5HLVA

Crystal structure of calcium and zinc-bound human s100a8 in space group p212121
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
89
structure length
89
Chain Sequence
ALTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A8
publication title Crystal structure of human S100A8 in complex with zinc and calcium.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 36
structure length 89
sequence length 89
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5hlvA00
1ZMZA 2JT8A 2L50A 3NSOA 3BXKA 3AKAA 2ZRSA 1M31A 2L0PA 4DRWA 1U5IB 2M3WA 1SPYA 1BU3A 3BYAA 1Q80A 1B8CA 2KI4C 3PM8A 1SL8A 2LUXA 3NSIA 1YX7A 2KSPA 2KQ6A 4ZCUA 1TN4A 2O60A 1PVAA 2COLB 2K61A 4P5OE 5HKZA 1IKUA 1KFUL 1B1GA 2KNEA 4GNKB 2BL0C 4PDZA 4I5NB 1QTXA 3VRQA 2M9GA 2KAVA 4GGFC 1JBAA 3EKHA 2F2PA 3JVTB 3HCMA 3IQOA 5KU1A 1IQ5A 1DTLA 1K9UA 3IF7A 1MR8A 4OV2A 1A4PA 3ZWHA 1EH2A 1MXLC 1DJXA 1L7ZA 5TNCA 3WHUB 3RM1A 2I18A 2JT0A 4A4BA 2GGZA 1GQMA 1R6PA 1SKTA 2JQ6A 1S3PA 1QV0A 1QV1A 1XVJA 1J1EA 2WCBA 2PALA 1FI5A 1UHKA 2JNXA 2MJWB 2SCPA 3CR4X 4MRXA 2JPTA 2K7BA 3BUXB 4OKHA 2K8MB 1BMOA 2AMIA 3PLFB 1E8AA 3HX4A 1B8RA 4L9MA 1OSAA 3JTDB 4F0ZB 1KCYA 1ALVA 3SG7A 2CTNA 2ZNEA 1ODBA 3TDUA 2NLNA 3D0YA 2M29A 4PE1A 2TN4A 2ZN9A 2BECA 4TNCA 4WRIA 1DF0B 1H8BA 3F45A 2BE4A 3CR2A 3VRNA 1WRKA 3ZNIA 1B47A 1SY9A 1K90D 2M8UA 1A75B 4AQIA 1S26D 2ZRTA 2HPSA 2D8NA 2Q4UA 2E30A 4BY4A 1HQVA 2OS8C 4ZCVA 1XFYO 2BCXA 4YGCB 3D0YB 5DKQA 4CFRA 1A2XA 2PSRA 1ALWA 3EK4A 2LLSA 1K94A 3E3RA 2JXLA 1IWQA 3BUMB 2PRUA 1Y1UA 1S6JA 1QXPA 4PE7A 1YRUB 3OHMB 4XJKA 1UURA 1YVHA 3OB1B 1S6CA 3KHEA 2BE6A 1F71A 5CSJA 1N65A 1OMDA 1BR4B 1YX8A 2BBNA 2ZNDA 4ICBA 2O5GA 5I2QA 2LVVA 1CDNA 2KFFA 2QACA 4XJKB 1UWOA 3LK1A 1GGZA 1RTP1 3PN7B 1H4BA 5DKNA 1PALA 2F33A 1L2OC 5BPJA 4MN0A 1TCFA 4JPZB 1RROA 1PSBA 1RFJA 1SRAA 4NDDA 1CLMA 2AUCA 2Y4QA 4YGDB 1SK6D 4P2YB 5JJGA 3IQQA 1XK4C 1NSHA 1NX2A 1FPWA 4GUKA 1DJGA 2F3YA 4M2QA 5ER4X 1QVIY 3TS5B 2HQ8A 1J7RA 3O78A 1MWNA 4YGEB 2EC6C 1X02A 2WCEA 3PFVA 1FI6A 2JOJA 2OPOA 1EXRA 2I94A 3I5IC 1JSAA 2MRDA 1CMGA 1SCMC 1NYAA 2L4IA 4PE0A 1TCOB 3AAJA 2HF5A 3DF0B 1S36A 1SL9A 2A4JA 3BOWB 4XYNA 3TDIA 1Y0VH 1G8IA 5AFPA 1KK8B 1CLLA 1QLSA 1ZOTB 1N0YA 5CSNA 5HLVA 1BF5A 2LMVA 1YRTB 4C0KA 3WNXB 1OQPA 1VRKA 3TUYC 1MHOA 3EK7A 1DGUA 4FTGA 1DMOA 2V53A 2E6WA 3AAKA 1JUOA 2LC5A 3BUWB 1D1OA 2F3ZA 2NCOA 3K21A 2BL0B 2LANA 4WQ2A 1U5IA 1DVIA 3I5HB 2FJUB 1MXEA 1C7WA 2JWWA 2HQWA 2ZKMX 1MQ1A 3OP0A 2B1UA 2MLFC 3FS7A 4CFQA 1TTXA 1YVLA 4DS7A 4YRUA 2BKHB 2GV5A 1W7IB 1IRJA 2JXCA 4OCIA 1RJVA 2JU0A 1PVBA 4PCWA 4YI8A 2K7CA 3A4UB 4I5JA 1S6IA 3SG5A 2L98A 1F54A 2IS9A 2JT3A 3KPXA 3CWGA 3OX6A 1JC2A 3VRRA 2H61A 2MAZA 2JC2A 2K7OA 4AQJA 3D10A 1LA3A 1TIZA 4HRGA 4NDCA 1UHNA 2KHNA 2SASA 1M39A 4GFTA 3I5HC 2JRFA 3WHTB 1QVIZ 4USLA 3NSLA 4JWQA 4U8DA 1DJWA 1DJZA 4ORAB 3VGOA 4DUQA 1OMVA 1ZUZA 1LVCD 4MEWA 4PHMA 2KYCA 3DVJA 1B7TY 2CNPA 1XA5A 1NX0A 1S1EA 2KAXA 2KOTA 2LMTA 2OS8B 1KQVA 4PHNA 4QJ5B 1EG4A 4WQ3A 2I2RE 1SNLA 3MSEB 3DD4A 2LVJA 2BKIB 1XFWO 1CM4A 1DF0A 2LHIA 3LCPC 1Y1AA 5I2OA 1OZOA 2KFHA 3DVEA 1SR6C 1A75A 1BT6A 1LA0A 1XFZO 2G2BA 2ZN8A 3KF9A 1MF8B 1F4OA 4ORBB 2JNFA 1MUXA 2LNKA 1DJYA 2P6BB 5ER5A 1TOPA 2M49B 1C7VA 2JZIA 3SG4A 1AK8A 1KFXL 1OOJA 2FCEA 1CFCA 1XK4A 1QASA 4YBHB 2KI6C 1RK9A 3A8RA 1CNPA 1L2OB 5AEQA 5FYXA 3AKBA 4I5LB 1UUSA 4IL1A 4M2PA 2R2IA 1A03A 2M97A 3M0WA 1UP5A 5F6TA 1NCZA 5GQQC 1DJHA 1BOCA 1Y1XA 5JOLA 1TNXA 1FBVA 4OR9B 1YUUA 2JTTA 4GGNA 2EC6B 1CFDA 1EG3A 2MBXA 3I5IB 4D1EA 4DIRA 2LM5A 3CGAA 1WDCB 1SCMB 1WY9A 2KGRA 2LLUA 2M1KB 1F4QA 4HSZA 4GPLB 1NPQA 1B7TZ 2HETA 3BUOB 1QX7A 1OZSA 5D69A 2F2OA 4MVFA 2LVIA 2EHBA 3NSKA 2LVKA 4R1EA 3NXAA 1WLMA 3TUYB 4C0JA 5AANA 1YURA 1KSMA 1J7PA 4PALA 3QRXA 1S5GY 3SIAA 3DF0A 3BOWA 3I5FB 2OTGC 1R2UA 3TZ1A 1DGVA 1IJ5A 1J7OA 4YGAA 1WDCC 1CDPA 1CMFA 1JWDA 4N5XA 3CS1A 2NXQA 4YGBB 3O6BA 5IBWA 1DT7B 1JFKA 3EK8A 2BCAA 2LE9B 4GGFA 1BR1B 1V1GA 2K0JA 2G9BA 1SW8A 5K89A 3SG3A 3BUNB 3VRPA 3VROA 2CT9A 2L5XB 1K9KA 3I5FC 1K96A 4I5KA 2KBMA 1F70A 4MLWA 1KWOC 1N2DA 1KQMC 4OVNF 1EJ3A 1IGVA 3SIBA 2KAYA 2BBMA 2Q91A 2Y1NA 1PULA 4FQOA 4MZJA 5PALA 4A4CA 4BY5A 1CKKA 2F8PA 2FOTA 3CZTX 5J3XA 2MHHA 1YR5A 2AAOA 2DOQA 4UPGA 2CBLA 1BODA 4N1FA 3FWBA 1A29A 1YTZC 3GOFA 1JF2A 4GBAA 4N1GA 1RECA 1TRFA 2Y5IA 4NQGA 3LLEA 4ORCB 1AUIB 3I5GC 3PALA 1SCVA 1M63B 5CPVA 3KEVA 1HT9A 2WORA 2BCBA 3GK2A 1QLKA 1PRWA 1S5GZ 1SR6B 2K7DA 1K9PA 3LL8B 1OMRA 1DJIA 1YUTA 5AXIA 5I8NA 2EGDA 1Y6WA 3PATA 1GJYA 3OB2B 4MZLA 4JQ0D 3CLNA 1SBJA 1FW4A 1G4YR 4DCKA 1XFXO 5D7FA 1ZFSA 1SMGA 1YUSA 2WCFA 2KQYA 3FWCA 2PASA 3EVUA 3FIAA 4CPVA 1IJ6A 1BJFA 1LKJA 3GK1A 2VRGA 1B8LA 2LMUA 5I2LA 1KK8C 1WRZA 3OX5A 4PE4A 1IG5A 1PK0D 1G33A 2FCDA 1CFPA 2KGBC 1SYMA 5G08A 1FF1A 2KI6D 1NX3A 1XO5A 2M7LA 1EL4A 2LP3A 2RGIA 1J55A 2PMYA 1F55A 3SJSA 1UHJA 2JULA 1C07A 1LINA 1BG1A 1ZACA 2LUCA 2WC8A 2I7AA 3JVTC 1AP4A 1V1FA 1JFJA 4HREE 2WOSA 2LAPA 5CSIA 4MRYA 1B4CA 2H61C 4NDBA 2PVBA 1BLQA 3EVVA 2LHLA 2OTGB 3DVKA 4HRHA 3LK0A 4CLNA 2MA2A 4QJ3B 1UHIA 5CSFA 2K2FA 1J1DA 1B9AA 3CR5X 2K2AA 2L51A 2JTZA 2L4HA 1KK7Y 2M1UA 3C1VA 5B8IB 1GGWA 1K95A 2KYFA 2NCPA 1QJTA 4CIDA 1NWDA 1AVSA 2LCPA 1NCYA 1QATA 4MSPA 2CXJA 3ICBA 3JTDC 1W7JB 4YI9A 1WLZA 1TNWA 3EKJA 5DKRA 1WRLA 1XFVO 1KFUS 1K93D 5HKYA 1K8UA 5HYDA 1XYDA 1KSOA 3SG2A 3EVRA 1J7QA 1RWYA 1TNPA 4GAOA 2LV7A 1K2HA 1QX2A 1KWOB 4QJ4B 1CLBA 1KQMB 4PHJA 2L2EA 3RLZA 2MLEC 1XFUO 1IQ3A 1NP8A 3O2PA 5KSZA 2GGMA 3H4SE 1M46A 2M7NA 2QPTA 1NUBA 1UHHA 2NZ0A 3DVMA 2LP2A 1NIWA 2KFGA 3CTNA 1CDMA 5HKWA 3I5GB 1AJ5A 2CCMA 4E68A 1CTRA 1QX5B 1SL7A 2KBIA 2LLTA 5AERA 1AHRA 1CFFA 1CB1A 5HLOA 4M2OA 2M0RA 1NX1A 4ETOA 1OE9B 1IH0A 2WNDA 1QS7A 1F8HA 2ZFDA 3GK4X 4MZKA 3PN7C 3PSRA 4C0LA 3WXAA 1KK7Z 2KI4B 4PHKA 1M45A 2ISDA 1KFXS 1TNQA 3SG6A 1AJ4A 2KDHA 3BQ3A 3TDZA 4Q04A 5KTYA 1LXFC 1CDLA 1PSRA 3KO0A 1JF0A 3TS5C 3O4YA 2H2KA 1QIWA 2Y1MA 4MBEA 4AOMA 1NCXA 1QIVA 1CM1A
chains in the Genus database with same CATH superfamily
1ZMZA 2JT8A 2L50A 3OBVA 3NSOA 3BXKA 3AKAA 2ZRSA 1DC1A 1M31A 2L0PA 4DRWA 1U5IB 2M3WA 1SPYA 1BU3A 3BYAA 1Q80A 1B8CA 2KI4C 3PM8A 1SL8A 2LUXA 3NSIA 1YX7A 2KSPA 2KPHA 2KQ6A 4ZCUA 1TN4A 2O60A 2BNXA 1PVAA 2COLB 2K61A 4P5OE 5HKZA 1IKUA 1KFUL 1B1GA 2KNEA 4GNKB 2BL0C 4PDZA 2FJYA 1QTXA 4I5NB 3VRQA 2M9GA 2KAVA 4GGFC 1JBAA 3EKHA 2F2PA 3JVTB 3HCMA 3IQOA 5KU1A 1IQ5A 1DTLA 1K9UA 3IF7A 2KLEA 1MR8A 4OV2A 5FI6A 1A4PA 3ZWHA 1EH2A 1MXLC 1DJXA 1L7ZA 5TNCA 3WHUB 3RM1A 2I18A 2JT0A 4A4BA 2JPOA 2GGZA 1GQMA 1R6PA 1SKTA 2JQ6A 1S3PA 2QDIA 1QV0A 1QV1A 1XVJA 1J1EA 2WCBA 2PALA 3OGNA 1FI5A 1UHKA 2JNXA 2MJWB 2SCPA 3CR4X 4MRXA 2JPTA 2K7BA 3BUXB 4OKHA 2K8MB 1BMOA 2AMIA 3PLFB 1E8AA 3HX4A 1B8RA 4L9MA 1OSAA 3JTDB 4F0ZB 1KCYA 1ALVA 3SG7A 2CTNA 2ZNEA 1ODBA 3TDUA 3B87A 2NLNA 3D0YA 2M29A 4PE1A 2TN4A 2ZN9A 2BECA 4TNCA 4WRIA 1DF0B 3S0FA 1H8BA 3F45A 2BE4A 3CR2A 3VRNA 1WRKA 3ZNIA 1B47A 1SY9A 1C3YA 1K90D 2M8UA 1A75B 4AQIA 1S26D 2ZRTA 4F7FA 2HPSA 1OOHA 2D8NA 2Q4UA 2E30A 4BY4A 1HQVA 2OS8C 4ZCVA 1XFYO 2BCXA 3CZ0A 4YGCB 3D0YB 5DKQA 4CFRA 1A2XA 2PSRA 1ALWA 3EK4A 2ERBA 2LLSA 3BFHA 1K94A 3E3RA 2JXLA 1IWQA 3BUMB 5HL1A 2PRUA 1Y1UA 1S6JA 1QXPA 4PE7A 1YRUB 3OHMB 3BFAA 4OZDA 4XJKA 1UURA 1YVHA 3OB1B 1S6CA 3KHEA 3D74A 2BE6A 1F71A 1TUZA 5CSJA 1N65A 1OMDA 2PQLA 1BR4B 1YX8A 2BBNA 2ZNDA 4ICBA 2O5GA 5I2QA 2LVVA 3DZTA 1CDNA 2KFFA 2QACA 1TUJA 4XJKB 1UWOA 3LK1A 1GGZA 1RTP1 3PN7B 1H4BA 5DKNA 1PALA 2F33A 3B7AA 1L2OC 5BPJA 4MN0A 1TCFA 4JPZB 1RROA 1PSBA 1RFJA 1SRAA 4NDDA 1CLMA 2AUCA 2Y4QA 3S0EA 4YGDB 1SK6D 4P2YB 5JJGA 3IQQA 3QMEA 1XK4C 1NSHA 1NX2A 1FPWA 3R1VA 4GUKA 1DJGA 2F3YA 2P70A 4M2QA 2WCJA 5ER4X 1QVIY 3TS5B 2HQ8A 3L4LA 1J7RA 3O78A 1MWNA 4YGEB 2EC6C 1X02A 2WCEA 3IVTA 3PFVA 1FI6A 2JOJA 2OPOA 1EXRA 2I94A 3I5IC 1JSAA 2MRDA 1CMGA 1SCMC 1NYAA 2L4IA 2YGUA 1TCOB 4PE0A 3AAJA 2HF5A 3DF0B 1S36A 1SL9A 2A4JA 3BOWB 4XYNA 3TDIA 1Y0VH 1G8IA 3EG5B 1KK8B 5AFPA 1CLLA 1QLSA 1ZOTB 1N0YA 5CSNA 5HLVA 1BF5A 2LMVA 3DY9A 1YRTB 4C0KA 3R1OA 3WNXB 1OQPA 1VRKA 3TUYC 1MHOA 3EK7A 1DGUA 4FTGA 1DMOA 2V53A 2E6WA 3B6XA 3AAKA 1JUOA 2LC5A 3BUWB 3D73A 5D3OA 1D1OA 3PJIA 2F3ZA 2NCOA 3B88A 3K21A 2BL0B 2LANA 4WQ2A 1U5IA 2BAPA 1DVIA 3FE6A 3I5HB 2FJUB 1MXEA 1C7WA 2JWWA 2HQWA 2ZKMX 3D77A 1MQ1A 3OP0A 2KLDA 2QEBA 2B1UA 2MLFC 3FS7A 4CFQA 2WCMA 1TTXA 1YVLA 4DS7A 4YRUA 2BKHB 2GV5A 2QEOA 1W7IB 1IRJA 2JXCA 4OCIA 1RJVA 2JU0A 1PVBA 4PCWA 4YI8A 2K7CA 3A4UB 4I5JA 1S6IA 3SG5A 1IIOA 2L98A 1F54A 2IS9A 3R72A 2JT3A 1DEKA 3KPXA 3CWGA 3OX6A 1JC2A 3VRRA 2H61A 2MAZA 2JC2A 2K7OA 4AQJA 3D10A 1LA3A 1TIZA 4HRGA 4NDCA 1UHNA 2KHNA 2SASA 1M39A 4GFTA 3I5HC 2JRFA 3WHTB 1QVIZ 4USLA 3NSLA 4JWQA 4U8DA 1DJWA 1DJZA 4ORAB 3VGOA 4DUQA 1OMVA 1ZUZA 1LVCD 1XFRA 4MEWA 2KYCA 4PHMA 3DVJA 1B7TY 2CNPA 1XA5A 4IJ7A 1NX0A 1S1EA 1Z2CB 2KAXA 2KOTA 2LMTA 2PYQA 2OS8B 4JD9A 4KYNA 1KQVA 4PHNA 4QJ5B 3N7HA 3VB1A 1EG4A 4WQ3A 2I2RE 1SNLA 3MSEB 3DD4A 2LVJA 2BKIB 1XFWO 1CM4A 1DF0A 2LHIA 3LCPC 1Y1AA 5I2OA 1OZOA 2KFHA 3DVEA 1SR6C 1A75A 1BT6A 1LA0A 1XFZO 2G2BA 2ZN8A 3D75A 1MF8B 3KF9A 1F4OA 4ORBB 2JNFA 3L47A 1MUXA 2LNKA 1DJYA 2P6BB 5ER5A 3S0GA 1TOPA 2M49B 1C7VA 2JZIA 3SG4A 1AK8A 1KFXL 1OOJA 2FCEA 1CFCA 5FI2A 1C3ZA 1XK4A 1QASA 4YBHB 2KI6C 1RK9A 3A8RA 1CNPA 3NHTA 1L2OB 2L5YA 2K60A 5FYXA 2P71A 5AEQA 3AKBA 4I5LB 1UUSA 4IL1A 4M2PA 2R2IA 1A03A 3K1EA 2M97A 3M0WA 1UP5A 5F6TA 1NCZA 3L4AA 5GQQC 3S0AA 1DJHA 1BOCA 1Y1XA 5JOLA 1TNXA 1FBVA 4OR9B 1YUUA 2JTTA 4GGNA 2EC6B 1CFDA 1EG3A 2MBXA 3I5IB 4D1EA 4DIRA 2LM5A 3CGAA 1WDCB 1SCMB 1WY9A 2KGRA 2LLUA 2M1KB 1F4QA 4HSZA 4GPLB 1NPQA 1B7TZ 2HETA 2WCLA 1QX7A 1OZSA 3BUOB 5D69A 2F2OA 4MVFA 2LVIA 2EHBA 3NSKA 2LVKA 4R1EA 3NXAA 1WLMA 3TUYB 4C0JA 5AANA 1YURA 1KSMA 1J7PA 4PALA 3QRXA 1S5GY 3SIAA 3DF0A 1OW4A 3BOWA 2OTGC 3I5FB 5I94A 2QEVA 1R2UA 3CYZA 1W9ZA 3TZ1A 1DGVA 1IJ5A 1J7OA 4YGAA 1WDCC 1NCXA 4INWA 1CDPA 1OOFA 1CMFA 1JWDA 4N5XA 3CS1A 2NXQA 2QEHA 3V2LA 1T14A 4YGBB 3O6BA 5IBWA 1DT7B 1JFKA 3EK8A 2BCAA 2LE9B 4GGFA 1BR1B 1V1GA 3SS4A 2K0JA 2G9BA 3O4XA 1SW8A 5K89A 4FQTA 3SG3A 3BUNB 3VRPA 3VROA 2CT9A 2L5XB 1K9KA 3I5FC 1K96A 4I5KA 5FI7A 2KBMA 1F70A 4MLWA 1KWOC 1N2DA 1KQMC 4OVNF 1EJ3A 1IGVA 3SIBA 2KAYA 2BBMA 2Q91A 2Y1NA 1PULA 4FQOA 4MZJA 5PALA 4A4CA 4BY5A 1CKKA 2F8PA 2FOTA 3CZTX 3UNWA 5J3XA 3FE9A 2MHHA 3RZSA 1YR5A 2AAOA 2DOQA 4UPGA 2H8VA 2CBLA 1BODA 4N1FA 3FWBA 1A29A 1YTZC 3GOFA 1JF2A 4GBAA 4N1GA 1RECA 1TRFA 2Y5IA 4NQGA 1OOGA 3LLEA 4ORCB 1AUIB 3I5GC 2GTEA 3PALA 1SCVA 1M63B 5CPVA 3KEVA 1HT9A 2WORA 2BCBA 3GK2A 1QLKA 1PRWA 1S5GZ 1SR6B 2K7DA 1K9PA 3LL8B 1OMRA 1DJIA 1YUTA 5AXIA 5I8NA 2EGDA 1Y6WA 3PATA 1GJYA 3OB2B 3CDNA 4MZLA 4JQ0D 3SS5A 2WCKA 3SS3A 3CLNA 1SBJA 1FW4A 1G4YR 4DCKA 1XFXO 5D7FA 1ZFSA 1SMGA 1YUSA 2WCFA 2KQYA 3FWCA 2PASA 3EVUA 3FIAA 4INXA 1IJ6A 4CPVA 1BJFA 1LKJA 3GK1A 2VRGA 1B8LA 2LMUA 5I2LA 1KK8C 1WRZA 3OX5A 4PE4A 3BJHA 1IG5A 2L2CA 1PK0D 1G33A 4PT1A 3CZ2A 2FCDA 1CFPA 2KGBC 1SYMA 3NGVA 5G08A 3CABA 1FF1A 2KI6D 1NX3A 2WCHA 1XO5A 1DELA 2M7LA 1EL4A 2LP3A 1TWOA 2RGIA 3DXLA 1J55A 2PMYA 3D78A 1F55A 3SJSA 1UHJA 2JULA 1C07A 1LINA 1BG1A 1OOIX 1ZACA 2LUCA 2WC8A 2I7AA 3JVTC 2WC5A 1AP4A 1V1FA 1JFJA 4HREE 2WOSA 2LAPA 5CSIA 4MRYA 1B4CA 2H61C 4NDBA 2PVBA 1BLQA 3EVVA 2LHLA 2OTGB 3DVKA 4HRHA 3S0DA 3LK0A 4CLNA 2MA2A 4QJ3B 3BFBA 1UHIA 5CSFA 2K2FA 1J1DA 1B9AA 3CR5X 2K2AA 2L51A 1Z4HA 2JTZA 2L4HA 1KK7Y 2M1UA 3C1VA 3UO9A 5B8IB 1GGWA 1K95A 2KYFA 2NCPA 1QJTA 4CIDA 1NWDA 1AVSA 2LCPA 1NCYA 1QATA 3NHIA 4MSPA 2CXJA 3ICBA 3JTDC 1W7JB 4YI9A 1WLZA 1SSEB 1TNWA 3EKJA 5DKRA 1WRLA 1XFVO 1KFUS 1K93D 5HKYA 1K8UA 5HYDA 1XYDA 1KSOA 3S0BA 3SG2A 3EVRA 3Q8IA 1RWYA 1J7QA 1TNPA 4GAOA 2LV7A 1K2HA 1QX2A 1KWOB 1ORGA 4QJ4B 1CLBA 1KQMB 4PHJA 2L2EA 3RLZA 1QWVA 1XFUO 2MLEC 1IQ3A 1NP8A 3O2PA 5KSZA 3R1PA 2GGMA 4JKTA 3H4SE 1M46A 2M7NA 2QPTA 1NUBA 1UHHA 2NZ0A 3DVMA 2LP2A 3CZ1A 1NIWA 2KFGA 3CTNA 1CDMA 5HKWA 3I5GB 1AJ5A 2CCMA 4E68A 1CTRA 1QX5B 3D76A 1SL7A 2KBIA 2LLTA 5AERA 1AHRA 1CFFA 1CB1A 5HLOA 4M2OA 2M0RA 1NX1A 4ETOA 1OE9B 1IH0A 2WNDA 1QS7A 5DICA 1F8HA 2ZFDA 1GM0A 5EL2A 3GK4X 4MZKA 3B86A 3PN7C 3DYEA 3PSRA 4C0LA 3WXAA 1KK7Z 2KI4B 4PHKA 1LS8A 1DQEA 1M45A 2ISDA 1KFXS 1TNQA 3SG6A 1AJ4A 2KDHA 3BQ3A 3TDZA 4Q04A 3PM2A 5KTYA 1LXFC 1CDLA 1PSRA 3KO0A 1JF0A 3TS5C 2WC6A 3O4YA 2H2KA 1QIWA 2Y1MA 4MBEA 3FE8A 4AOMA 1P28A 1QIVA 1CM1A
chains in the Genus database with same CATH topology
1ZMZA 2JT8A 2L50A 3NSOA 3BXKA 3AKAA 2ZRSA 1M31A 2L0PA 4DRWA 1U5IB 2M3WA 1SPYA 1BU3A 3BYAA 1Q80A 1B8CA 2KI4C 3PM8A 1SL8A 2LUXA 3NSIA 1YX7A 2KSPA 2KQ6A 4ZCUA 1TN4A 2O60A 1PVAA 2COLB 2K61A 4P5OE 5HKZA 1IKUA 1KFUL 1B1GA 2KNEA 4GNKB 2BL0C 4PDZA 4I5NB 1QTXA 3VRQA 2M9GA 2KAVA 4GGFC 1JBAA 3EKHA 2F2PA 3JVTB 3HCMA 3IQOA 5KU1A 1IQ5A 1DTLA 1K9UA 3IF7A 1MR8A 4OV2A 1A4PA 3ZWHA 1EH2A 1MXLC 1DJXA 1L7ZA 5TNCA 3WHUB 3RM1A 2I18A 2JT0A 4A4BA 2GGZA 1GQMA 1R6PA 1SKTA 2JQ6A 1S3PA 1QV0A 1QV1A 1XVJA 1J1EA 2WCBA 2PALA 1FI5A 1UHKA 2JNXA 2MJWB 2SCPA 3CR4X 4MRXA 2JPTA 2K7BA 3BUXB 4OKHA 2K8MB 1BMOA 2AMIA 3PLFB 1E8AA 3HX4A 1B8RA 4L9MA 1OSAA 3JTDB 4F0ZB 1KCYA 1ALVA 3SG7A 2CTNA 2ZNEA 1ODBA 3TDUA 2NLNA 3D0YA 2M29A 4PE1A 2TN4A 2ZN9A 2BECA 4TNCA 4WRIA 1DF0B 1H8BA 3F45A 2BE4A 3CR2A 3VRNA 1WRKA 3ZNIA 1B47A 1SY9A 1K90D 2M8UA 1A75B 4AQIA 1S26D 2ZRTA 2HPSA 2D8NA 2Q4UA 2E30A 4BY4A 1HQVA 2OS8C 4ZCVA 1XFYO 2BCXA 4YGCB 3D0YB 5DKQA 4CFRA 1A2XA 2PSRA 1ALWA 3EK4A 2LLSA 1K94A 3E3RA 2JXLA 1IWQA 3BUMB 2PRUA 1Y1UA 1S6JA 1QXPA 4PE7A 1YRUB 3OHMB 4XJKA 1UURA 1YVHA 3OB1B 1S6CA 3KHEA 2BE6A 1F71A 5CSJA 1N65A 1OMDA 1BR4B 1YX8A 2BBNA 2ZNDA 4ICBA 2O5GA 5I2QA 2LVVA 1CDNA 2KFFA 2QACA 4XJKB 1UWOA 3LK1A 1GGZA 1RTP1 3PN7B 1H4BA 5DKNA 1PALA 2F33A 1L2OC 5BPJA 4MN0A 1TCFA 4JPZB 1RROA 1PSBA 1RFJA 1SRAA 4NDDA 1CLMA 2AUCA 2Y4QA 4YGDB 1SK6D 4P2YB 5JJGA 3IQQA 1XK4C 1NSHA 1NX2A 1FPWA 4GUKA 1DJGA 2F3YA 4M2QA 5ER4X 1QVIY 3TS5B 2HQ8A 1J7RA 3O78A 1MWNA 4YGEB 2EC6C 1X02A 2WCEA 3PFVA 1FI6A 2JOJA 2OPOA 1EXRA 2I94A 3I5IC 1JSAA 2MRDA 1CMGA 1SCMC 1NYAA 2L4IA 4PE0A 1TCOB 3AAJA 2HF5A 3DF0B 1S36A 1SL9A 2A4JA 3BOWB 4XYNA 3TDIA 1Y0VH 1G8IA 5AFPA 1KK8B 1CLLA 1QLSA 1ZOTB 1N0YA 5CSNA 5HLVA 1BF5A 2LMVA 1YRTB 4C0KA 3WNXB 1OQPA 1VRKA 3TUYC 1MHOA 3EK7A 1DGUA 4FTGA 1DMOA 2V53A 2E6WA 3AAKA 1JUOA 2LC5A 3BUWB 1D1OA 2F3ZA 2NCOA 3K21A 2BL0B 2LANA 4WQ2A 1U5IA 1DVIA 3I5HB 2FJUB 1MXEA 1C7WA 2JWWA 2HQWA 2ZKMX 1MQ1A 3OP0A 2B1UA 2MLFC 3FS7A 4CFQA 1TTXA 1YVLA 4DS7A 4YRUA 2BKHB 2GV5A 1W7IB 1IRJA 2JXCA 4OCIA 1RJVA 2JU0A 1PVBA 4PCWA 4YI8A 2K7CA 3A4UB 4I5JA 1S6IA 3SG5A 2L98A 1F54A 2IS9A 2JT3A 3KPXA 3CWGA 3OX6A 1JC2A 3VRRA 2H61A 2MAZA 2JC2A 2K7OA 4AQJA 3D10A 1LA3A 1TIZA 4HRGA 4NDCA 1UHNA 2KHNA 2SASA 1M39A 4GFTA 3I5HC 2JRFA 3WHTB 1QVIZ 4USLA 3NSLA 4JWQA 4U8DA 1DJWA 1DJZA 4ORAB 3VGOA 4DUQA 1OMVA 1ZUZA 1LVCD 4MEWA 4PHMA 2KYCA 3DVJA 1B7TY 2CNPA 1XA5A 1NX0A 1S1EA 2KAXA 2KOTA 2LMTA 2OS8B 1KQVA 4PHNA 4QJ5B 1EG4A 4WQ3A 2I2RE 1SNLA 3MSEB 3DD4A 2LVJA 2BKIB 1XFWO 1CM4A 1DF0A 2LHIA 3LCPC 1Y1AA 5I2OA 1OZOA 2KFHA 3DVEA 1SR6C 1A75A 1BT6A 1LA0A 1XFZO 2G2BA 2ZN8A 3KF9A 1MF8B 1F4OA 4ORBB 2JNFA 1MUXA 2LNKA 1DJYA 2P6BB 5ER5A 1TOPA 2M49B 1C7VA 2JZIA 3SG4A 1AK8A 1KFXL 1OOJA 2FCEA 1CFCA 1XK4A 1QASA 4YBHB 2KI6C 1RK9A 3A8RA 1CNPA 1L2OB 5AEQA 5FYXA 3AKBA 4I5LB 1UUSA 4IL1A 4M2PA 2R2IA 1A03A 2M97A 3M0WA 1UP5A 5F6TA 1NCZA 5GQQC 1DJHA 1BOCA 1Y1XA 5JOLA 1TNXA 1FBVA 4OR9B 1YUUA 2JTTA 4GGNA 2EC6B 1CFDA 1EG3A 2MBXA 3I5IB 4D1EA 4DIRA 2LM5A 3CGAA 1WDCB 1SCMB 1WY9A 2KGRA 2LLUA 2M1KB 1F4QA 4HSZA 4GPLB 1NPQA 1B7TZ 2HETA 3BUOB 1QX7A 1OZSA 5D69A 2F2OA 4MVFA 2LVIA 2EHBA 3NSKA 2LVKA 4R1EA 3NXAA 1WLMA 3TUYB 4C0JA 5AANA 1YURA 1KSMA 1J7PA 4PALA 3QRXA 1S5GY 3SIAA 3DF0A 3BOWA 3I5FB 2OTGC 1R2UA 3TZ1A 1DGVA 1IJ5A 1J7OA 4YGAA 1WDCC 1CDPA 1CMFA 1JWDA 4N5XA 3CS1A 2NXQA 4YGBB 3O6BA 5IBWA 1DT7B 1JFKA 3EK8A 2BCAA 2LE9B 4GGFA 1BR1B 1V1GA 2K0JA 2G9BA 1SW8A 5K89A 3SG3A 3BUNB 3VRPA 3VROA 2CT9A 2L5XB 1K9KA 3I5FC 1K96A 4I5KA 2KBMA 1F70A 4MLWA 1KWOC 1N2DA 1KQMC 4OVNF 1EJ3A 1IGVA 3SIBA 2KAYA 2BBMA 2Q91A 2Y1NA 1PULA 4FQOA 4MZJA 5PALA 4A4CA 4BY5A 1CKKA 2F8PA 2FOTA 3CZTX 5J3XA 2MHHA 1YR5A 2AAOA 2DOQA 4UPGA 2CBLA 1BODA 4N1FA 3FWBA 1A29A 1YTZC 3GOFA 1JF2A 4GBAA 4N1GA 1RECA 1TRFA 2Y5IA 4NQGA 3LLEA 4ORCB 1AUIB 3I5GC 3PALA 1SCVA 1M63B 5CPVA 3KEVA 1HT9A 2WORA 2BCBA 3GK2A 1QLKA 1PRWA 1S5GZ 1SR6B 2K7DA 1K9PA 3LL8B 1OMRA 1DJIA 1YUTA 5AXIA 5I8NA 2EGDA 1Y6WA 3PATA 1GJYA 3OB2B 4MZLA 4JQ0D 3CLNA 1SBJA 1FW4A 1G4YR 4DCKA 1XFXO 5D7FA 1ZFSA 1SMGA 1YUSA 2WCFA 2KQYA 3FWCA 2PASA 3EVUA 3FIAA 4CPVA 1IJ6A 1BJFA 1LKJA 3GK1A 2VRGA 1B8LA 2LMUA 5I2LA 1KK8C 1WRZA 3OX5A 4PE4A 1IG5A 1PK0D 1G33A 2FCDA 1CFPA 2KGBC 1SYMA 5G08A 1FF1A 2KI6D 1NX3A 1XO5A 2M7LA 1EL4A 2LP3A 2RGIA 1J55A 2PMYA 1F55A 3SJSA 1UHJA 2JULA 1C07A 1LINA 1BG1A 1ZACA 2LUCA 2WC8A 2I7AA 3JVTC 1AP4A 1V1FA 1JFJA 4HREE 2WOSA 2LAPA 5CSIA 4MRYA 1B4CA 2H61C 4NDBA 2PVBA 1BLQA 3EVVA 2LHLA 2OTGB 3DVKA 4HRHA 3LK0A 4CLNA 2MA2A 4QJ3B 1UHIA 5CSFA 2K2FA 1J1DA 1B9AA 3CR5X 2K2AA 2L51A 2JTZA 2L4HA 1KK7Y 2M1UA 3C1VA 5B8IB 1GGWA 1K95A 2KYFA 2NCPA 1QJTA 4CIDA 1NWDA 1AVSA 2LCPA 1NCYA 1QATA 4MSPA 2CXJA 3ICBA 3JTDC 1W7JB 4YI9A 1WLZA 1TNWA 3EKJA 5DKRA 1WRLA 1XFVO 1KFUS 1K93D 5HKYA 1K8UA 5HYDA 1XYDA 1KSOA 3SG2A 3EVRA 1J7QA 1RWYA 1TNPA 4GAOA 2LV7A 1K2HA 1QX2A 1KWOB 4QJ4B 1CLBA 1KQMB 4PHJA 2L2EA 3RLZA 2MLEC 1XFUO 1IQ3A 1NP8A 3O2PA 5KSZA 2GGMA 3H4SE 1M46A 2M7NA 2QPTA 1NUBA 1UHHA 2NZ0A 3DVMA 2LP2A 1NIWA 2KFGA 3CTNA 1CDMA 5HKWA 3I5GB 1AJ5A 2CCMA 4E68A 1CTRA 1QX5B 1SL7A 2KBIA 2LLTA 5AERA 1AHRA 1CFFA 1CB1A 5HLOA 4M2OA 2M0RA 1NX1A 4ETOA 1OE9B 1IH0A 2WNDA 1QS7A 1F8HA 2ZFDA 3GK4X 4MZKA 3PN7C 3PSRA 4C0LA 3WXAA 1KK7Z 2KI4B 4PHKA 1M45A 2ISDA 1KFXS 1TNQA 3SG6A 1AJ4A 2KDHA 3BQ3A 3TDZA 4Q04A 5KTYA 1LXFC 1CDLA 1PSRA 3KO0A 1JF0A 3TS5C 3O4YA 2H2KA 1QIWA 2Y1MA 4MBEA 4AOMA 1NCXA 1QIVA 1CM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZMZ A;  2JT8 A;  2L50 A;  3NSO A;  3BXK A;  3AKA A;  2ZRS A;  1M31 A;  2L0P A;  4DRW A;  1U5I B;  2M3W A;  1SPY A;  1BU3 A;  3BYA A;  1Q80 A;  1B8C A;  2KI4 C;  3PM8 A;  1SL8 A;  2LUX A;  3NSI A;  1YX7 A;  2KSP A;  2KQ6 A;  4ZCU A;  1TN4 A;  2O60 A;  1PVA A;  2COL B;  2K61 A;  4P5O E;  5HKZ A;  1IKU A;  1KFU L;  1B1G A;  2KNE A;  4GNK B;  2BL0 C;  4PDZ A;  4I5N B;  1QTX A;  3VRQ A;  2M9G A;  2KAV A;  4GGF C;  1JBA A;  3EKH A;  2F2P A;  3JVT B;  3HCM A;  3IQO A;  5KU1 A;  1IQ5 A;  1DTL A;  1K9U A;  3IF7 A;  1MR8 A;  4OV2 A;  1A4P A;  3ZWH A;  1EH2 A;  1MXL C;  1DJX A;  1L7Z A;  5TNC A;  3WHU B;  3RM1 A;  2I18 A;  2JT0 A;  4A4B A;  2GGZ A;  1GQM A;  1R6P A;  1SKT A;  2JQ6 A;  1S3P A;  1QV0 A;  1QV1 A;  1XVJ A;  1J1E A;  2WCB A;  2PAL A;  1FI5 A;  1UHK A;  2JNX A;  2MJW B;  2SCP A;  3CR4 X;  4MRX A;  2JPT A;  2K7B A;  3BUX B;  4OKH A;  2K8M B;  1BMO A;  2AMI A;  3PLF B;  1E8A A;  3HX4 A;  1B8R A;  4L9M A;  1OSA A;  3JTD B;  4F0Z B;  1KCY A;  1ALV A;  3SG7 A;  2CTN A;  2ZNE A;  1ODB A;  3TDU A;  2NLN A;  3D0Y A;  2M29 A;  4PE1 A;  2TN4 A;  2ZN9 A;  2BEC A;  4TNC A;  4WRI A;  1DF0 B;  1H8B A;  3F45 A;  2BE4 A;  3CR2 A;  3VRN A;  1WRK A;  3ZNI A;  1B47 A;  1SY9 A;  1K90 D;  2M8U A;  1A75 B;  4AQI A;  1S26 D;  2ZRT A;  2HPS A;  2D8N A;  2Q4U A;  2E30 A;  4BY4 A;  1HQV A;  2OS8 C;  4ZCV A;  1XFY O;  2BCX A;  4YGC B;  3D0Y B;  5DKQ A;  4CFR A;  1A2X A;  2PSR A;  1ALW A;  3EK4 A;  2LLS A;  1K94 A;  3E3R A;  2JXL A;  1IWQ A;  3BUM B;  2PRU A;  1Y1U A;  1S6J A;  1QXP A;  4PE7 A;  1YRU B;  3OHM B;  4XJK A;  1UUR A;  1YVH A;  3OB1 B;  1S6C A;  3KHE A;  2BE6 A;  1F71 A;  5CSJ A;  1N65 A;  1OMD A;  1BR4 B;  1YX8 A;  2BBN A;  2ZND A;  4ICB A;  2O5G A;  5I2Q A;  2LVV A;  1CDN A;  2KFF A;  2QAC A;  4XJK B;  1UWO A;  3LK1 A;  1GGZ A;  1RTP 1;  3PN7 B;  1H4B A;  5DKN A;  1PAL A;  2F33 A;  1L2O C;  5BPJ A;  4MN0 A;  1TCF A;  4JPZ B;  1RRO A;  1PSB A;  1RFJ A;  1SRA A;  4NDD A;  1CLM A;  2AUC A;  2Y4Q A;  4YGD B;  1SK6 D;  4P2Y B;  5JJG A;  3IQQ A;  1XK4 C;  1NSH A;  1NX2 A;  1FPW A;  4GUK A;  1DJG A;  2F3Y A;  4M2Q A;  5ER4 X;  1QVI Y;  3TS5 B;  2HQ8 A;  1J7R A;  3O78 A;  1MWN A;  4YGE B;  2EC6 C;  1X02 A;  2WCE A;  3PFV A;  1FI6 A;  2JOJ A;  2OPO A;  1EXR A;  2I94 A;  3I5I C;  1JSA A;  2MRD A;  1CMG A;  1SCM C;  1NYA A;  2L4I A;  4PE0 A;  1TCO B;  3AAJ A;  2HF5 A;  3DF0 B;  1S36 A;  1SL9 A;  2A4J A;  3BOW B;  4XYN A;  3TDI A;  1Y0V H;  1G8I A;  5AFP A;  1KK8 B;  1CLL A;  1QLS A;  1ZOT B;  1N0Y A;  5CSN A;  5HLV A;  1BF5 A;  2LMV A;  1YRT B;  4C0K A;  3WNX B;  1OQP A;  1VRK A;  3TUY C;  1MHO A;  3EK7 A;  1DGU A;  4FTG A;  1DMO A;  2V53 A;  2E6W A;  3AAK A;  1JUO A;  2LC5 A;  3BUW B;  1D1O A;  2F3Z A;  2NCO A;  3K21 A;  2BL0 B;  2LAN A;  4WQ2 A;  1U5I A;  1DVI A;  3I5H B;  2FJU B;  1MXE A;  1C7W A;  2JWW A;  2HQW A;  2ZKM X;  1MQ1 A;  3OP0 A;  2B1U A;  2MLF C;  3FS7 A;  4CFQ A;  1TTX A;  1YVL A;  4DS7 A;  4YRU A;  2BKH B;  2GV5 A;  1W7I B;  1IRJ A;  2JXC A;  4OCI A;  1RJV A;  2JU0 A;  1PVB A;  4PCW A;  4YI8 A;  2K7C A;  3A4U B;  4I5J A;  1S6I A;  3SG5 A;  2L98 A;  1F54 A;  2IS9 A;  2JT3 A;  3KPX A;  3CWG A;  3OX6 A;  1JC2 A;  3VRR A;  2H61 A;  2MAZ A;  2JC2 A;  2K7O A;  4AQJ A;  3D10 A;  1LA3 A;  1TIZ A;  4HRG A;  4NDC A;  1UHN A;  2KHN A;  2SAS A;  1M39 A;  4GFT A;  3I5H C;  2JRF A;  3WHT B;  1QVI Z;  4USL A;  3NSL A;  4JWQ A;  4U8D A;  1DJW A;  1DJZ A;  4ORA B;  3VGO A;  4DUQ A;  1OMV A;  1ZUZ A;  1LVC D;  4MEW A;  4PHM A;  2KYC A;  3DVJ A;  1B7T Y;  2CNP A;  1XA5 A;  1NX0 A;  1S1E A;  2KAX A;  2KOT A;  2LMT A;  2OS8 B;  1KQV A;  4PHN A;  4QJ5 B;  1EG4 A;  4WQ3 A;  2I2R E;  1SNL A;  3MSE B;  3DD4 A;  2LVJ A;  2BKI B;  1XFW O;  1CM4 A;  1DF0 A;  2LHI A;  3LCP C;  1Y1A A;  5I2O A;  1OZO A;  2KFH A;  3DVE A;  1SR6 C;  1A75 A;  1BT6 A;  1LA0 A;  1XFZ O;  2G2B A;  2ZN8 A;  3KF9 A;  1MF8 B;  1F4O A;  4ORB B;  2JNF A;  1MUX A;  2LNK A;  1DJY A;  2P6B B;  5ER5 A;  1TOP A;  2M49 B;  1C7V A;  2JZI A;  3SG4 A;  1AK8 A;  1KFX L;  1OOJ A;  2FCE A;  1CFC A;  1XK4 A;  1QAS A;  4YBH B;  2KI6 C;  1RK9 A;  3A8R A;  1CNP A;  1L2O B;  5AEQ A;  5FYX A;  3AKB A;  4I5L B;  1UUS A;  4IL1 A;  4M2P A;  2R2I A;  1A03 A;  2M97 A;  3M0W A;  1UP5 A;  5F6T A;  1NCZ A;  5GQQ C;  1DJH A;  1BOC A;  1Y1X A;  5JOL A;  1TNX A;  1FBV A;  4OR9 B;  1YUU A;  2JTT A;  4GGN A;  2EC6 B;  1CFD A;  1EG3 A;  2MBX A;  3I5I B;  4D1E A;  4DIR A;  2LM5 A;  3CGA A;  1WDC B;  1SCM B;  1WY9 A;  2KGR A;  2LLU A;  2M1K B;  1F4Q A;  4HSZ A;  4GPL B;  1NPQ A;  1B7T Z;  2HET A;  3BUO B;  1QX7 A;  1OZS A;  5D69 A;  2F2O A;  4MVF A;  2LVI A;  2EHB A;  3NSK A;  2LVK A;  4R1E A;  3NXA A;  1WLM A;  3TUY B;  4C0J A;  5AAN A;  1YUR A;  1KSM A;  1J7P A;  4PAL A;  3QRX A;  1S5G Y;  3SIA A;  3DF0 A;  3BOW A;  3I5F B;  2OTG C;  1R2U A;  3TZ1 A;  1DGV A;  1IJ5 A;  1J7O A;  4YGA A;  1WDC C;  1CDP A;  1CMF A;  1JWD A;  4N5X A;  3CS1 A;  2NXQ A;  4YGB B;  3O6B A;  5IBW A;  1DT7 B;  1JFK A;  3EK8 A;  2BCA A;  2LE9 B;  4GGF A;  1BR1 B;  1V1G A;  2K0J A;  2G9B A;  1SW8 A;  5K89 A;  3SG3 A;  3BUN B;  3VRP A;  3VRO A;  2CT9 A;  2L5X B;  1K9K A;  3I5F C;  1K96 A;  4I5K A;  2KBM A;  1F70 A;  4MLW A;  1KWO C;  1N2D A;  1KQM C;  4OVN F;  1EJ3 A;  1IGV A;  3SIB A;  2KAY A;  2BBM A;  2Q91 A;  2Y1N A;  1PUL A;  4FQO A;  4MZJ A;  5PAL A;  4A4C A;  4BY5 A;  1CKK A;  2F8P A;  2FOT A;  3CZT X;  5J3X A;  2MHH A;  1YR5 A;  2AAO A;  2DOQ A;  4UPG A;  2CBL A;  1BOD A;  4N1F A;  3FWB A;  1A29 A;  1YTZ C;  3GOF A;  1JF2 A;  4GBA A;  4N1G A;  1REC A;  1TRF A;  2Y5I A;  4NQG A;  3LLE A;  4ORC B;  1AUI B;  3I5G C;  3PAL A;  1SCV A;  1M63 B;  5CPV A;  3KEV A;  1HT9 A;  2WOR A;  2BCB A;  3GK2 A;  1QLK A;  1PRW A;  1S5G Z;  1SR6 B;  2K7D A;  1K9P A;  3LL8 B;  1OMR A;  1DJI A;  1YUT A;  5AXI A;  5I8N A;  2EGD A;  1Y6W A;  3PAT A;  1GJY A;  3OB2 B;  4MZL A;  4JQ0 D;  3CLN A;  1SBJ A;  1FW4 A;  1G4Y R;  4DCK A;  1XFX O;  5D7F A;  1ZFS A;  1SMG A;  1YUS A;  2WCF A;  2KQY A;  3FWC A;  2PAS A;  3EVU A;  3FIA A;  4CPV A;  1IJ6 A;  1BJF A;  1LKJ A;  3GK1 A;  2VRG A;  1B8L A;  2LMU A;  5I2L A;  1KK8 C;  1WRZ A;  3OX5 A;  4PE4 A;  1IG5 A;  1PK0 D;  1G33 A;  2FCD A;  1CFP A;  2KGB C;  1SYM A;  5G08 A;  1FF1 A;  2KI6 D;  1NX3 A;  1XO5 A;  2M7L A;  1EL4 A;  2LP3 A;  2RGI A;  1J55 A;  2PMY A;  1F55 A;  3SJS A;  1UHJ A;  2JUL A;  1C07 A;  1LIN A;  1BG1 A;  1ZAC A;  2LUC A;  2WC8 A;  2I7A A;  3JVT C;  1AP4 A;  1V1F A;  1JFJ A;  4HRE E;  2WOS A;  2LAP A;  5CSI A;  4MRY A;  1B4C A;  2H61 C;  4NDB A;  2PVB A;  1BLQ A;  3EVV A;  2LHL A;  2OTG B;  3DVK A;  4HRH A;  3LK0 A;  4CLN A;  2MA2 A;  4QJ3 B;  1UHI A;  5CSF A;  2K2F A;  1J1D A;  1B9A A;  3CR5 X;  2K2A A;  2L51 A;  2JTZ A;  2L4H A;  1KK7 Y;  2M1U A;  3C1V A;  5B8I B;  1GGW A;  1K95 A;  2KYF A;  2NCP A;  1QJT A;  4CID A;  1NWD A;  1AVS A;  2LCP A;  1NCY A;  1QAT A;  4MSP A;  2CXJ A;  3ICB A;  3JTD C;  1W7J B;  4YI9 A;  1WLZ A;  1TNW A;  3EKJ A;  5DKR A;  1WRL A;  1XFV O;  1KFU S;  1K93 D;  5HKY A;  1K8U A;  5HYD A;  1XYD A;  1KSO A;  3SG2 A;  3EVR A;  1J7Q A;  1RWY A;  1TNP A;  4GAO A;  2LV7 A;  1K2H A;  1QX2 A;  1KWO B;  4QJ4 B;  1CLB A;  1KQM B;  4PHJ A;  2L2E A;  3RLZ A;  2MLE C;  1XFU O;  1IQ3 A;  1NP8 A;  3O2P A;  5KSZ A;  2GGM A;  3H4S E;  1M46 A;  2M7N A;  2QPT A;  1NUB A;  1UHH A;  2NZ0 A;  3DVM A;  2LP2 A;  1NIW A;  2KFG A;  3CTN A;  1CDM A;  5HKW A;  3I5G B;  1AJ5 A;  2CCM A;  4E68 A;  1CTR A;  1QX5 B;  1SL7 A;  2KBI A;  2LLT A;  5AER A;  1AHR A;  1CFF A;  1CB1 A;  5HLO A;  4M2O A;  2M0R A;  1NX1 A;  4ETO A;  1OE9 B;  1IH0 A;  2WND A;  1QS7 A;  1F8H A;  2ZFD A;  3GK4 X;  4MZK A;  3PN7 C;  3PSR A;  4C0L A;  3WXA A;  1KK7 Z;  2KI4 B;  4PHK A;  1M45 A;  2ISD A;  1KFX S;  1TNQ A;  3SG6 A;  1AJ4 A;  2KDH A;  3BQ3 A;  3TDZ A;  4Q04 A;  5KTY A;  1LXF C;  1CDL A;  1PSR A;  3KO0 A;  1JF0 A;  3TS5 C;  3O4Y A;  2H2K A;  1QIW A;  2Y1M A;  4MBE A;  4AOM A;  1NCX A;  1QIV A;  1CM1 A; 
#chains in the Genus database with same CATH topology
 1ZMZ A;  2JT8 A;  2L50 A;  3OBV A;  3NSO A;  3BXK A;  3AKA A;  2ZRS A;  1DC1 A;  1M31 A;  2L0P A;  4DRW A;  1U5I B;  2M3W A;  1SPY A;  1BU3 A;  3BYA A;  1Q80 A;  1B8C A;  2KI4 C;  3PM8 A;  1SL8 A;  2LUX A;  3NSI A;  1YX7 A;  2KSP A;  2KPH A;  2KQ6 A;  4ZCU A;  1TN4 A;  2O60 A;  2BNX A;  1PVA A;  2COL B;  2K61 A;  4P5O E;  5HKZ A;  1IKU A;  1KFU L;  1B1G A;  2KNE A;  4GNK B;  2BL0 C;  4PDZ A;  2FJY A;  1QTX A;  4I5N B;  3VRQ A;  2M9G A;  2KAV A;  4GGF C;  1JBA A;  3EKH A;  2F2P A;  3JVT B;  3HCM A;  3IQO A;  5KU1 A;  1IQ5 A;  1DTL A;  1K9U A;  3IF7 A;  2KLE A;  1MR8 A;  4OV2 A;  5FI6 A;  1A4P A;  3ZWH A;  1EH2 A;  1MXL C;  1DJX A;  1L7Z A;  5TNC A;  3WHU B;  3RM1 A;  2I18 A;  2JT0 A;  4A4B A;  2JPO A;  2GGZ A;  1GQM A;  1R6P A;  1SKT A;  2JQ6 A;  1S3P A;  2QDI A;  1QV0 A;  1QV1 A;  1XVJ A;  1J1E A;  2WCB A;  2PAL A;  3OGN A;  1FI5 A;  1UHK A;  2JNX A;  2MJW B;  2SCP A;  3CR4 X;  4MRX A;  2JPT A;  2K7B A;  3BUX B;  4OKH A;  2K8M B;  1BMO A;  2AMI A;  3PLF B;  1E8A A;  3HX4 A;  1B8R A;  4L9M A;  1OSA A;  3JTD B;  4F0Z B;  1KCY A;  1ALV A;  3SG7 A;  2CTN A;  2ZNE A;  1ODB A;  3TDU A;  3B87 A;  2NLN A;  3D0Y A;  2M29 A;  4PE1 A;  2TN4 A;  2ZN9 A;  2BEC A;  4TNC A;  4WRI A;  1DF0 B;  3S0F A;  1H8B A;  3F45 A;  2BE4 A;  3CR2 A;  3VRN A;  1WRK A;  3ZNI A;  1B47 A;  1SY9 A;  1C3Y A;  1K90 D;  2M8U A;  1A75 B;  4AQI A;  1S26 D;  2ZRT A;  4F7F A;  2HPS A;  1OOH A;  2D8N A;  2Q4U A;  2E30 A;  4BY4 A;  1HQV A;  2OS8 C;  4ZCV A;  1XFY O;  2BCX A;  3CZ0 A;  4YGC B;  3D0Y B;  5DKQ A;  4CFR A;  1A2X A;  2PSR A;  1ALW A;  3EK4 A;  2ERB A;  2LLS A;  3BFH A;  1K94 A;  3E3R A;  2JXL A;  1IWQ A;  3BUM B;  5HL1 A;  2PRU A;  1Y1U A;  1S6J A;  1QXP A;  4PE7 A;  1YRU B;  3OHM B;  3BFA A;  4OZD A;  4XJK A;  1UUR A;  1YVH A;  3OB1 B;  1S6C A;  3KHE A;  3D74 A;  2BE6 A;  1F71 A;  1TUZ A;  5CSJ A;  1N65 A;  1OMD A;  2PQL A;  1BR4 B;  1YX8 A;  2BBN A;  2ZND A;  4ICB A;  2O5G A;  5I2Q A;  2LVV A;  3DZT A;  1CDN A;  2KFF A;  2QAC A;  1TUJ A;  4XJK B;  1UWO A;  3LK1 A;  1GGZ A;  1RTP 1;  3PN7 B;  1H4B A;  5DKN A;  1PAL A;  2F33 A;  3B7A A;  1L2O C;  5BPJ A;  4MN0 A;  1TCF A;  4JPZ B;  1RRO A;  1PSB A;  1RFJ A;  1SRA A;  4NDD A;  1CLM A;  2AUC A;  2Y4Q A;  3S0E A;  4YGD B;  1SK6 D;  4P2Y B;  5JJG A;  3IQQ A;  3QME A;  1XK4 C;  1NSH A;  1NX2 A;  1FPW A;  3R1V A;  4GUK A;  1DJG A;  2F3Y A;  2P70 A;  4M2Q A;  2WCJ A;  5ER4 X;  1QVI Y;  3TS5 B;  2HQ8 A;  3L4L A;  1J7R A;  3O78 A;  1MWN A;  4YGE B;  2EC6 C;  1X02 A;  2WCE A;  3IVT A;  3PFV A;  1FI6 A;  2JOJ A;  2OPO A;  1EXR A;  2I94 A;  3I5I C;  1JSA A;  2MRD A;  1CMG A;  1SCM C;  1NYA A;  2L4I A;  2YGU A;  1TCO B;  4PE0 A;  3AAJ A;  2HF5 A;  3DF0 B;  1S36 A;  1SL9 A;  2A4J A;  3BOW B;  4XYN A;  3TDI A;  1Y0V H;  1G8I A;  3EG5 B;  1KK8 B;  5AFP A;  1CLL A;  1QLS A;  1ZOT B;  1N0Y A;  5CSN A;  5HLV A;  1BF5 A;  2LMV A;  3DY9 A;  1YRT B;  4C0K A;  3R1O A;  3WNX B;  1OQP A;  1VRK A;  3TUY C;  1MHO A;  3EK7 A;  1DGU A;  4FTG A;  1DMO A;  2V53 A;  2E6W A;  3B6X A;  3AAK A;  1JUO A;  2LC5 A;  3BUW B;  3D73 A;  5D3O A;  1D1O A;  3PJI A;  2F3Z A;  2NCO A;  3B88 A;  3K21 A;  2BL0 B;  2LAN A;  4WQ2 A;  1U5I A;  2BAP A;  1DVI A;  3FE6 A;  3I5H B;  2FJU B;  1MXE A;  1C7W A;  2JWW A;  2HQW A;  2ZKM X;  3D77 A;  1MQ1 A;  3OP0 A;  2KLD A;  2QEB A;  2B1U A;  2MLF C;  3FS7 A;  4CFQ A;  2WCM A;  1TTX A;  1YVL A;  4DS7 A;  4YRU A;  2BKH B;  2GV5 A;  2QEO A;  1W7I B;  1IRJ A;  2JXC A;  4OCI A;  1RJV A;  2JU0 A;  1PVB A;  4PCW A;  4YI8 A;  2K7C A;  3A4U B;  4I5J A;  1S6I A;  3SG5 A;  1IIO A;  2L98 A;  1F54 A;  2IS9 A;  3R72 A;  2JT3 A;  1DEK A;  3KPX A;  3CWG A;  3OX6 A;  1JC2 A;  3VRR A;  2H61 A;  2MAZ A;  2JC2 A;  2K7O A;  4AQJ A;  3D10 A;  1LA3 A;  1TIZ A;  4HRG A;  4NDC A;  1UHN A;  2KHN A;  2SAS A;  1M39 A;  4GFT A;  3I5H C;  2JRF A;  3WHT B;  1QVI Z;  4USL A;  3NSL A;  4JWQ A;  4U8D A;  1DJW A;  1DJZ A;  4ORA B;  3VGO A;  4DUQ A;  1OMV A;  1ZUZ A;  1LVC D;  1XFR A;  4MEW A;  2KYC A;  4PHM A;  3DVJ A;  1B7T Y;  2CNP A;  1XA5 A;  4IJ7 A;  1NX0 A;  1S1E A;  1Z2C B;  2KAX A;  2KOT A;  2LMT A;  2PYQ A;  2OS8 B;  4JD9 A;  4KYN A;  1KQV A;  4PHN A;  4QJ5 B;  3N7H A;  3VB1 A;  1EG4 A;  4WQ3 A;  2I2R E;  1SNL A;  3MSE B;  3DD4 A;  2LVJ A;  2BKI B;  1XFW O;  1CM4 A;  1DF0 A;  2LHI A;  3LCP C;  1Y1A A;  5I2O A;  1OZO A;  2KFH A;  3DVE A;  1SR6 C;  1A75 A;  1BT6 A;  1LA0 A;  1XFZ O;  2G2B A;  2ZN8 A;  3D75 A;  1MF8 B;  3KF9 A;  1F4O A;  4ORB B;  2JNF A;  3L47 A;  1MUX A;  2LNK A;  1DJY A;  2P6B B;  5ER5 A;  3S0G A;  1TOP A;  2M49 B;  1C7V A;  2JZI A;  3SG4 A;  1AK8 A;  1KFX L;  1OOJ A;  2FCE A;  1CFC A;  5FI2 A;  1C3Z A;  1XK4 A;  1QAS A;  4YBH B;  2KI6 C;  1RK9 A;  3A8R A;  1CNP A;  3NHT A;  1L2O B;  2L5Y A;  2K60 A;  5FYX A;  2P71 A;  5AEQ A;  3AKB A;  4I5L B;  1UUS A;  4IL1 A;  4M2P A;  2R2I A;  1A03 A;  3K1E A;  2M97 A;  3M0W A;  1UP5 A;  5F6T A;  1NCZ A;  3L4A A;  5GQQ C;  3S0A A;  1DJH A;  1BOC A;  1Y1X A;  5JOL A;  1TNX A;  1FBV A;  4OR9 B;  1YUU A;  2JTT A;  4GGN A;  2EC6 B;  1CFD A;  1EG3 A;  2MBX A;  3I5I B;  4D1E A;  4DIR A;  2LM5 A;  3CGA A;  1WDC B;  1SCM B;  1WY9 A;  2KGR A;  2LLU A;  2M1K B;  1F4Q A;  4HSZ A;  4GPL B;  1NPQ A;  1B7T Z;  2HET A;  2WCL A;  1QX7 A;  1OZS A;  3BUO B;  5D69 A;  2F2O A;  4MVF A;  2LVI A;  2EHB A;  3NSK A;  2LVK A;  4R1E A;  3NXA A;  1WLM A;  3TUY B;  4C0J A;  5AAN A;  1YUR A;  1KSM A;  1J7P A;  4PAL A;  3QRX A;  1S5G Y;  3SIA A;  3DF0 A;  1OW4 A;  3BOW A;  2OTG C;  3I5F B;  5I94 A;  2QEV A;  1R2U A;  3CYZ A;  1W9Z A;  3TZ1 A;  1DGV A;  1IJ5 A;  1J7O A;  4YGA A;  1WDC C;  1NCX A;  4INW A;  1CDP A;  1OOF A;  1CMF A;  1JWD A;  4N5X A;  3CS1 A;  2NXQ A;  2QEH A;  3V2L A;  1T14 A;  4YGB B;  3O6B A;  5IBW A;  1DT7 B;  1JFK A;  3EK8 A;  2BCA A;  2LE9 B;  4GGF A;  1BR1 B;  1V1G A;  3SS4 A;  2K0J A;  2G9B A;  3O4X A;  1SW8 A;  5K89 A;  4FQT A;  3SG3 A;  3BUN B;  3VRP A;  3VRO A;  2CT9 A;  2L5X B;  1K9K A;  3I5F C;  1K96 A;  4I5K A;  5FI7 A;  2KBM A;  1F70 A;  4MLW A;  1KWO C;  1N2D A;  1KQM C;  4OVN F;  1EJ3 A;  1IGV A;  3SIB A;  2KAY A;  2BBM A;  2Q91 A;  2Y1N A;  1PUL A;  4FQO A;  4MZJ A;  5PAL A;  4A4C A;  4BY5 A;  1CKK A;  2F8P A;  2FOT A;  3CZT X;  3UNW A;  5J3X A;  3FE9 A;  2MHH A;  3RZS A;  1YR5 A;  2AAO A;  2DOQ A;  4UPG A;  2H8V A;  2CBL A;  1BOD A;  4N1F A;  3FWB A;  1A29 A;  1YTZ C;  3GOF A;  1JF2 A;  4GBA A;  4N1G A;  1REC A;  1TRF A;  2Y5I A;  4NQG A;  1OOG A;  3LLE A;  4ORC B;  1AUI B;  3I5G C;  2GTE A;  3PAL A;  1SCV A;  1M63 B;  5CPV A;  3KEV A;  1HT9 A;  2WOR A;  2BCB A;  3GK2 A;  1QLK A;  1PRW A;  1S5G Z;  1SR6 B;  2K7D A;  1K9P A;  3LL8 B;  1OMR A;  1DJI A;  1YUT A;  5AXI A;  5I8N A;  2EGD A;  1Y6W A;  3PAT A;  1GJY A;  3OB2 B;  3CDN A;  4MZL A;  4JQ0 D;  3SS5 A;  2WCK A;  3SS3 A;  3CLN A;  1SBJ A;  1FW4 A;  1G4Y R;  4DCK A;  1XFX O;  5D7F A;  1ZFS A;  1SMG A;  1YUS A;  2WCF A;  2KQY A;  3FWC A;  2PAS A;  3EVU A;  3FIA A;  4INX A;  1IJ6 A;  4CPV A;  1BJF A;  1LKJ A;  3GK1 A;  2VRG A;  1B8L A;  2LMU A;  5I2L A;  1KK8 C;  1WRZ A;  3OX5 A;  4PE4 A;  3BJH A;  1IG5 A;  2L2C A;  1PK0 D;  1G33 A;  4PT1 A;  3CZ2 A;  2FCD A;  1CFP A;  2KGB C;  1SYM A;  3NGV A;  5G08 A;  3CAB A;  1FF1 A;  2KI6 D;  1NX3 A;  2WCH A;  1XO5 A;  1DEL A;  2M7L A;  1EL4 A;  2LP3 A;  1TWO A;  2RGI A;  3DXL A;  1J55 A;  2PMY A;  3D78 A;  1F55 A;  3SJS A;  1UHJ A;  2JUL A;  1C07 A;  1LIN A;  1BG1 A;  1OOI X;  1ZAC A;  2LUC A;  2WC8 A;  2I7A A;  3JVT C;  2WC5 A;  1AP4 A;  1V1F A;  1JFJ A;  4HRE E;  2WOS A;  2LAP A;  5CSI A;  4MRY A;  1B4C A;  2H61 C;  4NDB A;  2PVB A;  1BLQ A;  3EVV A;  2LHL A;  2OTG B;  3DVK A;  4HRH A;  3S0D A;  3LK0 A;  4CLN A;  2MA2 A;  4QJ3 B;  3BFB A;  1UHI A;  5CSF A;  2K2F A;  1J1D A;  1B9A A;  3CR5 X;  2K2A A;  2L51 A;  1Z4H A;  2JTZ A;  2L4H A;  1KK7 Y;  2M1U A;  3C1V A;  3UO9 A;  5B8I B;  1GGW A;  1K95 A;  2KYF A;  2NCP A;  1QJT A;  4CID A;  1NWD A;  1AVS A;  2LCP A;  1NCY A;  1QAT A;  3NHI A;  4MSP A;  2CXJ A;  3ICB A;  3JTD C;  1W7J B;  4YI9 A;  1WLZ A;  1SSE B;  1TNW A;  3EKJ A;  5DKR A;  1WRL A;  1XFV O;  1KFU S;  1K93 D;  5HKY A;  1K8U A;  5HYD A;  1XYD A;  1KSO A;  3S0B A;  3SG2 A;  3EVR A;  3Q8I A;  1RWY A;  1J7Q A;  1TNP A;  4GAO A;  2LV7 A;  1K2H A;  1QX2 A;  1KWO B;  1ORG A;  4QJ4 B;  1CLB A;  1KQM B;  4PHJ A;  2L2E A;  3RLZ A;  1QWV A;  1XFU O;  2MLE C;  1IQ3 A;  1NP8 A;  3O2P A;  5KSZ A;  3R1P A;  2GGM A;  4JKT A;  3H4S E;  1M46 A;  2M7N A;  2QPT A;  1NUB A;  1UHH A;  2NZ0 A;  3DVM A;  2LP2 A;  3CZ1 A;  1NIW A;  2KFG A;  3CTN A;  1CDM A;  5HKW A;  3I5G B;  1AJ5 A;  2CCM A;  4E68 A;  1CTR A;  1QX5 B;  3D76 A;  1SL7 A;  2KBI A;  2LLT A;  5AER A;  1AHR A;  1CFF A;  1CB1 A;  5HLO A;  4M2O A;  2M0R A;  1NX1 A;  4ETO A;  1OE9 B;  1IH0 A;  2WND A;  1QS7 A;  5DIC A;  1F8H A;  2ZFD A;  1GM0 A;  5EL2 A;  3GK4 X;  4MZK A;  3B86 A;  3PN7 C;  3DYE A;  3PSR A;  4C0L A;  3WXA A;  1KK7 Z;  2KI4 B;  4PHK A;  1LS8 A;  1DQE A;  1M45 A;  2ISD A;  1KFX S;  1TNQ A;  3SG6 A;  1AJ4 A;  2KDH A;  3BQ3 A;  3TDZ A;  4Q04 A;  3PM2 A;  5KTY A;  1LXF C;  1CDL A;  1PSR A;  3KO0 A;  1JF0 A;  3TS5 C;  2WC6 A;  3O4Y A;  2H2K A;  1QIW A;  2Y1M A;  4MBE A;  3FE8 A;  4AOM A;  1P28 A;  1QIV A;  1CM1 A; 
#chains in the Genus database with same CATH homology
 1ZMZ A;  2JT8 A;  2L50 A;  3NSO A;  3BXK A;  3AKA A;  2ZRS A;  1M31 A;  2L0P A;  4DRW A;  1U5I B;  2M3W A;  1SPY A;  1BU3 A;  3BYA A;  1Q80 A;  1B8C A;  2KI4 C;  3PM8 A;  1SL8 A;  2LUX A;  3NSI A;  1YX7 A;  2KSP A;  2KQ6 A;  4ZCU A;  1TN4 A;  2O60 A;  1PVA A;  2COL B;  2K61 A;  4P5O E;  5HKZ A;  1IKU A;  1KFU L;  1B1G A;  2KNE A;  4GNK B;  2BL0 C;  4PDZ A;  4I5N B;  1QTX A;  3VRQ A;  2M9G A;  2KAV A;  4GGF C;  1JBA A;  3EKH A;  2F2P A;  3JVT B;  3HCM A;  3IQO A;  5KU1 A;  1IQ5 A;  1DTL A;  1K9U A;  3IF7 A;  1MR8 A;  4OV2 A;  1A4P A;  3ZWH A;  1EH2 A;  1MXL C;  1DJX A;  1L7Z A;  5TNC A;  3WHU B;  3RM1 A;  2I18 A;  2JT0 A;  4A4B A;  2GGZ A;  1GQM A;  1R6P A;  1SKT A;  2JQ6 A;  1S3P A;  1QV0 A;  1QV1 A;  1XVJ A;  1J1E A;  2WCB A;  2PAL A;  1FI5 A;  1UHK A;  2JNX A;  2MJW B;  2SCP A;  3CR4 X;  4MRX A;  2JPT A;  2K7B A;  3BUX B;  4OKH A;  2K8M B;  1BMO A;  2AMI A;  3PLF B;  1E8A A;  3HX4 A;  1B8R A;  4L9M A;  1OSA A;  3JTD B;  4F0Z B;  1KCY A;  1ALV A;  3SG7 A;  2CTN A;  2ZNE A;  1ODB A;  3TDU A;  2NLN A;  3D0Y A;  2M29 A;  4PE1 A;  2TN4 A;  2ZN9 A;  2BEC A;  4TNC A;  4WRI A;  1DF0 B;  1H8B A;  3F45 A;  2BE4 A;  3CR2 A;  3VRN A;  1WRK A;  3ZNI A;  1B47 A;  1SY9 A;  1K90 D;  2M8U A;  1A75 B;  4AQI A;  1S26 D;  2ZRT A;  2HPS A;  2D8N A;  2Q4U A;  2E30 A;  4BY4 A;  1HQV A;  2OS8 C;  4ZCV A;  1XFY O;  2BCX A;  4YGC B;  3D0Y B;  5DKQ A;  4CFR A;  1A2X A;  2PSR A;  1ALW A;  3EK4 A;  2LLS A;  1K94 A;  3E3R A;  2JXL A;  1IWQ A;  3BUM B;  2PRU A;  1Y1U A;  1S6J A;  1QXP A;  4PE7 A;  1YRU B;  3OHM B;  4XJK A;  1UUR A;  1YVH A;  3OB1 B;  1S6C A;  3KHE A;  2BE6 A;  1F71 A;  5CSJ A;  1N65 A;  1OMD A;  1BR4 B;  1YX8 A;  2BBN A;  2ZND A;  4ICB A;  2O5G A;  5I2Q A;  2LVV A;  1CDN A;  2KFF A;  2QAC A;  4XJK B;  1UWO A;  3LK1 A;  1GGZ A;  1RTP 1;  3PN7 B;  1H4B A;  5DKN A;  1PAL A;  2F33 A;  1L2O C;  5BPJ A;  4MN0 A;  1TCF A;  4JPZ B;  1RRO A;  1PSB A;  1RFJ A;  1SRA A;  4NDD A;  1CLM A;  2AUC A;  2Y4Q A;  4YGD B;  1SK6 D;  4P2Y B;  5JJG A;  3IQQ A;  1XK4 C;  1NSH A;  1NX2 A;  1FPW A;  4GUK A;  1DJG A;  2F3Y A;  4M2Q A;  5ER4 X;  1QVI Y;  3TS5 B;  2HQ8 A;  1J7R A;  3O78 A;  1MWN A;  4YGE B;  2EC6 C;  1X02 A;  2WCE A;  3PFV A;  1FI6 A;  2JOJ A;  2OPO A;  1EXR A;  2I94 A;  3I5I C;  1JSA A;  2MRD A;  1CMG A;  1SCM C;  1NYA A;  2L4I A;  4PE0 A;  1TCO B;  3AAJ A;  2HF5 A;  3DF0 B;  1S36 A;  1SL9 A;  2A4J A;  3BOW B;  4XYN A;  3TDI A;  1Y0V H;  1G8I A;  5AFP A;  1KK8 B;  1CLL A;  1QLS A;  1ZOT B;  1N0Y A;  5CSN A;  5HLV A;  1BF5 A;  2LMV A;  1YRT B;  4C0K A;  3WNX B;  1OQP A;  1VRK A;  3TUY C;  1MHO A;  3EK7 A;  1DGU A;  4FTG A;  1DMO A;  2V53 A;  2E6W A;  3AAK A;  1JUO A;  2LC5 A;  3BUW B;  1D1O A;  2F3Z A;  2NCO A;  3K21 A;  2BL0 B;  2LAN A;  4WQ2 A;  1U5I A;  1DVI A;  3I5H B;  2FJU B;  1MXE A;  1C7W A;  2JWW A;  2HQW A;  2ZKM X;  1MQ1 A;  3OP0 A;  2B1U A;  2MLF C;  3FS7 A;  4CFQ A;  1TTX A;  1YVL A;  4DS7 A;  4YRU A;  2BKH B;  2GV5 A;  1W7I B;  1IRJ A;  2JXC A;  4OCI A;  1RJV A;  2JU0 A;  1PVB A;  4PCW A;  4YI8 A;  2K7C A;  3A4U B;  4I5J A;  1S6I A;  3SG5 A;  2L98 A;  1F54 A;  2IS9 A;  2JT3 A;  3KPX A;  3CWG A;  3OX6 A;  1JC2 A;  3VRR A;  2H61 A;  2MAZ A;  2JC2 A;  2K7O A;  4AQJ A;  3D10 A;  1LA3 A;  1TIZ A;  4HRG A;  4NDC A;  1UHN A;  2KHN A;  2SAS A;  1M39 A;  4GFT A;  3I5H C;  2JRF A;  3WHT B;  1QVI Z;  4USL A;  3NSL A;  4JWQ A;  4U8D A;  1DJW A;  1DJZ A;  4ORA B;  3VGO A;  4DUQ A;  1OMV A;  1ZUZ A;  1LVC D;  4MEW A;  4PHM A;  2KYC A;  3DVJ A;  1B7T Y;  2CNP A;  1XA5 A;  1NX0 A;  1S1E A;  2KAX A;  2KOT A;  2LMT A;  2OS8 B;  1KQV A;  4PHN A;  4QJ5 B;  1EG4 A;  4WQ3 A;  2I2R E;  1SNL A;  3MSE B;  3DD4 A;  2LVJ A;  2BKI B;  1XFW O;  1CM4 A;  1DF0 A;  2LHI A;  3LCP C;  1Y1A A;  5I2O A;  1OZO A;  2KFH A;  3DVE A;  1SR6 C;  1A75 A;  1BT6 A;  1LA0 A;  1XFZ O;  2G2B A;  2ZN8 A;  3KF9 A;  1MF8 B;  1F4O A;  4ORB B;  2JNF A;  1MUX A;  2LNK A;  1DJY A;  2P6B B;  5ER5 A;  1TOP A;  2M49 B;  1C7V A;  2JZI A;  3SG4 A;  1AK8 A;  1KFX L;  1OOJ A;  2FCE A;  1CFC A;  1XK4 A;  1QAS A;  4YBH B;  2KI6 C;  1RK9 A;  3A8R A;  1CNP A;  1L2O B;  5AEQ A;  5FYX A;  3AKB A;  4I5L B;  1UUS A;  4IL1 A;  4M2P A;  2R2I A;  1A03 A;  2M97 A;  3M0W A;  1UP5 A;  5F6T A;  1NCZ A;  5GQQ C;  1DJH A;  1BOC A;  1Y1X A;  5JOL A;  1TNX A;  1FBV A;  4OR9 B;  1YUU A;  2JTT A;  4GGN A;  2EC6 B;  1CFD A;  1EG3 A;  2MBX A;  3I5I B;  4D1E A;  4DIR A;  2LM5 A;  3CGA A;  1WDC B;  1SCM B;  1WY9 A;  2KGR A;  2LLU A;  2M1K B;  1F4Q A;  4HSZ A;  4GPL B;  1NPQ A;  1B7T Z;  2HET A;  3BUO B;  1QX7 A;  1OZS A;  5D69 A;  2F2O A;  4MVF A;  2LVI A;  2EHB A;  3NSK A;  2LVK A;  4R1E A;  3NXA A;  1WLM A;  3TUY B;  4C0J A;  5AAN A;  1YUR A;  1KSM A;  1J7P A;  4PAL A;  3QRX A;  1S5G Y;  3SIA A;  3DF0 A;  3BOW A;  3I5F B;  2OTG C;  1R2U A;  3TZ1 A;  1DGV A;  1IJ5 A;  1J7O A;  4YGA A;  1WDC C;  1CDP A;  1CMF A;  1JWD A;  4N5X A;  3CS1 A;  2NXQ A;  4YGB B;  3O6B A;  5IBW A;  1DT7 B;  1JFK A;  3EK8 A;  2BCA A;  2LE9 B;  4GGF A;  1BR1 B;  1V1G A;  2K0J A;  2G9B A;  1SW8 A;  5K89 A;  3SG3 A;  3BUN B;  3VRP A;  3VRO A;  2CT9 A;  2L5X B;  1K9K A;  3I5F C;  1K96 A;  4I5K A;  2KBM A;  1F70 A;  4MLW A;  1KWO C;  1N2D A;  1KQM C;  4OVN F;  1EJ3 A;  1IGV A;  3SIB A;  2KAY A;  2BBM A;  2Q91 A;  2Y1N A;  1PUL A;  4FQO A;  4MZJ A;  5PAL A;  4A4C A;  4BY5 A;  1CKK A;  2F8P A;  2FOT A;  3CZT X;  5J3X A;  2MHH A;  1YR5 A;  2AAO A;  2DOQ A;  4UPG A;  2CBL A;  1BOD A;  4N1F A;  3FWB A;  1A29 A;  1YTZ C;  3GOF A;  1JF2 A;  4GBA A;  4N1G A;  1REC A;  1TRF A;  2Y5I A;  4NQG A;  3LLE A;  4ORC B;  1AUI B;  3I5G C;  3PAL A;  1SCV A;  1M63 B;  5CPV A;  3KEV A;  1HT9 A;  2WOR A;  2BCB A;  3GK2 A;  1QLK A;  1PRW A;  1S5G Z;  1SR6 B;  2K7D A;  1K9P A;  3LL8 B;  1OMR A;  1DJI A;  1YUT A;  5AXI A;  5I8N A;  2EGD A;  1Y6W A;  3PAT A;  1GJY A;  3OB2 B;  4MZL A;  4JQ0 D;  3CLN A;  1SBJ A;  1FW4 A;  1G4Y R;  4DCK A;  1XFX O;  5D7F A;  1ZFS A;  1SMG A;  1YUS A;  2WCF A;  2KQY A;  3FWC A;  2PAS A;  3EVU A;  3FIA A;  4CPV A;  1IJ6 A;  1BJF A;  1LKJ A;  3GK1 A;  2VRG A;  1B8L A;  2LMU A;  5I2L A;  1KK8 C;  1WRZ A;  3OX5 A;  4PE4 A;  1IG5 A;  1PK0 D;  1G33 A;  2FCD A;  1CFP A;  2KGB C;  1SYM A;  5G08 A;  1FF1 A;  2KI6 D;  1NX3 A;  1XO5 A;  2M7L A;  1EL4 A;  2LP3 A;  2RGI A;  1J55 A;  2PMY A;  1F55 A;  3SJS A;  1UHJ A;  2JUL A;  1C07 A;  1LIN A;  1BG1 A;  1ZAC A;  2LUC A;  2WC8 A;  2I7A A;  3JVT C;  1AP4 A;  1V1F A;  1JFJ A;  4HRE E;  2WOS A;  2LAP A;  5CSI A;  4MRY A;  1B4C A;  2H61 C;  4NDB A;  2PVB A;  1BLQ A;  3EVV A;  2LHL A;  2OTG B;  3DVK A;  4HRH A;  3LK0 A;  4CLN A;  2MA2 A;  4QJ3 B;  1UHI A;  5CSF A;  2K2F A;  1J1D A;  1B9A A;  3CR5 X;  2K2A A;  2L51 A;  2JTZ A;  2L4H A;  1KK7 Y;  2M1U A;  3C1V A;  5B8I B;  1GGW A;  1K95 A;  2KYF A;  2NCP A;  1QJT A;  4CID A;  1NWD A;  1AVS A;  2LCP A;  1NCY A;  1QAT A;  4MSP A;  2CXJ A;  3ICB A;  3JTD C;  1W7J B;  4YI9 A;  1WLZ A;  1TNW A;  3EKJ A;  5DKR A;  1WRL A;  1XFV O;  1KFU S;  1K93 D;  5HKY A;  1K8U A;  5HYD A;  1XYD A;  1KSO A;  3SG2 A;  3EVR A;  1J7Q A;  1RWY A;  1TNP A;  4GAO A;  2LV7 A;  1K2H A;  1QX2 A;  1KWO B;  4QJ4 B;  1CLB A;  1KQM B;  4PHJ A;  2L2E A;  3RLZ A;  2MLE C;  1XFU O;  1IQ3 A;  1NP8 A;  3O2P A;  5KSZ A;  2GGM A;  3H4S E;  1M46 A;  2M7N A;  2QPT A;  1NUB A;  1UHH A;  2NZ0 A;  3DVM A;  2LP2 A;  1NIW A;  2KFG A;  3CTN A;  1CDM A;  5HKW A;  3I5G B;  1AJ5 A;  2CCM A;  4E68 A;  1CTR A;  1QX5 B;  1SL7 A;  2KBI A;  2LLT A;  5AER A;  1AHR A;  1CFF A;  1CB1 A;  5HLO A;  4M2O A;  2M0R A;  1NX1 A;  4ETO A;  1OE9 B;  1IH0 A;  2WND A;  1QS7 A;  1F8H A;  2ZFD A;  3GK4 X;  4MZK A;  3PN7 C;  3PSR A;  4C0L A;  3WXA A;  1KK7 Z;  2KI4 B;  4PHK A;  1M45 A;  2ISD A;  1KFX S;  1TNQ A;  3SG6 A;  1AJ4 A;  2KDH A;  3BQ3 A;  3TDZ A;  4Q04 A;  5KTY A;  1LXF C;  1CDL A;  1PSR A;  3KO0 A;  1JF0 A;  3TS5 C;  3O4Y A;  2H2K A;  1QIW A;  2Y1M A;  4MBE A;  4AOM A;  1NCX A;  1QIV A;  1CM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...