3CR5X

X-ray structure of bovine pnt-zn(2+),ca(2+)-s100b
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
91
structure length
91
Chain Sequence
b'MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
molecule tags Metal binding protein
source organism Bos taurus
publication title Divalent metal ion complexes of S100B in the absence and presence of pentamidine.
pubmed doi rcsb
total genus 31
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2008-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00036 EF-hand_1 EF hand
X PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3cr5X00
3FWCA 2L4IA 2MLEC 1JSAA 1S6IA 1AP4A 1S5GY 2BCAA 2ZNDA 3FWBA 1M31A 4OV2A 2R2IA 1BOCA 2KQ6A 2L4HA 5KTYA 3D10A 2K7OA 2LNKA 2HQ8A 1U5IA 3PLFB 2ZRTA 1TCFA 1SR6B 1DJHA 2BKHB 1Y1AA 1S6JA 2KAVA 3VRNA 3KPXA 1ZOTB 3K21A 1KWOB 4ETOA 4U8DA 3EVVA 4AQJA 2LMUA 3CS1A 4M2QA 4GNKB 1C7VA 2HPSA 1TTXA 1NX2A 2H61A 1XVJA 2ZRSA 2JZIA 1B7TY 4MRXA 5D7FA 3NXAA 2F2PA 5HYDA 1DJXA 1OMRA 3EKHA 2KFGA 4M2OA 4A4CA 4QJ5B 3O4YA 2D8NA 1NPQA 1LKJA 4YBHB 4C0JA 2K7DA 4L9MA 1DJGA 4GGFC 4JWQA 1NX1A 3ICBA 3KEVA 3DVJA 4GUKA 4YGAA 1LA3A 2A4JA 3TUYC 1CNPA 5FYXA 2PALA 2G2BA 2KYFA 3KHEA 1AUIB 4TNCA 3DVEA 1BR1B 1PSRA 1RK9A 1KFXL 2LM5A 2BE6A 1QX5B 2WNDA 1OMVA 2OS8B 2M29A 3OB1B 2WCBA 1FW4A 5I2QA 2M97A 2OTGC 1F54A 3BOWB 2WORA 2F3ZA 2JTTA 3HCMA 1GQMA 1WLMA 1JUOA 1N2DA 1YUSA 1JBAA 1CDLA 1HQVA 2L5XB 2V53A 4PE4A 4A4BA 2LVKA 1MHOA 4USLA 3CR5X 1L2OB 2KFFA 2M1UA 1SKTA 3VROA 2MLFC 2I18A 3ZWHA 1CMGA 2L2EA 2KI4B 1F4OA 1QIVA 2LVIA 2OPOA 1XFZO 3FS7A 1JC2A 1DJYA 1SL8A 4N5XA 4CLNA 1AK8A 1X02A 1UHHA 3QRXA 1EJ3A 1G4YR 1ZFSA 1BR4B 2MA2A 4GPLB 5F6TA 2BBMA 1CFPA 2OTGB 1BJFA 3EK8A 3SG2A 1EXRA 1J1EA 3DVKA 2LHIA 3SG4A 2CXJA 1B8CA 1UHJA 2QACA 2KHNA 4FQOA 5IBWA 1TNXA 1V1GA 1TNQA 1UUSA 2FOTA 3PATA 1M39A 2GGZA 1KK8B 1AJ5A 2O60A 5KSZA 1DGVA 4YRUA 3I5HC 2H61C 1AHRA 1IRJA 2LVVA 2MAZA 4PCWA 3I5IC 1OE9B 3BOWA 3O78A 1KK7Z 5ER4X 1QV0A 5GQQC 3LCPC 1DJWA 4C0KA 1WLZA 2MRDA 4PHNA 1DF0A 1S26D 1SCVA 3SJSA 3SG3A 2M3WA 1NCYA 3LK0A 4I5KA 2BCBA 2F33A 3LLEA 3EVRA 4MZKA 1XFUO 2LLTA 1LINA 1TRFA 5HKYA 2KBMA 3AAKA 1SW8A 3VRQA 1YTZC 2F2OA 2KI6D 1S3PA 4FTGA 2MJWB 3NSKA 1QXPA 1KK8C 2SCPA 4PE1A 3IQQA 4AQIA 3FIAA 3I5IB 5I2OA 5I8NA 4MZJA 1IQ5A 1IG5A 2F3YA 4DCKA 2M8UA 3PN7C 5HKWA 2Y4QA 3EVUA 1WRZA 2CCMA 3JVTB 2L51A 1IH0A 1F8HA 1IJ5A 1KWOC 1B8RA 1WRKA 3AKBA 3KO0A 4QJ3B 5CSIA 2HQWA 1AVSA 2KAXA 1QATA 1BF5A 2KI6C 1KQVA 3GK1A 2KNEA 3A4UB 2P6BB 3CLNA 3PALA 1OOJA 5AXIA 3BQ3A 3JTDB 1QTXA 2HF5A 3PM8A 1CFCA 1TIZA 1K93D 1F70A 1OZSA 1FBVA 5HLVA 1KCYA 3M0WA 1MF8B 1XK4A 2M9GA 1MXEA 1TNPA 2JT3A 2PASA 5I2LA 4UPGA 2HETA 4MSPA 1PRWA 1CB1A 2IS9A 3GK2A 4DUQA 4GGFA 1Y1XA 4YGCB 1TNWA 5JJGA 1M46A 4CIDA 1JF0A 4ZCUA 5AERA 3PFVA 3JTDC 2KFHA 4WQ3A 4R1EA 2TN4A 2KGRA 4BY4A 3DVMA 1PVAA 4GFTA 4YGDB 4YGBB 1FF1A 1YVHA 2O5GA 1PVBA 1K8UA 2BCXA 2JULA 4WQ2A 1NUBA 1RROA 1OMDA 2E6WA 1DF0B 2JWWA 4NDBA 2F8PA 1IQ3A 2MBXA 1LA0A 2CNPA 2Y1NA 1NCZA 1K95A 3TDZA 2JXLA 4HRHA 1KFUL 1CLLA 1VRKA 2ZNEA 1DT7B 1S36A 2NCPA 1YUTA 1SMGA 2JU0A 3WHUB 1J7QA 2M1KB 2WC8A 4Q04A 3CR4X 1H8BA 3D0YB 4ORAB 1J7PA 1S5GZ 2JRFA 3WNXB 1QIWA 4MBEA 2M7LA 1A4PA 2LHLA 1SY9A 3RLZA 3EKJA 3I5HB 3WXAA 1DMOA 1IJ6A 1KQMB 2WOSA 2FJUB 1Q80A 2RGIA 3BXKA 2GGMA 2ZN8A 3VRPA 2WCFA 3I5GC 1SR6C 4D1EA 1BODA 1JFJA 1UHIA 1XK4C 2BBNA 2AUCA 2LUCA 2LLSA 4ICBA 1QV1A 2JTZA 1UHKA 2JNFA 1KFUS 4NDCA 1MQ1A 1J55A 2LC5A 1L7ZA 4JQ0D 1TOPA 1A75A 1AJ4A 1ZMZA 1RECA 4M2PA 3NSLA 4PE0A 2KAYA 1RTP1 3BUMB 5DKRA 3SIAA 3PSRA 4QJ4B 4N1GA 4PE7A 1R2UA 3NSIA 3AKAA 3I5GB 1XO5A 2VRGA 1B1GA 1PALA 3OHMB 2JNXA 4I5NB 2Q4UA 4PDZA 4OKHA 3SG7A 2AMIA 1WDCB 3NSOA 4HRGA 2JC2A 4JPZB 3OB2B 3O6BA 1QS7A 2BE4A 5HLOA 2KOTA 2LVJA 3OX5A 2PMYA 5AANA 4XJKA 1XFWO 1Y1UA 2I2RE 2QPTA 4MZLA 1ALVA 1BMOA 4GAOA 1A29A 1LXFC 1YUUA 1YR5A 2PVBA 3EK7A 1L2OC 2H2KA 1YX7A 4OR9B 3TZ1A 2KBIA 1UP5A 3LK1A 5CSNA 4ORBB 2L50A 1QVIZ 1K9KA 1DVIA 1OQPA 1YX8A 3LL8B 2EGDA 2LLUA 1DGUA 3AAJA 1IGVA 3TS5B 1K94A 2I94A 4YI9A 5AEQA 1YRUB 2LUXA 4IL1A 1K9PA 2ZN9A 3GOFA 4GBAA 1JWDA 1SRAA 1MR8A 3IQOA 1EG3A 1LVCD 1B47A 2LV7A 1CM4A 1DTLA 2M49B 1SYMA 2NCOA 2WCEA 1SNLA 3CZTX 3TUYB 4OCIA 1NIWA 1SPYA 1XFVO 2I7AA 2Y1MA 1K2HA 1KFXS 3OX6A 1YURA 3SG5A 2GV5A 5TNCA 1QX2A 4MN0A 1ALWA 2K0JA 4F0ZB 1A75B 3BUWB 5DKNA 5B8IB 1QASA 1NYAA 2BL0B 1B4CA 3OP0A 1F55A 1OSAA 2LMTA 4NDDA 5D69A 1XFXO 5DKQA 1JF2A 1UHNA 3I5FB 1NWDA 5PALA 1JFKA 1G33A 3DF0B 1V1FA 1S6CA 1K96A 1RFJA 1SL7A 2JOJA 1KK7Y 1IKUA 1RWYA 1YVLA 2JQ6A 2LMVA 2COLB 1IWQA 3PN7B 2K2FA 1CDMA 1CM1A 4GGNA 2LP3A 3F45A 1N0YA 1FI5A 1PSBA 2KYCA 2ZFDA 5ER5A 1SBJA 3BYAA 4XYNA 3ZNIA 1J7RA 1H4BA 5CPVA 2BL0C 1PK0D 2K2AA 2LE9B 1CDPA 1WRLA 2ISDA 3KF9A 1UURA 2EC6C 1PULA 1XA5A 2JPTA 1CFFA 2LAPA 3I5FC 3SG6A 2LCPA 2L0PA 2LANA 4HREE 1TN4A 1ZACA 1B7TZ 3VGOA 4N1FA 2SASA 2CTNA 2KGBC 4YI8A 1B9AA 1BG1A 3EK4A 2B1UA 3TDIA 1EL4A 1U5IB 1NP8A 3BUXB 1WDCC 1B8LA 1KSOA 4E68A 5K89A 1BLQA 2K8MB 4PHKA 3CGAA 2KQYA 3HX4A 2JT8A 3DF0A 4PALA 1FI6A 2EC6B 1GGWA 5G08A 1Y0VH 1MWNA 2E30A 1CTRA 1S1EA 5JOLA 1GGZA 1QJTA 1CLMA 1ZUZA 2NXQA 1FPWA 1NCXA 1KSMA 2M7NA 3H4SE 3IF7A 2KSPA 2ZKMX 5CSJA 1EH2A 3SIBA 2DOQA 1NSHA 2LP2A 4DS7A 5BPJA 4CFQA 1DJZA 4MLWA 2OS8C 5J3XA 3RM1A 1QLSA 1HT9A 5CSFA 4MEWA 4P2YB 4WRIA 1DJIA 1J7OA 2CT9A 1M63B 1G8IA 1A2XA 4C0LA 2K7BA 3CR2A 1NX0A 1C7WA 2PSRA 4P5OE 3CWGA 4XJKB 1BT6A 3E3RA 1QLKA 1MUXA 1RJVA 3O2PA 3D0YA 1W7IB 5HKZA 3MSEB 1SCMC 1XYDA 3CTNA 1KQMC 2KI4C 1CDNA 4CPVA 1Y6WA 2Q91A 3BUOB 4HSZA 5KU1A 4PHMA 1XFYO 2JXCA 2CBLA 3BUNB 1N65A 2EHBA 1QVIY 2K7CA 2L98A 2BKIB 2KDHA 2BECA 1TCOB 2Y5IA 3JVTC 1J1DA 4PHJA 4MVFA 1E8AA 4NQGA 3WHTB 4BY5A 1F71A 1EG4A 2JT0A 1D1OA 1ODBA 3TDUA 1YRTB 1K9UA 1A03A 1NX3A 1F4QA 1WY9A 3DD4A 1MXLC 1K90D 1CMFA 1CLBA 4I5JA 2PRUA 2NLNA 4ZCVA 5AFPA 4DRWA 1OZOA 1UWOA 3C1VA 4CFRA 4AOMA 1SCMB 4DIRA 1C07A 1CFDA 3VRRA 4ORCB 2M0RA 1M45A 1R6PA 1QX7A 2FCEA 4OVNF 2K61A 2G9BA 2AAOA 3GK4X 3TS5C 1BU3A 3A8RA 1GJYA 1SK6D 4I5LB 2FCDA 4YGEB 1SL9A 1CKKA 2MHHA 4MRYA 1W7JB 2NZ0A
chains in the Genus database with same CATH superfamily
3FWCA 2L4IA 2MLEC 1JSAA 1S6IA 1AP4A 1S5GY 2BCAA 2ZNDA 3FWBA 1Z4HA 1M31A 4OV2A 1Z2CB 5I94A 2R2IA 1C3YA 1BOCA 2KQ6A 2L4HA 3BFHA 5KTYA 3D10A 2K7OA 2LNKA 2HQ8A 1U5IA 3PLFB 2ZRTA 1TCFA 1SR6B 1DJHA 2BKHB 2QEOA 1Y1AA 1S6JA 2KAVA 3VRNA 3KPXA 4IJ7A 1ZOTB 3K21A 1KWOB 4ETOA 4U8DA 3EVVA 4AQJA 2LMUA 3CS1A 4M2QA 5DICA 3CZ0A 4GNKB 2HPSA 1C7VA 1TTXA 1NX2A 2H61A 1XVJA 2ZRSA 3UNWA 2JZIA 5HL1A 1B7TY 4MRXA 5D7FA 3NXAA 2F2PA 3DY9A 5HYDA 1DJXA 1OMRA 3EKHA 2KFGA 1DELA 4M2OA 4A4CA 4QJ5B 3O4YA 2D8NA 1NPQA 1LKJA 4YBHB 4C0JA 2K7DA 4L9MA 1DJGA 1OOFA 4GGFC 4JWQA 1NX1A 3D77A 3ICBA 3S0GA 3KEVA 3DVJA 4GUKA 4YGAA 1LA3A 2A4JA 1TUZA 3TUYC 5FYXA 1CNPA 2PALA 2G2BA 2KYFA 3KHEA 1AUIB 4TNCA 3DVEA 1BR1B 1PSRA 1RK9A 1KFXL 2LM5A 1P28A 1QX5B 1OW4A 1OMVA 2BE6A 2M29A 2OS8B 2WCBA 2WNDA 3Q8IA 1FW4A 5I2QA 2M97A 2OTGC 1F54A 3BOWB 2WORA 2F3ZA 3CYZA 2JTTA 3HCMA 1GQMA 1WLMA 1JUOA 1N2DA 1YUSA 1JBAA 1CDLA 1HQVA 2L5XB 2V53A 4PE4A 4A4BA 5FI7A 2LVKA 1LS8A 1MHOA 3R1OA 4USLA 3CR5X 1L2OB 2KFFA 2M1UA 1SKTA 3VROA 2MLFC 2I18A 3ZWHA 1CMGA 2L2EA 2KI4B 1F4OA 1QIVA 2LVIA 2OPOA 1XFZO 2WCKA 3FS7A 1JC2A 1DJYA 1SL8A 3OBVA 4N5XA 4CLNA 1AK8A 4INXA 3VB1A 1X02A 1UHHA 3QRXA 3UO9A 1ZFSA 1EJ3A 1G4YR 1BR4B 2MA2A 4GPLB 3D73A 2BBMA 2L2CA 2OTGB 5F6TA 1CFPA 1BJFA 3EG5B 3EK8A 3BJHA 3SG2A 1EXRA 3FE9A 5EL2A 5D3OA 3K1EA 1J1EA 3B87A 3DVKA 2LHIA 3SG4A 3BFBA 2CXJA 1B8CA 1UHJA 2QACA 2KHNA 4FQOA 3R72A 1TNXA 5IBWA 1V1GA 1TNQA 1UUSA 2ERBA 2FOTA 3PATA 1M39A 2GGZA 1KK8B 3SS3A 1AJ5A 2O60A 5KSZA 1DGVA 4YRUA 3I5HC 2H61C 3DXLA 1AHRA 1IRJA 2LVVA 2MAZA 3D78A 3I5IC 4PCWA 1OE9B 3BOWA 1T14A 3O78A 1KK7Z 5ER4X 1QV0A 3R1VA 5GQQC 1ORGA 3LCPC 2KLDA 1DJWA 4PT1A 4C0KA 1WLZA 2MRDA 3CABA 4PHNA 1DF0A 1S26D 1SCVA 3OB1B 3SJSA 3SG3A 2M3WA 1NCYA 3LK0A 4I5KA 2BCBA 2F33A 3LLEA 3EVRA 4MZKA 1XFUO 2LLTA 1LINA 1TRFA 5HKYA 2KBMA 3AAKA 1SW8A 3VRQA 1YTZC 2F2OA 2KI6D 1S3PA 4FTGA 2MJWB 3NSKA 1QXPA 1KK8C 2SCPA 3IVTA 4PE1A 1IKUA 3IQQA 4AQIA 3FIAA 3I5IB 5I2OA 5I8NA 4MZJA 2WC5A 2QEVA 1IQ5A 1IG5A 2F3YA 4DCKA 2M8UA 3PN7C 5HKWA 2Y4QA 3EVUA 1WRZA 2CCMA 2L5YA 2L51A 3JVTB 1F8HA 1IJ5A 1IH0A 1KWOC 1B8RA 1WRKA 3AKBA 1XFRA 3KO0A 4QJ3B 5CSIA 2HQWA 1AVSA 2KAXA 4FQTA 1QATA 1BF5A 2KI6C 1KQVA 3GK1A 2KNEA 3A4UB 2P6BB 3CLNA 3PALA 2QDIA 1OOJA 5AXIA 3BQ3A 3JTDB 1QTXA 2HF5A 3PM8A 1CFCA 1TIZA 1K93D 1F70A 1OZSA 1FBVA 5HLVA 1KCYA 3M0WA 1MF8B 1XK4A 2M9GA 1MXEA 1TNPA 2JT3A 2PASA 5I2LA 4UPGA 2HETA 4MSPA 1PRWA 1CB1A 2IS9A 3GK2A 4DUQA 1TWOA 4GGFA 1Y1XA 4YGCB 1TNWA 5JJGA 1M46A 4CIDA 1JF0A 4ZCUA 5AERA 3R1PA 3SS5A 3PFVA 3JTDC 2KFHA 4WQ3A 4R1EA 2TN4A 2KGRA 4BY4A 3DVMA 1PVAA 4GFTA 4YGDB 4YGBB 1FF1A 1YVHA 2O5GA 1C3ZA 1PVBA 1K8UA 1QWVA 3NGVA 2BCXA 2JULA 4WQ2A 1NUBA 1RROA 1OMDA 2E6WA 1DF0B 2JWWA 4NDBA 2F8PA 1IQ3A 2MBXA 1LA0A 2CNPA 2Y1NA 5FI6A 1NCZA 1K95A 3TDZA 2JXLA 4HRHA 3L4AA 1KFUL 1CLLA 1W9ZA 1VRKA 2ZNEA 1DT7B 1S36A 2FJYA 2NCPA 1YUTA 1SMGA 2JU0A 3WHUB 1J7QA 2M1KB 2WC8A 4Q04A 3CR4X 1H8BA 3D0YB 3D75A 4ORAB 3SS4A 1S5GZ 3L4LA 2JRFA 1J7PA 3WNXB 1QIWA 3B7AA 3D74A 4MBEA 1A4PA 2M7LA 2LHLA 1SY9A 3RLZA 3EKJA 1TUJA 3I5HB 3WXAA 3B6XA 1IJ6A 1DMOA 1KQMB 2PQLA 2WOSA 2FJUB 1Q80A 2RGIA 3BXKA 2GGMA 2ZN8A 3VRPA 2YGUA 2WCFA 3I5GC 1SR6C 4D1EA 1BODA 1JFJA 1UHIA 1XK4C 2BBNA 2AUCA 2LUCA 2LLSA 4ICBA 1QV1A 2JTZA 1UHKA 2JNFA 1KFUS 1OOGA 4NDCA 1MQ1A 1J55A 2LC5A 1L7ZA 4JQ0D 1TOPA 1A75A 1AJ4A 1ZMZA 1RECA 4M2PA 3NSLA 4PE0A 2KAYA 1RTP1 3BUMB 5DKRA 3SIAA 3PSRA 4QJ4B 4N1GA 4PE7A 1R2UA 3NSIA 2WCHA 2BNXA 3AKAA 3I5GB 1XO5A 2VRGA 1B1GA 1PALA 3OHMB 2JNXA 4I5NB 2Q4UA 3V2LA 4PDZA 4OKHA 3SG7A 2AMIA 1WDCB 2WCLA 3NSOA 4HRGA 2JC2A 4JPZB 3OB2B 3O6BA 1QS7A 2BE4A 5HLOA 2KOTA 2LVJA 3OX5A 2PMYA 5AANA 4XJKA 3RZSA 1XFWO 1Y1UA 2I2RE 2QPTA 3OGNA 4MZLA 1ALVA 1BMOA 4GAOA 1A29A 1LXFC 1YUUA 3D76A 1YR5A 3CDNA 2PVBA 3EK7A 3S0DA 1L2OC 2H2KA 1YX7A 4OR9B 3CZ2A 3TZ1A 2KBIA 1UP5A 1DEKA 3LK1A 5CSNA 4ORBB 2L50A 1QVIZ 1K9KA 3DYEA 1DVIA 1YX8A 1OQPA 3LL8B 2EGDA 2WCJA 2LLUA 1DGUA 3AAJA 1IGVA 3TS5B 1K94A 2I94A 4F7FA 4YI9A 3QMEA 5AEQA 1YRUB 2LUXA 4IL1A 2BAPA 1K9PA 2ZN9A 3GOFA 4GBAA 1JWDA 1GM0A 1SRAA 3N7HA 1MR8A 3IQOA 1EG3A 1LVCD 1B47A 2LV7A 1CM4A 1DTLA 2M49B 1SYMA 2NCOA 2WCEA 1SNLA 3CZTX 3TUYB 4OCIA 1NIWA 1SPYA 1XFVO 4KYNA 2I7AA 2Y1MA 1K2HA 1KFXS 3OX6A 1YURA 2JPOA 3NHIA 3FE6A 2GV5A 3S0BA 5TNCA 3SG5A 1QX2A 4MN0A 1ALWA 2K0JA 4F0ZB 1A75B 3BUWB 5DKNA 5B8IB 1QASA 1NYAA 2BL0B 1B4CA 3L47A 3OP0A 1F55A 1OSAA 2LMTA 4NDDA 5D69A 1XFXO 2WCMA 3S0FA 5DKQA 1JF2A 1UHNA 3I5FB 1NWDA 5PALA 1JFKA 1G33A 3DF0B 1V1FA 1S6CA 1K96A 1RFJA 1SL7A 2JOJA 1KK7Y 2P70A 1RWYA 1YVLA 2KLEA 2JQ6A 1DQEA 2LMVA 2COLB 1IWQA 3PN7B 2K2FA 1CDMA 1CM1A 3PJIA 4GGNA 2LP3A 3F45A 3S0AA 1N0YA 1FI5A 1PSBA 2KYCA 2ZFDA 5ER5A 1SBJA 3BYAA 4XYNA 4JKTA 3ZNIA 1J7RA 1H4BA 5CPVA 2BL0C 1PK0D 2K2AA 2LE9B 1CDPA 1WRLA 2KPHA 3KF9A 2ISDA 1UURA 2EC6C 1PULA 1XA5A 2JPTA 1CFFA 2LAPA 3I5FC 3SG6A 2LCPA 2L0PA 2LANA 3BFAA 4HREE 1TN4A 1ZACA 1B7TZ 1IIOA 3VGOA 4N1FA 2SASA 2CTNA 2WC6A 2KGBC 4YI8A 1B9AA 1BG1A 3EK4A 2B1UA 3NHTA 3TDIA 1EL4A 1U5IB 1NP8A 3BUXB 1WDCC 1B8LA 1KSOA 4E68A 5K89A 2GTEA 1BLQA 2K8MB 4PHKA 3CGAA 2KQYA 3HX4A 2JT8A 3B86A 3DF0A 4PALA 1FI6A 2EC6B 1GGWA 5G08A 1Y0VH 1MWNA 2E30A 1CTRA 1S1EA 2PYQA 5JOLA 1GGZA 1QJTA 1CLMA 1ZUZA 2NXQA 1FPWA 1NCXA 1KSMA 2M7NA 3H4SE 3IF7A 2KSPA 2ZKMX 5CSJA 1EH2A 3SIBA 1DC1A 2DOQA 1NSHA 2LP2A 4DS7A 5BPJA 4CFQA 1DJZA 4MLWA 2OS8C 5J3XA 3RM1A 1QLSA 1HT9A 5CSFA 4MEWA 4P2YB 4WRIA 1DJIA 1J7OA 2CT9A 1M63B 1G8IA 3DZTA 1A2XA 4C0LA 3B88A 2K7BA 3CR2A 5FI2A 1NX0A 1C7WA 2PSRA 4P5OE 3CWGA 3CZ1A 1BT6A 3E3RA 4XJKB 1QLKA 1MUXA 1RJVA 3O2PA 3D0YA 1W7IB 5HKZA 3MSEB 1SCMC 3FE8A 1XYDA 3CTNA 1KQMC 2KI4C 1CDNA 4CPVA 1Y6WA 2Q91A 3BUOB 4HSZA 5KU1A 4PHMA 1XFYO 2JXCA 2CBLA 1OOIX 3BUNB 1N65A 2EHBA 1QVIY 2K7CA 2L98A 2P71A 2BKIB 2KDHA 2BECA 1TCOB 2Y5IA 3JVTC 1SSEB 3S0EA 1J1DA 4PHJA 4MVFA 1E8AA 2QEHA 4NQGA 3WHTB 4BY5A 1F71A 1EG4A 2JT0A 1D1OA 1ODBA 3TDUA 1YRTB 1K9UA 1A03A 2K60A 3PM2A 1NX3A 1WY9A 1F4QA 1OOHA 3DD4A 1MXLC 1K90D 1CMFA 1CLBA 4I5JA 2PRUA 2NLNA 4ZCVA 5AFPA 4DRWA 1OZOA 1UWOA 3C1VA 4CFRA 2H8VA 1SCMB 4AOMA 4DIRA 1C07A 1CFDA 3VRRA 4ORCB 2M0RA 1M45A 1R6PA 1QX7A 2FCEA 2QEBA 4OVNF 2K61A 2G9BA 2AAOA 3GK4X 3TS5C 1BU3A 3A8RA 1GJYA 1SK6D 4I5LB 2FCDA 4OZDA 4YGEB 4JD9A 1SL9A 1CKKA 2MHHA 4MRYA 3O4XA 1W7JB 2NZ0A 4INWA
chains in the Genus database with same CATH topology
3FWCA 2L4IA 2MLEC 1JSAA 1S6IA 1AP4A 1S5GY 2BCAA 2ZNDA 3FWBA 1M31A 4OV2A 2R2IA 1BOCA 2KQ6A 2L4HA 5KTYA 3D10A 2K7OA 2LNKA 2HQ8A 1U5IA 3PLFB 2ZRTA 1TCFA 1SR6B 1DJHA 2BKHB 1Y1AA 1S6JA 2KAVA 3VRNA 3KPXA 1ZOTB 3K21A 1KWOB 4ETOA 4U8DA 3EVVA 4AQJA 2LMUA 3CS1A 4M2QA 4GNKB 1C7VA 2HPSA 1TTXA 1NX2A 2H61A 1XVJA 2ZRSA 2JZIA 1B7TY 4MRXA 5D7FA 3NXAA 2F2PA 5HYDA 1DJXA 1OMRA 3EKHA 2KFGA 4M2OA 4A4CA 4QJ5B 3O4YA 2D8NA 1NPQA 1LKJA 4YBHB 4C0JA 2K7DA 4L9MA 1DJGA 4GGFC 4JWQA 1NX1A 3ICBA 3KEVA 3DVJA 4GUKA 4YGAA 1LA3A 2A4JA 3TUYC 1CNPA 5FYXA 2PALA 2G2BA 2KYFA 3KHEA 1AUIB 4TNCA 3DVEA 1BR1B 1PSRA 1RK9A 1KFXL 2LM5A 2BE6A 1QX5B 2WNDA 1OMVA 2OS8B 2M29A 3OB1B 2WCBA 1FW4A 5I2QA 2M97A 2OTGC 1F54A 3BOWB 2WORA 2F3ZA 2JTTA 3HCMA 1GQMA 1WLMA 1JUOA 1N2DA 1YUSA 1JBAA 1CDLA 1HQVA 2L5XB 2V53A 4PE4A 4A4BA 2LVKA 1MHOA 4USLA 3CR5X 1L2OB 2KFFA 2M1UA 1SKTA 3VROA 2MLFC 2I18A 3ZWHA 1CMGA 2L2EA 2KI4B 1F4OA 1QIVA 2LVIA 2OPOA 1XFZO 3FS7A 1JC2A 1DJYA 1SL8A 4N5XA 4CLNA 1AK8A 1X02A 1UHHA 3QRXA 1EJ3A 1G4YR 1ZFSA 1BR4B 2MA2A 4GPLB 5F6TA 2BBMA 1CFPA 2OTGB 1BJFA 3EK8A 3SG2A 1EXRA 1J1EA 3DVKA 2LHIA 3SG4A 2CXJA 1B8CA 1UHJA 2QACA 2KHNA 4FQOA 5IBWA 1TNXA 1V1GA 1TNQA 1UUSA 2FOTA 3PATA 1M39A 2GGZA 1KK8B 1AJ5A 2O60A 5KSZA 1DGVA 4YRUA 3I5HC 2H61C 1AHRA 1IRJA 2LVVA 2MAZA 4PCWA 3I5IC 1OE9B 3BOWA 3O78A 1KK7Z 5ER4X 1QV0A 5GQQC 3LCPC 1DJWA 4C0KA 1WLZA 2MRDA 4PHNA 1DF0A 1S26D 1SCVA 3SJSA 3SG3A 2M3WA 1NCYA 3LK0A 4I5KA 2BCBA 2F33A 3LLEA 3EVRA 4MZKA 1XFUO 2LLTA 1LINA 1TRFA 5HKYA 2KBMA 3AAKA 1SW8A 3VRQA 1YTZC 2F2OA 2KI6D 1S3PA 4FTGA 2MJWB 3NSKA 1QXPA 1KK8C 2SCPA 4PE1A 3IQQA 4AQIA 3FIAA 3I5IB 5I2OA 5I8NA 4MZJA 1IQ5A 1IG5A 2F3YA 4DCKA 2M8UA 3PN7C 5HKWA 2Y4QA 3EVUA 1WRZA 2CCMA 3JVTB 2L51A 1IH0A 1F8HA 1IJ5A 1KWOC 1B8RA 1WRKA 3AKBA 3KO0A 4QJ3B 5CSIA 2HQWA 1AVSA 2KAXA 1QATA 1BF5A 2KI6C 1KQVA 3GK1A 2KNEA 3A4UB 2P6BB 3CLNA 3PALA 1OOJA 5AXIA 3BQ3A 3JTDB 1QTXA 2HF5A 3PM8A 1CFCA 1TIZA 1K93D 1F70A 1OZSA 1FBVA 5HLVA 1KCYA 3M0WA 1MF8B 1XK4A 2M9GA 1MXEA 1TNPA 2JT3A 2PASA 5I2LA 4UPGA 2HETA 4MSPA 1PRWA 1CB1A 2IS9A 3GK2A 4DUQA 4GGFA 1Y1XA 4YGCB 1TNWA 5JJGA 1M46A 4CIDA 1JF0A 4ZCUA 5AERA 3PFVA 3JTDC 2KFHA 4WQ3A 4R1EA 2TN4A 2KGRA 4BY4A 3DVMA 1PVAA 4GFTA 4YGDB 4YGBB 1FF1A 1YVHA 2O5GA 1PVBA 1K8UA 2BCXA 2JULA 4WQ2A 1NUBA 1RROA 1OMDA 2E6WA 1DF0B 2JWWA 4NDBA 2F8PA 1IQ3A 2MBXA 1LA0A 2CNPA 2Y1NA 1NCZA 1K95A 3TDZA 2JXLA 4HRHA 1KFUL 1CLLA 1VRKA 2ZNEA 1DT7B 1S36A 2NCPA 1YUTA 1SMGA 2JU0A 3WHUB 1J7QA 2M1KB 2WC8A 4Q04A 3CR4X 1H8BA 3D0YB 4ORAB 1J7PA 1S5GZ 2JRFA 3WNXB 1QIWA 4MBEA 2M7LA 1A4PA 2LHLA 1SY9A 3RLZA 3EKJA 3I5HB 3WXAA 1DMOA 1IJ6A 1KQMB 2WOSA 2FJUB 1Q80A 2RGIA 3BXKA 2GGMA 2ZN8A 3VRPA 2WCFA 3I5GC 1SR6C 4D1EA 1BODA 1JFJA 1UHIA 1XK4C 2BBNA 2AUCA 2LUCA 2LLSA 4ICBA 1QV1A 2JTZA 1UHKA 2JNFA 1KFUS 4NDCA 1MQ1A 1J55A 2LC5A 1L7ZA 4JQ0D 1TOPA 1A75A 1AJ4A 1ZMZA 1RECA 4M2PA 3NSLA 4PE0A 2KAYA 1RTP1 3BUMB 5DKRA 3SIAA 3PSRA 4QJ4B 4N1GA 4PE7A 1R2UA 3NSIA 3AKAA 3I5GB 1XO5A 2VRGA 1B1GA 1PALA 3OHMB 2JNXA 4I5NB 2Q4UA 4PDZA 4OKHA 3SG7A 2AMIA 1WDCB 3NSOA 4HRGA 2JC2A 4JPZB 3OB2B 3O6BA 1QS7A 2BE4A 5HLOA 2KOTA 2LVJA 3OX5A 2PMYA 5AANA 4XJKA 1XFWO 1Y1UA 2I2RE 2QPTA 4MZLA 1ALVA 1BMOA 4GAOA 1A29A 1LXFC 1YUUA 1YR5A 2PVBA 3EK7A 1L2OC 2H2KA 1YX7A 4OR9B 3TZ1A 2KBIA 1UP5A 3LK1A 5CSNA 4ORBB 2L50A 1QVIZ 1K9KA 1DVIA 1OQPA 1YX8A 3LL8B 2EGDA 2LLUA 1DGUA 3AAJA 1IGVA 3TS5B 1K94A 2I94A 4YI9A 5AEQA 1YRUB 2LUXA 4IL1A 1K9PA 2ZN9A 3GOFA 4GBAA 1JWDA 1SRAA 1MR8A 3IQOA 1EG3A 1LVCD 1B47A 2LV7A 1CM4A 1DTLA 2M49B 1SYMA 2NCOA 2WCEA 1SNLA 3CZTX 3TUYB 4OCIA 1NIWA 1SPYA 1XFVO 2I7AA 2Y1MA 1K2HA 1KFXS 3OX6A 1YURA 3SG5A 2GV5A 5TNCA 1QX2A 4MN0A 1ALWA 2K0JA 4F0ZB 1A75B 3BUWB 5DKNA 5B8IB 1QASA 1NYAA 2BL0B 1B4CA 3OP0A 1F55A 1OSAA 2LMTA 4NDDA 5D69A 1XFXO 5DKQA 1JF2A 1UHNA 3I5FB 1NWDA 5PALA 1JFKA 1G33A 3DF0B 1V1FA 1S6CA 1K96A 1RFJA 1SL7A 2JOJA 1KK7Y 1IKUA 1RWYA 1YVLA 2JQ6A 2LMVA 2COLB 1IWQA 3PN7B 2K2FA 1CDMA 1CM1A 4GGNA 2LP3A 3F45A 1N0YA 1FI5A 1PSBA 2KYCA 2ZFDA 5ER5A 1SBJA 3BYAA 4XYNA 3ZNIA 1J7RA 1H4BA 5CPVA 2BL0C 1PK0D 2K2AA 2LE9B 1CDPA 1WRLA 2ISDA 3KF9A 1UURA 2EC6C 1PULA 1XA5A 2JPTA 1CFFA 2LAPA 3I5FC 3SG6A 2LCPA 2L0PA 2LANA 4HREE 1TN4A 1ZACA 1B7TZ 3VGOA 4N1FA 2SASA 2CTNA 2KGBC 4YI8A 1B9AA 1BG1A 3EK4A 2B1UA 3TDIA 1EL4A 1U5IB 1NP8A 3BUXB 1WDCC 1B8LA 1KSOA 4E68A 5K89A 1BLQA 2K8MB 4PHKA 3CGAA 2KQYA 3HX4A 2JT8A 3DF0A 4PALA 1FI6A 2EC6B 1GGWA 5G08A 1Y0VH 1MWNA 2E30A 1CTRA 1S1EA 5JOLA 1GGZA 1QJTA 1CLMA 1ZUZA 2NXQA 1FPWA 1NCXA 1KSMA 2M7NA 3H4SE 3IF7A 2KSPA 2ZKMX 5CSJA 1EH2A 3SIBA 2DOQA 1NSHA 2LP2A 4DS7A 5BPJA 4CFQA 1DJZA 4MLWA 2OS8C 5J3XA 3RM1A 1QLSA 1HT9A 5CSFA 4MEWA 4P2YB 4WRIA 1DJIA 1J7OA 2CT9A 1M63B 1G8IA 1A2XA 4C0LA 2K7BA 3CR2A 1NX0A 1C7WA 2PSRA 4P5OE 3CWGA 4XJKB 1BT6A 3E3RA 1QLKA 1MUXA 1RJVA 3O2PA 3D0YA 1W7IB 5HKZA 3MSEB 1SCMC 1XYDA 3CTNA 1KQMC 2KI4C 1CDNA 4CPVA 1Y6WA 2Q91A 3BUOB 4HSZA 5KU1A 4PHMA 1XFYO 2JXCA 2CBLA 3BUNB 1N65A 2EHBA 1QVIY 2K7CA 2L98A 2BKIB 2KDHA 2BECA 1TCOB 2Y5IA 3JVTC 1J1DA 4PHJA 4MVFA 1E8AA 4NQGA 3WHTB 4BY5A 1F71A 1EG4A 2JT0A 1D1OA 1ODBA 3TDUA 1YRTB 1K9UA 1A03A 1NX3A 1F4QA 1WY9A 3DD4A 1MXLC 1K90D 1CMFA 1CLBA 4I5JA 2PRUA 2NLNA 4ZCVA 5AFPA 4DRWA 1OZOA 1UWOA 3C1VA 4CFRA 4AOMA 1SCMB 4DIRA 1C07A 1CFDA 3VRRA 4ORCB 2M0RA 1M45A 1R6PA 1QX7A 2FCEA 4OVNF 2K61A 2G9BA 2AAOA 3GK4X 3TS5C 1BU3A 3A8RA 1GJYA 1SK6D 4I5LB 2FCDA 4YGEB 1SL9A 1CKKA 2MHHA 4MRYA 1W7JB 2NZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FWC A;  2L4I A;  2MLE C;  1JSA A;  1S6I A;  1AP4 A;  1S5G Y;  2BCA A;  2ZND A;  3FWB A;  1M31 A;  4OV2 A;  2R2I A;  1BOC A;  2KQ6 A;  2L4H A;  5KTY A;  3D10 A;  2K7O A;  2LNK A;  2HQ8 A;  1U5I A;  3PLF B;  2ZRT A;  1TCF A;  1SR6 B;  1DJH A;  2BKH B;  1Y1A A;  1S6J A;  2KAV A;  3VRN A;  3KPX A;  1ZOT B;  3K21 A;  1KWO B;  4ETO A;  4U8D A;  3EVV A;  4AQJ A;  2LMU A;  3CS1 A;  4M2Q A;  4GNK B;  1C7V A;  2HPS A;  1TTX A;  1NX2 A;  2H61 A;  1XVJ A;  2ZRS A;  2JZI A;  1B7T Y;  4MRX A;  5D7F A;  3NXA A;  2F2P A;  5HYD A;  1DJX A;  1OMR A;  3EKH A;  2KFG A;  4M2O A;  4A4C A;  4QJ5 B;  3O4Y A;  2D8N A;  1NPQ A;  1LKJ A;  4YBH B;  4C0J A;  2K7D A;  4L9M A;  1DJG A;  4GGF C;  4JWQ A;  1NX1 A;  3ICB A;  3KEV A;  3DVJ A;  4GUK A;  4YGA A;  1LA3 A;  2A4J A;  3TUY C;  1CNP A;  5FYX A;  2PAL A;  2G2B A;  2KYF A;  3KHE A;  1AUI B;  4TNC A;  3DVE A;  1BR1 B;  1PSR A;  1RK9 A;  1KFX L;  2LM5 A;  2BE6 A;  1QX5 B;  2WND A;  1OMV A;  2OS8 B;  2M29 A;  3OB1 B;  2WCB A;  1FW4 A;  5I2Q A;  2M97 A;  2OTG C;  1F54 A;  3BOW B;  2WOR A;  2F3Z A;  2JTT A;  3HCM A;  1GQM A;  1WLM A;  1JUO A;  1N2D A;  1YUS A;  1JBA A;  1CDL A;  1HQV A;  2L5X B;  2V53 A;  4PE4 A;  4A4B A;  2LVK A;  1MHO A;  4USL A;  3CR5 X;  1L2O B;  2KFF A;  2M1U A;  1SKT A;  3VRO A;  2MLF C;  2I18 A;  3ZWH A;  1CMG A;  2L2E A;  2KI4 B;  1F4O A;  1QIV A;  2LVI A;  2OPO A;  1XFZ O;  3FS7 A;  1JC2 A;  1DJY A;  1SL8 A;  4N5X A;  4CLN A;  1AK8 A;  1X02 A;  1UHH A;  3QRX A;  1EJ3 A;  1G4Y R;  1ZFS A;  1BR4 B;  2MA2 A;  4GPL B;  5F6T A;  2BBM A;  1CFP A;  2OTG B;  1BJF A;  3EK8 A;  3SG2 A;  1EXR A;  1J1E A;  3DVK A;  2LHI A;  3SG4 A;  2CXJ A;  1B8C A;  1UHJ A;  2QAC A;  2KHN A;  4FQO A;  5IBW A;  1TNX A;  1V1G A;  1TNQ A;  1UUS A;  2FOT A;  3PAT A;  1M39 A;  2GGZ A;  1KK8 B;  1AJ5 A;  2O60 A;  5KSZ A;  1DGV A;  4YRU A;  3I5H C;  2H61 C;  1AHR A;  1IRJ A;  2LVV A;  2MAZ A;  4PCW A;  3I5I C;  1OE9 B;  3BOW A;  3O78 A;  1KK7 Z;  5ER4 X;  1QV0 A;  5GQQ C;  3LCP C;  1DJW A;  4C0K A;  1WLZ A;  2MRD A;  4PHN A;  1DF0 A;  1S26 D;  1SCV A;  3SJS A;  3SG3 A;  2M3W A;  1NCY A;  3LK0 A;  4I5K A;  2BCB A;  2F33 A;  3LLE A;  3EVR A;  4MZK A;  1XFU O;  2LLT A;  1LIN A;  1TRF A;  5HKY A;  2KBM A;  3AAK A;  1SW8 A;  3VRQ A;  1YTZ C;  2F2O A;  2KI6 D;  1S3P A;  4FTG A;  2MJW B;  3NSK A;  1QXP A;  1KK8 C;  2SCP A;  4PE1 A;  3IQQ A;  4AQI A;  3FIA A;  3I5I B;  5I2O A;  5I8N A;  4MZJ A;  1IQ5 A;  1IG5 A;  2F3Y A;  4DCK A;  2M8U A;  3PN7 C;  5HKW A;  2Y4Q A;  3EVU A;  1WRZ A;  2CCM A;  3JVT B;  2L51 A;  1IH0 A;  1F8H A;  1IJ5 A;  1KWO C;  1B8R A;  1WRK A;  3AKB A;  3KO0 A;  4QJ3 B;  5CSI A;  2HQW A;  1AVS A;  2KAX A;  1QAT A;  1BF5 A;  2KI6 C;  1KQV A;  3GK1 A;  2KNE A;  3A4U B;  2P6B B;  3CLN A;  3PAL A;  1OOJ A;  5AXI A;  3BQ3 A;  3JTD B;  1QTX A;  2HF5 A;  3PM8 A;  1CFC A;  1TIZ A;  1K93 D;  1F70 A;  1OZS A;  1FBV A;  5HLV A;  1KCY A;  3M0W A;  1MF8 B;  1XK4 A;  2M9G A;  1MXE A;  1TNP A;  2JT3 A;  2PAS A;  5I2L A;  4UPG A;  2HET A;  4MSP A;  1PRW A;  1CB1 A;  2IS9 A;  3GK2 A;  4DUQ A;  4GGF A;  1Y1X A;  4YGC B;  1TNW A;  5JJG A;  1M46 A;  4CID A;  1JF0 A;  4ZCU A;  5AER A;  3PFV A;  3JTD C;  2KFH A;  4WQ3 A;  4R1E A;  2TN4 A;  2KGR A;  4BY4 A;  3DVM A;  1PVA A;  4GFT A;  4YGD B;  4YGB B;  1FF1 A;  1YVH A;  2O5G A;  1PVB A;  1K8U A;  2BCX A;  2JUL A;  4WQ2 A;  1NUB A;  1RRO A;  1OMD A;  2E6W A;  1DF0 B;  2JWW A;  4NDB A;  2F8P A;  1IQ3 A;  2MBX A;  1LA0 A;  2CNP A;  2Y1N A;  1NCZ A;  1K95 A;  3TDZ A;  2JXL A;  4HRH A;  1KFU L;  1CLL A;  1VRK A;  2ZNE A;  1DT7 B;  1S36 A;  2NCP A;  1YUT A;  1SMG A;  2JU0 A;  3WHU B;  1J7Q A;  2M1K B;  2WC8 A;  4Q04 A;  3CR4 X;  1H8B A;  3D0Y B;  4ORA B;  1J7P A;  1S5G Z;  2JRF A;  3WNX B;  1QIW A;  4MBE A;  2M7L A;  1A4P A;  2LHL A;  1SY9 A;  3RLZ A;  3EKJ A;  3I5H B;  3WXA A;  1DMO A;  1IJ6 A;  1KQM B;  2WOS A;  2FJU B;  1Q80 A;  2RGI A;  3BXK A;  2GGM A;  2ZN8 A;  3VRP A;  2WCF A;  3I5G C;  1SR6 C;  4D1E A;  1BOD A;  1JFJ A;  1UHI A;  1XK4 C;  2BBN A;  2AUC A;  2LUC A;  2LLS A;  4ICB A;  1QV1 A;  2JTZ A;  1UHK A;  2JNF A;  1KFU S;  4NDC A;  1MQ1 A;  1J55 A;  2LC5 A;  1L7Z A;  4JQ0 D;  1TOP A;  1A75 A;  1AJ4 A;  1ZMZ A;  1REC A;  4M2P A;  3NSL A;  4PE0 A;  2KAY A;  1RTP 1;  3BUM B;  5DKR A;  3SIA A;  3PSR A;  4QJ4 B;  4N1G A;  4PE7 A;  1R2U A;  3NSI A;  3AKA A;  3I5G B;  1XO5 A;  2VRG A;  1B1G A;  1PAL A;  3OHM B;  2JNX A;  4I5N B;  2Q4U A;  4PDZ A;  4OKH A;  3SG7 A;  2AMI A;  1WDC B;  3NSO A;  4HRG A;  2JC2 A;  4JPZ B;  3OB2 B;  3O6B A;  1QS7 A;  2BE4 A;  5HLO A;  2KOT A;  2LVJ A;  3OX5 A;  2PMY A;  5AAN A;  4XJK A;  1XFW O;  1Y1U A;  2I2R E;  2QPT A;  4MZL A;  1ALV A;  1BMO A;  4GAO A;  1A29 A;  1LXF C;  1YUU A;  1YR5 A;  2PVB A;  3EK7 A;  1L2O C;  2H2K A;  1YX7 A;  4OR9 B;  3TZ1 A;  2KBI A;  1UP5 A;  3LK1 A;  5CSN A;  4ORB B;  2L50 A;  1QVI Z;  1K9K A;  1DVI A;  1OQP A;  1YX8 A;  3LL8 B;  2EGD A;  2LLU A;  1DGU A;  3AAJ A;  1IGV A;  3TS5 B;  1K94 A;  2I94 A;  4YI9 A;  5AEQ A;  1YRU B;  2LUX A;  4IL1 A;  1K9P A;  2ZN9 A;  3GOF A;  4GBA A;  1JWD A;  1SRA A;  1MR8 A;  3IQO A;  1EG3 A;  1LVC D;  1B47 A;  2LV7 A;  1CM4 A;  1DTL A;  2M49 B;  1SYM A;  2NCO A;  2WCE A;  1SNL A;  3CZT X;  3TUY B;  4OCI A;  1NIW A;  1SPY A;  1XFV O;  2I7A A;  2Y1M A;  1K2H A;  1KFX S;  3OX6 A;  1YUR A;  3SG5 A;  2GV5 A;  5TNC A;  1QX2 A;  4MN0 A;  1ALW A;  2K0J A;  4F0Z B;  1A75 B;  3BUW B;  5DKN A;  5B8I B;  1QAS A;  1NYA A;  2BL0 B;  1B4C A;  3OP0 A;  1F55 A;  1OSA A;  2LMT A;  4NDD A;  5D69 A;  1XFX O;  5DKQ A;  1JF2 A;  1UHN A;  3I5F B;  1NWD A;  5PAL A;  1JFK A;  1G33 A;  3DF0 B;  1V1F A;  1S6C A;  1K96 A;  1RFJ A;  1SL7 A;  2JOJ A;  1KK7 Y;  1IKU A;  1RWY A;  1YVL A;  2JQ6 A;  2LMV A;  2COL B;  1IWQ A;  3PN7 B;  2K2F A;  1CDM A;  1CM1 A;  4GGN A;  2LP3 A;  3F45 A;  1N0Y A;  1FI5 A;  1PSB A;  2KYC A;  2ZFD A;  5ER5 A;  1SBJ A;  3BYA A;  4XYN A;  3ZNI A;  1J7R A;  1H4B A;  5CPV A;  2BL0 C;  1PK0 D;  2K2A A;  2LE9 B;  1CDP A;  1WRL A;  2ISD A;  3KF9 A;  1UUR A;  2EC6 C;  1PUL A;  1XA5 A;  2JPT A;  1CFF A;  2LAP A;  3I5F C;  3SG6 A;  2LCP A;  2L0P A;  2LAN A;  4HRE E;  1TN4 A;  1ZAC A;  1B7T Z;  3VGO A;  4N1F A;  2SAS A;  2CTN A;  2KGB C;  4YI8 A;  1B9A A;  1BG1 A;  3EK4 A;  2B1U A;  3TDI A;  1EL4 A;  1U5I B;  1NP8 A;  3BUX B;  1WDC C;  1B8L A;  1KSO A;  4E68 A;  5K89 A;  1BLQ A;  2K8M B;  4PHK A;  3CGA A;  2KQY A;  3HX4 A;  2JT8 A;  3DF0 A;  4PAL A;  1FI6 A;  2EC6 B;  1GGW A;  5G08 A;  1Y0V H;  1MWN A;  2E30 A;  1CTR A;  1S1E A;  5JOL A;  1GGZ A;  1QJT A;  1CLM A;  1ZUZ A;  2NXQ A;  1FPW A;  1NCX A;  1KSM A;  2M7N A;  3H4S E;  3IF7 A;  2KSP A;  2ZKM X;  5CSJ A;  1EH2 A;  3SIB A;  2DOQ A;  1NSH A;  2LP2 A;  4DS7 A;  5BPJ A;  4CFQ A;  1DJZ A;  4MLW A;  2OS8 C;  5J3X A;  3RM1 A;  1QLS A;  1HT9 A;  5CSF A;  4MEW A;  4P2Y B;  4WRI A;  1DJI A;  1J7O A;  2CT9 A;  1M63 B;  1G8I A;  1A2X A;  4C0L A;  2K7B A;  3CR2 A;  1NX0 A;  1C7W A;  2PSR A;  4P5O E;  3CWG A;  4XJK B;  1BT6 A;  3E3R A;  1QLK A;  1MUX A;  1RJV A;  3O2P A;  3D0Y A;  1W7I B;  5HKZ A;  3MSE B;  1SCM C;  1XYD A;  3CTN A;  1KQM C;  2KI4 C;  1CDN A;  4CPV A;  1Y6W A;  2Q91 A;  3BUO B;  4HSZ A;  5KU1 A;  4PHM A;  1XFY O;  2JXC A;  2CBL A;  3BUN B;  1N65 A;  2EHB A;  1QVI Y;  2K7C A;  2L98 A;  2BKI B;  2KDH A;  2BEC A;  1TCO B;  2Y5I A;  3JVT C;  1J1D A;  4PHJ A;  4MVF A;  1E8A A;  4NQG A;  3WHT B;  4BY5 A;  1F71 A;  1EG4 A;  2JT0 A;  1D1O A;  1ODB A;  3TDU A;  1YRT B;  1K9U A;  1A03 A;  1NX3 A;  1F4Q A;  1WY9 A;  3DD4 A;  1MXL C;  1K90 D;  1CMF A;  1CLB A;  4I5J A;  2PRU A;  2NLN A;  4ZCV A;  5AFP A;  4DRW A;  1OZO A;  1UWO A;  3C1V A;  4CFR A;  4AOM A;  1SCM B;  4DIR A;  1C07 A;  1CFD A;  3VRR A;  4ORC B;  2M0R A;  1M45 A;  1R6P A;  1QX7 A;  2FCE A;  4OVN F;  2K61 A;  2G9B A;  2AAO A;  3GK4 X;  3TS5 C;  1BU3 A;  3A8R A;  1GJY A;  1SK6 D;  4I5L B;  2FCD A;  4YGE B;  1SL9 A;  1CKK A;  2MHH A;  4MRY A;  1W7J B;  2NZ0 A; 
#chains in the Genus database with same CATH topology
 3FWC A;  2L4I A;  2MLE C;  1JSA A;  1S6I A;  1AP4 A;  1S5G Y;  2BCA A;  2ZND A;  3FWB A;  1Z4H A;  1M31 A;  4OV2 A;  1Z2C B;  5I94 A;  2R2I A;  1C3Y A;  1BOC A;  2KQ6 A;  2L4H A;  3BFH A;  5KTY A;  3D10 A;  2K7O A;  2LNK A;  2HQ8 A;  1U5I A;  3PLF B;  2ZRT A;  1TCF A;  1SR6 B;  1DJH A;  2BKH B;  2QEO A;  1Y1A A;  1S6J A;  2KAV A;  3VRN A;  3KPX A;  4IJ7 A;  1ZOT B;  3K21 A;  1KWO B;  4ETO A;  4U8D A;  3EVV A;  4AQJ A;  2LMU A;  3CS1 A;  4M2Q A;  5DIC A;  3CZ0 A;  4GNK B;  2HPS A;  1C7V A;  1TTX A;  1NX2 A;  2H61 A;  1XVJ A;  2ZRS A;  3UNW A;  2JZI A;  5HL1 A;  1B7T Y;  4MRX A;  5D7F A;  3NXA A;  2F2P A;  3DY9 A;  5HYD A;  1DJX A;  1OMR A;  3EKH A;  2KFG A;  1DEL A;  4M2O A;  4A4C A;  4QJ5 B;  3O4Y A;  2D8N A;  1NPQ A;  1LKJ A;  4YBH B;  4C0J A;  2K7D A;  4L9M A;  1DJG A;  1OOF A;  4GGF C;  4JWQ A;  1NX1 A;  3D77 A;  3ICB A;  3S0G A;  3KEV A;  3DVJ A;  4GUK A;  4YGA A;  1LA3 A;  2A4J A;  1TUZ A;  3TUY C;  5FYX A;  1CNP A;  2PAL A;  2G2B A;  2KYF A;  3KHE A;  1AUI B;  4TNC A;  3DVE A;  1BR1 B;  1PSR A;  1RK9 A;  1KFX L;  2LM5 A;  1P28 A;  1QX5 B;  1OW4 A;  1OMV A;  2BE6 A;  2M29 A;  2OS8 B;  2WCB A;  2WND A;  3Q8I A;  1FW4 A;  5I2Q A;  2M97 A;  2OTG C;  1F54 A;  3BOW B;  2WOR A;  2F3Z A;  3CYZ A;  2JTT A;  3HCM A;  1GQM A;  1WLM A;  1JUO A;  1N2D A;  1YUS A;  1JBA A;  1CDL A;  1HQV A;  2L5X B;  2V53 A;  4PE4 A;  4A4B A;  5FI7 A;  2LVK A;  1LS8 A;  1MHO A;  3R1O A;  4USL A;  3CR5 X;  1L2O B;  2KFF A;  2M1U A;  1SKT A;  3VRO A;  2MLF C;  2I18 A;  3ZWH A;  1CMG A;  2L2E A;  2KI4 B;  1F4O A;  1QIV A;  2LVI A;  2OPO A;  1XFZ O;  2WCK A;  3FS7 A;  1JC2 A;  1DJY A;  1SL8 A;  3OBV A;  4N5X A;  4CLN A;  1AK8 A;  4INX A;  3VB1 A;  1X02 A;  1UHH A;  3QRX A;  3UO9 A;  1ZFS A;  1EJ3 A;  1G4Y R;  1BR4 B;  2MA2 A;  4GPL B;  3D73 A;  2BBM A;  2L2C A;  2OTG B;  5F6T A;  1CFP A;  1BJF A;  3EG5 B;  3EK8 A;  3BJH A;  3SG2 A;  1EXR A;  3FE9 A;  5EL2 A;  5D3O A;  3K1E A;  1J1E A;  3B87 A;  3DVK A;  2LHI A;  3SG4 A;  3BFB A;  2CXJ A;  1B8C A;  1UHJ A;  2QAC A;  2KHN A;  4FQO A;  3R72 A;  1TNX A;  5IBW A;  1V1G A;  1TNQ A;  1UUS A;  2ERB A;  2FOT A;  3PAT A;  1M39 A;  2GGZ A;  1KK8 B;  3SS3 A;  1AJ5 A;  2O60 A;  5KSZ A;  1DGV A;  4YRU A;  3I5H C;  2H61 C;  3DXL A;  1AHR A;  1IRJ A;  2LVV A;  2MAZ A;  3D78 A;  3I5I C;  4PCW A;  1OE9 B;  3BOW A;  1T14 A;  3O78 A;  1KK7 Z;  5ER4 X;  1QV0 A;  3R1V A;  5GQQ C;  1ORG A;  3LCP C;  2KLD A;  1DJW A;  4PT1 A;  4C0K A;  1WLZ A;  2MRD A;  3CAB A;  4PHN A;  1DF0 A;  1S26 D;  1SCV A;  3OB1 B;  3SJS A;  3SG3 A;  2M3W A;  1NCY A;  3LK0 A;  4I5K A;  2BCB A;  2F33 A;  3LLE A;  3EVR A;  4MZK A;  1XFU O;  2LLT A;  1LIN A;  1TRF A;  5HKY A;  2KBM A;  3AAK A;  1SW8 A;  3VRQ A;  1YTZ C;  2F2O A;  2KI6 D;  1S3P A;  4FTG A;  2MJW B;  3NSK A;  1QXP A;  1KK8 C;  2SCP A;  3IVT A;  4PE1 A;  1IKU A;  3IQQ A;  4AQI A;  3FIA A;  3I5I B;  5I2O A;  5I8N A;  4MZJ A;  2WC5 A;  2QEV A;  1IQ5 A;  1IG5 A;  2F3Y A;  4DCK A;  2M8U A;  3PN7 C;  5HKW A;  2Y4Q A;  3EVU A;  1WRZ A;  2CCM A;  2L5Y A;  2L51 A;  3JVT B;  1F8H A;  1IJ5 A;  1IH0 A;  1KWO C;  1B8R A;  1WRK A;  3AKB A;  1XFR A;  3KO0 A;  4QJ3 B;  5CSI A;  2HQW A;  1AVS A;  2KAX A;  4FQT A;  1QAT A;  1BF5 A;  2KI6 C;  1KQV A;  3GK1 A;  2KNE A;  3A4U B;  2P6B B;  3CLN A;  3PAL A;  2QDI A;  1OOJ A;  5AXI A;  3BQ3 A;  3JTD B;  1QTX A;  2HF5 A;  3PM8 A;  1CFC A;  1TIZ A;  1K93 D;  1F70 A;  1OZS A;  1FBV A;  5HLV A;  1KCY A;  3M0W A;  1MF8 B;  1XK4 A;  2M9G A;  1MXE A;  1TNP A;  2JT3 A;  2PAS A;  5I2L A;  4UPG A;  2HET A;  4MSP A;  1PRW A;  1CB1 A;  2IS9 A;  3GK2 A;  4DUQ A;  1TWO A;  4GGF A;  1Y1X A;  4YGC B;  1TNW A;  5JJG A;  1M46 A;  4CID A;  1JF0 A;  4ZCU A;  5AER A;  3R1P A;  3SS5 A;  3PFV A;  3JTD C;  2KFH A;  4WQ3 A;  4R1E A;  2TN4 A;  2KGR A;  4BY4 A;  3DVM A;  1PVA A;  4GFT A;  4YGD B;  4YGB B;  1FF1 A;  1YVH A;  2O5G A;  1C3Z A;  1PVB A;  1K8U A;  1QWV A;  3NGV A;  2BCX A;  2JUL A;  4WQ2 A;  1NUB A;  1RRO A;  1OMD A;  2E6W A;  1DF0 B;  2JWW A;  4NDB A;  2F8P A;  1IQ3 A;  2MBX A;  1LA0 A;  2CNP A;  2Y1N A;  5FI6 A;  1NCZ A;  1K95 A;  3TDZ A;  2JXL A;  4HRH A;  3L4A A;  1KFU L;  1CLL A;  1W9Z A;  1VRK A;  2ZNE A;  1DT7 B;  1S36 A;  2FJY A;  2NCP A;  1YUT A;  1SMG A;  2JU0 A;  3WHU B;  1J7Q A;  2M1K B;  2WC8 A;  4Q04 A;  3CR4 X;  1H8B A;  3D0Y B;  3D75 A;  4ORA B;  3SS4 A;  1S5G Z;  3L4L A;  2JRF A;  1J7P A;  3WNX B;  1QIW A;  3B7A A;  3D74 A;  4MBE A;  1A4P A;  2M7L A;  2LHL A;  1SY9 A;  3RLZ A;  3EKJ A;  1TUJ A;  3I5H B;  3WXA A;  3B6X A;  1IJ6 A;  1DMO A;  1KQM B;  2PQL A;  2WOS A;  2FJU B;  1Q80 A;  2RGI A;  3BXK A;  2GGM A;  2ZN8 A;  3VRP A;  2YGU A;  2WCF A;  3I5G C;  1SR6 C;  4D1E A;  1BOD A;  1JFJ A;  1UHI A;  1XK4 C;  2BBN A;  2AUC A;  2LUC A;  2LLS A;  4ICB A;  1QV1 A;  2JTZ A;  1UHK A;  2JNF A;  1KFU S;  1OOG A;  4NDC A;  1MQ1 A;  1J55 A;  2LC5 A;  1L7Z A;  4JQ0 D;  1TOP A;  1A75 A;  1AJ4 A;  1ZMZ A;  1REC A;  4M2P A;  3NSL A;  4PE0 A;  2KAY A;  1RTP 1;  3BUM B;  5DKR A;  3SIA A;  3PSR A;  4QJ4 B;  4N1G A;  4PE7 A;  1R2U A;  3NSI A;  2WCH A;  2BNX A;  3AKA A;  3I5G B;  1XO5 A;  2VRG A;  1B1G A;  1PAL A;  3OHM B;  2JNX A;  4I5N B;  2Q4U A;  3V2L A;  4PDZ A;  4OKH A;  3SG7 A;  2AMI A;  1WDC B;  2WCL A;  3NSO A;  4HRG A;  2JC2 A;  4JPZ B;  3OB2 B;  3O6B A;  1QS7 A;  2BE4 A;  5HLO A;  2KOT A;  2LVJ A;  3OX5 A;  2PMY A;  5AAN A;  4XJK A;  3RZS A;  1XFW O;  1Y1U A;  2I2R E;  2QPT A;  3OGN A;  4MZL A;  1ALV A;  1BMO A;  4GAO A;  1A29 A;  1LXF C;  1YUU A;  3D76 A;  1YR5 A;  3CDN A;  2PVB A;  3EK7 A;  3S0D A;  1L2O C;  2H2K A;  1YX7 A;  4OR9 B;  3CZ2 A;  3TZ1 A;  2KBI A;  1UP5 A;  1DEK A;  3LK1 A;  5CSN A;  4ORB B;  2L50 A;  1QVI Z;  1K9K A;  3DYE A;  1DVI A;  1YX8 A;  1OQP A;  3LL8 B;  2EGD A;  2WCJ A;  2LLU A;  1DGU A;  3AAJ A;  1IGV A;  3TS5 B;  1K94 A;  2I94 A;  4F7F A;  4YI9 A;  3QME A;  5AEQ A;  1YRU B;  2LUX A;  4IL1 A;  2BAP A;  1K9P A;  2ZN9 A;  3GOF A;  4GBA A;  1JWD A;  1GM0 A;  1SRA A;  3N7H A;  1MR8 A;  3IQO A;  1EG3 A;  1LVC D;  1B47 A;  2LV7 A;  1CM4 A;  1DTL A;  2M49 B;  1SYM A;  2NCO A;  2WCE A;  1SNL A;  3CZT X;  3TUY B;  4OCI A;  1NIW A;  1SPY A;  1XFV O;  4KYN A;  2I7A A;  2Y1M A;  1K2H A;  1KFX S;  3OX6 A;  1YUR A;  2JPO A;  3NHI A;  3FE6 A;  2GV5 A;  3S0B A;  5TNC A;  3SG5 A;  1QX2 A;  4MN0 A;  1ALW A;  2K0J A;  4F0Z B;  1A75 B;  3BUW B;  5DKN A;  5B8I B;  1QAS A;  1NYA A;  2BL0 B;  1B4C A;  3L47 A;  3OP0 A;  1F55 A;  1OSA A;  2LMT A;  4NDD A;  5D69 A;  1XFX O;  2WCM A;  3S0F A;  5DKQ A;  1JF2 A;  1UHN A;  3I5F B;  1NWD A;  5PAL A;  1JFK A;  1G33 A;  3DF0 B;  1V1F A;  1S6C A;  1K96 A;  1RFJ A;  1SL7 A;  2JOJ A;  1KK7 Y;  2P70 A;  1RWY A;  1YVL A;  2KLE A;  2JQ6 A;  1DQE A;  2LMV A;  2COL B;  1IWQ A;  3PN7 B;  2K2F A;  1CDM A;  1CM1 A;  3PJI A;  4GGN A;  2LP3 A;  3F45 A;  3S0A A;  1N0Y A;  1FI5 A;  1PSB A;  2KYC A;  2ZFD A;  5ER5 A;  1SBJ A;  3BYA A;  4XYN A;  4JKT A;  3ZNI A;  1J7R A;  1H4B A;  5CPV A;  2BL0 C;  1PK0 D;  2K2A A;  2LE9 B;  1CDP A;  1WRL A;  2KPH A;  3KF9 A;  2ISD A;  1UUR A;  2EC6 C;  1PUL A;  1XA5 A;  2JPT A;  1CFF A;  2LAP A;  3I5F C;  3SG6 A;  2LCP A;  2L0P A;  2LAN A;  3BFA A;  4HRE E;  1TN4 A;  1ZAC A;  1B7T Z;  1IIO A;  3VGO A;  4N1F A;  2SAS A;  2CTN A;  2WC6 A;  2KGB C;  4YI8 A;  1B9A A;  1BG1 A;  3EK4 A;  2B1U A;  3NHT A;  3TDI A;  1EL4 A;  1U5I B;  1NP8 A;  3BUX B;  1WDC C;  1B8L A;  1KSO A;  4E68 A;  5K89 A;  2GTE A;  1BLQ A;  2K8M B;  4PHK A;  3CGA A;  2KQY A;  3HX4 A;  2JT8 A;  3B86 A;  3DF0 A;  4PAL A;  1FI6 A;  2EC6 B;  1GGW A;  5G08 A;  1Y0V H;  1MWN A;  2E30 A;  1CTR A;  1S1E A;  2PYQ A;  5JOL A;  1GGZ A;  1QJT A;  1CLM A;  1ZUZ A;  2NXQ A;  1FPW A;  1NCX A;  1KSM A;  2M7N A;  3H4S E;  3IF7 A;  2KSP A;  2ZKM X;  5CSJ A;  1EH2 A;  3SIB A;  1DC1 A;  2DOQ A;  1NSH A;  2LP2 A;  4DS7 A;  5BPJ A;  4CFQ A;  1DJZ A;  4MLW A;  2OS8 C;  5J3X A;  3RM1 A;  1QLS A;  1HT9 A;  5CSF A;  4MEW A;  4P2Y B;  4WRI A;  1DJI A;  1J7O A;  2CT9 A;  1M63 B;  1G8I A;  3DZT A;  1A2X A;  4C0L A;  3B88 A;  2K7B A;  3CR2 A;  5FI2 A;  1NX0 A;  1C7W A;  2PSR A;  4P5O E;  3CWG A;  3CZ1 A;  1BT6 A;  3E3R A;  4XJK B;  1QLK A;  1MUX A;  1RJV A;  3O2P A;  3D0Y A;  1W7I B;  5HKZ A;  3MSE B;  1SCM C;  3FE8 A;  1XYD A;  3CTN A;  1KQM C;  2KI4 C;  1CDN A;  4CPV A;  1Y6W A;  2Q91 A;  3BUO B;  4HSZ A;  5KU1 A;  4PHM A;  1XFY O;  2JXC A;  2CBL A;  1OOI X;  3BUN B;  1N65 A;  2EHB A;  1QVI Y;  2K7C A;  2L98 A;  2P71 A;  2BKI B;  2KDH A;  2BEC A;  1TCO B;  2Y5I A;  3JVT C;  1SSE B;  3S0E A;  1J1D A;  4PHJ A;  4MVF A;  1E8A A;  2QEH A;  4NQG A;  3WHT B;  4BY5 A;  1F71 A;  1EG4 A;  2JT0 A;  1D1O A;  1ODB A;  3TDU A;  1YRT B;  1K9U A;  1A03 A;  2K60 A;  3PM2 A;  1NX3 A;  1WY9 A;  1F4Q A;  1OOH A;  3DD4 A;  1MXL C;  1K90 D;  1CMF A;  1CLB A;  4I5J A;  2PRU A;  2NLN A;  4ZCV A;  5AFP A;  4DRW A;  1OZO A;  1UWO A;  3C1V A;  4CFR A;  2H8V A;  1SCM B;  4AOM A;  4DIR A;  1C07 A;  1CFD A;  3VRR A;  4ORC B;  2M0R A;  1M45 A;  1R6P A;  1QX7 A;  2FCE A;  2QEB A;  4OVN F;  2K61 A;  2G9B A;  2AAO A;  3GK4 X;  3TS5 C;  1BU3 A;  3A8R A;  1GJY A;  1SK6 D;  4I5L B;  2FCD A;  4OZD A;  4YGE B;  4JD9 A;  1SL9 A;  1CKK A;  2MHH A;  4MRY A;  3O4X A;  1W7J B;  2NZ0 A;  4INW A; 
#chains in the Genus database with same CATH homology
 3FWC A;  2L4I A;  2MLE C;  1JSA A;  1S6I A;  1AP4 A;  1S5G Y;  2BCA A;  2ZND A;  3FWB A;  1M31 A;  4OV2 A;  2R2I A;  1BOC A;  2KQ6 A;  2L4H A;  5KTY A;  3D10 A;  2K7O A;  2LNK A;  2HQ8 A;  1U5I A;  3PLF B;  2ZRT A;  1TCF A;  1SR6 B;  1DJH A;  2BKH B;  1Y1A A;  1S6J A;  2KAV A;  3VRN A;  3KPX A;  1ZOT B;  3K21 A;  1KWO B;  4ETO A;  4U8D A;  3EVV A;  4AQJ A;  2LMU A;  3CS1 A;  4M2Q A;  4GNK B;  1C7V A;  2HPS A;  1TTX A;  1NX2 A;  2H61 A;  1XVJ A;  2ZRS A;  2JZI A;  1B7T Y;  4MRX A;  5D7F A;  3NXA A;  2F2P A;  5HYD A;  1DJX A;  1OMR A;  3EKH A;  2KFG A;  4M2O A;  4A4C A;  4QJ5 B;  3O4Y A;  2D8N A;  1NPQ A;  1LKJ A;  4YBH B;  4C0J A;  2K7D A;  4L9M A;  1DJG A;  4GGF C;  4JWQ A;  1NX1 A;  3ICB A;  3KEV A;  3DVJ A;  4GUK A;  4YGA A;  1LA3 A;  2A4J A;  3TUY C;  1CNP A;  5FYX A;  2PAL A;  2G2B A;  2KYF A;  3KHE A;  1AUI B;  4TNC A;  3DVE A;  1BR1 B;  1PSR A;  1RK9 A;  1KFX L;  2LM5 A;  2BE6 A;  1QX5 B;  2WND A;  1OMV A;  2OS8 B;  2M29 A;  3OB1 B;  2WCB A;  1FW4 A;  5I2Q A;  2M97 A;  2OTG C;  1F54 A;  3BOW B;  2WOR A;  2F3Z A;  2JTT A;  3HCM A;  1GQM A;  1WLM A;  1JUO A;  1N2D A;  1YUS A;  1JBA A;  1CDL A;  1HQV A;  2L5X B;  2V53 A;  4PE4 A;  4A4B A;  2LVK A;  1MHO A;  4USL A;  3CR5 X;  1L2O B;  2KFF A;  2M1U A;  1SKT A;  3VRO A;  2MLF C;  2I18 A;  3ZWH A;  1CMG A;  2L2E A;  2KI4 B;  1F4O A;  1QIV A;  2LVI A;  2OPO A;  1XFZ O;  3FS7 A;  1JC2 A;  1DJY A;  1SL8 A;  4N5X A;  4CLN A;  1AK8 A;  1X02 A;  1UHH A;  3QRX A;  1EJ3 A;  1G4Y R;  1ZFS A;  1BR4 B;  2MA2 A;  4GPL B;  5F6T A;  2BBM A;  1CFP A;  2OTG B;  1BJF A;  3EK8 A;  3SG2 A;  1EXR A;  1J1E A;  3DVK A;  2LHI A;  3SG4 A;  2CXJ A;  1B8C A;  1UHJ A;  2QAC A;  2KHN A;  4FQO A;  5IBW A;  1TNX A;  1V1G A;  1TNQ A;  1UUS A;  2FOT A;  3PAT A;  1M39 A;  2GGZ A;  1KK8 B;  1AJ5 A;  2O60 A;  5KSZ A;  1DGV A;  4YRU A;  3I5H C;  2H61 C;  1AHR A;  1IRJ A;  2LVV A;  2MAZ A;  4PCW A;  3I5I C;  1OE9 B;  3BOW A;  3O78 A;  1KK7 Z;  5ER4 X;  1QV0 A;  5GQQ C;  3LCP C;  1DJW A;  4C0K A;  1WLZ A;  2MRD A;  4PHN A;  1DF0 A;  1S26 D;  1SCV A;  3SJS A;  3SG3 A;  2M3W A;  1NCY A;  3LK0 A;  4I5K A;  2BCB A;  2F33 A;  3LLE A;  3EVR A;  4MZK A;  1XFU O;  2LLT A;  1LIN A;  1TRF A;  5HKY A;  2KBM A;  3AAK A;  1SW8 A;  3VRQ A;  1YTZ C;  2F2O A;  2KI6 D;  1S3P A;  4FTG A;  2MJW B;  3NSK A;  1QXP A;  1KK8 C;  2SCP A;  4PE1 A;  3IQQ A;  4AQI A;  3FIA A;  3I5I B;  5I2O A;  5I8N A;  4MZJ A;  1IQ5 A;  1IG5 A;  2F3Y A;  4DCK A;  2M8U A;  3PN7 C;  5HKW A;  2Y4Q A;  3EVU A;  1WRZ A;  2CCM A;  3JVT B;  2L51 A;  1IH0 A;  1F8H A;  1IJ5 A;  1KWO C;  1B8R A;  1WRK A;  3AKB A;  3KO0 A;  4QJ3 B;  5CSI A;  2HQW A;  1AVS A;  2KAX A;  1QAT A;  1BF5 A;  2KI6 C;  1KQV A;  3GK1 A;  2KNE A;  3A4U B;  2P6B B;  3CLN A;  3PAL A;  1OOJ A;  5AXI A;  3BQ3 A;  3JTD B;  1QTX A;  2HF5 A;  3PM8 A;  1CFC A;  1TIZ A;  1K93 D;  1F70 A;  1OZS A;  1FBV A;  5HLV A;  1KCY A;  3M0W A;  1MF8 B;  1XK4 A;  2M9G A;  1MXE A;  1TNP A;  2JT3 A;  2PAS A;  5I2L A;  4UPG A;  2HET A;  4MSP A;  1PRW A;  1CB1 A;  2IS9 A;  3GK2 A;  4DUQ A;  4GGF A;  1Y1X A;  4YGC B;  1TNW A;  5JJG A;  1M46 A;  4CID A;  1JF0 A;  4ZCU A;  5AER A;  3PFV A;  3JTD C;  2KFH A;  4WQ3 A;  4R1E A;  2TN4 A;  2KGR A;  4BY4 A;  3DVM A;  1PVA A;  4GFT A;  4YGD B;  4YGB B;  1FF1 A;  1YVH A;  2O5G A;  1PVB A;  1K8U A;  2BCX A;  2JUL A;  4WQ2 A;  1NUB A;  1RRO A;  1OMD A;  2E6W A;  1DF0 B;  2JWW A;  4NDB A;  2F8P A;  1IQ3 A;  2MBX A;  1LA0 A;  2CNP A;  2Y1N A;  1NCZ A;  1K95 A;  3TDZ A;  2JXL A;  4HRH A;  1KFU L;  1CLL A;  1VRK A;  2ZNE A;  1DT7 B;  1S36 A;  2NCP A;  1YUT A;  1SMG A;  2JU0 A;  3WHU B;  1J7Q A;  2M1K B;  2WC8 A;  4Q04 A;  3CR4 X;  1H8B A;  3D0Y B;  4ORA B;  1J7P A;  1S5G Z;  2JRF A;  3WNX B;  1QIW A;  4MBE A;  2M7L A;  1A4P A;  2LHL A;  1SY9 A;  3RLZ A;  3EKJ A;  3I5H B;  3WXA A;  1DMO A;  1IJ6 A;  1KQM B;  2WOS A;  2FJU B;  1Q80 A;  2RGI A;  3BXK A;  2GGM A;  2ZN8 A;  3VRP A;  2WCF A;  3I5G C;  1SR6 C;  4D1E A;  1BOD A;  1JFJ A;  1UHI A;  1XK4 C;  2BBN A;  2AUC A;  2LUC A;  2LLS A;  4ICB A;  1QV1 A;  2JTZ A;  1UHK A;  2JNF A;  1KFU S;  4NDC A;  1MQ1 A;  1J55 A;  2LC5 A;  1L7Z A;  4JQ0 D;  1TOP A;  1A75 A;  1AJ4 A;  1ZMZ A;  1REC A;  4M2P A;  3NSL A;  4PE0 A;  2KAY A;  1RTP 1;  3BUM B;  5DKR A;  3SIA A;  3PSR A;  4QJ4 B;  4N1G A;  4PE7 A;  1R2U A;  3NSI A;  3AKA A;  3I5G B;  1XO5 A;  2VRG A;  1B1G A;  1PAL A;  3OHM B;  2JNX A;  4I5N B;  2Q4U A;  4PDZ A;  4OKH A;  3SG7 A;  2AMI A;  1WDC B;  3NSO A;  4HRG A;  2JC2 A;  4JPZ B;  3OB2 B;  3O6B A;  1QS7 A;  2BE4 A;  5HLO A;  2KOT A;  2LVJ A;  3OX5 A;  2PMY A;  5AAN A;  4XJK A;  1XFW O;  1Y1U A;  2I2R E;  2QPT A;  4MZL A;  1ALV A;  1BMO A;  4GAO A;  1A29 A;  1LXF C;  1YUU A;  1YR5 A;  2PVB A;  3EK7 A;  1L2O C;  2H2K A;  1YX7 A;  4OR9 B;  3TZ1 A;  2KBI A;  1UP5 A;  3LK1 A;  5CSN A;  4ORB B;  2L50 A;  1QVI Z;  1K9K A;  1DVI A;  1OQP A;  1YX8 A;  3LL8 B;  2EGD A;  2LLU A;  1DGU A;  3AAJ A;  1IGV A;  3TS5 B;  1K94 A;  2I94 A;  4YI9 A;  5AEQ A;  1YRU B;  2LUX A;  4IL1 A;  1K9P A;  2ZN9 A;  3GOF A;  4GBA A;  1JWD A;  1SRA A;  1MR8 A;  3IQO A;  1EG3 A;  1LVC D;  1B47 A;  2LV7 A;  1CM4 A;  1DTL A;  2M49 B;  1SYM A;  2NCO A;  2WCE A;  1SNL A;  3CZT X;  3TUY B;  4OCI A;  1NIW A;  1SPY A;  1XFV O;  2I7A A;  2Y1M A;  1K2H A;  1KFX S;  3OX6 A;  1YUR A;  3SG5 A;  2GV5 A;  5TNC A;  1QX2 A;  4MN0 A;  1ALW A;  2K0J A;  4F0Z B;  1A75 B;  3BUW B;  5DKN A;  5B8I B;  1QAS A;  1NYA A;  2BL0 B;  1B4C A;  3OP0 A;  1F55 A;  1OSA A;  2LMT A;  4NDD A;  5D69 A;  1XFX O;  5DKQ A;  1JF2 A;  1UHN A;  3I5F B;  1NWD A;  5PAL A;  1JFK A;  1G33 A;  3DF0 B;  1V1F A;  1S6C A;  1K96 A;  1RFJ A;  1SL7 A;  2JOJ A;  1KK7 Y;  1IKU A;  1RWY A;  1YVL A;  2JQ6 A;  2LMV A;  2COL B;  1IWQ A;  3PN7 B;  2K2F A;  1CDM A;  1CM1 A;  4GGN A;  2LP3 A;  3F45 A;  1N0Y A;  1FI5 A;  1PSB A;  2KYC A;  2ZFD A;  5ER5 A;  1SBJ A;  3BYA A;  4XYN A;  3ZNI A;  1J7R A;  1H4B A;  5CPV A;  2BL0 C;  1PK0 D;  2K2A A;  2LE9 B;  1CDP A;  1WRL A;  2ISD A;  3KF9 A;  1UUR A;  2EC6 C;  1PUL A;  1XA5 A;  2JPT A;  1CFF A;  2LAP A;  3I5F C;  3SG6 A;  2LCP A;  2L0P A;  2LAN A;  4HRE E;  1TN4 A;  1ZAC A;  1B7T Z;  3VGO A;  4N1F A;  2SAS A;  2CTN A;  2KGB C;  4YI8 A;  1B9A A;  1BG1 A;  3EK4 A;  2B1U A;  3TDI A;  1EL4 A;  1U5I B;  1NP8 A;  3BUX B;  1WDC C;  1B8L A;  1KSO A;  4E68 A;  5K89 A;  1BLQ A;  2K8M B;  4PHK A;  3CGA A;  2KQY A;  3HX4 A;  2JT8 A;  3DF0 A;  4PAL A;  1FI6 A;  2EC6 B;  1GGW A;  5G08 A;  1Y0V H;  1MWN A;  2E30 A;  1CTR A;  1S1E A;  5JOL A;  1GGZ A;  1QJT A;  1CLM A;  1ZUZ A;  2NXQ A;  1FPW A;  1NCX A;  1KSM A;  2M7N A;  3H4S E;  3IF7 A;  2KSP A;  2ZKM X;  5CSJ A;  1EH2 A;  3SIB A;  2DOQ A;  1NSH A;  2LP2 A;  4DS7 A;  5BPJ A;  4CFQ A;  1DJZ A;  4MLW A;  2OS8 C;  5J3X A;  3RM1 A;  1QLS A;  1HT9 A;  5CSF A;  4MEW A;  4P2Y B;  4WRI A;  1DJI A;  1J7O A;  2CT9 A;  1M63 B;  1G8I A;  1A2X A;  4C0L A;  2K7B A;  3CR2 A;  1NX0 A;  1C7W A;  2PSR A;  4P5O E;  3CWG A;  4XJK B;  1BT6 A;  3E3R A;  1QLK A;  1MUX A;  1RJV A;  3O2P A;  3D0Y A;  1W7I B;  5HKZ A;  3MSE B;  1SCM C;  1XYD A;  3CTN A;  1KQM C;  2KI4 C;  1CDN A;  4CPV A;  1Y6W A;  2Q91 A;  3BUO B;  4HSZ A;  5KU1 A;  4PHM A;  1XFY O;  2JXC A;  2CBL A;  3BUN B;  1N65 A;  2EHB A;  1QVI Y;  2K7C A;  2L98 A;  2BKI B;  2KDH A;  2BEC A;  1TCO B;  2Y5I A;  3JVT C;  1J1D A;  4PHJ A;  4MVF A;  1E8A A;  4NQG A;  3WHT B;  4BY5 A;  1F71 A;  1EG4 A;  2JT0 A;  1D1O A;  1ODB A;  3TDU A;  1YRT B;  1K9U A;  1A03 A;  1NX3 A;  1F4Q A;  1WY9 A;  3DD4 A;  1MXL C;  1K90 D;  1CMF A;  1CLB A;  4I5J A;  2PRU A;  2NLN A;  4ZCV A;  5AFP A;  4DRW A;  1OZO A;  1UWO A;  3C1V A;  4CFR A;  4AOM A;  1SCM B;  4DIR A;  1C07 A;  1CFD A;  3VRR A;  4ORC B;  2M0R A;  1M45 A;  1R6P A;  1QX7 A;  2FCE A;  4OVN F;  2K61 A;  2G9B A;  2AAO A;  3GK4 X;  3TS5 C;  1BU3 A;  3A8R A;  1GJY A;  1SK6 D;  4I5L B;  2FCD A;  4YGE B;  1SL9 A;  1CKK A;  2MHH A;  4MRY A;  1W7J B;  2NZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...