3CR5X

X-ray structure of bovine pnt-zn(2+),ca(2+)-s100b
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
91
structure length
91
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title Divalent metal ion complexes of S100B in the absence and presence of pentamidine.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 31
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2008-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00036 EF-hand_1 EF hand
X PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3cr5X00
4MRXA 1TTXA 1F54A 3OX6A 2GGMA 2ZN8A 1JF0A 1WY9A 3BOWA 5DKQA 1R6PA 1DGUA 3NSLA 1S6JA 3DVKA 1J7QA 1UHJA 1AJ5A 5DKRA 1DJYA 3DVMA 2L98A 1W7IB 1BMOA 3DVEA 5KSZA 1YUTA 2PMYA 5I2OA 2LV7A 1JWDA 1DJGA 1S1EA 1B8LA 2K2AA 3LCPC 4QJ5B 3NSKA 1NCYA 1TNQA 2BL0B 2M0RA 2E30A 2R2IA 2Q91A 4GGNA 1GJYA 1YRTB 2EGDA 1XYDA 1DF0B 3C1VA 3LLEA 1FI5A 5GQQC 2F3ZA 3EK7A 4MSPA 2GV5A 2I7AA 1EG3A 2LLTA 1SCVA 2F3YA 3SG6A 1EG4A 1QV1A 2PALA 3I5HB 2O60A 3PLFB 1OMVA 2KAXA 2ZN9A 5ER4X 3DF0A 3OX5A 1F8HA 2LMTA 1IQ3A 2PSRA 3M0WA 1B9AA 4U8DA 3JTDC 2SCPA 4MZKA 1L2OC 4PALA 1CFCA 1JBAA 1DJWA 2KFFA 4WRIA 1B7TY 1JC2A 2M7NA 5AXIA 1NX2A 1BR4B 3OB2B 3QRXA 5ER5A 1C07A 1FI6A 1MXLC 4JWQA 3JVTB 5JJGA 2OS8B 1TNXA 2Y1MA 3D0YA 2WCBA 2EC6C 4BY5A 1BU3A 2JT3A 5PALA 2BBNA 1N0YA 3MSEB 4MZLA 1S5GZ 2COLB 3VROA 2LCPA 1UHKA 1M63B 1Y1UA 2KSPA 3TUYB 2NLNA 3VRRA 3A4UB 3O6BA 2WNDA 1CFPA 2BCXA 1NYAA 1UUSA 1QVIZ 2DOQA 2KGBC 1AVSA 1IQ5A 1SL8A 4PE4A 1BF5A 3KHEA 1IWQA 4GAOA 2L5XB 2QPTA 1G4YR 1OMDA 1A75A 3K21A 3KF9A 2KDHA 1B1GA 3EK8A 3VRNA 4I5NB 4GBAA 1QLKA 3EK4A 4F0ZB 1IG5A 3CR5X 2F2OA 3HX4A 2MLFC 3BUMB 1G33A 1IJ5A 4ORBB 4PHMA 2Y4QA 1SCMB 2KI6C 2ZFDA 2MLEC 3FWCA 3SG4A 2CCMA 1XK4C 4XJKA 1AJ4A 2WCEA 2LC5A 4GUKA 2ISDA 3KEVA 5AFPA 4DIRA 3ZWHA 3FIAA 1PULA 1SRAA 1QATA 1PSRA 1QJTA 3BYAA 1TNPA 2OPOA 1DVIA 4NDBA 4QJ4B 1SK6D 2M1KB 2M49B 1NSHA 1S36A 3O4YA 3WHTB 4HRGA 4YRUA 1CNPA 1KCYA 1GGWA 1KWOB 1X02A 1MQ1A 3NSOA 1WLMA 3EKJA 2H2KA 1J1DA 3BXKA 2LMVA 1RJVA 1RK9A 2CXJA 1CFDA 1RTP1 4PE7A 1YVHA 3GOFA 2KYCA 5D7FA 1BJFA 2K7CA 4CIDA 2LM5A 2JNFA 1K96A 2HPSA 1CMFA 2CNPA 3E3RA 1CDPA 1MF8B 4M2QA 2P6BB 5HLVA 3VGOA 4CFQA 1CTRA 1V1GA 3PFVA 4HSZA 3PSRA 3EKHA 4XYNA 3D10A 3EVVA 3NSIA 3TS5C 1RWYA 4BY4A 1KK7Z 5IBWA 1ALWA 2CT9A 2D8NA 3FS7A 3I5FB 2M29A 1WDCC 3WHUB 2LMUA 2JWWA 2K0JA 2KYFA 4AQJA 3RLZA 1NWDA 1ZOTB 4YGDB 1OE9B 1EL4A 1C7WA 1NP8A 2KGRA 4C0LA 1CM4A 2M7LA 2LP3A 3SG3A 1S3PA 1CDNA 2ZNDA 2LUXA 4JQ0D 1B8RA 1SR6C 1TNWA 2I94A 2L51A 4OVNF 3CR2A 1CKKA 1QIWA 2G9BA 1M46A 3AAJA 3TDZA 4WQ2A 1ODBA 2BKIB 4I5JA 1DF0A 1MWNA 1CMGA 4YGEB 1KQMB 2MHHA 1OOJA 3KO0A 1A29A 1TCFA 2KI6D 3AAKA 1SKTA 1N65A 1C7VA 1YURA 1NCXA 1CFFA 1KSMA 1KFXS 2JU0A 1DJHA 1QX2A 1SY9A 2KBIA 3DD4A 3I5GC 4ZCVA 2MA2A 2L2EA 1FBVA 2BCAA 1QX7A 2Y5IA 2K8MB 5CSNA 5HYDA 1LA0A 1HQVA 1QX5B 2F2PA 3SG5A 4A4CA 2JTZA 1W7JB 1YX7A 1BT6A 4M2OA 1LKJA 5CSIA 1FW4A 1SL9A 2VRGA 2CTNA 3JTDB 1MHOA 1KK8C 1L2OB 2LVVA 4D1EA 1J7PA 4ZCUA 1U5IB 1WRKA 3A8RA 4YGBB 4CLNA 3IF7A 4MVFA 1TN4A 2JPTA 1DT7B 3TDUA 4JPZB 1UHHA 2KFHA 2EC6B 1J7OA 1S5GY 3GK1A 1V1FA 2K7BA 1BLQA 1WRZA 3CS1A 4PDZA 1WLZA 2LE9B 3DF0B 4L9MA 4UPGA 2JXLA 1XFXO 2KAVA 2K7OA 4MZJA 5CSFA 1FPWA 1K9UA 1DJXA 2FCEA 4Q04A 1IKUA 1IH0A 1CDMA 1KFXL 1S26D 1B7TZ 3CR4X 1OZOA 1AK8A 2F8PA 4CFRA 3IQQA 1YRUB 2JOJA 1VRKA 2M3WA 2BKHB 3BUOB 4TNCA 1QV0A 1XFVO 4NDCA 1HT9A 2L4IA 1SMGA 2LANA 3EVRA 1ZFSA 2Y1NA 1A4PA 2I2RE 4C0KA 1N2DA 1F4QA 4N5XA 4PHJA 1OZSA 1SW8A 1K9KA 2QACA 1CB1A 1Y1AA 1EJ3A 3WNXB 1Y1XA 5HKWA 1M31A 2ZKMX 2JT8A 1G8IA 1IGVA 2AUCA 3OHMB 3BUNB 2JTTA 1NUBA 1KQVA 3LK1A 1K8UA 1JSAA 1NX1A 1RROA 3SJSA 3PATA 3TZ1A 2B1UA 4CPVA 4WQ3A 4AQIA 1CLLA 5BPJA 1CLBA 1BR1B 1YUUA 2KI4B 3O2PA 4MEWA 3RM1A 4GGFA 4MN0A 4GFTA 1J7RA 1DTLA 2M97A 3KPXA 4YI9A 2MBXA 1XVJA 2KBMA 1JFKA 2KOTA 1KFUS 3DVJA 1B4CA 1RFJA 1TRFA 2TN4A 2EHBA 4R1EA 2BCBA 2L50A 2OTGC 3CGAA 4HRHA 3BUWB 1MUXA 3CZTX 3I5IB 2FOTA 1D1OA 2JC2A 1AHRA 3ICBA 4PHKA 4NDDA 1GGZA 4C0JA 2V53A 1KSOA 1QTXA 3GK4X 3FWBA 4IL1A 1A03A 1DJIA 2NXQA 3OP0A 4MLWA 1LINA 1NX3A 1SL7A 3TS5B 1IJ6A 4I5KA 1OMRA 3CTNA 4DRWA 3PN7B 2WORA 1WDCB 4OR9B 1XFUO 2BE4A 2HQ8A 1F71A 1YUSA 4ORCB 1CM1A 2K2FA 1ALVA 1YX8A 2NZ0A 2NCOA 1NIWA 4N1GA 1KFUL 5KU1A 2KFGA 5FYXA 5I2QA 1FF1A 1A2XA 5D69A 4OV2A 1L7ZA 1JUOA 4PE0A 1SR6B 4DUQA 5HLOA 4YGCB 4NQGA 3SIAA 4OCIA 1S6CA 4ICBA 1S6IA 1UURA 1H4BA 2G2BA 1WRLA 3BOWB 1ZACA 4GPLB 5KTYA 2MRDA 1XFYO 1BODA 2RGIA 4USLA 2ZNEA 3ZNIA 2WOSA 3I5GB 1DGVA 2PVBA 2JNXA 3VRQA 1XFWO 1TIZA 2BL0C 1QXPA 4A4BA 3PM8A 1GQMA 1SBJA 3IQOA 1PRWA 5F6TA 3VRPA 4DCKA 2M1UA 2HETA 2M8UA 1B8CA 4ETOA 4ORAB 1PK0D 3WXAA 1KQMC 2CBLA 2IS9A 1TOPA 2KNEA 1KK8B 2BE6A 4YBHB 2BECA 1E8AA 1U5IA 3OB1B 1OQPA 3H4SE 1NX0A 1SYMA 2K7DA 1M45A 4QJ3B 3I5HC 2NCPA 1ZUZA 5I2LA 2JT0A 3LL8B 4OKHA 1CDLA 3O78A 2JQ6A 1XO5A 2JRFA 2ZRTA 4PE1A 1QVIY 1XA5A 1CLMA 2LLSA 5DKNA 5JOLA 3CLNA 1JF2A 3EVUA 2FJUB 3JVTC 2OS8C 3NXAA 5AANA 4P5OE 2LAPA 1ZMZA 2E6WA 5HKYA 3D0YB 4HREE 3SG7A 1AUIB 2BBMA 2Q4UA 1DMOA 1EXRA 2JULA 1DJZA 3HCMA 2KHNA 3TUYC 2FCDA 2KAYA 4DS7A 5TNCA 1SNLA 1K90D 1Y0VH 1XFZO 1PSBA 1OSAA 1Q80A 4PHNA 1QASA 2GGZA 1UP5A 1A75B 1M39A 1XK4A 1MR8A 4I5LB 4M2PA 2H61A 4MRYA 1EH2A 1K94A 2AMIA 2PASA 5CPVA 2MJWB 3SG2A 1Y6WA 5K89A 2F33A 4GNKB 1LVCD 4PCWA 1H8BA 2JXCA 2LP2A 5J3XA 4FTGA 1SCMC 1B47A 2LVIA 5AERA 2AAOA 5CSJA 1UHNA 1SPYA 2HF5A 4XJKB 3GK2A 1PVAA 2L4HA 2OTGB 2H61C 2K61A 2I18A 2LLUA 1K2HA 1QIVA 1J1EA 2HQWA 3AKAA 1AP4A 2KQYA 1LA3A 1NCZA 1YVLA 3PALA 4P2YB 3CWGA 2KI4C 1LXFC 4GGFC 5I8NA 1F4OA 4N1FA 2LUCA 5HKZA 1NPQA 3AKBA 1KWOC 1UHIA 1KK7Y 5G08A 1K95A 2PRUA 3F45A 4YGAA 3BQ3A 2LVKA 1J55A 2LVJA 1TCOB 1RECA 1BOCA 4YI8A 1F55A 3I5IC 5B8IB 1QLSA 2KQ6A 1PALA 3LK0A 1QS7A 1JFJA 2SASA 1K93D 2O5GA 2A4JA 2M9GA 1PVBA 3BUXB 3TDIA 1F70A 1UWOA 2LHIA 3SIBA 4FQOA 2ZRSA 1IRJA 2WC8A 1MXEA 4MBEA 5AEQA 2MAZA 4AOMA 2LNKA 1K9PA 3PN7C 2LHLA 3I5FC 1BG1A 2JZIA 1YTZC 1YR5A 1R2UA 2L0PA 4E68A 2WCFA
chains in the Genus database with same CATH superfamily
4MRXA 1TTXA 1F54A 3OX6A 2GGMA 2ZN8A 1JF0A 1WY9A 2WCMA 3BOWA 5DKQA 1R6PA 1DGUA 3NSLA 3OBVA 1S6JA 3DVKA 2L5YA 1J7QA 1UHJA 1AJ5A 5DKRA 1DJYA 3DVMA 2L98A 1W7IB 1BMOA 3DVEA 5KSZA 1YUTA 2PMYA 3D73A 3D77A 5I2OA 2LV7A 1JWDA 1DJGA 1S1EA 1B8LA 2K2AA 3LCPC 3L4LA 2FJYA 4QJ5B 3NSKA 1NCYA 1TNQA 2BL0B 2M0RA 2E30A 2R2IA 2Q91A 4GGNA 1GJYA 1YRTB 2EGDA 1XYDA 1DF0B 3C1VA 3LLEA 5FI7A 1FI5A 5GQQC 2F3ZA 3EK7A 2L2CA 4MSPA 2GV5A 4JKTA 2I7AA 1EG3A 2LLTA 1SCVA 2F3YA 1OOIX 3SG6A 1EG4A 1QV1A 2PALA 2QEBA 3I5HB 2O60A 3PLFB 3NHTA 1OMVA 2KAXA 2ZN9A 5ER4X 3DF0A 3EG5B 3OX5A 1F8HA 2LMTA 1IQ3A 2PSRA 3M0WA 1B9AA 4U8DA 3JTDC 2SCPA 4MZKA 1L2OC 4PALA 1CFCA 1JBAA 3S0BA 1DJWA 2KFFA 4WRIA 3RZSA 1B7TY 1JC2A 2M7NA 2GTEA 2P71A 5AXIA 1NX2A 1BR4B 3OB2B 3QRXA 5ER5A 1C07A 1FI6A 1MXLC 4JWQA 3JVTB 5JJGA 2OS8B 3V2LA 2QEOA 1TNXA 2ERBA 2Y1MA 3D0YA 2WCBA 2EC6C 4BY5A 3SS3A 1DQEA 1BU3A 2JT3A 5PALA 2PYQA 2BBNA 1N0YA 3MSEB 4MZLA 1S5GZ 2COLB 3VROA 2LCPA 1UHKA 1M63B 1Y1UA 2KSPA 3BFBA 2NLNA 3TUYB 3VRRA 3A4UB 3O6BA 2WNDA 1CFPA 2BCXA 1NYAA 1UUSA 1QVIZ 2DOQA 2KGBC 1IIOA 1AVSA 1IQ5A 1SL8A 4PE4A 1BF5A 3KHEA 1IWQA 4GAOA 3SS5A 2L5XB 2QPTA 1G4YR 1OMDA 1DC1A 1A75A 3K21A 3KF9A 2KDHA 1B1GA 3EK8A 4INWA 3VRNA 4I5NB 2PQLA 4GBAA 2WCHA 1QLKA 3NGVA 3EK4A 3S0EA 1IG5A 3CR5X 2F2OA 3HX4A 4F0ZB 3D76A 2MLFC 3BUMB 1G33A 1IJ5A 4ORBB 4PHMA 2Y4QA 1SCMB 2KI6C 2ZFDA 2MLEC 3FWCA 3SG4A 2CCMA 1XK4C 4XJKA 1AJ4A 2WCEA 2LC5A 4GUKA 2ISDA 3KEVA 5AFPA 4DIRA 3QMEA 5FI6A 3ZWHA 3FIAA 1PULA 1SRAA 1QATA 1PSRA 1QJTA 3BYAA 1TNPA 2OPOA 1DVIA 2KLEA 4NDBA 4QJ4B 1LS8A 1SK6D 2M1KB 2M49B 1NSHA 1S36A 3O4YA 3WHTB 4HRGA 4YRUA 1CNPA 1KCYA 1GGWA 1KWOB 1X02A 1MQ1A 3NSOA 1WLMA 3EKJA 2H2KA 2YGUA 1J1DA 3BXKA 2LMVA 3CDNA 3DYEA 1RJVA 1RK9A 2CXJA 1CFDA 1RTP1 4PE7A 1YVHA 3GOFA 2KYCA 3PJIA 1BJFA 5D7FA 2K7CA 4CIDA 2LM5A 3CZ1A 2JNFA 1K96A 2HPSA 1CMFA 2CNPA 3B7AA 3E3RA 1CDPA 1MF8B 4M2QA 2P6BB 5HLVA 3VGOA 1OOGA 1CTRA 1V1GA 3PFVA 2WCKA 3B6XA 3PSRA 3EKHA 4HSZA 4XYNA 3D10A 3EVVA 3NSIA 3TS5C 1RWYA 4BY4A 1KK7Z 5IBWA 1ALWA 2CT9A 2D8NA 3FS7A 3I5FB 2M29A 1WDCC 3WHUB 3DZTA 2LMUA 2JWWA 2K0JA 2KYFA 4AQJA 3RLZA 1NWDA 1ZOTB 4YGDB 1OE9B 1QWVA 1EL4A 1C7WA 1NP8A 2KGRA 3FE9A 1CM4A 2M7LA 4C0LA 3B86A 2LP3A 3SG3A 1S3PA 1CDNA 2ZNDA 2LUXA 4JQ0D 1B8RA 1SR6C 1TNWA 2I94A 2L51A 4OVNF 3CR2A 1CKKA 1QIWA 2G9BA 1M46A 3AAJA 3TDZA 4WQ2A 1ODBA 2BKIB 4I5JA 1DF0A 1MWNA 3S0DA 1CMGA 4YGEB 1KQMB 2MHHA 1OOJA 3KO0A 1A29A 1TCFA 2KI6D 3AAKA 1SKTA 1N65A 1Z4HA 1YURA 1NCXA 1C7VA 1KSMA 1KFXS 2JU0A 1DJHA 1QX2A 1SY9A 1TUZA 2KBIA 3DD4A 3I5GC 4ZCVA 2MA2A 2QEVA 2L2EA 1FBVA 2BCAA 1QX7A 2Y5IA 2K8MB 5CSNA 5HYDA 1LA0A 1HQVA 1QX5B 2F2PA 3SG5A 4A4CA 2JTZA 1W7JB 1XFRA 1YX7A 3O4XA 1BT6A 4M2OA 1LKJA 5CSIA 1FW4A 1SL9A 2VRGA 3D75A 2CTNA 3JTDB 3S0GA 1MHOA 3R1OA 1KK8C 1L2OB 2LVVA 1DEKA 4D1EA 1J7PA 4ZCUA 1U5IB 1OOHA 1WRKA 3A8RA 4YGBB 4CLNA 3IF7A 4MVFA 1TN4A 2JPTA 1DT7B 3TDUA 4JPZB 1UHHA 2KFHA 2EC6B 1J7OA 1S5GY 3GK1A 1V1FA 2K7BA 1BLQA 1WRZA 3CS1A 3CZ2A 1WLZA 2LE9B 3DF0B 3N7HA 4L9MA 4PDZA 5FI2A 4UPGA 2JXLA 3D74A 1TUJA 1XFXO 2KAVA 2K7OA 3BJHA 4MZJA 5CSFA 1FPWA 3R1PA 1K9UA 1DJXA 2FCEA 4Q04A 1IKUA 1IH0A 1CDMA 1KFXL 1S26D 3FE6A 4FQTA 1B7TZ 3CR4X 1OZOA 1AK8A 2BAPA 2F8PA 4CFRA 3IQQA 1YRUB 2JOJA 1VRKA 2M3WA 2BKHB 3BUOB 4TNCA 1QV0A 1XFVO 4NDCA 2KLDA 1HT9A 2L4IA 1SMGA 2LANA 3EVRA 1ZFSA 2Y1NA 1P28A 1A4PA 2I2RE 4C0KA 1N2DA 1F4QA 4N5XA 3R72A 4PHJA 1OZSA 1SW8A 1K9KA 2QACA 1CB1A 3CABA 1Y1AA 1EJ3A 3WNXB 1Y1XA 3VB1A 5HKWA 1M31A 2ZKMX 2JT8A 1G8IA 1IGVA 2AUCA 4OZDA 3OHMB 3BUNB 2JTTA 1NUBA 1KQVA 3LK1A 1K8UA 1JSAA 1NX1A 1RROA 3SJSA 3PATA 3TZ1A 2B1UA 4CPVA 4WQ3A 1Z2CB 4AQIA 1CLLA 5BPJA 1CLBA 1BR1B 5DICA 1YUUA 2KI4B 3O2PA 4MEWA 3RM1A 3SS4A 4GGFA 4MN0A 4GFTA 1J7RA 1DTLA 2M97A 3KPXA 4YI9A 2MBXA 2H8VA 1XVJA 2KBMA 3S0FA 1JFKA 2KOTA 1KFUS 3DVJA 1B4CA 1RFJA 1TRFA 2TN4A 2EHBA 4R1EA 1CFFA 2WC6A 2BCBA 2L50A 2OTGC 3CGAA 4HRHA 3BUWB 3CYZA 1MUXA 1ORGA 3CZTX 3I5IB 2FOTA 1D1OA 4F7FA 2JC2A 3UNWA 1C3YA 3B87A 1AHRA 3B88A 3ICBA 4PHKA 4NDDA 1GGZA 4C0JA 2V53A 1KSOA 1QTXA 3GK4X 3FWBA 4IL1A 1A03A 1DJIA 2NXQA 3OP0A 3PM2A 4MLWA 1LINA 1NX3A 1SL7A 3TS5B 1IJ6A 4I5KA 1OMRA 3CTNA 3Q8IA 3PN7B 4DRWA 3BFHA 2WORA 3UO9A 1WDCB 4OR9B 1XFUO 2BE4A 2HQ8A 3IVTA 1F71A 1YUSA 4ORCB 1CM1A 2K2FA 1ALVA 1YX8A 2NZ0A 2NCOA 1NIWA 4N1GA 1KFUL 5KU1A 2KFGA 5FYXA 5I2QA 1FF1A 1A2XA 5D69A 2WCJA 4OV2A 1L7ZA 1JUOA 2WCLA 1SR6B 4PE0A 4DUQA 5HLOA 4YGCB 4NQGA 3SIAA 4OCIA 1S6CA 4ICBA 1S6IA 1UURA 1H4BA 2G2BA 3NHIA 1WRLA 3BOWB 1ZACA 4GPLB 5KTYA 2MRDA 1XFYO 1BODA 2RGIA 4USLA 2ZNEA 3ZNIA 2WOSA 3I5GB 1DGVA 2PVBA 1TWOA 2JNXA 3VRQA 1XFWO 1TIZA 2BL0C 1QXPA 4A4BA 3PM8A 1GQMA 1SBJA 3IQOA 1PRWA 5F6TA 3VRPA 4DCKA 2M1UA 4JD9A 2HETA 2M8UA 1B8CA 4ETOA 4ORAB 1PK0D 3DXLA 3WXAA 1KQMC 2CBLA 2IS9A 1TOPA 2KNEA 1KK8B 2BE6A 4YBHB 1E8AA 1U5IA 2BECA 3OB1B 5HL1A 1OQPA 2P70A 3DY9A 3H4SE 1NX0A 1SYMA 2K7DA 1M45A 4QJ3B 3I5HC 5EL2A 3FE8A 2NCPA 1ZUZA 3L4AA 5I2LA 2JT0A 3LL8B 4OKHA 1W9ZA 1CDLA 3O78A 2JQ6A 2KPHA 1XO5A 2JRFA 2ZRTA 1OOFA 4PE1A 1QVIY 1XA5A 1CLMA 2LLSA 5DKNA 5JOLA 3CLNA 1JF2A 3EVUA 2FJUB 3JVTC 2OS8C 3NXAA 5AANA 4P5OE 2LAPA 1ZMZA 2E6WA 5HKYA 3D0YB 4HREE 3SG7A 1AUIB 2BBMA 2Q4UA 5I94A 1DMOA 1EXRA 2JULA 1DJZA 3HCMA 2KHNA 3TUYC 2FCDA 3BFAA 2KAYA 4DS7A 5TNCA 1SNLA 1T14A 1K90D 1Y0VH 1XFZO 1PSBA 1OSAA 1Q80A 4PHNA 1QASA 2GGZA 1UP5A 1A75B 1M39A 1XK4A 1MR8A 4I5LB 4M2PA 2H61A 4MRYA 1EH2A 1K94A 2AMIA 2PASA 5CPVA 2MJWB 3SG2A 1DELA 1Y6WA 5K89A 2F33A 4GNKB 1LVCD 1OW4A 4PCWA 2JXCA 1H8BA 2LP2A 2WC5A 4INXA 4FTGA 1SCMC 5J3XA 1B47A 2LVIA 1GM0A 4CFQA 5AERA 2AAOA 5CSJA 1UHNA 3OGNA 3CZ0A 1SPYA 2HF5A 4XJKB 3GK2A 1PVAA 4KYNA 2L4HA 2OTGB 2H61C 2K61A 2I18A 2LLUA 1C3ZA 1QIVA 1J1EA 2HQWA 2QEHA 3AKAA 1AP4A 1K2HA 2KQYA 1LA3A 1NCZA 1YVLA 3PALA 4P2YB 3CWGA 2KI4C 1LXFC 4GGFC 5I8NA 1F4OA 4N1FA 2LUCA 5HKZA 1NPQA 3AKBA 1KWOC 1UHIA 1KK7Y 2JPOA 5G08A 1K95A 2PRUA 3F45A 4YGAA 3BQ3A 2LVKA 1J55A 2LVJA 1TCOB 1RECA 1BOCA 4YI8A 3S0AA 1F55A 3I5IC 5B8IB 1QLSA 2KQ6A 1SSEB 1PALA 3LK0A 1QS7A 1JFJA 4IJ7A 2SASA 1K93D 2K60A 2O5GA 3K1EA 2A4JA 2M9GA 1PVBA 3BUXB 2QDIA 3TDIA 1F70A 1UWOA 2LHIA 4PT1A 3R1VA 4FQOA 2ZRSA 1IRJA 3SIBA 2BNXA 1MXEA 2WC8A 4MBEA 5AEQA 3L47A 2MAZA 4AOMA 2LNKA 1K9PA 3PN7C 2LHLA 3I5FC 1BG1A 2JZIA 1YTZC 1YR5A 5D3OA 1R2UA 2L0PA 4E68A 2WCFA 3D78A
chains in the Genus database with same CATH topology
4MRXA 1TTXA 1F54A 3OX6A 2GGMA 2ZN8A 1JF0A 1WY9A 3BOWA 5DKQA 1R6PA 1DGUA 3NSLA 1S6JA 3DVKA 1J7QA 1UHJA 1AJ5A 5DKRA 1DJYA 3DVMA 2L98A 1W7IB 1BMOA 3DVEA 5KSZA 1YUTA 2PMYA 5I2OA 2LV7A 1JWDA 1DJGA 1S1EA 1B8LA 2K2AA 3LCPC 4QJ5B 3NSKA 1NCYA 1TNQA 2BL0B 2M0RA 2E30A 2R2IA 2Q91A 4GGNA 1GJYA 1YRTB 2EGDA 1XYDA 1DF0B 3C1VA 3LLEA 1FI5A 5GQQC 2F3ZA 3EK7A 4MSPA 2GV5A 2I7AA 1EG3A 2LLTA 1SCVA 2F3YA 3SG6A 1EG4A 1QV1A 2PALA 3I5HB 2O60A 3PLFB 1OMVA 2KAXA 2ZN9A 5ER4X 3DF0A 3OX5A 1F8HA 2LMTA 1IQ3A 2PSRA 3M0WA 1B9AA 4U8DA 3JTDC 2SCPA 4MZKA 1L2OC 4PALA 1CFCA 1JBAA 1DJWA 2KFFA 4WRIA 1B7TY 1JC2A 2M7NA 5AXIA 1NX2A 1BR4B 3OB2B 3QRXA 5ER5A 1C07A 1FI6A 1MXLC 4JWQA 3JVTB 5JJGA 2OS8B 1TNXA 2Y1MA 3D0YA 2WCBA 2EC6C 4BY5A 1BU3A 2JT3A 5PALA 2BBNA 1N0YA 3MSEB 4MZLA 1S5GZ 2COLB 3VROA 2LCPA 1UHKA 1M63B 1Y1UA 2KSPA 3TUYB 2NLNA 3VRRA 3A4UB 3O6BA 2WNDA 1CFPA 2BCXA 1NYAA 1UUSA 1QVIZ 2DOQA 2KGBC 1AVSA 1IQ5A 1SL8A 4PE4A 1BF5A 3KHEA 1IWQA 4GAOA 2L5XB 2QPTA 1G4YR 1OMDA 1A75A 3K21A 3KF9A 2KDHA 1B1GA 3EK8A 3VRNA 4I5NB 4GBAA 1QLKA 3EK4A 4F0ZB 1IG5A 3CR5X 2F2OA 3HX4A 2MLFC 3BUMB 1G33A 1IJ5A 4ORBB 4PHMA 2Y4QA 1SCMB 2KI6C 2ZFDA 2MLEC 3FWCA 3SG4A 2CCMA 1XK4C 4XJKA 1AJ4A 2WCEA 2LC5A 4GUKA 2ISDA 3KEVA 5AFPA 4DIRA 3ZWHA 3FIAA 1PULA 1SRAA 1QATA 1PSRA 1QJTA 3BYAA 1TNPA 2OPOA 1DVIA 4NDBA 4QJ4B 1SK6D 2M1KB 2M49B 1NSHA 1S36A 3O4YA 3WHTB 4HRGA 4YRUA 1CNPA 1KCYA 1GGWA 1KWOB 1X02A 1MQ1A 3NSOA 1WLMA 3EKJA 2H2KA 1J1DA 3BXKA 2LMVA 1RJVA 1RK9A 2CXJA 1CFDA 1RTP1 4PE7A 1YVHA 3GOFA 2KYCA 5D7FA 1BJFA 2K7CA 4CIDA 2LM5A 2JNFA 1K96A 2HPSA 1CMFA 2CNPA 3E3RA 1CDPA 1MF8B 4M2QA 2P6BB 5HLVA 3VGOA 4CFQA 1CTRA 1V1GA 3PFVA 4HSZA 3PSRA 3EKHA 4XYNA 3D10A 3EVVA 3NSIA 3TS5C 1RWYA 4BY4A 1KK7Z 5IBWA 1ALWA 2CT9A 2D8NA 3FS7A 3I5FB 2M29A 1WDCC 3WHUB 2LMUA 2JWWA 2K0JA 2KYFA 4AQJA 3RLZA 1NWDA 1ZOTB 4YGDB 1OE9B 1EL4A 1C7WA 1NP8A 2KGRA 4C0LA 1CM4A 2M7LA 2LP3A 3SG3A 1S3PA 1CDNA 2ZNDA 2LUXA 4JQ0D 1B8RA 1SR6C 1TNWA 2I94A 2L51A 4OVNF 3CR2A 1CKKA 1QIWA 2G9BA 1M46A 3AAJA 3TDZA 4WQ2A 1ODBA 2BKIB 4I5JA 1DF0A 1MWNA 1CMGA 4YGEB 1KQMB 2MHHA 1OOJA 3KO0A 1A29A 1TCFA 2KI6D 3AAKA 1SKTA 1N65A 1C7VA 1YURA 1NCXA 1CFFA 1KSMA 1KFXS 2JU0A 1DJHA 1QX2A 1SY9A 2KBIA 3DD4A 3I5GC 4ZCVA 2MA2A 2L2EA 1FBVA 2BCAA 1QX7A 2Y5IA 2K8MB 5CSNA 5HYDA 1LA0A 1HQVA 1QX5B 2F2PA 3SG5A 4A4CA 2JTZA 1W7JB 1YX7A 1BT6A 4M2OA 1LKJA 5CSIA 1FW4A 1SL9A 2VRGA 2CTNA 3JTDB 1MHOA 1KK8C 1L2OB 2LVVA 4D1EA 1J7PA 4ZCUA 1U5IB 1WRKA 3A8RA 4YGBB 4CLNA 3IF7A 4MVFA 1TN4A 2JPTA 1DT7B 3TDUA 4JPZB 1UHHA 2KFHA 2EC6B 1J7OA 1S5GY 3GK1A 1V1FA 2K7BA 1BLQA 1WRZA 3CS1A 4PDZA 1WLZA 2LE9B 3DF0B 4L9MA 4UPGA 2JXLA 1XFXO 2KAVA 2K7OA 4MZJA 5CSFA 1FPWA 1K9UA 1DJXA 2FCEA 4Q04A 1IKUA 1IH0A 1CDMA 1KFXL 1S26D 1B7TZ 3CR4X 1OZOA 1AK8A 2F8PA 4CFRA 3IQQA 1YRUB 2JOJA 1VRKA 2M3WA 2BKHB 3BUOB 4TNCA 1QV0A 1XFVO 4NDCA 1HT9A 2L4IA 1SMGA 2LANA 3EVRA 1ZFSA 2Y1NA 1A4PA 2I2RE 4C0KA 1N2DA 1F4QA 4N5XA 4PHJA 1OZSA 1SW8A 1K9KA 2QACA 1CB1A 1Y1AA 1EJ3A 3WNXB 1Y1XA 5HKWA 1M31A 2ZKMX 2JT8A 1G8IA 1IGVA 2AUCA 3OHMB 3BUNB 2JTTA 1NUBA 1KQVA 3LK1A 1K8UA 1JSAA 1NX1A 1RROA 3SJSA 3PATA 3TZ1A 2B1UA 4CPVA 4WQ3A 4AQIA 1CLLA 5BPJA 1CLBA 1BR1B 1YUUA 2KI4B 3O2PA 4MEWA 3RM1A 4GGFA 4MN0A 4GFTA 1J7RA 1DTLA 2M97A 3KPXA 4YI9A 2MBXA 1XVJA 2KBMA 1JFKA 2KOTA 1KFUS 3DVJA 1B4CA 1RFJA 1TRFA 2TN4A 2EHBA 4R1EA 2BCBA 2L50A 2OTGC 3CGAA 4HRHA 3BUWB 1MUXA 3CZTX 3I5IB 2FOTA 1D1OA 2JC2A 1AHRA 3ICBA 4PHKA 4NDDA 1GGZA 4C0JA 2V53A 1KSOA 1QTXA 3GK4X 3FWBA 4IL1A 1A03A 1DJIA 2NXQA 3OP0A 4MLWA 1LINA 1NX3A 1SL7A 3TS5B 1IJ6A 4I5KA 1OMRA 3CTNA 4DRWA 3PN7B 2WORA 1WDCB 4OR9B 1XFUO 2BE4A 2HQ8A 1F71A 1YUSA 4ORCB 1CM1A 2K2FA 1ALVA 1YX8A 2NZ0A 2NCOA 1NIWA 4N1GA 1KFUL 5KU1A 2KFGA 5FYXA 5I2QA 1FF1A 1A2XA 5D69A 4OV2A 1L7ZA 1JUOA 4PE0A 1SR6B 4DUQA 5HLOA 4YGCB 4NQGA 3SIAA 4OCIA 1S6CA 4ICBA 1S6IA 1UURA 1H4BA 2G2BA 1WRLA 3BOWB 1ZACA 4GPLB 5KTYA 2MRDA 1XFYO 1BODA 2RGIA 4USLA 2ZNEA 3ZNIA 2WOSA 3I5GB 1DGVA 2PVBA 2JNXA 3VRQA 1XFWO 1TIZA 2BL0C 1QXPA 4A4BA 3PM8A 1GQMA 1SBJA 3IQOA 1PRWA 5F6TA 3VRPA 4DCKA 2M1UA 2HETA 2M8UA 1B8CA 4ETOA 4ORAB 1PK0D 3WXAA 1KQMC 2CBLA 2IS9A 1TOPA 2KNEA 1KK8B 2BE6A 4YBHB 2BECA 1E8AA 1U5IA 3OB1B 1OQPA 3H4SE 1NX0A 1SYMA 2K7DA 1M45A 4QJ3B 3I5HC 2NCPA 1ZUZA 5I2LA 2JT0A 3LL8B 4OKHA 1CDLA 3O78A 2JQ6A 1XO5A 2JRFA 2ZRTA 4PE1A 1QVIY 1XA5A 1CLMA 2LLSA 5DKNA 5JOLA 3CLNA 1JF2A 3EVUA 2FJUB 3JVTC 2OS8C 3NXAA 5AANA 4P5OE 2LAPA 1ZMZA 2E6WA 5HKYA 3D0YB 4HREE 3SG7A 1AUIB 2BBMA 2Q4UA 1DMOA 1EXRA 2JULA 1DJZA 3HCMA 2KHNA 3TUYC 2FCDA 2KAYA 4DS7A 5TNCA 1SNLA 1K90D 1Y0VH 1XFZO 1PSBA 1OSAA 1Q80A 4PHNA 1QASA 2GGZA 1UP5A 1A75B 1M39A 1XK4A 1MR8A 4I5LB 4M2PA 2H61A 4MRYA 1EH2A 1K94A 2AMIA 2PASA 5CPVA 2MJWB 3SG2A 1Y6WA 5K89A 2F33A 4GNKB 1LVCD 4PCWA 1H8BA 2JXCA 2LP2A 5J3XA 4FTGA 1SCMC 1B47A 2LVIA 5AERA 2AAOA 5CSJA 1UHNA 1SPYA 2HF5A 4XJKB 3GK2A 1PVAA 2L4HA 2OTGB 2H61C 2K61A 2I18A 2LLUA 1K2HA 1QIVA 1J1EA 2HQWA 3AKAA 1AP4A 2KQYA 1LA3A 1NCZA 1YVLA 3PALA 4P2YB 3CWGA 2KI4C 1LXFC 4GGFC 5I8NA 1F4OA 4N1FA 2LUCA 5HKZA 1NPQA 3AKBA 1KWOC 1UHIA 1KK7Y 5G08A 1K95A 2PRUA 3F45A 4YGAA 3BQ3A 2LVKA 1J55A 2LVJA 1TCOB 1RECA 1BOCA 4YI8A 1F55A 3I5IC 5B8IB 1QLSA 2KQ6A 1PALA 3LK0A 1QS7A 1JFJA 2SASA 1K93D 2O5GA 2A4JA 2M9GA 1PVBA 3BUXB 3TDIA 1F70A 1UWOA 2LHIA 3SIBA 4FQOA 2ZRSA 1IRJA 2WC8A 1MXEA 4MBEA 5AEQA 2MAZA 4AOMA 2LNKA 1K9PA 3PN7C 2LHLA 3I5FC 1BG1A 2JZIA 1YTZC 1YR5A 1R2UA 2L0PA 4E68A 2WCFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MRX A;  1TTX A;  1F54 A;  3OX6 A;  2GGM A;  2ZN8 A;  1JF0 A;  1WY9 A;  3BOW A;  5DKQ A;  1R6P A;  1DGU A;  3NSL A;  1S6J A;  3DVK A;  1J7Q A;  1UHJ A;  1AJ5 A;  5DKR A;  1DJY A;  3DVM A;  2L98 A;  1W7I B;  1BMO A;  3DVE A;  5KSZ A;  1YUT A;  2PMY A;  5I2O A;  2LV7 A;  1JWD A;  1DJG A;  1S1E A;  1B8L A;  2K2A A;  3LCP C;  4QJ5 B;  3NSK A;  1NCY A;  1TNQ A;  2BL0 B;  2M0R A;  2E30 A;  2R2I A;  2Q91 A;  4GGN A;  1GJY A;  1YRT B;  2EGD A;  1XYD A;  1DF0 B;  3C1V A;  3LLE A;  1FI5 A;  5GQQ C;  2F3Z A;  3EK7 A;  4MSP A;  2GV5 A;  2I7A A;  1EG3 A;  2LLT A;  1SCV A;  2F3Y A;  3SG6 A;  1EG4 A;  1QV1 A;  2PAL A;  3I5H B;  2O60 A;  3PLF B;  1OMV A;  2KAX A;  2ZN9 A;  5ER4 X;  3DF0 A;  3OX5 A;  1F8H A;  2LMT A;  1IQ3 A;  2PSR A;  3M0W A;  1B9A A;  4U8D A;  3JTD C;  2SCP A;  4MZK A;  1L2O C;  4PAL A;  1CFC A;  1JBA A;  1DJW A;  2KFF A;  4WRI A;  1B7T Y;  1JC2 A;  2M7N A;  5AXI A;  1NX2 A;  1BR4 B;  3OB2 B;  3QRX A;  5ER5 A;  1C07 A;  1FI6 A;  1MXL C;  4JWQ A;  3JVT B;  5JJG A;  2OS8 B;  1TNX A;  2Y1M A;  3D0Y A;  2WCB A;  2EC6 C;  4BY5 A;  1BU3 A;  2JT3 A;  5PAL A;  2BBN A;  1N0Y A;  3MSE B;  4MZL A;  1S5G Z;  2COL B;  3VRO A;  2LCP A;  1UHK A;  1M63 B;  1Y1U A;  2KSP A;  3TUY B;  2NLN A;  3VRR A;  3A4U B;  3O6B A;  2WND A;  1CFP A;  2BCX A;  1NYA A;  1UUS A;  1QVI Z;  2DOQ A;  2KGB C;  1AVS A;  1IQ5 A;  1SL8 A;  4PE4 A;  1BF5 A;  3KHE A;  1IWQ A;  4GAO A;  2L5X B;  2QPT A;  1G4Y R;  1OMD A;  1A75 A;  3K21 A;  3KF9 A;  2KDH A;  1B1G A;  3EK8 A;  3VRN A;  4I5N B;  4GBA A;  1QLK A;  3EK4 A;  4F0Z B;  1IG5 A;  3CR5 X;  2F2O A;  3HX4 A;  2MLF C;  3BUM B;  1G33 A;  1IJ5 A;  4ORB B;  4PHM A;  2Y4Q A;  1SCM B;  2KI6 C;  2ZFD A;  2MLE C;  3FWC A;  3SG4 A;  2CCM A;  1XK4 C;  4XJK A;  1AJ4 A;  2WCE A;  2LC5 A;  4GUK A;  2ISD A;  3KEV A;  5AFP A;  4DIR A;  3ZWH A;  3FIA A;  1PUL A;  1SRA A;  1QAT A;  1PSR A;  1QJT A;  3BYA A;  1TNP A;  2OPO A;  1DVI A;  4NDB A;  4QJ4 B;  1SK6 D;  2M1K B;  2M49 B;  1NSH A;  1S36 A;  3O4Y A;  3WHT B;  4HRG A;  4YRU A;  1CNP A;  1KCY A;  1GGW A;  1KWO B;  1X02 A;  1MQ1 A;  3NSO A;  1WLM A;  3EKJ A;  2H2K A;  1J1D A;  3BXK A;  2LMV A;  1RJV A;  1RK9 A;  2CXJ A;  1CFD A;  1RTP 1;  4PE7 A;  1YVH A;  3GOF A;  2KYC A;  5D7F A;  1BJF A;  2K7C A;  4CID A;  2LM5 A;  2JNF A;  1K96 A;  2HPS A;  1CMF A;  2CNP A;  3E3R A;  1CDP A;  1MF8 B;  4M2Q A;  2P6B B;  5HLV A;  3VGO A;  4CFQ A;  1CTR A;  1V1G A;  3PFV A;  4HSZ A;  3PSR A;  3EKH A;  4XYN A;  3D10 A;  3EVV A;  3NSI A;  3TS5 C;  1RWY A;  4BY4 A;  1KK7 Z;  5IBW A;  1ALW A;  2CT9 A;  2D8N A;  3FS7 A;  3I5F B;  2M29 A;  1WDC C;  3WHU B;  2LMU A;  2JWW A;  2K0J A;  2KYF A;  4AQJ A;  3RLZ A;  1NWD A;  1ZOT B;  4YGD B;  1OE9 B;  1EL4 A;  1C7W A;  1NP8 A;  2KGR A;  4C0L A;  1CM4 A;  2M7L A;  2LP3 A;  3SG3 A;  1S3P A;  1CDN A;  2ZND A;  2LUX A;  4JQ0 D;  1B8R A;  1SR6 C;  1TNW A;  2I94 A;  2L51 A;  4OVN F;  3CR2 A;  1CKK A;  1QIW A;  2G9B A;  1M46 A;  3AAJ A;  3TDZ A;  4WQ2 A;  1ODB A;  2BKI B;  4I5J A;  1DF0 A;  1MWN A;  1CMG A;  4YGE B;  1KQM B;  2MHH A;  1OOJ A;  3KO0 A;  1A29 A;  1TCF A;  2KI6 D;  3AAK A;  1SKT A;  1N65 A;  1C7V A;  1YUR A;  1NCX A;  1CFF A;  1KSM A;  1KFX S;  2JU0 A;  1DJH A;  1QX2 A;  1SY9 A;  2KBI A;  3DD4 A;  3I5G C;  4ZCV A;  2MA2 A;  2L2E A;  1FBV A;  2BCA A;  1QX7 A;  2Y5I A;  2K8M B;  5CSN A;  5HYD A;  1LA0 A;  1HQV A;  1QX5 B;  2F2P A;  3SG5 A;  4A4C A;  2JTZ A;  1W7J B;  1YX7 A;  1BT6 A;  4M2O A;  1LKJ A;  5CSI A;  1FW4 A;  1SL9 A;  2VRG A;  2CTN A;  3JTD B;  1MHO A;  1KK8 C;  1L2O B;  2LVV A;  4D1E A;  1J7P A;  4ZCU A;  1U5I B;  1WRK A;  3A8R A;  4YGB B;  4CLN A;  3IF7 A;  4MVF A;  1TN4 A;  2JPT A;  1DT7 B;  3TDU A;  4JPZ B;  1UHH A;  2KFH A;  2EC6 B;  1J7O A;  1S5G Y;  3GK1 A;  1V1F A;  2K7B A;  1BLQ A;  1WRZ A;  3CS1 A;  4PDZ A;  1WLZ A;  2LE9 B;  3DF0 B;  4L9M A;  4UPG A;  2JXL A;  1XFX O;  2KAV A;  2K7O A;  4MZJ A;  5CSF A;  1FPW A;  1K9U A;  1DJX A;  2FCE A;  4Q04 A;  1IKU A;  1IH0 A;  1CDM A;  1KFX L;  1S26 D;  1B7T Z;  3CR4 X;  1OZO A;  1AK8 A;  2F8P A;  4CFR A;  3IQQ A;  1YRU B;  2JOJ A;  1VRK A;  2M3W A;  2BKH B;  3BUO B;  4TNC A;  1QV0 A;  1XFV O;  4NDC A;  1HT9 A;  2L4I A;  1SMG A;  2LAN A;  3EVR A;  1ZFS A;  2Y1N A;  1A4P A;  2I2R E;  4C0K A;  1N2D A;  1F4Q A;  4N5X A;  4PHJ A;  1OZS A;  1SW8 A;  1K9K A;  2QAC A;  1CB1 A;  1Y1A A;  1EJ3 A;  3WNX B;  1Y1X A;  5HKW A;  1M31 A;  2ZKM X;  2JT8 A;  1G8I A;  1IGV A;  2AUC A;  3OHM B;  3BUN B;  2JTT A;  1NUB A;  1KQV A;  3LK1 A;  1K8U A;  1JSA A;  1NX1 A;  1RRO A;  3SJS A;  3PAT A;  3TZ1 A;  2B1U A;  4CPV A;  4WQ3 A;  4AQI A;  1CLL A;  5BPJ A;  1CLB A;  1BR1 B;  1YUU A;  2KI4 B;  3O2P A;  4MEW A;  3RM1 A;  4GGF A;  4MN0 A;  4GFT A;  1J7R A;  1DTL A;  2M97 A;  3KPX A;  4YI9 A;  2MBX A;  1XVJ A;  2KBM A;  1JFK A;  2KOT A;  1KFU S;  3DVJ A;  1B4C A;  1RFJ A;  1TRF A;  2TN4 A;  2EHB A;  4R1E A;  2BCB A;  2L50 A;  2OTG C;  3CGA A;  4HRH A;  3BUW B;  1MUX A;  3CZT X;  3I5I B;  2FOT A;  1D1O A;  2JC2 A;  1AHR A;  3ICB A;  4PHK A;  4NDD A;  1GGZ A;  4C0J A;  2V53 A;  1KSO A;  1QTX A;  3GK4 X;  3FWB A;  4IL1 A;  1A03 A;  1DJI A;  2NXQ A;  3OP0 A;  4MLW A;  1LIN A;  1NX3 A;  1SL7 A;  3TS5 B;  1IJ6 A;  4I5K A;  1OMR A;  3CTN A;  4DRW A;  3PN7 B;  2WOR A;  1WDC B;  4OR9 B;  1XFU O;  2BE4 A;  2HQ8 A;  1F71 A;  1YUS A;  4ORC B;  1CM1 A;  2K2F A;  1ALV A;  1YX8 A;  2NZ0 A;  2NCO A;  1NIW A;  4N1G A;  1KFU L;  5KU1 A;  2KFG A;  5FYX A;  5I2Q A;  1FF1 A;  1A2X A;  5D69 A;  4OV2 A;  1L7Z A;  1JUO A;  4PE0 A;  1SR6 B;  4DUQ A;  5HLO A;  4YGC B;  4NQG A;  3SIA A;  4OCI A;  1S6C A;  4ICB A;  1S6I A;  1UUR A;  1H4B A;  2G2B A;  1WRL A;  3BOW B;  1ZAC A;  4GPL B;  5KTY A;  2MRD A;  1XFY O;  1BOD A;  2RGI A;  4USL A;  2ZNE A;  3ZNI A;  2WOS A;  3I5G B;  1DGV A;  2PVB A;  2JNX A;  3VRQ A;  1XFW O;  1TIZ A;  2BL0 C;  1QXP A;  4A4B A;  3PM8 A;  1GQM A;  1SBJ A;  3IQO A;  1PRW A;  5F6T A;  3VRP A;  4DCK A;  2M1U A;  2HET A;  2M8U A;  1B8C A;  4ETO A;  4ORA B;  1PK0 D;  3WXA A;  1KQM C;  2CBL A;  2IS9 A;  1TOP A;  2KNE A;  1KK8 B;  2BE6 A;  4YBH B;  2BEC A;  1E8A A;  1U5I A;  3OB1 B;  1OQP A;  3H4S E;  1NX0 A;  1SYM A;  2K7D A;  1M45 A;  4QJ3 B;  3I5H C;  2NCP A;  1ZUZ A;  5I2L A;  2JT0 A;  3LL8 B;  4OKH A;  1CDL A;  3O78 A;  2JQ6 A;  1XO5 A;  2JRF A;  2ZRT A;  4PE1 A;  1QVI Y;  1XA5 A;  1CLM A;  2LLS A;  5DKN A;  5JOL A;  3CLN A;  1JF2 A;  3EVU A;  2FJU B;  3JVT C;  2OS8 C;  3NXA A;  5AAN A;  4P5O E;  2LAP A;  1ZMZ A;  2E6W A;  5HKY A;  3D0Y B;  4HRE E;  3SG7 A;  1AUI B;  2BBM A;  2Q4U A;  1DMO A;  1EXR A;  2JUL A;  1DJZ A;  3HCM A;  2KHN A;  3TUY C;  2FCD A;  2KAY A;  4DS7 A;  5TNC A;  1SNL A;  1K90 D;  1Y0V H;  1XFZ O;  1PSB A;  1OSA A;  1Q80 A;  4PHN A;  1QAS A;  2GGZ A;  1UP5 A;  1A75 B;  1M39 A;  1XK4 A;  1MR8 A;  4I5L B;  4M2P A;  2H61 A;  4MRY A;  1EH2 A;  1K94 A;  2AMI A;  2PAS A;  5CPV A;  2MJW B;  3SG2 A;  1Y6W A;  5K89 A;  2F33 A;  4GNK B;  1LVC D;  4PCW A;  1H8B A;  2JXC A;  2LP2 A;  5J3X A;  4FTG A;  1SCM C;  1B47 A;  2LVI A;  5AER A;  2AAO A;  5CSJ A;  1UHN A;  1SPY A;  2HF5 A;  4XJK B;  3GK2 A;  1PVA A;  2L4H A;  2OTG B;  2H61 C;  2K61 A;  2I18 A;  2LLU A;  1K2H A;  1QIV A;  1J1E A;  2HQW A;  3AKA A;  1AP4 A;  2KQY A;  1LA3 A;  1NCZ A;  1YVL A;  3PAL A;  4P2Y B;  3CWG A;  2KI4 C;  1LXF C;  4GGF C;  5I8N A;  1F4O A;  4N1F A;  2LUC A;  5HKZ A;  1NPQ A;  3AKB A;  1KWO C;  1UHI A;  1KK7 Y;  5G08 A;  1K95 A;  2PRU A;  3F45 A;  4YGA A;  3BQ3 A;  2LVK A;  1J55 A;  2LVJ A;  1TCO B;  1REC A;  1BOC A;  4YI8 A;  1F55 A;  3I5I C;  5B8I B;  1QLS A;  2KQ6 A;  1PAL A;  3LK0 A;  1QS7 A;  1JFJ A;  2SAS A;  1K93 D;  2O5G A;  2A4J A;  2M9G A;  1PVB A;  3BUX B;  3TDI A;  1F70 A;  1UWO A;  2LHI A;  3SIB A;  4FQO A;  2ZRS A;  1IRJ A;  2WC8 A;  1MXE A;  4MBE A;  5AEQ A;  2MAZ A;  4AOM A;  2LNK A;  1K9P A;  3PN7 C;  2LHL A;  3I5F C;  1BG1 A;  2JZI A;  1YTZ C;  1YR5 A;  1R2U A;  2L0P A;  4E68 A;  2WCF A; 
#chains in the Genus database with same CATH topology
 4MRX A;  1TTX A;  1F54 A;  3OX6 A;  2GGM A;  2ZN8 A;  1JF0 A;  1WY9 A;  2WCM A;  3BOW A;  5DKQ A;  1R6P A;  1DGU A;  3NSL A;  3OBV A;  1S6J A;  3DVK A;  2L5Y A;  1J7Q A;  1UHJ A;  1AJ5 A;  5DKR A;  1DJY A;  3DVM A;  2L98 A;  1W7I B;  1BMO A;  3DVE A;  5KSZ A;  1YUT A;  2PMY A;  3D73 A;  3D77 A;  5I2O A;  2LV7 A;  1JWD A;  1DJG A;  1S1E A;  1B8L A;  2K2A A;  3LCP C;  3L4L A;  2FJY A;  4QJ5 B;  3NSK A;  1NCY A;  1TNQ A;  2BL0 B;  2M0R A;  2E30 A;  2R2I A;  2Q91 A;  4GGN A;  1GJY A;  1YRT B;  2EGD A;  1XYD A;  1DF0 B;  3C1V A;  3LLE A;  5FI7 A;  1FI5 A;  5GQQ C;  2F3Z A;  3EK7 A;  2L2C A;  4MSP A;  2GV5 A;  4JKT A;  2I7A A;  1EG3 A;  2LLT A;  1SCV A;  2F3Y A;  1OOI X;  3SG6 A;  1EG4 A;  1QV1 A;  2PAL A;  2QEB A;  3I5H B;  2O60 A;  3PLF B;  3NHT A;  1OMV A;  2KAX A;  2ZN9 A;  5ER4 X;  3DF0 A;  3EG5 B;  3OX5 A;  1F8H A;  2LMT A;  1IQ3 A;  2PSR A;  3M0W A;  1B9A A;  4U8D A;  3JTD C;  2SCP A;  4MZK A;  1L2O C;  4PAL A;  1CFC A;  1JBA A;  3S0B A;  1DJW A;  2KFF A;  4WRI A;  3RZS A;  1B7T Y;  1JC2 A;  2M7N A;  2GTE A;  2P71 A;  5AXI A;  1NX2 A;  1BR4 B;  3OB2 B;  3QRX A;  5ER5 A;  1C07 A;  1FI6 A;  1MXL C;  4JWQ A;  3JVT B;  5JJG A;  2OS8 B;  3V2L A;  2QEO A;  1TNX A;  2ERB A;  2Y1M A;  3D0Y A;  2WCB A;  2EC6 C;  4BY5 A;  3SS3 A;  1DQE A;  1BU3 A;  2JT3 A;  5PAL A;  2PYQ A;  2BBN A;  1N0Y A;  3MSE B;  4MZL A;  1S5G Z;  2COL B;  3VRO A;  2LCP A;  1UHK A;  1M63 B;  1Y1U A;  2KSP A;  3BFB A;  2NLN A;  3TUY B;  3VRR A;  3A4U B;  3O6B A;  2WND A;  1CFP A;  2BCX A;  1NYA A;  1UUS A;  1QVI Z;  2DOQ A;  2KGB C;  1IIO A;  1AVS A;  1IQ5 A;  1SL8 A;  4PE4 A;  1BF5 A;  3KHE A;  1IWQ A;  4GAO A;  3SS5 A;  2L5X B;  2QPT A;  1G4Y R;  1OMD A;  1DC1 A;  1A75 A;  3K21 A;  3KF9 A;  2KDH A;  1B1G A;  3EK8 A;  4INW A;  3VRN A;  4I5N B;  2PQL A;  4GBA A;  2WCH A;  1QLK A;  3NGV A;  3EK4 A;  3S0E A;  1IG5 A;  3CR5 X;  2F2O A;  3HX4 A;  4F0Z B;  3D76 A;  2MLF C;  3BUM B;  1G33 A;  1IJ5 A;  4ORB B;  4PHM A;  2Y4Q A;  1SCM B;  2KI6 C;  2ZFD A;  2MLE C;  3FWC A;  3SG4 A;  2CCM A;  1XK4 C;  4XJK A;  1AJ4 A;  2WCE A;  2LC5 A;  4GUK A;  2ISD A;  3KEV A;  5AFP A;  4DIR A;  3QME A;  5FI6 A;  3ZWH A;  3FIA A;  1PUL A;  1SRA A;  1QAT A;  1PSR A;  1QJT A;  3BYA A;  1TNP A;  2OPO A;  1DVI A;  2KLE A;  4NDB A;  4QJ4 B;  1LS8 A;  1SK6 D;  2M1K B;  2M49 B;  1NSH A;  1S36 A;  3O4Y A;  3WHT B;  4HRG A;  4YRU A;  1CNP A;  1KCY A;  1GGW A;  1KWO B;  1X02 A;  1MQ1 A;  3NSO A;  1WLM A;  3EKJ A;  2H2K A;  2YGU A;  1J1D A;  3BXK A;  2LMV A;  3CDN A;  3DYE A;  1RJV A;  1RK9 A;  2CXJ A;  1CFD A;  1RTP 1;  4PE7 A;  1YVH A;  3GOF A;  2KYC A;  3PJI A;  1BJF A;  5D7F A;  2K7C A;  4CID A;  2LM5 A;  3CZ1 A;  2JNF A;  1K96 A;  2HPS A;  1CMF A;  2CNP A;  3B7A A;  3E3R A;  1CDP A;  1MF8 B;  4M2Q A;  2P6B B;  5HLV A;  3VGO A;  1OOG A;  1CTR A;  1V1G A;  3PFV A;  2WCK A;  3B6X A;  3PSR A;  3EKH A;  4HSZ A;  4XYN A;  3D10 A;  3EVV A;  3NSI A;  3TS5 C;  1RWY A;  4BY4 A;  1KK7 Z;  5IBW A;  1ALW A;  2CT9 A;  2D8N A;  3FS7 A;  3I5F B;  2M29 A;  1WDC C;  3WHU B;  3DZT A;  2LMU A;  2JWW A;  2K0J A;  2KYF A;  4AQJ A;  3RLZ A;  1NWD A;  1ZOT B;  4YGD B;  1OE9 B;  1QWV A;  1EL4 A;  1C7W A;  1NP8 A;  2KGR A;  3FE9 A;  1CM4 A;  2M7L A;  4C0L A;  3B86 A;  2LP3 A;  3SG3 A;  1S3P A;  1CDN A;  2ZND A;  2LUX A;  4JQ0 D;  1B8R A;  1SR6 C;  1TNW A;  2I94 A;  2L51 A;  4OVN F;  3CR2 A;  1CKK A;  1QIW A;  2G9B A;  1M46 A;  3AAJ A;  3TDZ A;  4WQ2 A;  1ODB A;  2BKI B;  4I5J A;  1DF0 A;  1MWN A;  3S0D A;  1CMG A;  4YGE B;  1KQM B;  2MHH A;  1OOJ A;  3KO0 A;  1A29 A;  1TCF A;  2KI6 D;  3AAK A;  1SKT A;  1N65 A;  1Z4H A;  1YUR A;  1NCX A;  1C7V A;  1KSM A;  1KFX S;  2JU0 A;  1DJH A;  1QX2 A;  1SY9 A;  1TUZ A;  2KBI A;  3DD4 A;  3I5G C;  4ZCV A;  2MA2 A;  2QEV A;  2L2E A;  1FBV A;  2BCA A;  1QX7 A;  2Y5I A;  2K8M B;  5CSN A;  5HYD A;  1LA0 A;  1HQV A;  1QX5 B;  2F2P A;  3SG5 A;  4A4C A;  2JTZ A;  1W7J B;  1XFR A;  1YX7 A;  3O4X A;  1BT6 A;  4M2O A;  1LKJ A;  5CSI A;  1FW4 A;  1SL9 A;  2VRG A;  3D75 A;  2CTN A;  3JTD B;  3S0G A;  1MHO A;  3R1O A;  1KK8 C;  1L2O B;  2LVV A;  1DEK A;  4D1E A;  1J7P A;  4ZCU A;  1U5I B;  1OOH A;  1WRK A;  3A8R A;  4YGB B;  4CLN A;  3IF7 A;  4MVF A;  1TN4 A;  2JPT A;  1DT7 B;  3TDU A;  4JPZ B;  1UHH A;  2KFH A;  2EC6 B;  1J7O A;  1S5G Y;  3GK1 A;  1V1F A;  2K7B A;  1BLQ A;  1WRZ A;  3CS1 A;  3CZ2 A;  1WLZ A;  2LE9 B;  3DF0 B;  3N7H A;  4L9M A;  4PDZ A;  5FI2 A;  4UPG A;  2JXL A;  3D74 A;  1TUJ A;  1XFX O;  2KAV A;  2K7O A;  3BJH A;  4MZJ A;  5CSF A;  1FPW A;  3R1P A;  1K9U A;  1DJX A;  2FCE A;  4Q04 A;  1IKU A;  1IH0 A;  1CDM A;  1KFX L;  1S26 D;  3FE6 A;  4FQT A;  1B7T Z;  3CR4 X;  1OZO A;  1AK8 A;  2BAP A;  2F8P A;  4CFR A;  3IQQ A;  1YRU B;  2JOJ A;  1VRK A;  2M3W A;  2BKH B;  3BUO B;  4TNC A;  1QV0 A;  1XFV O;  4NDC A;  2KLD A;  1HT9 A;  2L4I A;  1SMG A;  2LAN A;  3EVR A;  1ZFS A;  2Y1N A;  1P28 A;  1A4P A;  2I2R E;  4C0K A;  1N2D A;  1F4Q A;  4N5X A;  3R72 A;  4PHJ A;  1OZS A;  1SW8 A;  1K9K A;  2QAC A;  1CB1 A;  3CAB A;  1Y1A A;  1EJ3 A;  3WNX B;  1Y1X A;  3VB1 A;  5HKW A;  1M31 A;  2ZKM X;  2JT8 A;  1G8I A;  1IGV A;  2AUC A;  4OZD A;  3OHM B;  3BUN B;  2JTT A;  1NUB A;  1KQV A;  3LK1 A;  1K8U A;  1JSA A;  1NX1 A;  1RRO A;  3SJS A;  3PAT A;  3TZ1 A;  2B1U A;  4CPV A;  4WQ3 A;  1Z2C B;  4AQI A;  1CLL A;  5BPJ A;  1CLB A;  1BR1 B;  5DIC A;  1YUU A;  2KI4 B;  3O2P A;  4MEW A;  3RM1 A;  3SS4 A;  4GGF A;  4MN0 A;  4GFT A;  1J7R A;  1DTL A;  2M97 A;  3KPX A;  4YI9 A;  2MBX A;  2H8V A;  1XVJ A;  2KBM A;  3S0F A;  1JFK A;  2KOT A;  1KFU S;  3DVJ A;  1B4C A;  1RFJ A;  1TRF A;  2TN4 A;  2EHB A;  4R1E A;  1CFF A;  2WC6 A;  2BCB A;  2L50 A;  2OTG C;  3CGA A;  4HRH A;  3BUW B;  3CYZ A;  1MUX A;  1ORG A;  3CZT X;  3I5I B;  2FOT A;  1D1O A;  4F7F A;  2JC2 A;  3UNW A;  1C3Y A;  3B87 A;  1AHR A;  3B88 A;  3ICB A;  4PHK A;  4NDD A;  1GGZ A;  4C0J A;  2V53 A;  1KSO A;  1QTX A;  3GK4 X;  3FWB A;  4IL1 A;  1A03 A;  1DJI A;  2NXQ A;  3OP0 A;  3PM2 A;  4MLW A;  1LIN A;  1NX3 A;  1SL7 A;  3TS5 B;  1IJ6 A;  4I5K A;  1OMR A;  3CTN A;  3Q8I A;  3PN7 B;  4DRW A;  3BFH A;  2WOR A;  3UO9 A;  1WDC B;  4OR9 B;  1XFU O;  2BE4 A;  2HQ8 A;  3IVT A;  1F71 A;  1YUS A;  4ORC B;  1CM1 A;  2K2F A;  1ALV A;  1YX8 A;  2NZ0 A;  2NCO A;  1NIW A;  4N1G A;  1KFU L;  5KU1 A;  2KFG A;  5FYX A;  5I2Q A;  1FF1 A;  1A2X A;  5D69 A;  2WCJ A;  4OV2 A;  1L7Z A;  1JUO A;  2WCL A;  1SR6 B;  4PE0 A;  4DUQ A;  5HLO A;  4YGC B;  4NQG A;  3SIA A;  4OCI A;  1S6C A;  4ICB A;  1S6I A;  1UUR A;  1H4B A;  2G2B A;  3NHI A;  1WRL A;  3BOW B;  1ZAC A;  4GPL B;  5KTY A;  2MRD A;  1XFY O;  1BOD A;  2RGI A;  4USL A;  2ZNE A;  3ZNI A;  2WOS A;  3I5G B;  1DGV A;  2PVB A;  1TWO A;  2JNX A;  3VRQ A;  1XFW O;  1TIZ A;  2BL0 C;  1QXP A;  4A4B A;  3PM8 A;  1GQM A;  1SBJ A;  3IQO A;  1PRW A;  5F6T A;  3VRP A;  4DCK A;  2M1U A;  4JD9 A;  2HET A;  2M8U A;  1B8C A;  4ETO A;  4ORA B;  1PK0 D;  3DXL A;  3WXA A;  1KQM C;  2CBL A;  2IS9 A;  1TOP A;  2KNE A;  1KK8 B;  2BE6 A;  4YBH B;  1E8A A;  1U5I A;  2BEC A;  3OB1 B;  5HL1 A;  1OQP A;  2P70 A;  3DY9 A;  3H4S E;  1NX0 A;  1SYM A;  2K7D A;  1M45 A;  4QJ3 B;  3I5H C;  5EL2 A;  3FE8 A;  2NCP A;  1ZUZ A;  3L4A A;  5I2L A;  2JT0 A;  3LL8 B;  4OKH A;  1W9Z A;  1CDL A;  3O78 A;  2JQ6 A;  2KPH A;  1XO5 A;  2JRF A;  2ZRT A;  1OOF A;  4PE1 A;  1QVI Y;  1XA5 A;  1CLM A;  2LLS A;  5DKN A;  5JOL A;  3CLN A;  1JF2 A;  3EVU A;  2FJU B;  3JVT C;  2OS8 C;  3NXA A;  5AAN A;  4P5O E;  2LAP A;  1ZMZ A;  2E6W A;  5HKY A;  3D0Y B;  4HRE E;  3SG7 A;  1AUI B;  2BBM A;  2Q4U A;  5I94 A;  1DMO A;  1EXR A;  2JUL A;  1DJZ A;  3HCM A;  2KHN A;  3TUY C;  2FCD A;  3BFA A;  2KAY A;  4DS7 A;  5TNC A;  1SNL A;  1T14 A;  1K90 D;  1Y0V H;  1XFZ O;  1PSB A;  1OSA A;  1Q80 A;  4PHN A;  1QAS A;  2GGZ A;  1UP5 A;  1A75 B;  1M39 A;  1XK4 A;  1MR8 A;  4I5L B;  4M2P A;  2H61 A;  4MRY A;  1EH2 A;  1K94 A;  2AMI A;  2PAS A;  5CPV A;  2MJW B;  3SG2 A;  1DEL A;  1Y6W A;  5K89 A;  2F33 A;  4GNK B;  1LVC D;  1OW4 A;  4PCW A;  2JXC A;  1H8B A;  2LP2 A;  2WC5 A;  4INX A;  4FTG A;  1SCM C;  5J3X A;  1B47 A;  2LVI A;  1GM0 A;  4CFQ A;  5AER A;  2AAO A;  5CSJ A;  1UHN A;  3OGN A;  3CZ0 A;  1SPY A;  2HF5 A;  4XJK B;  3GK2 A;  1PVA A;  4KYN A;  2L4H A;  2OTG B;  2H61 C;  2K61 A;  2I18 A;  2LLU A;  1C3Z A;  1QIV A;  1J1E A;  2HQW A;  2QEH A;  3AKA A;  1AP4 A;  1K2H A;  2KQY A;  1LA3 A;  1NCZ A;  1YVL A;  3PAL A;  4P2Y B;  3CWG A;  2KI4 C;  1LXF C;  4GGF C;  5I8N A;  1F4O A;  4N1F A;  2LUC A;  5HKZ A;  1NPQ A;  3AKB A;  1KWO C;  1UHI A;  1KK7 Y;  2JPO A;  5G08 A;  1K95 A;  2PRU A;  3F45 A;  4YGA A;  3BQ3 A;  2LVK A;  1J55 A;  2LVJ A;  1TCO B;  1REC A;  1BOC A;  4YI8 A;  3S0A A;  1F55 A;  3I5I C;  5B8I B;  1QLS A;  2KQ6 A;  1SSE B;  1PAL A;  3LK0 A;  1QS7 A;  1JFJ A;  4IJ7 A;  2SAS A;  1K93 D;  2K60 A;  2O5G A;  3K1E A;  2A4J A;  2M9G A;  1PVB A;  3BUX B;  2QDI A;  3TDI A;  1F70 A;  1UWO A;  2LHI A;  4PT1 A;  3R1V A;  4FQO A;  2ZRS A;  1IRJ A;  3SIB A;  2BNX A;  1MXE A;  2WC8 A;  4MBE A;  5AEQ A;  3L47 A;  2MAZ A;  4AOM A;  2LNK A;  1K9P A;  3PN7 C;  2LHL A;  3I5F C;  1BG1 A;  2JZI A;  1YTZ C;  1YR5 A;  5D3O A;  1R2U A;  2L0P A;  4E68 A;  2WCF A;  3D78 A; 
#chains in the Genus database with same CATH homology
 4MRX A;  1TTX A;  1F54 A;  3OX6 A;  2GGM A;  2ZN8 A;  1JF0 A;  1WY9 A;  3BOW A;  5DKQ A;  1R6P A;  1DGU A;  3NSL A;  1S6J A;  3DVK A;  1J7Q A;  1UHJ A;  1AJ5 A;  5DKR A;  1DJY A;  3DVM A;  2L98 A;  1W7I B;  1BMO A;  3DVE A;  5KSZ A;  1YUT A;  2PMY A;  5I2O A;  2LV7 A;  1JWD A;  1DJG A;  1S1E A;  1B8L A;  2K2A A;  3LCP C;  4QJ5 B;  3NSK A;  1NCY A;  1TNQ A;  2BL0 B;  2M0R A;  2E30 A;  2R2I A;  2Q91 A;  4GGN A;  1GJY A;  1YRT B;  2EGD A;  1XYD A;  1DF0 B;  3C1V A;  3LLE A;  1FI5 A;  5GQQ C;  2F3Z A;  3EK7 A;  4MSP A;  2GV5 A;  2I7A A;  1EG3 A;  2LLT A;  1SCV A;  2F3Y A;  3SG6 A;  1EG4 A;  1QV1 A;  2PAL A;  3I5H B;  2O60 A;  3PLF B;  1OMV A;  2KAX A;  2ZN9 A;  5ER4 X;  3DF0 A;  3OX5 A;  1F8H A;  2LMT A;  1IQ3 A;  2PSR A;  3M0W A;  1B9A A;  4U8D A;  3JTD C;  2SCP A;  4MZK A;  1L2O C;  4PAL A;  1CFC A;  1JBA A;  1DJW A;  2KFF A;  4WRI A;  1B7T Y;  1JC2 A;  2M7N A;  5AXI A;  1NX2 A;  1BR4 B;  3OB2 B;  3QRX A;  5ER5 A;  1C07 A;  1FI6 A;  1MXL C;  4JWQ A;  3JVT B;  5JJG A;  2OS8 B;  1TNX A;  2Y1M A;  3D0Y A;  2WCB A;  2EC6 C;  4BY5 A;  1BU3 A;  2JT3 A;  5PAL A;  2BBN A;  1N0Y A;  3MSE B;  4MZL A;  1S5G Z;  2COL B;  3VRO A;  2LCP A;  1UHK A;  1M63 B;  1Y1U A;  2KSP A;  3TUY B;  2NLN A;  3VRR A;  3A4U B;  3O6B A;  2WND A;  1CFP A;  2BCX A;  1NYA A;  1UUS A;  1QVI Z;  2DOQ A;  2KGB C;  1AVS A;  1IQ5 A;  1SL8 A;  4PE4 A;  1BF5 A;  3KHE A;  1IWQ A;  4GAO A;  2L5X B;  2QPT A;  1G4Y R;  1OMD A;  1A75 A;  3K21 A;  3KF9 A;  2KDH A;  1B1G A;  3EK8 A;  3VRN A;  4I5N B;  4GBA A;  1QLK A;  3EK4 A;  4F0Z B;  1IG5 A;  3CR5 X;  2F2O A;  3HX4 A;  2MLF C;  3BUM B;  1G33 A;  1IJ5 A;  4ORB B;  4PHM A;  2Y4Q A;  1SCM B;  2KI6 C;  2ZFD A;  2MLE C;  3FWC A;  3SG4 A;  2CCM A;  1XK4 C;  4XJK A;  1AJ4 A;  2WCE A;  2LC5 A;  4GUK A;  2ISD A;  3KEV A;  5AFP A;  4DIR A;  3ZWH A;  3FIA A;  1PUL A;  1SRA A;  1QAT A;  1PSR A;  1QJT A;  3BYA A;  1TNP A;  2OPO A;  1DVI A;  4NDB A;  4QJ4 B;  1SK6 D;  2M1K B;  2M49 B;  1NSH A;  1S36 A;  3O4Y A;  3WHT B;  4HRG A;  4YRU A;  1CNP A;  1KCY A;  1GGW A;  1KWO B;  1X02 A;  1MQ1 A;  3NSO A;  1WLM A;  3EKJ A;  2H2K A;  1J1D A;  3BXK A;  2LMV A;  1RJV A;  1RK9 A;  2CXJ A;  1CFD A;  1RTP 1;  4PE7 A;  1YVH A;  3GOF A;  2KYC A;  5D7F A;  1BJF A;  2K7C A;  4CID A;  2LM5 A;  2JNF A;  1K96 A;  2HPS A;  1CMF A;  2CNP A;  3E3R A;  1CDP A;  1MF8 B;  4M2Q A;  2P6B B;  5HLV A;  3VGO A;  4CFQ A;  1CTR A;  1V1G A;  3PFV A;  4HSZ A;  3PSR A;  3EKH A;  4XYN A;  3D10 A;  3EVV A;  3NSI A;  3TS5 C;  1RWY A;  4BY4 A;  1KK7 Z;  5IBW A;  1ALW A;  2CT9 A;  2D8N A;  3FS7 A;  3I5F B;  2M29 A;  1WDC C;  3WHU B;  2LMU A;  2JWW A;  2K0J A;  2KYF A;  4AQJ A;  3RLZ A;  1NWD A;  1ZOT B;  4YGD B;  1OE9 B;  1EL4 A;  1C7W A;  1NP8 A;  2KGR A;  4C0L A;  1CM4 A;  2M7L A;  2LP3 A;  3SG3 A;  1S3P A;  1CDN A;  2ZND A;  2LUX A;  4JQ0 D;  1B8R A;  1SR6 C;  1TNW A;  2I94 A;  2L51 A;  4OVN F;  3CR2 A;  1CKK A;  1QIW A;  2G9B A;  1M46 A;  3AAJ A;  3TDZ A;  4WQ2 A;  1ODB A;  2BKI B;  4I5J A;  1DF0 A;  1MWN A;  1CMG A;  4YGE B;  1KQM B;  2MHH A;  1OOJ A;  3KO0 A;  1A29 A;  1TCF A;  2KI6 D;  3AAK A;  1SKT A;  1N65 A;  1C7V A;  1YUR A;  1NCX A;  1CFF A;  1KSM A;  1KFX S;  2JU0 A;  1DJH A;  1QX2 A;  1SY9 A;  2KBI A;  3DD4 A;  3I5G C;  4ZCV A;  2MA2 A;  2L2E A;  1FBV A;  2BCA A;  1QX7 A;  2Y5I A;  2K8M B;  5CSN A;  5HYD A;  1LA0 A;  1HQV A;  1QX5 B;  2F2P A;  3SG5 A;  4A4C A;  2JTZ A;  1W7J B;  1YX7 A;  1BT6 A;  4M2O A;  1LKJ A;  5CSI A;  1FW4 A;  1SL9 A;  2VRG A;  2CTN A;  3JTD B;  1MHO A;  1KK8 C;  1L2O B;  2LVV A;  4D1E A;  1J7P A;  4ZCU A;  1U5I B;  1WRK A;  3A8R A;  4YGB B;  4CLN A;  3IF7 A;  4MVF A;  1TN4 A;  2JPT A;  1DT7 B;  3TDU A;  4JPZ B;  1UHH A;  2KFH A;  2EC6 B;  1J7O A;  1S5G Y;  3GK1 A;  1V1F A;  2K7B A;  1BLQ A;  1WRZ A;  3CS1 A;  4PDZ A;  1WLZ A;  2LE9 B;  3DF0 B;  4L9M A;  4UPG A;  2JXL A;  1XFX O;  2KAV A;  2K7O A;  4MZJ A;  5CSF A;  1FPW A;  1K9U A;  1DJX A;  2FCE A;  4Q04 A;  1IKU A;  1IH0 A;  1CDM A;  1KFX L;  1S26 D;  1B7T Z;  3CR4 X;  1OZO A;  1AK8 A;  2F8P A;  4CFR A;  3IQQ A;  1YRU B;  2JOJ A;  1VRK A;  2M3W A;  2BKH B;  3BUO B;  4TNC A;  1QV0 A;  1XFV O;  4NDC A;  1HT9 A;  2L4I A;  1SMG A;  2LAN A;  3EVR A;  1ZFS A;  2Y1N A;  1A4P A;  2I2R E;  4C0K A;  1N2D A;  1F4Q A;  4N5X A;  4PHJ A;  1OZS A;  1SW8 A;  1K9K A;  2QAC A;  1CB1 A;  1Y1A A;  1EJ3 A;  3WNX B;  1Y1X A;  5HKW A;  1M31 A;  2ZKM X;  2JT8 A;  1G8I A;  1IGV A;  2AUC A;  3OHM B;  3BUN B;  2JTT A;  1NUB A;  1KQV A;  3LK1 A;  1K8U A;  1JSA A;  1NX1 A;  1RRO A;  3SJS A;  3PAT A;  3TZ1 A;  2B1U A;  4CPV A;  4WQ3 A;  4AQI A;  1CLL A;  5BPJ A;  1CLB A;  1BR1 B;  1YUU A;  2KI4 B;  3O2P A;  4MEW A;  3RM1 A;  4GGF A;  4MN0 A;  4GFT A;  1J7R A;  1DTL A;  2M97 A;  3KPX A;  4YI9 A;  2MBX A;  1XVJ A;  2KBM A;  1JFK A;  2KOT A;  1KFU S;  3DVJ A;  1B4C A;  1RFJ A;  1TRF A;  2TN4 A;  2EHB A;  4R1E A;  2BCB A;  2L50 A;  2OTG C;  3CGA A;  4HRH A;  3BUW B;  1MUX A;  3CZT X;  3I5I B;  2FOT A;  1D1O A;  2JC2 A;  1AHR A;  3ICB A;  4PHK A;  4NDD A;  1GGZ A;  4C0J A;  2V53 A;  1KSO A;  1QTX A;  3GK4 X;  3FWB A;  4IL1 A;  1A03 A;  1DJI A;  2NXQ A;  3OP0 A;  4MLW A;  1LIN A;  1NX3 A;  1SL7 A;  3TS5 B;  1IJ6 A;  4I5K A;  1OMR A;  3CTN A;  4DRW A;  3PN7 B;  2WOR A;  1WDC B;  4OR9 B;  1XFU O;  2BE4 A;  2HQ8 A;  1F71 A;  1YUS A;  4ORC B;  1CM1 A;  2K2F A;  1ALV A;  1YX8 A;  2NZ0 A;  2NCO A;  1NIW A;  4N1G A;  1KFU L;  5KU1 A;  2KFG A;  5FYX A;  5I2Q A;  1FF1 A;  1A2X A;  5D69 A;  4OV2 A;  1L7Z A;  1JUO A;  4PE0 A;  1SR6 B;  4DUQ A;  5HLO A;  4YGC B;  4NQG A;  3SIA A;  4OCI A;  1S6C A;  4ICB A;  1S6I A;  1UUR A;  1H4B A;  2G2B A;  1WRL A;  3BOW B;  1ZAC A;  4GPL B;  5KTY A;  2MRD A;  1XFY O;  1BOD A;  2RGI A;  4USL A;  2ZNE A;  3ZNI A;  2WOS A;  3I5G B;  1DGV A;  2PVB A;  2JNX A;  3VRQ A;  1XFW O;  1TIZ A;  2BL0 C;  1QXP A;  4A4B A;  3PM8 A;  1GQM A;  1SBJ A;  3IQO A;  1PRW A;  5F6T A;  3VRP A;  4DCK A;  2M1U A;  2HET A;  2M8U A;  1B8C A;  4ETO A;  4ORA B;  1PK0 D;  3WXA A;  1KQM C;  2CBL A;  2IS9 A;  1TOP A;  2KNE A;  1KK8 B;  2BE6 A;  4YBH B;  2BEC A;  1E8A A;  1U5I A;  3OB1 B;  1OQP A;  3H4S E;  1NX0 A;  1SYM A;  2K7D A;  1M45 A;  4QJ3 B;  3I5H C;  2NCP A;  1ZUZ A;  5I2L A;  2JT0 A;  3LL8 B;  4OKH A;  1CDL A;  3O78 A;  2JQ6 A;  1XO5 A;  2JRF A;  2ZRT A;  4PE1 A;  1QVI Y;  1XA5 A;  1CLM A;  2LLS A;  5DKN A;  5JOL A;  3CLN A;  1JF2 A;  3EVU A;  2FJU B;  3JVT C;  2OS8 C;  3NXA A;  5AAN A;  4P5O E;  2LAP A;  1ZMZ A;  2E6W A;  5HKY A;  3D0Y B;  4HRE E;  3SG7 A;  1AUI B;  2BBM A;  2Q4U A;  1DMO A;  1EXR A;  2JUL A;  1DJZ A;  3HCM A;  2KHN A;  3TUY C;  2FCD A;  2KAY A;  4DS7 A;  5TNC A;  1SNL A;  1K90 D;  1Y0V H;  1XFZ O;  1PSB A;  1OSA A;  1Q80 A;  4PHN A;  1QAS A;  2GGZ A;  1UP5 A;  1A75 B;  1M39 A;  1XK4 A;  1MR8 A;  4I5L B;  4M2P A;  2H61 A;  4MRY A;  1EH2 A;  1K94 A;  2AMI A;  2PAS A;  5CPV A;  2MJW B;  3SG2 A;  1Y6W A;  5K89 A;  2F33 A;  4GNK B;  1LVC D;  4PCW A;  1H8B A;  2JXC A;  2LP2 A;  5J3X A;  4FTG A;  1SCM C;  1B47 A;  2LVI A;  5AER A;  2AAO A;  5CSJ A;  1UHN A;  1SPY A;  2HF5 A;  4XJK B;  3GK2 A;  1PVA A;  2L4H A;  2OTG B;  2H61 C;  2K61 A;  2I18 A;  2LLU A;  1K2H A;  1QIV A;  1J1E A;  2HQW A;  3AKA A;  1AP4 A;  2KQY A;  1LA3 A;  1NCZ A;  1YVL A;  3PAL A;  4P2Y B;  3CWG A;  2KI4 C;  1LXF C;  4GGF C;  5I8N A;  1F4O A;  4N1F A;  2LUC A;  5HKZ A;  1NPQ A;  3AKB A;  1KWO C;  1UHI A;  1KK7 Y;  5G08 A;  1K95 A;  2PRU A;  3F45 A;  4YGA A;  3BQ3 A;  2LVK A;  1J55 A;  2LVJ A;  1TCO B;  1REC A;  1BOC A;  4YI8 A;  1F55 A;  3I5I C;  5B8I B;  1QLS A;  2KQ6 A;  1PAL A;  3LK0 A;  1QS7 A;  1JFJ A;  2SAS A;  1K93 D;  2O5G A;  2A4J A;  2M9G A;  1PVB A;  3BUX B;  3TDI A;  1F70 A;  1UWO A;  2LHI A;  3SIB A;  4FQO A;  2ZRS A;  1IRJ A;  2WC8 A;  1MXE A;  4MBE A;  5AEQ A;  2MAZ A;  4AOM A;  2LNK A;  1K9P A;  3PN7 C;  2LHL A;  3I5F C;  1BG1 A;  2JZI A;  1YTZ C;  1YR5 A;  1R2U A;  2L0P A;  4E68 A;  2WCF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...