA 1CLBA 1MHOA 2L5XB 2ZNEA 1JSAA 3SJSA 1KSOA 4OV2A 1PULA 1YVHA 1SCMB 3WHUB 3I5IB 1SCVA 4GGFA 1K8UA 2KQYA 4PHKA 2JOJA 1OMDA 4YGCB 2CCMA 1PRWA 1GQMA 1OMRA 1WLZA 3LL8B 2HQWA 1DJZA 2F3ZA 1R6PA 2G2BA 3ZWHA 5ER4X 1M31A 1SL8A 1NX3A 1C7WA 1MR8A 2BECA 2KYCA 3HX4A 4XJKB 1SCMC 3I5IC 2LHLA 2OPOA 2RGIA 1ZACA 3D0YA 1S3PA 3A8RA 1H8BA 2HETA 1F4OA 4HRGA 2K61A 3TUYB 1TCFA 2M7LA 1DJXA 2EC6B 1UURA 3BOWA 1KK8B 2H61A 3AAKA 4YGDB 1OSAA 3SIBA 2WCEA 1CLLA 1NPQA 4MRXA 1Q80A 2I2RE 2E6WA 2KYFA 1MF8B 2R2IA 2KOTA 1CFPA 1DJWA 4I5JA 2FJUB 1IQ5A 1BF5A 1CDMA 2WORA 1CDLA 1OE9B 1UUSA 3IQQA 1PSBA 3IF7A 3DF0A 4OKHA 3BUXB 2LVIA 2M7NA 4ETOA 3TUYC 2MHHA 2SCPA 4ORBB 2LLSA 1D1OA 1DJIA 4HREE 2JTTA 2JPTA 1KK8C 1N0YA 3DVMA 5K89A 2FCDA 1BMOA 3FWCA 1C7VA 1PVBA 2HPSA 1QV0A 2M8UA 4PCWA 3CLNA 5CSJA 1JC2A 1KFUS 2F3YA 1SKTA 2G9BA 1DGVA 1JFKA 1OOJA 3DVEA 4QJ3B 5J3XA 1OQPA 2BBMA 3IQOA 1A4PA 2M3WA 1M39A 2LMUA 4JQ0D 3TDIA 5AFPA 1RTP1 1AVSA 2AMIA 2MBXA 3KPXA 3I5HB 1IWQA 2L4IA 2MLEC 5I2OA 4PDZA 1Y1XA 4YGAA 2GGMA 2MRDA 5I2LA 4I5KA 4XYNA 1M45A 2SASA 1GJYA 1U5IA 2JRFA 1WRKA 3SIAA 4MEWA 3CWGA 2K2AA 3CR5X 2KBMA 1K9UA 4CPVA 2K2FA 1TNXA 1B4CA 1SY9A 4P5OE 2KNEA 3I5FC 1LINA 2BE6A 2JXLA 1NCYA 3I5HC 2CNPA 1XA5A 1UHIA 2ZRTA 2MJWB 1L2OC 3LK1A 1S36A 5KU1A 2KQ6A 1BJFA 5HLVA 1TNPA 1JF0A 2VRGA 4ICBA 2LAPA 1XFXO 3BXKA 1G8IA 3KEVA 3SG7A 1J7OA 5AERA 1IJ5A 1KQMB 2LV7A 2QPTA 4YI9A 3H4SE 1NX2A 1PK0D 3DVKA 1CFDA 2LP2A 1RK9A 1A29A 3VROA 1UHNA 1HQVA 3OHMB 3PATA 3MSEB 1F71A 5TNCA 2Y5IA 1XFWO 1NCZA 5HKZA 1Y0VH 4NDDA 1J55A 3OB1B 1DF0B 1JFJA 1S5GZ 3BUWB 2JT8A 5PALA 2K8MB 1VRKA 1N2DA 3O2PA 4ZCUA 2F2OA 3BUMB 5AANA 2LM5A 4A4BA 1K9PA 3D10A 1QXPA 1LXFC 2KFGA 3EVUA 5CSFA 5HKWA 1KQMC 1QJTA 1MWNA 1QTXA 2BCBA 4HRHA 1CMFA 1QLSA 1TTXA 1YUUA 2JU0A 5D69A 4GFTA 3VRPA 3PALA 1DT7B 2BL0B 1CNPA 4F0ZB 2M49B 2FOTA 1SPYA 4GAOA 4OCIA 3PSRA 2O60A 2NCPA 4MBEA 5CSIA 1UHJA 2K0JA 1BT6A 4PALA 1CM1A 1AJ4A 3VRNA 1F55A 1KK7Y 3TDUA 1TN4A 1KSMA 1YUSA 3LCPC 2KI6D 3O78A 2JQ6A 2E30A 4MZJA 4WQ2A 1BR1B 2BL0C 1E8AA 2I7AA 3LLEA 1BU3A 3WXAA 1GGZA 1B7TZ 2K7OA 2D8NA 1YUTA 1JF2A 1DMOA 2TN4A 3O6BA 1QX5B 1PALA 5KSZA 4HSZA 1K96A 2B1UA 2JULA 1EG3A 1XK4A 3NSKA 1BR4B 4NQGA 1BLQA 3M0WA 4MLWA 3GOFA 4A4CA 1ALVA 2LHIA 4Q04A 2P6BB 2LNKA 1ZFSA 1XFVO 1YURA 3SG4A 2LLTA 2LP3A 2ZNDA 3GK1A 1V1GA 1MXLC 3ZNIA 1NCXA 3CS1A 4TNCA 4FQOA 2DOQA 1EXRA 1WRZA 1SL7A 2IS9A 2OTGB 1RFJA 1SL9A 2PVBA 4GBAA 5AXIA 1MUXA 5IBWA 4JWQA 2KAVA 1F54A 1QX2A 1H4BA 2COLB 1XVJA 4PHMA 1FBVA 2KI4B 1AHRA 3EK4A 2JT0A 1DJHA 1QATA 1WLMA 1F70A 3WNXB 1MQ1A 4PE0A 1S5GY 4OVNF 1NYAA 2WOSA 4AOMA 1QIWA 1YX8A 1WY9A 2LE9B 1V1FA 1LVCD 1S6JA 3DD4A 1CDNA 1SR6C 3I5FB 1HT9A 2L0PA 4USLA 1K94A 2OTGC 1XO5A 2MA2A 1K95A 2L4HA 3JTDB 1MXEA 1J7QA 4E68A 1TOPA 1L2OB 3CGAA 2KAXA 4GUKA 2M29A 4GNKB 5HYDA 1OZSA 2M0RA 1ZOTB 2BCXA 2KI4C 3CZTX 1A75B 4DIRA 1K2HA 2CBLA 1KFXL 3CR2A 2LVVA 4MRYA 5JOLA 3GK4X 4D1EA 2NZ0A 2L51A 1EG4A 1YR5A 1LKJA 4GGFC 4NDBA 2ZRSA 1A03A 3D0YB 1S1EA 2JTZA 2M1UA 3BYAA 5DKNA 3JTDC 3TDZA 2K7DA 4XJKA 2HQ8A 3E3RA 5KTYA 1FW4A 2Q4UA 3BUOB 1TIZA 3OX6A 1IKUA 1SNLA 3FIAA 1KQVA 5CSNA 1B7TY 3KO0A 2PASA 2PMYA 2WC8A 1NX0A 4CLNA 4M2OA 5D7FA 1DVIA 1IRJA 2FCEA 1F4QA 3BOWB 3RLZA 3OP0A 2LVJA 4M2PA 1UHHA 1G33A 3LK0A 1W7JB 1ZUZA 3TS5B 3F45A 4C0KA 2KGBC 1YRTB 1QLKA 1B8CA 1JUOA 3EK7A 2GV5A 1R2UA 3GK2A 4YGBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DF0 B;  1IH0 A;  1ALW A;  4U8D A;  1X02 A;  1REC A;  1UHK A;  3KF9 A;  1NP8 A;  3TZ1 A;  4AQJ A;  1CMG A;  1FF1 A;  3A4U B;  2NXQ A;  4IL1 A;  4P2Y B;  2H61 C;  2Q91 A;  2LVK A;  2LUC A;  2PSR A;  3EVV A;  1IJ6 A;  2M97 A;  1NIW A;  3TS5 C;  3K21 A;  1SK6 D;  2LUX A;  4CFR A;  1Y1U A;  1S6C A;  1AJ5 A;  1QVI Z;  3VRQ A;  1FPW A;  3I5G B;  2AUC A;  3CR4 X;  3VRR A;  5I2Q A;  1YRU B;  4CFQ A;  2HF5 A;  4WRI A;  1LA3 A;  3PFV A;  2CXJ A;  3OX5 A;  1CB1 A;  4PE1 A;  1EH2 A;  1QV1 A;  4JPZ B;  2ZFD A;  3O4Y A;  1K93 D;  1NX1 A;  4PE7 A;  1B8L A;  1K9K A;  3FS7 A;  4WQ3 A;  5JJG A;  1IG5 A;  1CFC A;  1SBJ A;  4C0J A;  2LMT A;  1YVL A;  1RJV A;  2LLU A;  1RRO A;  1N65 A;  2BKI B;  2PAL A;  1A2X A;  1QAS A;  1U5I B;  2BCA A;  3I5G C;  4DUQ A;  2KGR A;  3EK8 A;  1A75 A;  1ZMZ A;  2KBI A;  4N1G A;  1SW8 A;  2KSP A;  3OB2 B;  2LC5 A;  3WHT B;  2GGZ A;  3NSO A;  1DGU A;  2MAZ A;  5FYX A;  5B8I B;  2Y1M A;  3PM8 A;  4OR9 B;  4MVF A;  4N5X A;  4R1E A;  3RM1 A;  1PSR A;  1IGV A;  3BUN B;  2AAO A;  3KHE A;  4PHN A;  1L7Z A;  1Y1A A;  4YRU A;  2KFH A;  1ODB A;  3QRX A;  1AUI B;  1K90 D;  2LAN A;  2L98 A;  4DS7 A;  1M63 B;  4L9M A;  1SR6 B;  4PHJ A;  4QJ4 B;  5DKR A;  4UPG A;  1CFF A;  2F8P A;  2QAC A;  1OZO A;  4ZCV A;  1B1G A;  1TRF A;  3NSI A;  1UWO A;  1SYM A;  2MLF C;  5HLO A;  1JWD A;  1B9A A;  2EGD A;  2WCB A;  3SG3 A;  2WCF A;  2EHB A;  1TNW A;  1FI5 A;  2M1K B;  1DJY A;  4N1F A;  1DJG A;  1XFZ O;  3SG5 A;  1B47 A;  1DF0 A;  4MSP A;  2LCP A;  4MZL A;  2Y4Q A;  2Y1N A;  2BE4 A;  2M9G A;  4MN0 A;  2L2E A;  1CTR A;  1PVA A;  5GQQ C;  1NWD A;  2EC6 C;  2KI6 C;  4ORC B;  1J7P A;  1KFX S;  2JZI A;  3NXA A;  1RWY A;  2V53 A;  4BY4 A;  3EKH A;  1QVI Y;  1WRL A;  5G08 A;  1XFY O;  3VGO A;  1TCO B;  5HKY A;  2JWW A;  1S26 D;  2KAY A;  4FTG A;  4DRW A;  1EL4 A;  1M46 A;  2LMV A;  4DCK A;  2I18 A;  1KFU L;  3BQ3 A;  2WND A;  4CID A;  4YGE B;  1S6I A;  3DVJ A;  1GGW A;  2OS8 B;  2ISD A;  2PRU A;  4PE4 A;  3AKA A;  2KDH A;  5I8N A;  1BOC A;  1KK7 Z;  4QJ5 B;  2JNF A;  1OMV A;  1DTL A;  1NSH A;  2F2P A;  1W7I B;  1KWO B;  2JNX A;  2O5G A;  1WDC B;  2ZN9 A;  5BPJ A;  1AK8 A;  1J7R A;  1CM4 A;  1CLM A;  1G4Y R;  2KHN A;  1YTZ C;  5AEQ A;  3CTN A;  2BKH B;  1CDP A;  4NDC A;  3JVT B;  5ER5 A;  1TNQ A;  2BBN A;  2L50 A;  4I5N B;  3FWB A;  4C0L A;  1LA0 A;  2H2K A;  2ZN8 A;  3PN7 B;  4YI8 A;  1QIV A;  1J1E A;  3AAJ A;  2OS8 C;  1QS7 A;  1FI6 A;  4GPL B;  2NCO A;  3SG6 A;  2JXC A;  4MZK A;  1QX7 A;  4M2Q A;  4GGN A;  4BY5 A;  4AQI A;  1JBA A;  4ORA B;  1NUB A;  3AKB A;  5F6T A;  1KWO C;  2A4J A;  1WDC C;  4I5L B;  2K7C A;  1AP4 A;  2I94 A;  1Y6W A;  2CT9 A;  1BG1 A;  3EKJ A;  1EJ3 A;  3SG2 A;  1C07 A;  1F8H A;  5DKQ A;  2NLN A;  3JVT C;  1CKK A;  5CPV A;  3NSL A;  1UP5 A;  1XK4 C;  1KCY A;  3PN7 C;  3PLF B;  2JT3 A;  3HCM A;  1SMG A;  2ZKM X;  3ICB A;  2F33 A;  2JC2 A;  2KFF A;  1XYD A;  1XFU O;  2K7B A;  3C1V A;  3EVR A;  1J1D A;  2CTN A;  4YBH B;  1YX7 A;  1BOD A;  1IQ3 A;  1B8R A;  1SRA A;  1CLB A;  1MHO A;  2L5X B;  2ZNE A;  1JSA A;  3SJS A;  1KSO A;  4OV2 A;  1PUL A;  1YVH A;  1SCM B;  3WHU B;  3I5I B;  1SCV A;  4GGF A;  1K8U A;  2KQY A;  4PHK A;  2JOJ A;  1OMD A;  4YGC B;  2CCM A;  1PRW A;  1GQM A;  1OMR A;  1WLZ A;  3LL8 B;  2HQW A;  1DJZ A;  2F3Z A;  1R6P A;  2G2B A;  3ZWH A;  5ER4 X;  1M31 A;  1SL8 A;  1NX3 A;  1C7W A;  1MR8 A;  2BEC A;  2KYC A;  3HX4 A;  4XJK B;  1SCM C;  3I5I C;  2LHL A;  2OPO A;  2RGI A;  1ZAC A;  3D0Y A;  1S3P A;  3A8R A;  1H8B A;  2HET A;  1F4O A;  4HRG A;  2K61 A;  3TUY B;  1TCF A;  2M7L A;  1DJX A;  2EC6 B;  1UUR A;  3BOW A;  1KK8 B;  2H61 A;  3AAK A;  4YGD B;  1OSA A;  3SIB A;  2WCE A;  1CLL A;  1NPQ A;  4MRX A;  1Q80 A;  2I2R E;  2E6W A;  2KYF A;  1MF8 B;  2R2I A;  2KOT A;  1CFP A;  1DJW A;  4I5J A;  2FJU B;  1IQ5 A;  1BF5 A;  1CDM A;  2WOR A;  1CDL A;  1OE9 B;  1UUS A;  3IQQ A;  1PSB A;  3IF7 A;  3DF0 A;  4OKH A;  3BUX B;  2LVI A;  2M7N A;  4ETO A;  3TUY C;  2MHH A;  2SCP A;  4ORB B;  2LLS A;  1D1O A;  1DJI A;  4HRE E;  2JTT A;  2JPT A;  1KK8 C;  1N0Y A;  3DVM A;  5K89 A;  2FCD A;  1BMO A;  3FWC A;  1C7V A;  1PVB A;  2HPS A;  1QV0 A;  2M8U A;  4PCW A;  3CLN A;  5CSJ A;  1JC2 A;  1KFU S;  2F3Y A;  1SKT A;  2G9B A;  1DGV A;  1JFK A;  1OOJ A;  3DVE A;  4QJ3 B;  5J3X A;  1OQP A;  2BBM A;  3IQO A;  1A4P A;  2M3W A;  1M39 A;  2LMU A;  4JQ0 D;  3TDI A;  5AFP A;  1RTP 1;  1AVS A;  2AMI A;  2MBX A;  3KPX A;  3I5H B;  1IWQ A;  2L4I A;  2MLE C;  5I2O A;  4PDZ A;  1Y1X A;  4YGA A;  2GGM A;  2MRD A;  5I2L A;  4I5K A;  4XYN A;  1M45 A;  2SAS A;  1GJY A;  1U5I A;  2JRF A;  1WRK A;  3SIA A;  4MEW A;  3CWG A;  2K2A A;  3CR5 X;  2KBM A;  1K9U A;  4CPV A;  2K2F A;  1TNX A;  1B4C A;  1SY9 A;  4P5O E;  2KNE A;  3I5F C;  1LIN A;  2BE6 A;  2JXL A;  1NCY A;  3I5H C;  2CNP A;  1XA5 A;  1UHI A;  2ZRT A;  2MJW B;  1L2O C;  3LK1 A;  1S36 A;  5KU1 A;  2KQ6 A;  1BJF A;  5HLV A;  1TNP A;  1JF0 A;  2VRG A;  4ICB A;  2LAP A;  1XFX O;  3BXK A;  1G8I A;  3KEV A;  3SG7 A;  1J7O A;  5AER A;  1IJ5 A;  1KQM B;  2LV7 A;  2QPT A;  4YI9 A;  3H4S E;  1NX2 A;  1PK0 D;  3DVK A;  1CFD A;  2LP2 A;  1RK9 A;  1A29 A;  3VRO A;  1UHN A;  1HQV A;  3OHM B;  3PAT A;  3MSE B;  1F71 A;  5TNC A;  2Y5I A;  1XFW O;  1NCZ A;  5HKZ A;  1Y0V H;  4NDD A;  1J55 A;  3OB1 B;  1DF0 B;  1JFJ A;  1S5G Z;  3BUW B;  2JT8 A;  5PAL A;  2K8M B;  1VRK A;  1N2D A;  3O2P A;  4ZCU A;  2F2O A;  3BUM B;  5AAN A;  2LM5 A;  4A4B A;  1K9P A;  3D10 A;  1QXP A;  1LXF C;  2KFG A;  3EVU A;  5CSF A;  5HKW A;  1KQM C;  1QJT A;  1MWN A;  1QTX A;  2BCB A;  4HRH A;  1CMF A;  1QLS A;  1TTX A;  1YUU A;  2JU0 A;  5D69 A;  4GFT A;  3VRP A;  3PAL A;  1DT7 B;  2BL0 B;  1CNP A;  4F0Z B;  2M49 B;  2FOT A;  1SPY A;  4GAO A;  4OCI A;  3PSR A;  2O60 A;  2NCP A;  4MBE A;  5CSI A;  1UHJ A;  2K0J A;  1BT6 A;  4PAL A;  1CM1 A;  1AJ4 A;  3VRN A;  1F55 A;  1KK7 Y;  3TDU A;  1TN4 A;  1KSM A;  1YUS A;  3LCP C;  2KI6 D;  3O78 A;  2JQ6 A;  2E30 A;  4MZJ A;  4WQ2 A;  1BR1 B;  2BL0 C;  1E8A A;  2I7A A;  3LLE A;  1BU3 A;  3WXA A;  1GGZ A;  1B7T Z;  2K7O A;  2D8N A;  1YUT A;  1JF2 A;  1DMO A;  2TN4 A;  3O6B A;  1QX5 B;  1PAL A;  5KSZ A;  4HSZ A;  1K96 A;  2B1U A;  2JUL A;  1EG3 A;  1XK4 A;  3NSK A;  1BR4 B;  4NQG A;  1BLQ A;  3M0W A;  4MLW A;  3GOF A;  4A4C A;  1ALV A;  2LHI A;  4Q04 A;  2P6B B;  2LNK A;  1ZFS A;  1XFV O;  1YUR A;  3SG4 A;  2LLT A;  2LP3 A;  2ZND A;  3GK1 A;  1V1G A;  1MXL C;  3ZNI A;  1NCX A;  3CS1 A;  4TNC A;  4FQO A;  2DOQ A;  1EXR A;  1WRZ A;  1SL7 A;  2IS9 A;  2OTG B;  1RFJ A;  1SL9 A;  2PVB A;  4GBA A;  5AXI A;  1MUX A;  5IBW A;  4JWQ A;  2KAV A;  1F54 A;  1QX2 A;  1H4B A;  2COL B;  1XVJ A;  4PHM A;  1FBV A;  2KI4 B;  1AHR A;  3EK4 A;  2JT0 A;  1DJH A;  1QAT A;  1WLM A;  1F70 A;  3WNX B;  1MQ1 A;  4PE0 A;  1S5G Y;  4OVN F;  1NYA A;  2WOS A;  4AOM A;  1QIW A;  1YX8 A;  1WY9 A;  2LE9 B;  1V1F A;  1LVC D;  1S6J A;  3DD4 A;  1CDN A;  1SR6 C;  3I5F B;  1HT9 A;  2L0P A;  4USL A;  1K94 A;  2OTG C;  1XO5 A;  2MA2 A;  1K95 A;  2L4H A;  3JTD B;  1MXE A;  1J7Q A;  4E68 A;  1TOP A;  1L2O B;  3CGA A;  2KAX A;  4GUK A;  2M29 A;  4GNK B;  5HYD A;  1OZS A;  2M0R A;  1ZOT B;  2BCX A;  2KI4 C;  3CZT X;  1A75 B;  4DIR A;  1K2H A;  2CBL A;  1KFX L;  3CR2 A;  2LVV A;  4MRY A;  5JOL A;  3GK4 X;  4D1E A;  2NZ0 A;  2L51 A;  1EG4 A;  1YR5 A;  1LKJ A;  4GGF C;  4NDB A;  2ZRS A;  1A03 A;  3D0Y B;  1S1E A;  2JTZ A;  2M1U A;  3BYA A;  5DKN A;  3JTD C;  3TDZ A;  2K7D A;  4XJK A;  2HQ8 A;  3E3R A;  5KTY A;  1FW4 A;  2Q4U A;  3BUO B;  1TIZ A;  3OX6 A;  1IKU A;  1SNL A;  3FIA A;  1KQV A;  5CSN A;  1B7T Y;  3KO0 A;  2PAS A;  2PMY A;  2WC8 A;  1NX0 A;  4CLN A;  4M2O A;  5D7F A;  1DVI A;  1IRJ A;  2FCE A;  1F4Q A;  3BOW B;  3RLZ A;  3OP0 A;  2LVJ A;  4M2P A;  1UHH A;  1G33 A;  3LK0 A;  1W7J B;  1ZUZ A;  3TS5 B;  3F45 A;  4C0K A;  2KGB C;  1YRT B;  1QLK A;  1B8C A;  1JUO A;  3EK7 A;  2GV5 A;  1R2U A;  3GK2 A;  4YGB B; 
#chains in the Genus database with same CATH topology
 4OZD A;  3DF0 B;  1IH0 A;  1ALW A;  4U8D A;  1X02 A;  1REC A;  1UHK A;  3KF9 A;  1NP8 A;  3TZ1 A;  4AQJ A;  1CMG A;  1FF1 A;  3A4U B;  2NXQ A;  4IL1 A;  4P2Y B;  2H61 C;  2Q91 A;  2LVK A;  2LUC A;  2PSR A;  3EVV A;  1IJ6 A;  2M97 A;  1DQE A;  1NIW A;  3PJI A;  3TS5 C;  3K21 A;  1SK6 D;  2LUX A;  4CFR A;  1Y1U A;  1S6C A;  1AJ5 A;  1QVI Z;  3VRQ A;  1FPW A;  2KLD A;  3I5G B;  2AUC A;  3CR4 X;  4IJ7 A;  3VRR A;  2PYQ A;  5I2Q A;  1YRU B;  3B6X A;  4CFQ A;  2HF5 A;  4WRI A;  1LA3 A;  3PFV A;  2CXJ A;  3OX5 A;  3RZS A;  1CB1 A;  4PE1 A;  1EH2 A;  1QV1 A;  3D74 A;  2L2C A;  4JPZ B;  2ZFD A;  3O4Y A;  1K93 D;  3D73 A;  1NX1 A;  4PE7 A;  1B8L A;  1K9K A;  3FS7 A;  4WQ3 A;  5JJG A;  1IG5 A;  1CFC A;  1SBJ A;  4C0J A;  2LMT A;  1YVL A;  3R1V A;  1RJV A;  2LLU A;  1RRO A;  1N65 A;  2BKI B;  2PAL A;  1A2X A;  1QAS A;  1U5I B;  2BCA A;  3I5G C;  4DUQ A;  2KGR A;  3EK8 A;  1A75 A;  1ZMZ A;  2KBI A;  4N1G A;  1SW8 A;  2KSP A;  3OB2 B;  2LC5 A;  3WHT B;  2GGZ A;  3NSO A;  1DGU A;  2MAZ A;  5FYX A;  1C3Z A;  5B8I B;  2Y1M A;  3PM8 A;  4OR9 B;  4MVF A;  4N5X A;  4R1E A;  4PT1 A;  2QEV A;  3RM1 A;  1PSR A;  1IGV A;  3BUN B;  4JD9 A;  5EL2 A;  2AAO A;  3KHE A;  4PHN A;  1L7Z A;  1Y1A A;  4YRU A;  2KFH A;  1ODB A;  3QRX A;  1AUI B;  1K90 D;  2LAN A;  2L98 A;  4DS7 A;  1M63 B;  4L9M A;  1SR6 B;  4PHJ A;  4QJ4 B;  5DKR A;  3IVT A;  4UPG A;  1CFF A;  2F8P A;  1LS8 A;  2QAC A;  2BNX A;  1OZO A;  4ZCV A;  1B1G A;  1TRF A;  3NSI A;  1UWO A;  3CYZ A;  1SYM A;  2MLF C;  5HLO A;  1JWD A;  1B9A A;  5FI2 A;  3PM2 A;  2EGD A;  2WCB A;  3SG3 A;  2WCF A;  2EHB A;  1TNW A;  1FI5 A;  2M1K B;  1DJY A;  4N1F A;  1DJG A;  1XFZ O;  3NHI A;  3SG5 A;  1B47 A;  1DF0 A;  4MSP A;  2LCP A;  3R72 A;  4MZL A;  2Y4Q A;  2Y1N A;  2BE4 A;  2M9G A;  4MN0 A;  2L2E A;  1CTR A;  1PVA A;  5GQQ C;  1NWD A;  2EC6 C;  2KI6 C;  3D77 A;  4ORC B;  3S0A A;  1KFX S;  2JZI A;  3NXA A;  1J7P A;  1RWY A;  2V53 A;  4BY4 A;  3EKH A;  1QVI Y;  1WRL A;  5G08 A;  4FQT A;  1XFY O;  3VGO A;  1TCO B;  5HKY A;  2JWW A;  2WC5 A;  1S26 D;  2KAY A;  4FTG A;  4DRW A;  1EL4 A;  1M46 A;  2LMV A;  3DXL A;  4DCK A;  2I18 A;  1KFU L;  3BQ3 A;  2WND A;  4CID A;  1XFR A;  4YGE B;  1S6I A;  3DVJ A;  4INW A;  2YGU A;  1GGW A;  2OS8 B;  2ISD A;  2PRU A;  4PE4 A;  3AKA A;  2KDH A;  5I8N A;  1BOC A;  1KK7 Z;  4QJ5 B;  2JNF A;  1OMV A;  3S0E A;  1DTL A;  1NSH A;  2F2P A;  1W7I B;  1KWO B;  2JNX A;  2O5G A;  1WDC B;  2ZN9 A;  5BPJ A;  1AK8 A;  5D3O A;  1J7R A;  1CM4 A;  1CLM A;  1G4Y R;  2WCL A;  2KHN A;  1YTZ C;  5AEQ A;  3CTN A;  2BKH B;  1CDP A;  4NDC A;  3JVT B;  5ER5 A;  1OOG A;  1TNQ A;  2BBN A;  2L50 A;  4I5N B;  3FWB A;  3B7A A;  4C0L A;  1LA0 A;  2H2K A;  2ZN8 A;  3PN7 B;  4YI8 A;  1QIV A;  2QEO A;  1J1E A;  3AAJ A;  2OS8 C;  1QS7 A;  3BFH A;  3R1P A;  2NCO A;  4GPL B;  1FI6 A;  3SG6 A;  2JXC A;  4MZK A;  1QX7 A;  1DEK A;  4M2Q A;  4GGN A;  4BY5 A;  4AQI A;  1JBA A;  4ORA B;  1NUB A;  3AKB A;  5F6T A;  1KWO C;  2A4J A;  1WDC C;  2WC6 A;  4I5L B;  3SS4 A;  3FE6 A;  2K7C A;  2WCM A;  1AP4 A;  2I94 A;  3QME A;  1Y6W A;  2CT9 A;  1BG1 A;  3EKJ A;  1EJ3 A;  3SG2 A;  1C07 A;  1F8H A;  5DKQ A;  2NLN A;  3JVT C;  3B88 A;  1CKK A;  2QDI A;  3CAB A;  5CPV A;  3N7H A;  3NSL A;  1UP5 A;  1XK4 C;  1KCY A;  3PN7 C;  3PLF B;  2JT3 A;  3HCM A;  1SMG A;  2ZKM X;  3ICB A;  2F33 A;  2JC2 A;  2KFF A;  1XYD A;  1XFU O;  2K7B A;  3CDN A;  5FI7 A;  3C1V A;  3EVR A;  1J1D A;  2CTN A;  4YBH B;  1YX7 A;  1BOD A;  1IQ3 A;  1B8R A;  1SRA A;  2KLE A;  1CLB A;  1MHO A;  2L5X B;  2ZNE A;  3UNW A;  1JSA A;  3SJS A;  1KSO A;  1GM0 A;  1ORG A;  4OV2 A;  1PUL A;  1YVH A;  1SCM B;  3WHU B;  3I5I B;  1SCV A;  4GGF A;  1K8U A;  2KQY A;  3S0F A;  4PHK A;  2JOJ A;  1OMD A;  4YGC B;  2CCM A;  2KPH A;  1PRW A;  1GQM A;  1OMR A;  1WLZ A;  3LL8 B;  2HQW A;  3S0G A;  1DJZ A;  2F3Z A;  1R6P A;  1TWO A;  2G2B A;  3ZWH A;  5ER4 X;  1M31 A;  1SL8 A;  1NX3 A;  1C7W A;  1MR8 A;  2BEC A;  2KYC A;  3HX4 A;  4XJK B;  1Z2C B;  1SCM C;  3I5I C;  2LHL A;  2OPO A;  2RGI A;  3R1O A;  1ZAC A;  3O4X A;  3D0Y A;  1S3P A;  2WCJ A;  3A8R A;  1QWV A;  2JPO A;  3CZ1 A;  1C3Y A;  2HET A;  1F4O A;  1H8B A;  3B86 A;  4HRG A;  1T14 A;  2K61 A;  3TUY B;  1TCF A;  3FE8 A;  2M7L A;  1DJX A;  2EC6 B;  1UUR A;  3BOW A;  5FI6 A;  1KK8 B;  2H61 A;  3AAK A;  4YGD B;  1OSA A;  3SIB A;  2WCE A;  1CLL A;  1NPQ A;  4MRX A;  1Q80 A;  2I2R E;  2E6W A;  2KYF A;  1MF8 B;  2R2I A;  2KOT A;  3NGV A;  1CFP A;  1DJW A;  3SS3 A;  1IIO A;  3EG5 B;  4I5J A;  2FJU B;  1IQ5 A;  1BF5 A;  1CDM A;  2WOR A;  1CDL A;  1OE9 B;  1UUS A;  3IQQ A;  1PSB A;  3IF7 A;  3DF0 A;  4OKH A;  3BUX B;  2LVI A;  2M7N A;  4ETO A;  3TUY C;  2MHH A;  2SCP A;  4ORB B;  2LLS A;  1D1O A;  3CZ0 A;  1DJI A;  4HRE E;  2JTT A;  2JPT A;  1OW4 A;  1KK8 C;  1N0Y A;  3DVM A;  5K89 A;  2FCD A;  1BMO A;  3FWC A;  1C7V A;  1PVB A;  2HPS A;  1QV0 A;  2M8U A;  4PCW A;  3CLN A;  5CSJ A;  1JC2 A;  1KFU S;  2F3Y A;  1SKT A;  2G9B A;  2H8V A;  1DGV A;  1JFK A;  3BJH A;  1OOJ A;  3DVE A;  4QJ3 B;  5J3X A;  1OQP A;  2BBM A;  3IQO A;  1A4P A;  2M3W A;  1M39 A;  2LMU A;  2K60 A;  4JQ0 D;  3TDI A;  1RTP 1;  5AFP A;  1AVS A;  2AMI A;  2MBX A;  3KPX A;  3I5H B;  1IWQ A;  2L4I A;  2MLE C;  3DY9 A;  5I2O A;  4PDZ A;  1Y1X A;  4YGA A;  2GGM A;  2MRD A;  5I2L A;  4I5K A;  1OOF A;  4XYN A;  1M45 A;  2SAS A;  1GJY A;  1U5I A;  2JRF A;  1WRK A;  3SIA A;  4MEW A;  3CWG A;  2K2A A;  3CR5 X;  2KBM A;  1TUZ A;  1K9U A;  4CPV A;  2K2F A;  1TNX A;  1B4C A;  1SY9 A;  4P5O E;  2KNE A;  3I5F C;  1LIN A;  2BE6 A;  2JXL A;  1NCY A;  4F7F A;  3I5H C;  2CNP A;  1XA5 A;  1UHI A;  2WCK A;  2ZRT A;  2MJW B;  1L2O C;  3LK1 A;  1S36 A;  4JKT A;  1DEL A;  5KU1 A;  2KQ6 A;  1BJF A;  2QEH A;  5HLV A;  1TNP A;  3K1E A;  1JF0 A;  2VRG A;  4ICB A;  2LAP A;  1XFX O;  3BFA A;  3SS5 A;  3BXK A;  3VB1 A;  2GTE A;  1G8I A;  3KEV A;  3SG7 A;  2FJY A;  1J7O A;  5AER A;  1IJ5 A;  1KQM B;  2LV7 A;  2QPT A;  4YI9 A;  3H4S E;  1NX2 A;  1PK0 D;  2QEB A;  3DVK A;  1CFD A;  2LP2 A;  1RK9 A;  1A29 A;  3VRO A;  1DC1 A;  1UHN A;  1HQV A;  3OHM B;  3PAT A;  3MSE B;  1F71 A;  5TNC A;  2Y5I A;  1XFW O;  1NCZ A;  5HKZ A;  1Y0V H;  4NDD A;  1J55 A;  3OB1 B;  1DF0 B;  1JFJ A;  1S5G Z;  3BUW B;  2JT8 A;  3CZ2 A;  2K8M B;  2PQL A;  1VRK A;  5PAL A;  1N2D A;  3B87 A;  5HL1 A;  3O2P A;  4ZCU A;  2F2O A;  3BUM B;  5AAN A;  2LM5 A;  4A4B A;  1K9P A;  3D10 A;  1QXP A;  1LXF C;  2KFG A;  3EVU A;  5CSF A;  5HKW A;  1KQM C;  1QJT A;  1P28 A;  1MWN A;  1QTX A;  2BCB A;  4HRH A;  1CMF A;  1QLS A;  1TTX A;  1YUU A;  2JU0 A;  5D69 A;  4GFT A;  3VRP A;  3PAL A;  1DT7 B;  2BL0 B;  1CNP A;  3S0B A;  3UO9 A;  4F0Z B;  2M49 B;  2FOT A;  1SPY A;  4GAO A;  4OCI A;  2ERB A;  3PSR A;  2O60 A;  2NCP A;  4MBE A;  5CSI A;  1UHJ A;  2K0J A;  3V2L A;  1BT6 A;  4PAL A;  1CM1 A;  1AJ4 A;  2L5Y A;  3VRN A;  3OBV A;  1KK7 Y;  1F55 A;  3TDU A;  1TN4 A;  1KSM A;  2P71 A;  1YUS A;  3LCP C;  2KI6 D;  3O78 A;  2JQ6 A;  2E30 A;  4MZJ A;  4INX A;  4KYN A;  4WQ2 A;  3OGN A;  1BR1 B;  2BL0 C;  1E8A A;  2I7A A;  3LLE A;  1BU3 A;  3NHT A;  3WXA A;  1GGZ A;  3Q8I A;  1B7T Z;  2K7O A;  2D8N A;  1OOI X;  1YUT A;  1JF2 A;  3D78 A;  1DMO A;  2TN4 A;  3O6B A;  1QX5 B;  1PAL A;  5KSZ A;  4HSZ A;  1K96 A;  2B1U A;  2JUL A;  1EG3 A;  1XK4 A;  3NSK A;  1BR4 B;  4NQG A;  1BLQ A;  3M0W A;  4MLW A;  3GOF A;  4A4C A;  1ALV A;  2LHI A;  4Q04 A;  2P6B B;  2LNK A;  1ZFS A;  1XFV O;  1YUR A;  3SG4 A;  2LLT A;  3DZT A;  2LP3 A;  2WCH A;  2ZND A;  3GK1 A;  1Z4H A;  1V1G A;  1MXL C;  5DIC A;  3ZNI A;  1NCX A;  3CS1 A;  4TNC A;  4FQO A;  2DOQ A;  1EXR A;  1WRZ A;  1SL7 A;  2IS9 A;  2OTG B;  1RFJ A;  1SL9 A;  2PVB A;  4GBA A;  5AXI A;  1MUX A;  5IBW A;  4JWQ A;  2KAV A;  1F54 A;  1QX2 A;  1H4B A;  2COL B;  1XVJ A;  4PHM A;  1FBV A;  2KI4 B;  1AHR A;  3EK4 A;  2JT0 A;  1DJH A;  1QAT A;  1SSE B;  1WLM A;  1F70 A;  3WNX B;  3FE9 A;  1MQ1 A;  4PE0 A;  1S5G Y;  4OVN F;  1NYA A;  2BAP A;  2WOS A;  4AOM A;  1QIW A;  1YX8 A;  1WY9 A;  2LE9 B;  1V1F A;  1LVC D;  1S6J A;  3DD4 A;  1CDN A;  1SR6 C;  3I5F B;  1HT9 A;  2L0P A;  4USL A;  1K94 A;  2OTG C;  1XO5 A;  3BFB A;  2MA2 A;  1K95 A;  2L4H A;  3JTD B;  1MXE A;  3L4L A;  1J7Q A;  4E68 A;  1TOP A;  1L2O B;  3CGA A;  2KAX A;  4GUK A;  2M29 A;  4GNK B;  5HYD A;  1OZS A;  2M0R A;  1ZOT B;  2BCX A;  2KI4 C;  3CZT X;  1A75 B;  4DIR A;  1TUJ A;  1K2H A;  3L4A A;  2CBL A;  1KFX L;  3D75 A;  3CR2 A;  2LVV A;  4MRY A;  3GK2 A;  5JOL A;  3GK4 X;  2P70 A;  4D1E A;  2NZ0 A;  2L51 A;  1EG4 A;  1YR5 A;  1LKJ A;  4GGF C;  4NDB A;  2ZRS A;  1A03 A;  3D0Y B;  1S1E A;  2JTZ A;  2M1U A;  3BYA A;  5DKN A;  3JTD C;  3TDZ A;  2K7D A;  4XJK A;  2HQ8 A;  3E3R A;  5KTY A;  1FW4 A;  2Q4U A;  3BUO B;  1TIZ A;  3OX6 A;  1IKU A;  1SNL A;  3DYE A;  3FIA A;  1KQV A;  5CSN A;  1B7T Y;  3KO0 A;  2PAS A;  2PMY A;  2WC8 A;  1NX0 A;  1W9Z A;  4M2O A;  1OOH A;  4CLN A;  5D7F A;  1DVI A;  1IRJ A;  2FCE A;  1F4Q A;  3BOW B;  3RLZ A;  3OP0 A;  2LVJ A;  4M2P A;  1UHH A;  1G33 A;  3LK0 A;  1W7J B;  1ZUZ A;  3TS5 B;  3F45 A;  4C0K A;  2KGB C;  1YRT B;  1QLK A;  1B8C A;  3S0D A;  1JUO A;  3EK7 A;  2GV5 A;  5I94 A;  1R2U A;  3D76 A;  3L47 A;  4YGB B; 
#chains in the Genus database with same CATH homology
 3DF0 B;  1IH0 A;  1ALW A;  4U8D A;  1X02 A;  1REC A;  1UHK A;  3KF9 A;  1NP8 A;  3TZ1 A;  4AQJ A;  1CMG A;  1FF1 A;  3A4U B;  2NXQ A;  4IL1 A;  4P2Y B;  2H61 C;  2Q91 A;  2LVK A;  2LUC A;  2PSR A;  3EVV A;  1IJ6 A;  2M97 A;  1NIW A;  3TS5 C;  3K21 A;  1SK6 D;  2LUX A;  4CFR A;  1Y1U A;  1S6C A;  1AJ5 A;  1QVI Z;  3VRQ A;  1FPW A;  3I5G B;  2AUC A;  3CR4 X;  3VRR A;  5I2Q A;  1YRU B;  4CFQ A;  2HF5 A;  4WRI A;  1LA3 A;  3PFV A;  2CXJ A;  3OX5 A;  1CB1 A;  4PE1 A;  1EH2 A;  1QV1 A;  4JPZ B;  2ZFD A;  3O4Y A;  1K93 D;  1NX1 A;  4PE7 A;  1B8L A;  1K9K A;  3FS7 A;  4WQ3 A;  5JJG A;  1IG5 A;  1CFC A;  1SBJ A;  4C0J A;  2LMT A;  1YVL A;  1RJV A;  2LLU A;  1RRO A;  1N65 A;  2BKI B;  2PAL A;  1A2X A;  1QAS A;  1U5I B;  2BCA A;  3I5G C;  4DUQ A;  2KGR A;  3EK8 A;  1A75 A;  1ZMZ A;  2KBI A;  4N1G A;  1SW8 A;  2KSP A;  3OB2 B;  2LC5 A;  3WHT B;  2GGZ A;  3NSO A;  1DGU A;  2MAZ A;  5FYX A;  5B8I B;  2Y1M A;  3PM8 A;  4OR9 B;  4MVF A;  4N5X A;  4R1E A;  3RM1 A;  1PSR A;  1IGV A;  3BUN B;  2AAO A;  3KHE A;  4PHN A;  1L7Z A;  1Y1A A;  4YRU A;  2KFH A;  1ODB A;  3QRX A;  1AUI B;  1K90 D;  2LAN A;  2L98 A;  4DS7 A;  1M63 B;  4L9M A;  1SR6 B;  4PHJ A;  4QJ4 B;  5DKR A;  4UPG A;  1CFF A;  2F8P A;  2QAC A;  1OZO A;  4ZCV A;  1B1G A;  1TRF A;  3NSI A;  1UWO A;  1SYM A;  2MLF C;  5HLO A;  1JWD A;  1B9A A;  2EGD A;  2WCB A;  3SG3 A;  2WCF A;  2EHB A;  1TNW A;  1FI5 A;  2M1K B;  1DJY A;  4N1F A;  1DJG A;  1XFZ O;  3SG5 A;  1B47 A;  1DF0 A;  4MSP A;  2LCP A;  4MZL A;  2Y4Q A;  2Y1N A;  2BE4 A;  2M9G A;  4MN0 A;  2L2E A;  1CTR A;  1PVA A;  5GQQ C;  1NWD A;  2EC6 C;  2KI6 C;  4ORC B;  1J7P A;  1KFX S;  2JZI A;  3NXA A;  1RWY A;  2V53 A;  4BY4 A;  3EKH A;  1QVI Y;  1WRL A;  5G08 A;  1XFY O;  3VGO A;  1TCO B;  5HKY A;  2JWW A;  1S26 D;  2KAY A;  4FTG A;  4DRW A;  1EL4 A;  1M46 A;  2LMV A;  4DCK A;  2I18 A;  1KFU L;  3BQ3 A;  2WND A;  4CID A;  4YGE B;  1S6I A;  3DVJ A;  1GGW A;  2OS8 B;  2ISD A;  2PRU A;  4PE4 A;  3AKA A;  2KDH A;  5I8N A;  1BOC A;  1KK7 Z;  4QJ5 B;  2JNF A;  1OMV A;  1DTL A;  1NSH A;  2F2P A;  1W7I B;  1KWO B;  2JNX A;  2O5G A;  1WDC B;  2ZN9 A;  5BPJ A;  1AK8 A;  1J7R A;  1CM4 A;  1CLM A;  1G4Y R;  2KHN A;  1YTZ C;  5AEQ A;  3CTN A;  2BKH B;  1CDP A;  4NDC A;  3JVT B;  5ER5 A;  1TNQ A;  2BBN A;  2L50 A;  4I5N B;  3FWB A;  4C0L A;  1LA0 A;  2H2K A;  2ZN8 A;  3PN7 B;  4YI8 A;  1QIV A;  1J1E A;  3AAJ A;  2OS8 C;  1QS7 A;  1FI6 A;  4GPL B;  2NCO A;  3SG6 A;  2JXC A;  4MZK A;  1QX7 A;  4M2Q A;  4GGN A;  4BY5 A;  4AQI A;  1JBA A;  4ORA B;  1NUB A;  3AKB A;  5F6T A;  1KWO C;  2A4J A;  1WDC C;  4I5L B;  2K7C A;  1AP4 A;  2I94 A;  1Y6W A;  2CT9 A;  1BG1 A;  3EKJ A;  1EJ3 A;  3SG2 A;  1C07 A;  1F8H A;  5DKQ A;  2NLN A;  3JVT C;  1CKK A;  5CPV A;  3NSL A;  1UP5 A;  1XK4 C;  1KCY A;  3PN7 C;  3PLF B;  2JT3 A;  3HCM A;  1SMG A;  2ZKM X;  3ICB A;  2F33 A;  2JC2 A;  2KFF A;  1XYD A;  1XFU O;  2K7B A;  3C1V A;  3EVR A;  1J1D A;  2CTN A;  4YBH B;  1YX7 A;  1BOD A;  1IQ3 A;  1B8R A;  1SRA A;  1CLB A;  1MHO A;  2L5X B;  2ZNE A;  1JSA A;  3SJS A;  1KSO A;  4OV2 A;  1PUL A;  1YVH A;  1SCM B;  3WHU B;  3I5I B;  1SCV A;  4GGF A;  1K8U A;  2KQY A;  4PHK A;  2JOJ A;  1OMD A;  4YGC B;  2CCM A;  1PRW A;  1GQM A;  1OMR A;  1WLZ A;  3LL8 B;  2HQW A;  1DJZ A;  2F3Z A;  1R6P A;  2G2B A;  3ZWH A;  5ER4 X;  1M31 A;  1SL8 A;  1NX3 A;  1C7W A;  1MR8 A;  2BEC A;  2KYC A;  3HX4 A;  4XJK B;  1SCM C;  3I5I C;  2LHL A;  2OPO A;  2RGI A;  1ZAC A;  3D0Y A;  1S3P A;  3A8R A;  1H8B A;  2HET A;  1F4O A;  4HRG A;  2K61 A;  3TUY B;  1TCF A;  2M7L A;  1DJX A;  2EC6 B;  1UUR A;  3BOW A;  1KK8 B;  2H61 A;  3AAK A;  4YGD B;  1OSA A;  3SIB A;  2WCE A;  1CLL A;  1NPQ A;  4MRX A;  1Q80 A;  2I2R E;  2E6W A;  2KYF A;  1MF8 B;  2R2I A;  2KOT A;  1CFP A;  1DJW A;  4I5J A;  2FJU B;  1IQ5 A;  1BF5 A;  1CDM A;  2WOR A;  1CDL A;  1OE9 B;  1UUS A;  3IQQ A;  1PSB A;  3IF7 A;  3DF0 A;  4OKH A;  3BUX B;  2LVI A;  2M7N A;  4ETO A;  3TUY C;  2MHH A;  2SCP A;  4ORB B;  2LLS A;  1D1O A;  1DJI A;  4HRE E;  2JTT A;  2JPT A;  1KK8 C;  1N0Y A;  3DVM A;  5K89 A;  2FCD A;  1BMO A;  3FWC A;  1C7V A;  1PVB A;  2HPS A;  1QV0 A;  2M8U A;  4PCW A;  3CLN A;  5CSJ A;  1JC2 A;  1KFU S;  2F3Y A;  1SKT A;  2G9B A;  1DGV A;  1JFK A;  1OOJ A;  3DVE A;  4QJ3 B;  5J3X A;  1OQP A;  2BBM A;  3IQO A;  1A4P A;  2M3W A;  1M39 A;  2LMU A;  4JQ0 D;  3TDI A;  5AFP A;  1RTP 1;  1AVS A;  2AMI A;  2MBX A;  3KPX A;  3I5H B;  1IWQ A;  2L4I A;  2MLE C;  5I2O A;  4PDZ A;  1Y1X A;  4YGA A;  2GGM A;  2MRD A;  5I2L A;  4I5K A;  4XYN A;  1M45 A;  2SAS A;  1GJY A;  1U5I A;  2JRF A;  1WRK A;  3SIA A;  4MEW A;  3CWG A;  2K2A A;  3CR5 X;  2KBM A;  1K9U A;  4CPV A;  2K2F A;  1TNX A;  1B4C A;  1SY9 A;  4P5O E;  2KNE A;  3I5F C;  1LIN A;  2BE6 A;  2JXL A;  1NCY A;  3I5H C;  2CNP A;  1XA5 A;  1UHI A;  2ZRT A;  2MJW B;  1L2O C;  3LK1 A;  1S36 A;  5KU1 A;  2KQ6 A;  1BJF A;  5HLV A;  1TNP A;  1JF0 A;  2VRG A;  4ICB A;  2LAP A;  1XFX O;  3BXK A;  1G8I A;  3KEV A;  3SG7 A;  1J7O A;  5AER A;  1IJ5 A;  1KQM B;  2LV7 A;  2QPT A;  4YI9 A;  3H4S E;  1NX2 A;  1PK0 D;  3DVK A;  1CFD A;  2LP2 A;  1RK9 A;  1A29 A;  3VRO A;  1UHN A;  1HQV A;  3OHM B;  3PAT A;  3MSE B;  1F71 A;  5TNC A;  2Y5I A;  1XFW O;  1NCZ A;  5HKZ A;  1Y0V H;  4NDD A;  1J55 A;  3OB1 B;  1DF0 B;  1JFJ A;  1S5G Z;  3BUW B;  2JT8 A;  5PAL A;  2K8M B;  1VRK A;  1N2D A;  3O2P A;  4ZCU A;  2F2O A;  3BUM B;  5AAN A;  2LM5 A;  4A4B A;  1K9P A;  3D10 A;  1QXP A;  1LXF C;  2KFG A;  3EVU A;  5CSF A;  5HKW A;  1KQM C;  1QJT A;  1MWN A;  1QTX A;  2BCB A;  4HRH A;  1CMF A;  1QLS A;  1TTX A;  1YUU A;  2JU0 A;  5D69 A;  4GFT A;  3VRP A;  3PAL A;  1DT7 B;  2BL0 B;  1CNP A;  4F0Z B;  2M49 B;  2FOT A;  1SPY A;  4GAO A;  4OCI A;  3PSR A;  2O60 A;  2NCP A;  4MBE A;  5CSI A;  1UHJ A;  2K0J A;  1BT6 A;  4PAL A;  1CM1 A;  1AJ4 A;  3VRN A;  1F55 A;  1KK7 Y;  3TDU A;  1TN4 A;  1KSM A;  1YUS A;  3LCP C;  2KI6 D;  3O78 A;  2JQ6 A;  2E30 A;  4MZJ A;  4WQ2 A;  1BR1 B;  2BL0 C;  1E8A A;  2I7A A;  3LLE A;  1BU3 A;  3WXA A;  1GGZ A;  1B7T Z;  2K7O A;  2D8N A;  1YUT A;  1JF2 A;  1DMO A;  2TN4 A;  3O6B A;  1QX5 B;  1PAL A;  5KSZ A;  4HSZ A;  1K96 A;  2B1U A;  2JUL A;  1EG3 A;  1XK4 A;  3NSK A;  1BR4 B;  4NQG A;  1BLQ A;  3M0W A;  4MLW A;  3GOF A;  4A4C A;  1ALV A;  2LHI A;  4Q04 A;  2P6B B;  2LNK A;  1ZFS A;  1XFV O;  1YUR A;  3SG4 A;  2LLT A;  2LP3 A;  2ZND A;  3GK1 A;  1V1G A;  1MXL C;  3ZNI A;  1NCX A;  3CS1 A;  4TNC A;  4FQO A;  2DOQ A;  1EXR A;  1WRZ A;  1SL7 A;  2IS9 A;  2OTG B;  1RFJ A;  1SL9 A;  2PVB A;  4GBA A;  5AXI A;  1MUX A;  5IBW A;  4JWQ A;  2KAV A;  1F54 A;  1QX2 A;  1H4B A;  2COL B;  1XVJ A;  4PHM A;  1FBV A;  2KI4 B;  1AHR A;  3EK4 A;  2JT0 A;  1DJH A;  1QAT A;  1WLM A;  1F70 A;  3WNX B;  1MQ1 A;  4PE0 A;  1S5G Y;  4OVN F;  1NYA A;  2WOS A;  4AOM A;  1QIW A;  1YX8 A;  1WY9 A;  2LE9 B;  1V1F A;  1LVC D;  1S6J A;  3DD4 A;  1CDN A;  1SR6 C;  3I5F B;  1HT9 A;  2L0P A;  4USL A;  1K94 A;  2OTG C;  1XO5 A;  2MA2 A;  1K95 A;  2L4H A;  3JTD B;  1MXE A;  1J7Q A;  4E68 A;  1TOP A;  1L2O B;  3CGA A;  2KAX A;  4GUK A;  2M29 A;  4GNK B;  5HYD A;  1OZS A;  2M0R A;  1ZOT B;  2BCX A;  2KI4 C;  3CZT X;  1A75 B;  4DIR A;  1K2H A;  2CBL A;  1KFX L;  3CR2 A;  2LVV A;  4MRY A;  5JOL A;  3GK4 X;  4D1E A;  2NZ0 A;  2L51 A;  1EG4 A;  1YR5 A;  1LKJ A;  4GGF C;  4NDB A;  2ZRS A;  1A03 A;  3D0Y B;  1S1E A;  2JTZ A;  2M1U A;  3BYA A;  5DKN A;  3JTD C;  3TDZ A;  2K7D A;  4XJK A;  2HQ8 A;  3E3R A;  5KTY A;  1FW4 A;  2Q4U A;  3BUO B;  1TIZ A;  3OX6 A;  1IKU A;  1SNL A;  3FIA A;  1KQV A;  5CSN A;  1B7T Y;  3KO0 A;  2PAS A;  2PMY A;  2WC8 A;  1NX0 A;  4CLN A;  4M2O A;  5D7F A;  1DVI A;  1IRJ A;  2FCE A;  1F4Q A;  3BOW B;  3RLZ A;  3OP0 A;  2LVJ A;  4M2P A;  1UHH A;  1G33 A;  3LK0 A;  1W7J B;  1ZUZ A;  3TS5 B;  3F45 A;  4C0K A;  2KGB C;  1YRT B;  1QLK A;  1B8C A;  1JUO A;  3EK7 A;  2GV5 A;  1R2U A;  3GK2 A;  4YGB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...