1MQ1A

Ca2+-s100b-trtk-12 complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
91
structure length
91
Chain Sequence
SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords S-100 protein, beta chain
publication title A novel S100 target conformation is revealed by the solution structure of the Ca2+-S100B-TRTK-12 complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1mq1A00
2NZ0A 3PALA 2EGDA 1WRKA 2CCMA 5I2LA 4M2OA 3HCMA 2V53A 1RWYA 1CLBA 1J7OA 1YURA 3KEVA 5D69A 2K7DA 3JTDB 4N1FA 2KI4B 1SR6B 2O60A 1L2OB 3F45A 1AVSA 1L7ZA 1M39A 3DVJA 2F33A 3EVUA 4I5KA 2ZNDA 1F54A 2PALA 2ZN8A 4WRIA 4L9MA 1EH2A 2MLEC 1K9KA 1OZSA 2LMVA 1K2HA 1XFVO 3NSOA 4U8DA 2MJWB 1DTLA 1EL4A 2JPTA 2KQYA 2KYCA 2KQ6A 1NIWA 4N1GA 4GGFA 3SG3A 1H4BA 1OQPA 5AFPA 5ER5A 2OTGB 1LXFC 2HETA 4MSPA 2BL0C 1MWNA 2IS9A 5AEQA 1N65A 4XYNA 3HX4A 3AAKA 1G33A 3NSKA 4DS7A 3C1VA 4USLA 1SL7A 1MHOA 2BE6A 2KFGA 4JPZB 1GGZA 1PVBA 1SRAA 1SCVA 4JQ0D 2CTNA 2K2AA 1S6JA 4UPGA 1JC2A 4FQOA 4HRGA 1F8HA 1B8LA 4JWQA 4PCWA 5J3XA 1JFKA 2KGRA 1CM4A 3JVTC 1SNLA 1SY9A 1TNXA 3EKHA 2LVVA 3I5GB 1FI6A 1CM1A 1S6IA 4YI8A 1B47A 1QXPA 3I5FC 3BUOB 3CZTX 2ZFDA 5CSIA 1PRWA 2LLTA 2I94A 2WCFA 3BUNB 2ISDA 1NCZA 1IRJA 1A29A 2K7BA 1CDLA 3LL8B 1SYMA 1AUIB 1OZOA 1A2XA 4I5NB 1YX8A 4ORBB 1EG4A 5DKRA 3DF0A 1J1EA 2K61A 3DVMA 4PHJA 2JXCA 5ER4X 5AANA 4MZJA 5K89A 3OHMB 2PVBA 3TZ1A 1BJFA 1KQMB 3OB2B 3PN7C 2JTZA 5KSZA 4MZLA 1IQ3A 2NCOA 3KO0A 3BXKA 4YGCB 4NDDA 2BCAA 1MR8A 4WQ2A 2M29A 1GQMA 2DOQA 3SG4A 1PULA 3AAJA 1BOCA 1SBJA 1KK8B 4HREE 4MVFA 1BMOA 1ZUZA 2BCBA 4ZCVA 3TS5B 1K95A 4C0LA 1CDMA 1DJXA 1J55A 2Y1NA 3E3RA 2LM5A 1QVIY 2H61C 4AOMA 1DF0A 1SCMB 1ALWA 1LA0A 1WRZA 2BECA 4CFQA 2NCPA 4ETOA 3DF0B 4MLWA 1JSAA 4OR9B 1V1GA 4D1EA 4YGEB 4N5XA 2KFHA 2EC6C 2FCDA 3SIAA 3I5HB 2WCEA 1TCFA 2I18A 3TDIA 4AQJA 1CNPA 1FBVA 2JQ6A 2LVIA 4MBEA 3TUYB 1D1OA 4PE7A 5F6TA 2LC5A 1S3PA 3O78A 1UHIA 2EHBA 2JU0A 1CKKA 1FF1A 5G08A 4XJKA 4C0JA 3OB1B 1CLMA 1J1DA 1SW8A 1H8BA 1K90D 1DF0B 3O4YA 3VRRA 1RK9A 1HT9A 4GPLB 1KK7Z 1Y0VH 1DVIA 3EK8A 5FYXA 1TCOB 1B8CA 2FOTA 1U5IA 4M2QA 1XVJA 4DRWA 2M7NA 1DJIA 1XA5A 1M63B 4PE4A 5HYDA 1GGWA 1QV1A 1YX7A 1G4YR 3VGOA 5B8IB 1KFXS 2BE4A 5KTYA 3BQ3A 4MZKA 1WY9A 1Y1UA 1YTZC 5HKYA 2KGBC 1A75A 2AMIA 1FPWA 1QJTA 4XJKB 1CDPA 1SL8A 1Y1XA 1OE9B 2K2FA 1QASA 4BY4A 1JF0A 1FW4A 5AERA 4DCKA 3WNXB 2R2IA 1ZOTB 2HQWA 1EXRA 1BG1A 2JWWA 2CNPA 3CR2A 1U5IB 4ORAB 2LP2A 2K7CA 2K0JA 1JFJA 3BUMB 1N2DA 2M7LA 3TDUA 4YGAA 1RFJA 1SPYA 1BU3A 2G2BA 1KFUL 3KHEA 4PHMA 1DJYA 1K94A 2LHIA 2K7OA 1VRKA 5CSFA 3IF7A 4ICBA 2M1UA 3IQQA 1B7TZ 3GK1A 3FS7A 1J7PA 1A75B 1QLKA 2HPSA 3M0WA 1UHKA 1KCYA 1IH0A 1AP4A 5BPJA 1NPQA 3SG2A 2LUXA 2M1KB 2JT3A 1BR4B 1KQVA 1RJVA 4PDZA 3QRXA 5HLOA 1S36A 1TN4A 1ODBA 1CFFA 3FIAA 1JF2A 3OX5A 2JC2A 3BUWB 3ZWHA 2BKHB 3DD4A 2ZN9A 2MA2A 4QJ3B 1N0YA 2MLFC 2WORA 1OMRA 3KF9A 1KK7Y 3OP0A 4E68A 1SMGA 1KWOC 2VRGA 3A8RA 1MXLC 2I2RE 2AUCA 3BOWA 1M31A 1YR5A 2LLUA 3GK4X 3NSLA 2MAZA 2BL0B 1CFPA 1EJ3A 2JT8A 3KPXA 4A4CA 1CTRA 2Q4UA 1QX7A 2KI6C 4HRHA 2LANA 2LMTA 3OX6A 2G9BA 4GGNA 3LLEA 2LUCA 4CLNA 1ZFSA 1DGUA 4DIRA 2L50A 2PRUA 2L0PA 2WOSA 1UWOA 1NX2A 2F3ZA 2JULA 1Y1AA 2KBMA 1YRUB 2E30A 2ZNEA 1F55A 2E6WA 3VRQA 1CDNA 2JNFA 3CLNA 4QJ5B 2D8NA 1IG5A 3I5IC 3SG5A 3GOFA 1RROA 3JVTB 4GUKA 2OS8C 2LE9B 4MRXA 3EKJA 1A03A 1GJYA 1HQVA 4PHNA 3LCPC 4TNCA 1NP8A 1NSHA 3PFVA 4YRUA 5AXIA 4DUQA 3I5FB 3D10A 3RM1A 1BODA 1OMDA 1B7TY 1WDCC 2LLSA 1IJ5A 3FWCA 1QS7A 2ZRSA 3TUYC 3WXAA 1G8IA 2H61A 2KAVA 1TNQA 4M2PA 4OCIA 4GNKB 2MHHA 4GFTA 2KFFA 4YI9A 1QIWA 2GV5A 2BBNA 1KSOA 1BF5A 5PALA 1LINA 1LVCD 1M46A 4PALA 3PN7B 2JT0A 1DT7B 1RTP1 2FCEA 1PSRA 1OOJA 4QJ4B 1J7QA 3EK4A 5CSNA 1C07A 2COLB 1ALVA 1AJ4A 2OPOA 3K21A 2KNEA 5IBWA 2JTTA 2KAXA 1YRTB 1TRFA 2KSPA 3JTDC 1PVAA 2NLNA 2KI4C 1SR6C 5DKQA 1L2OC 1IGVA 1WLMA 4NDBA 3ICBA 1YUTA 1YUUA 3BYAA 1E8AA 1DJHA 1MQ1A 2JZIA 2M9GA 2JRFA 1FI5A 2Y5IA 1SL9A 1B4CA 4I5LB 5TNCA 2EC6B 4OKHA 1NX1A 1DMOA 3PM8A 1B8RA 1C7VA 4Q04A 2LAPA 1UHHA 2M0RA 2F2PA 4F0ZB 1UUSA 4R1EA 3WHTB 3CTNA 3LK0A 1ZACA 1MUXA 2QPTA 2F3YA 2Y4QA 3CS1A 2BBMA 3NXAA 2KI6D 5JOLA 4CFRA 1MXEA 2OTGC 1M45A 2L98A 4BY5A 2QACA 1YUSA 3SG7A 2LMUA 2JNXA 2PMYA 2BCXA 1K9PA 1AHRA 2I7AA 1CMFA 4GBAA 4OV2A 4P5OE 2K8MB 2SASA 2WNDA 1C7WA 1QATA 5CPVA 5HLVA 3LK1A 1YVLA 2L5XB 1IWQA 2M8UA 1Q80A 1BR1B 4YBHB 1XO5A 1XFUO 4P2YB 2JOJA 5GQQC 3PATA 1K9UA 3PLFB 1UP5A 1JBAA 1B1GA 5HKWA 2B1UA 1UHNA 1CMGA 1TNPA 2A4JA 2CBLA 4GGFC 2JXLA 4AQIA 1BLQA 3D0YA 1MF8B 2NXQA 2LVJA 2RGIA 2GGZA 3I5GC 1SK6D 2LNKA 4NQGA 3H4SE 4HSZA 1QX5B 1QVIZ 1W7JB 1OSAA 5DKNA 1XYDA 2KDHA 2LP3A 3SIBA 1NX0A 1CB1A 2M49B 3CWGA 5JJGA 2SCPA 2HF5A 1CFDA 2F8PA 3GK2A 2CT9A 1J7RA 2KYFA 1JUOA 1QLSA 2AAOA 2LCPA 1JWDA 1WLZA 1S5GZ 2L4IA 2O5GA 1S26D 1S6CA 2L51A 4NDCA 5I2QA 1LA3A 1SKTA 4CPVA 1KQMC 3EVVA 1QX2A 1DJZA 2FJUB 3D0YB 1BT6A 1RECA 1IQ5A 1XFXO 1S1EA 1XK4C 1DJGA 1TNWA 5HKZA 1KSMA 3VRPA 3O6BA 3TS5C 1KK8C 1QV0A 1UURA 3ZNIA 5I8NA 3AKAA 1F4OA 1NX3A 2LV7A 2L2EA 3AKBA 1XK4A 2MRDA 3PSRA 2M97A 3A4UB 4MEWA 4ORCB 1OMVA 1PK0D 1SCMC 1NCYA 4IL1A 1IKUA 3VRNA 1TIZA 4YGBB 5D7FA 1KFUS 3BOWB 1B9AA 4CIDA 3EK7A 1K93D 1AK8A 1F70A 2CXJA 4FTGA 1KWOB 1AJ5A 1A4PA 2TN4A 2ZKMX 3NSIA 4OVNF 3I5HC 5CSJA 3FWBA 1NWDA 4C0KA 3IQOA 1KFXL 1Y6WA 3EVRA 1YVHA 2HQ8A 1PALA 3MSEB 2WCBA 1F4QA 1TTXA 2KHNA 1QIVA 3O2PA 2PASA 4GAOA 3WHUB 2BKIB 2M3WA 1F71A 4ZCUA 1NCXA 1XFYO 1QTXA 2WC8A 2KAYA 2PSRA 4WQ3A 3BUXB 4PHKA 4A4BA 2KBIA 1NUBA 1TOPA 2F2OA 3DVKA 2LHLA 3CR5X 2GGMA 1XFWO 1LKJA 3I5IB 1IJ6A 1R2UA 1PSBA 2OS8B 2Q91A 3TDZA 4PE1A 1K96A 3SG6A 2L4HA 2KOTA 1WRLA 4MRYA 1S5GY 4PE0A 2H2KA 1K8UA 1WDCB 1R6PA 1UHJA 1ZMZA 3SJSA 2P6BB 5KU1A 3CR4X 2ZRTA 5I2OA 4MN0A 4YGDB 1V1FA 1W7IB 1CLLA 3DVEA 3VROA 1CFCA 4I5JA 1X02A 2MBXA 2Y1MA 1NYAA 1XFZO 3RLZA 2LVKA 1DJWA 3CGAA 1EG3A 1DGVA
chains in the Genus database with same CATH superfamily
2NZ0A 3D75A 3PALA 2EGDA 1QWVA 1WRKA 2CCMA 5I2LA 4M2OA 3CZ1A 3HCMA 2V53A 1RWYA 1CLBA 1C3ZA 1J7OA 1YURA 3KEVA 3QMEA 2K7DA 3JTDB 4N1FA 3D73A 3K1EA 2KI4B 5D69A 1SR6B 2O60A 1L2OB 3F45A 1AVSA 1L7ZA 1M39A 3DVJA 2F33A 3EVUA 4I5KA 2ZNDA 1F54A 2KLDA 2PALA 2ZN8A 4WRIA 4L9MA 3DZTA 1EH2A 2MLEC 1DEKA 1K9KA 1OZSA 2LMVA 1K2HA 3BJHA 1XFVO 3NSOA 4U8DA 2MJWB 1DTLA 3D77A 1EL4A 2JPTA 2KQYA 1IIOA 2KYCA 3SS5A 2KQ6A 1NIWA 4N1GA 4GGFA 3SG3A 1H4BA 1OQPA 5AFPA 5ER5A 2OTGB 1LXFC 2HETA 4MSPA 2BL0C 1MWNA 1Z4HA 1OOHA 2IS9A 5AEQA 3D74A 1N65A 4XYNA 3HX4A 3AAKA 3NGVA 1G33A 3NSKA 4DS7A 3C1VA 3CABA 4USLA 1SL7A 1MHOA 4OZDA 2BE6A 2KFGA 4JPZB 1GGZA 1PVBA 1SRAA 1SCVA 4JQ0D 2CTNA 1T14A 2K2AA 1S6JA 4UPGA 1JC2A 4FQOA 4HRGA 1F8HA 1B8LA 4JWQA 4PCWA 5J3XA 1JFKA 2KGRA 1CM4A 3JVTC 1SNLA 1SY9A 1TNXA 3EKHA 1XFRA 2LVVA 3I5GB 1C3YA 1FI6A 1CM1A 1S6IA 4YI8A 1B47A 4KYNA 1QXPA 3I5FC 1TUZA 3BUOB 3CZTX 2ZFDA 5CSIA 1PRWA 2LLTA 2I94A 2WCFA 3BUNB 2ISDA 1NCZA 1IRJA 1A29A 2K7BA 1CDLA 3LL8B 1SYMA 1AUIB 1OZOA 2QEBA 1A2XA 5CSJA 4I5NB 1YX8A 4ORBB 1EG4A 5DKRA 3DF0A 1J1EA 2K61A 3DVMA 4PHJA 2JXCA 5ER4X 5AANA 4MZJA 5K89A 3OHMB 2PVBA 3TZ1A 3UNWA 1BJFA 1KQMB 3OB2B 3PN7C 2JTZA 3Q8IA 4MZLA 5KSZA 1IQ3A 2NCOA 3KO0A 3BXKA 4YGCB 4NDDA 2BCAA 4IJ7A 1MR8A 4WQ2A 2M29A 1GQMA 2DOQA 3SG4A 1PULA 3AAJA 3EG5B 1BOCA 1SBJA 1KK8B 4HREE 4MVFA 1BMOA 1ZUZA 2BCBA 4ZCVA 3TS5B 1K95A 4C0LA 1CDMA 1DJXA 1J55A 2PQLA 2Y1NA 2LM5A 3E3RA 1QVIY 2H61C 4AOMA 1DF0A 1SCMB 1ALWA 5D3OA 1LA0A 1WRZA 2BECA 4CFQA 2NCPA 4ETOA 3DF0B 4MLWA 1JSAA 4OR9B 1V1GA 4FQTA 4D1EA 4YGEB 4N5XA 1LS8A 2KFHA 2EC6C 2FCDA 3SIAA 3I5HB 2WCEA 1TCFA 2I18A 3TDIA 4JD9A 4AQJA 1CNPA 1FBVA 2JQ6A 2LVIA 2P70A 4MBEA 3TUYB 1D1OA 4PE7A 5F6TA 2LC5A 1TUJA 1S3PA 3O78A 1UHIA 2EHBA 2JU0A 1CKKA 2H8VA 1FF1A 1TWOA 5G08A 4XJKA 4C0JA 3OB1B 1CLMA 1J1DA 1SW8A 1H8BA 1K90D 1DF0B 3UO9A 3O4YA 3VRRA 1RK9A 1HT9A 3R1PA 4GPLB 1KK7Z 1Y0VH 1DVIA 3EK8A 3FE9A 5FYXA 1TCOB 1B8CA 2FOTA 1U5IA 4M2QA 1GM0A 1XVJA 4DRWA 2M7NA 1DJIA 1XA5A 1M63B 4PE4A 5HYDA 1GGWA 4PT1A 1QV1A 1YX7A 1G4YR 3VGOA 5B8IB 1KFXS 2BE4A 5KTYA 3BQ3A 4MZKA 1WY9A 1Y1UA 4C0KA 3B7AA 1YTZC 5HKYA 2KGBC 1A75A 2AMIA 1FPWA 1QJTA 4XJKB 1CDPA 1SL8A 1Y1XA 3D76A 1OE9B 2K2FA 1QASA 4BY4A 1JF0A 1FW4A 5AERA 4DCKA 3SS4A 3WNXB 2R2IA 1ZOTB 2HQWA 1EXRA 1BG1A 2JWWA 2CNPA 3CR2A 1U5IB 4ORAB 2LP2A 2K7CA 2K0JA 1JFJA 3BUMB 1N2DA 2M7LA 5DICA 3TDUA 4YGAA 1RFJA 1SPYA 1BU3A 2G2BA 1KFUL 2FJYA 3KHEA 4PHMA 1DJYA 1K94A 2LHIA 2K7OA 1VRKA 5CSFA 3S0GA 3IF7A 4ICBA 2M1UA 3IQQA 1B7TZ 3GK1A 3FS7A 1J7PA 1A75B 1QLKA 2HPSA 3M0WA 1UHKA 2WCKA 1KCYA 1IH0A 1AP4A 2L2CA 5BPJA 1NPQA 3S0EA 3SG2A 2LUXA 2M1KB 2JT3A 1BR4B 1KQVA 1RJVA 1W9ZA 3B86A 3DYEA 4PDZA 3QRXA 5HLOA 1S36A 1TN4A 1ODBA 1CFFA 3FIAA 1JF2A 3OX5A 5FI2A 2JC2A 3BUWB 3ZWHA 2BKHB 3BFBA 3DD4A 2ZN9A 2MA2A 4QJ3B 1N0YA 2MLFC 2WORA 1OMRA 3KF9A 1KK7Y 3OP0A 4E68A 3SS3A 1SMGA 2QEOA 1KWOC 3FE8A 3PJIA 2VRGA 3A8RA 1MXLC 2I2RE 2AUCA 3BOWA 1M31A 1YR5A 2LLUA 3GK4X 3NSLA 2MAZA 3R72A 2BL0B 3DY9A 1CFPA 2L5YA 1EJ3A 2JT8A 3KPXA 2QEVA 4A4CA 1CTRA 2Q4UA 2KPHA 1QX7A 2KI6C 2YGUA 4HRHA 2LANA 2LMTA 3OX6A 2G9BA 4GGNA 3LLEA 2LUCA 4CLNA 1ZFSA 1DGUA 2KLEA 2L50A 4DIRA 2PRUA 2L0PA 2WOSA 1UWOA 1NX2A 2F3ZA 2JULA 1Y1AA 2KBMA 1YRUB 2E30A 2ZNEA 1F55A 2E6WA 3VRQA 2PYQA 2JNFA 1CDNA 3B87A 3CLNA 4QJ5B 5FI7A 2D8NA 1IG5A 3I5IC 3BFHA 3SG5A 3GOFA 1RROA 3JVTB 4GUKA 2OS8C 2LE9B 4MRXA 3EKJA 1A03A 1GJYA 1HQVA 4PHNA 3LCPC 2QEHA 1NP8A 1NSHA 3PFVA 4TNCA 5AXIA 4DUQA 3I5FB 3D10A 3RM1A 4YRUA 1BODA 3B88A 1OMDA 1B7TY 1WDCC 2LLSA 1IJ5A 2WC6A 1QS7A 3FWCA 2ZRSA 3L4LA 3TUYC 3WXAA 1G8IA 2H61A 2KAVA 1TNQA 3NHTA 4M2PA 4OCIA 4GNKB 2MHHA 2BNXA 4GFTA 2KFFA 4YI9A 3IVTA 1QIWA 2GV5A 2BBNA 1KSOA 1BF5A 5PALA 1LINA 1LVCD 1M46A 4PALA 3PN7B 2JT0A 1DT7B 1RTP1 2FCEA 1PSRA 1OOJA 4QJ4B 1J7QA 3EK4A 3B6XA 5CSNA 1C07A 2COLB 1ALVA 1AJ4A 2OPOA 3K21A 2KNEA 5IBWA 2BAPA 2JTTA 2WCHA 2KAXA 1YRTB 1TRFA 2KSPA 3JTDC 1PVAA 2NLNA 2KI4C 1SR6C 5DKQA 1L2OC 1IGVA 1WLMA 4NDBA 3ICBA 1YUTA 1YUUA 3BYAA 1E8AA 1DJHA 1MQ1A 2JZIA 2M9GA 2JRFA 1FI5A 2Y5IA 2ERBA 1SL9A 1B4CA 4I5LB 5TNCA 3S0BA 2EC6B 4OKHA 1NX1A 3CZ2A 1DMOA 3PM8A 1B8RA 1C7VA 4Q04A 5FI6A 3VB1A 2LAPA 1UHHA 1DQEA 2F2PA 2M0RA 4F0ZB 1UUSA 4R1EA 3WHTB 3CTNA 3LK0A 1ZACA 1MUXA 2QPTA 2F3YA 2Y4QA 3CS1A 2BBMA 3NXAA 2KI6D 5JOLA 4CFRA 1MXEA 2OTGC 1M45A 2L98A 3OBVA 4BY5A 2QACA 1YUSA 3SG7A 2LMUA 2JNXA 2PMYA 2BCXA 1K9PA 3S0DA 1AHRA 2I7AA 1CMFA 4GBAA 4OV2A 4P5OE 4F7FA 2K8MB 2SASA 2WC5A 2WNDA 3CDNA 1C7WA 1QATA 5CPVA 5HLVA 3LK1A 1YVLA 2L5XB 1IWQA 2M8UA 1Q80A 1BR1B 4YBHB 1XO5A 1XFUO 1OW4A 4P2YB 2JOJA 5GQQC 3PATA 1DC1A 1K9UA 3PLFB 1UP5A 1JBAA 1B1GA 5HKWA 2B1UA 1UHNA 1CMGA 1TNPA 2A4JA 2CBLA 4GGFC 2JXLA 4AQIA 1BLQA 3D0YA 1MF8B 2NXQA 2LVJA 2RGIA 2GGZA 3CZ0A 1SK6D 2LNKA 3I5GC 4NQGA 3H4SE 4HSZA 1OOIX 1QX5B 1QVIZ 1W7JB 5EL2A 1OSAA 5DKNA 1XYDA 2KDHA 2LP3A 3SIBA 3DXLA 1NX0A 1CB1A 2M49B 3CWGA 2JPOA 5JJGA 2SCPA 2HF5A 1Z2CB 1CFDA 2F8PA 3GK2A 2CT9A 1J7RA 2KYFA 1JUOA 1QLSA 2AAOA 2LCPA 1JWDA 1WLZA 1ORGA 1S5GZ 3O4XA 2L4IA 2O5GA 3PM2A 1S26D 1S6CA 2L51A 4NDCA 5I2QA 1LA3A 1SKTA 4CPVA 1KQMC 3EVVA 1QX2A 1DJZA 2FJUB 3D0YB 1BT6A 1RECA 1IQ5A 1XFXO 1S1EA 1XK4C 1DJGA 1TNWA 3R1VA 5HKZA 1KSMA 3VRPA 3O6BA 5I94A 3TS5C 1KK8C 1QV0A 1UURA 2WCJA 3ZNIA 5I8NA 3AKAA 1F4OA 1NX3A 2LV7A 2L2EA 1SSEB 3AKBA 3BFAA 1XK4A 2MRDA 3PSRA 2M97A 2WCLA 3A4UB 4MEWA 4ORCB 1OMVA 1PK0D 1SCMC 1NCYA 4IL1A 1IKUA 3VRNA 1TIZA 4YGBB 5D7FA 1KFUS 3BOWB 1B9AA 4CIDA 3EK7A 1K93D 1AK8A 1F70A 2CXJA 4FTGA 1KWOB 1AJ5A 2K60A 1A4PA 2TN4A 2ZKMX 3NSIA 4OVNF 3I5HC 3N7HA 2P71A 1NWDA 3FWBA 3IQOA 1KFXL 1OOFA 1Y6WA 3EVRA 3CYZA 1P28A 1YVHA 2HQ8A 3L47A 1PALA 3MSEB 2WCBA 1F4QA 1TTXA 2KHNA 1QIVA 3O2PA 2PASA 4GAOA 3WHUB 2BKIB 2GTEA 3R1OA 2M3WA 1F71A 4ZCUA 1NCXA 1XFYO 1QTXA 2WC8A 2QDIA 4INXA 3RZSA 2KAYA 2PSRA 4WQ3A 3BUXB 3L4AA 4PHKA 4A4BA 2KBIA 1NUBA 3D78A 1TOPA 2F2OA 3DVKA 2LHLA 3CR5X 1OOGA 1DELA 2GGMA 1XFWO 1LKJA 3I5IB 3FE6A 1IJ6A 1R2UA 1PSBA 2OS8B 2Q91A 3TDZA 3V2LA 4PE1A 1K96A 3SG6A 2L4HA 2KOTA 2WCMA 3S0FA 1WRLA 4MRYA 1S5GY 4PE0A 2H2KA 3OGNA 1K8UA 1WDCB 1R6PA 3NHIA 1UHJA 1ZMZA 3SJSA 2P6BB 5HL1A 5KU1A 3S0AA 3CR4X 2ZRTA 5I2OA 4MN0A 4YGDB 1V1FA 1W7IB 1CLLA 4INWA 3DVEA 3VROA 1CFCA 4I5JA 1X02A 2MBXA 2Y1MA 1NYAA 1XFZO 3RLZA 2LVKA 1DJWA 3CGAA 1EG3A 4JKTA 1DGVA
chains in the Genus database with same CATH topology
2NZ0A 3PALA 2EGDA 1WRKA 2CCMA 5I2LA 4M2OA 3HCMA 2V53A 1RWYA 1CLBA 1J7OA 1YURA 3KEVA 5D69A 2K7DA 3JTDB 4N1FA 2KI4B 1SR6B 2O60A 1L2OB 3F45A 1AVSA 1L7ZA 1M39A 3DVJA 2F33A 3EVUA 4I5KA 2ZNDA 1F54A 2PALA 2ZN8A 4WRIA 4L9MA 1EH2A 2MLEC 1K9KA 1OZSA 2LMVA 1K2HA 1XFVO 3NSOA 4U8DA 2MJWB 1DTLA 1EL4A 2JPTA 2KQYA 2KYCA 2KQ6A 1NIWA 4N1GA 4GGFA 3SG3A 1H4BA 1OQPA 5AFPA 5ER5A 2OTGB 1LXFC 2HETA 4MSPA 2BL0C 1MWNA 2IS9A 5AEQA 1N65A 4XYNA 3HX4A 3AAKA 1G33A 3NSKA 4DS7A 3C1VA 4USLA 1SL7A 1MHOA 2BE6A 2KFGA 4JPZB 1GGZA 1PVBA 1SRAA 1SCVA 4JQ0D 2CTNA 2K2AA 1S6JA 4UPGA 1JC2A 4FQOA 4HRGA 1F8HA 1B8LA 4JWQA 4PCWA 5J3XA 1JFKA 2KGRA 1CM4A 3JVTC 1SNLA 1SY9A 1TNXA 3EKHA 2LVVA 3I5GB 1FI6A 1CM1A 1S6IA 4YI8A 1B47A 1QXPA 3I5FC 3BUOB 3CZTX 2ZFDA 5CSIA 1PRWA 2LLTA 2I94A 2WCFA 3BUNB 2ISDA 1NCZA 1IRJA 1A29A 2K7BA 1CDLA 3LL8B 1SYMA 1AUIB 1OZOA 1A2XA 4I5NB 1YX8A 4ORBB 1EG4A 5DKRA 3DF0A 1J1EA 2K61A 3DVMA 4PHJA 2JXCA 5ER4X 5AANA 4MZJA 5K89A 3OHMB 2PVBA 3TZ1A 1BJFA 1KQMB 3OB2B 3PN7C 2JTZA 5KSZA 4MZLA 1IQ3A 2NCOA 3KO0A 3BXKA 4YGCB 4NDDA 2BCAA 1MR8A 4WQ2A 2M29A 1GQMA 2DOQA 3SG4A 1PULA 3AAJA 1BOCA 1SBJA 1KK8B 4HREE 4MVFA 1BMOA 1ZUZA 2BCBA 4ZCVA 3TS5B 1K95A 4C0LA 1CDMA 1DJXA 1J55A 2Y1NA 3E3RA 2LM5A 1QVIY 2H61C 4AOMA 1DF0A 1SCMB 1ALWA 1LA0A 1WRZA 2BECA 4CFQA 2NCPA 4ETOA 3DF0B 4MLWA 1JSAA 4OR9B 1V1GA 4D1EA 4YGEB 4N5XA 2KFHA 2EC6C 2FCDA 3SIAA 3I5HB 2WCEA 1TCFA 2I18A 3TDIA 4AQJA 1CNPA 1FBVA 2JQ6A 2LVIA 4MBEA 3TUYB 1D1OA 4PE7A 5F6TA 2LC5A 1S3PA 3O78A 1UHIA 2EHBA 2JU0A 1CKKA 1FF1A 5G08A 4XJKA 4C0JA 3OB1B 1CLMA 1J1DA 1SW8A 1H8BA 1K90D 1DF0B 3O4YA 3VRRA 1RK9A 1HT9A 4GPLB 1KK7Z 1Y0VH 1DVIA 3EK8A 5FYXA 1TCOB 1B8CA 2FOTA 1U5IA 4M2QA 1XVJA 4DRWA 2M7NA 1DJIA 1XA5A 1M63B 4PE4A 5HYDA 1GGWA 1QV1A 1YX7A 1G4YR 3VGOA 5B8IB 1KFXS 2BE4A 5KTYA 3BQ3A 4MZKA 1WY9A 1Y1UA 1YTZC 5HKYA 2KGBC 1A75A 2AMIA 1FPWA 1QJTA 4XJKB 1CDPA 1SL8A 1Y1XA 1OE9B 2K2FA 1QASA 4BY4A 1JF0A 1FW4A 5AERA 4DCKA 3WNXB 2R2IA 1ZOTB 2HQWA 1EXRA 1BG1A 2JWWA 2CNPA 3CR2A 1U5IB 4ORAB 2LP2A 2K7CA 2K0JA 1JFJA 3BUMB 1N2DA 2M7LA 3TDUA 4YGAA 1RFJA 1SPYA 1BU3A 2G2BA 1KFUL 3KHEA 4PHMA 1DJYA 1K94A 2LHIA 2K7OA 1VRKA 5CSFA 3IF7A 4ICBA 2M1UA 3IQQA 1B7TZ 3GK1A 3FS7A 1J7PA 1A75B 1QLKA 2HPSA 3M0WA 1UHKA 1KCYA 1IH0A 1AP4A 5BPJA 1NPQA 3SG2A 2LUXA 2M1KB 2JT3A 1BR4B 1KQVA 1RJVA 4PDZA 3QRXA 5HLOA 1S36A 1TN4A 1ODBA 1CFFA 3FIAA 1JF2A 3OX5A 2JC2A 3BUWB 3ZWHA 2BKHB 3DD4A 2ZN9A 2MA2A 4QJ3B 1N0YA 2MLFC 2WORA 1OMRA 3KF9A 1KK7Y 3OP0A 4E68A 1SMGA 1KWOC 2VRGA 3A8RA 1MXLC 2I2RE 2AUCA 3BOWA 1M31A 1YR5A 2LLUA 3GK4X 3NSLA 2MAZA 2BL0B 1CFPA 1EJ3A 2JT8A 3KPXA 4A4CA 1CTRA 2Q4UA 1QX7A 2KI6C 4HRHA 2LANA 2LMTA 3OX6A 2G9BA 4GGNA 3LLEA 2LUCA 4CLNA 1ZFSA 1DGUA 4DIRA 2L50A 2PRUA 2L0PA 2WOSA 1UWOA 1NX2A 2F3ZA 2JULA 1Y1AA 2KBMA 1YRUB 2E30A 2ZNEA 1F55A 2E6WA 3VRQA 1CDNA 2JNFA 3CLNA 4QJ5B 2D8NA 1IG5A 3I5IC 3SG5A 3GOFA 1RROA 3JVTB 4GUKA 2OS8C 2LE9B 4MRXA 3EKJA 1A03A 1GJYA 1HQVA 4PHNA 3LCPC 4TNCA 1NP8A 1NSHA 3PFVA 4YRUA 5AXIA 4DUQA 3I5FB 3D10A 3RM1A 1BODA 1OMDA 1B7TY 1WDCC 2LLSA 1IJ5A 3FWCA 1QS7A 2ZRSA 3TUYC 3WXAA 1G8IA 2H61A 2KAVA 1TNQA 4M2PA 4OCIA 4GNKB 2MHHA 4GFTA 2KFFA 4YI9A 1QIWA 2GV5A 2BBNA 1KSOA 1BF5A 5PALA 1LINA 1LVCD 1M46A 4PALA 3PN7B 2JT0A 1DT7B 1RTP1 2FCEA 1PSRA 1OOJA 4QJ4B 1J7QA 3EK4A 5CSNA 1C07A 2COLB 1ALVA 1AJ4A 2OPOA 3K21A 2KNEA 5IBWA 2JTTA 2KAXA 1YRTB 1TRFA 2KSPA 3JTDC 1PVAA 2NLNA 2KI4C 1SR6C 5DKQA 1L2OC 1IGVA 1WLMA 4NDBA 3ICBA 1YUTA 1YUUA 3BYAA 1E8AA 1DJHA 1MQ1A 2JZIA 2M9GA 2JRFA 1FI5A 2Y5IA 1SL9A 1B4CA 4I5LB 5TNCA 2EC6B 4OKHA 1NX1A 1DMOA 3PM8A 1B8RA 1C7VA 4Q04A 2LAPA 1UHHA 2M0RA 2F2PA 4F0ZB 1UUSA 4R1EA 3WHTB 3CTNA 3LK0A 1ZACA 1MUXA 2QPTA 2F3YA 2Y4QA 3CS1A 2BBMA 3NXAA 2KI6D 5JOLA 4CFRA 1MXEA 2OTGC 1M45A 2L98A 4BY5A 2QACA 1YUSA 3SG7A 2LMUA 2JNXA 2PMYA 2BCXA 1K9PA 1AHRA 2I7AA 1CMFA 4GBAA 4OV2A 4P5OE 2K8MB 2SASA 2WNDA 1C7WA 1QATA 5CPVA 5HLVA 3LK1A 1YVLA 2L5XB 1IWQA 2M8UA 1Q80A 1BR1B 4YBHB 1XO5A 1XFUO 4P2YB 2JOJA 5GQQC 3PATA 1K9UA 3PLFB 1UP5A 1JBAA 1B1GA 5HKWA 2B1UA 1UHNA 1CMGA 1TNPA 2A4JA 2CBLA 4GGFC 2JXLA 4AQIA 1BLQA 3D0YA 1MF8B 2NXQA 2LVJA 2RGIA 2GGZA 3I5GC 1SK6D 2LNKA 4NQGA 3H4SE 4HSZA 1QX5B 1QVIZ 1W7JB 1OSAA 5DKNA 1XYDA 2KDHA 2LP3A 3SIBA 1NX0A 1CB1A 2M49B 3CWGA 5JJGA 2SCPA 2HF5A 1CFDA 2F8PA 3GK2A 2CT9A 1J7RA 2KYFA 1JUOA 1QLSA 2AAOA 2LCPA 1JWDA 1WLZA 1S5GZ 2L4IA 2O5GA 1S26D 1S6CA 2L51A 4NDCA 5I2QA 1LA3A 1SKTA 4CPVA 1KQMC 3EVVA 1QX2A 1DJZA 2FJUB 3D0YB 1BT6A 1RECA 1IQ5A 1XFXO 1S1EA 1XK4C 1DJGA 1TNWA 5HKZA 1KSMA 3VRPA 3O6BA 3TS5C 1KK8C 1QV0A 1UURA 3ZNIA 5I8NA 3AKAA 1F4OA 1NX3A 2LV7A 2L2EA 3AKBA 1XK4A 2MRDA 3PSRA 2M97A 3A4UB 4MEWA 4ORCB 1OMVA 1PK0D 1SCMC 1NCYA 4IL1A 1IKUA 3VRNA 1TIZA 4YGBB 5D7FA 1KFUS 3BOWB 1B9AA 4CIDA 3EK7A 1K93D 1AK8A 1F70A 2CXJA 4FTGA 1KWOB 1AJ5A 1A4PA 2TN4A 2ZKMX 3NSIA 4OVNF 3I5HC 5CSJA 3FWBA 1NWDA 4C0KA 3IQOA 1KFXL 1Y6WA 3EVRA 1YVHA 2HQ8A 1PALA 3MSEB 2WCBA 1F4QA 1TTXA 2KHNA 1QIVA 3O2PA 2PASA 4GAOA 3WHUB 2BKIB 2M3WA 1F71A 4ZCUA 1NCXA 1XFYO 1QTXA 2WC8A 2KAYA 2PSRA 4WQ3A 3BUXB 4PHKA 4A4BA 2KBIA 1NUBA 1TOPA 2F2OA 3DVKA 2LHLA 3CR5X 2GGMA 1XFWO 1LKJA 3I5IB 1IJ6A 1R2UA 1PSBA 2OS8B 2Q91A 3TDZA 4PE1A 1K96A 3SG6A 2L4HA 2KOTA 1WRLA 4MRYA 1S5GY 4PE0A 2H2KA 1K8UA 1WDCB 1R6PA 1UHJA 1ZMZA 3SJSA 2P6BB 5KU1A 3CR4X 2ZRTA 5I2OA 4MN0A 4YGDB 1V1FA 1W7IB 1CLLA 3DVEA 3VROA 1CFCA 4I5JA 1X02A 2MBXA 2Y1MA 1NYAA 1XFZO 3RLZA 2LVKA 1DJWA 3CGAA 1EG3A 1DGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NZ0 A;  3PAL A;  2EGD A;  1WRK A;  2CCM A;  5I2L A;  4M2O A;  3HCM A;  2V53 A;  1RWY A;  1CLB A;  1J7O A;  1YUR A;  3KEV A;  5D69 A;  2K7D A;  3JTD B;  4N1F A;  2KI4 B;  1SR6 B;  2O60 A;  1L2O B;  3F45 A;  1AVS A;  1L7Z A;  1M39 A;  3DVJ A;  2F33 A;  3EVU A;  4I5K A;  2ZND A;  1F54 A;  2PAL A;  2ZN8 A;  4WRI A;  4L9M A;  1EH2 A;  2MLE C;  1K9K A;  1OZS A;  2LMV A;  1K2H A;  1XFV O;  3NSO A;  4U8D A;  2MJW B;  1DTL A;  1EL4 A;  2JPT A;  2KQY A;  2KYC A;  2KQ6 A;  1NIW A;  4N1G A;  4GGF A;  3SG3 A;  1H4B A;  1OQP A;  5AFP A;  5ER5 A;  2OTG B;  1LXF C;  2HET A;  4MSP A;  2BL0 C;  1MWN A;  2IS9 A;  5AEQ A;  1N65 A;  4XYN A;  3HX4 A;  3AAK A;  1G33 A;  3NSK A;  4DS7 A;  3C1V A;  4USL A;  1SL7 A;  1MHO A;  2BE6 A;  2KFG A;  4JPZ B;  1GGZ A;  1PVB A;  1SRA A;  1SCV A;  4JQ0 D;  2CTN A;  2K2A A;  1S6J A;  4UPG A;  1JC2 A;  4FQO A;  4HRG A;  1F8H A;  1B8L A;  4JWQ A;  4PCW A;  5J3X A;  1JFK A;  2KGR A;  1CM4 A;  3JVT C;  1SNL A;  1SY9 A;  1TNX A;  3EKH A;  2LVV A;  3I5G B;  1FI6 A;  1CM1 A;  1S6I A;  4YI8 A;  1B47 A;  1QXP A;  3I5F C;  3BUO B;  3CZT X;  2ZFD A;  5CSI A;  1PRW A;  2LLT A;  2I94 A;  2WCF A;  3BUN B;  2ISD A;  1NCZ A;  1IRJ A;  1A29 A;  2K7B A;  1CDL A;  3LL8 B;  1SYM A;  1AUI B;  1OZO A;  1A2X A;  4I5N B;  1YX8 A;  4ORB B;  1EG4 A;  5DKR A;  3DF0 A;  1J1E A;  2K61 A;  3DVM A;  4PHJ A;  2JXC A;  5ER4 X;  5AAN A;  4MZJ A;  5K89 A;  3OHM B;  2PVB A;  3TZ1 A;  1BJF A;  1KQM B;  3OB2 B;  3PN7 C;  2JTZ A;  5KSZ A;  4MZL A;  1IQ3 A;  2NCO A;  3KO0 A;  3BXK A;  4YGC B;  4NDD A;  2BCA A;  1MR8 A;  4WQ2 A;  2M29 A;  1GQM A;  2DOQ A;  3SG4 A;  1PUL A;  3AAJ A;  1BOC A;  1SBJ A;  1KK8 B;  4HRE E;  4MVF A;  1BMO A;  1ZUZ A;  2BCB A;  4ZCV A;  3TS5 B;  1K95 A;  4C0L A;  1CDM A;  1DJX A;  1J55 A;  2Y1N A;  3E3R A;  2LM5 A;  1QVI Y;  2H61 C;  4AOM A;  1DF0 A;  1SCM B;  1ALW A;  1LA0 A;  1WRZ A;  2BEC A;  4CFQ A;  2NCP A;  4ETO A;  3DF0 B;  4MLW A;  1JSA A;  4OR9 B;  1V1G A;  4D1E A;  4YGE B;  4N5X A;  2KFH A;  2EC6 C;  2FCD A;  3SIA A;  3I5H B;  2WCE A;  1TCF A;  2I18 A;  3TDI A;  4AQJ A;  1CNP A;  1FBV A;  2JQ6 A;  2LVI A;  4MBE A;  3TUY B;  1D1O A;  4PE7 A;  5F6T A;  2LC5 A;  1S3P A;  3O78 A;  1UHI A;  2EHB A;  2JU0 A;  1CKK A;  1FF1 A;  5G08 A;  4XJK A;  4C0J A;  3OB1 B;  1CLM A;  1J1D A;  1SW8 A;  1H8B A;  1K90 D;  1DF0 B;  3O4Y A;  3VRR A;  1RK9 A;  1HT9 A;  4GPL B;  1KK7 Z;  1Y0V H;  1DVI A;  3EK8 A;  5FYX A;  1TCO B;  1B8C A;  2FOT A;  1U5I A;  4M2Q A;  1XVJ A;  4DRW A;  2M7N A;  1DJI A;  1XA5 A;  1M63 B;  4PE4 A;  5HYD A;  1GGW A;  1QV1 A;  1YX7 A;  1G4Y R;  3VGO A;  5B8I B;  1KFX S;  2BE4 A;  5KTY A;  3BQ3 A;  4MZK A;  1WY9 A;  1Y1U A;  1YTZ C;  5HKY A;  2KGB C;  1A75 A;  2AMI A;  1FPW A;  1QJT A;  4XJK B;  1CDP A;  1SL8 A;  1Y1X A;  1OE9 B;  2K2F A;  1QAS A;  4BY4 A;  1JF0 A;  1FW4 A;  5AER A;  4DCK A;  3WNX B;  2R2I A;  1ZOT B;  2HQW A;  1EXR A;  1BG1 A;  2JWW A;  2CNP A;  3CR2 A;  1U5I B;  4ORA B;  2LP2 A;  2K7C A;  2K0J A;  1JFJ A;  3BUM B;  1N2D A;  2M7L A;  3TDU A;  4YGA A;  1RFJ A;  1SPY A;  1BU3 A;  2G2B A;  1KFU L;  3KHE A;  4PHM A;  1DJY A;  1K94 A;  2LHI A;  2K7O A;  1VRK A;  5CSF A;  3IF7 A;  4ICB A;  2M1U A;  3IQQ A;  1B7T Z;  3GK1 A;  3FS7 A;  1J7P A;  1A75 B;  1QLK A;  2HPS A;  3M0W A;  1UHK A;  1KCY A;  1IH0 A;  1AP4 A;  5BPJ A;  1NPQ A;  3SG2 A;  2LUX A;  2M1K B;  2JT3 A;  1BR4 B;  1KQV A;  1RJV A;  4PDZ A;  3QRX A;  5HLO A;  1S36 A;  1TN4 A;  1ODB A;  1CFF A;  3FIA A;  1JF2 A;  3OX5 A;  2JC2 A;  3BUW B;  3ZWH A;  2BKH B;  3DD4 A;  2ZN9 A;  2MA2 A;  4QJ3 B;  1N0Y A;  2MLF C;  2WOR A;  1OMR A;  3KF9 A;  1KK7 Y;  3OP0 A;  4E68 A;  1SMG A;  1KWO C;  2VRG A;  3A8R A;  1MXL C;  2I2R E;  2AUC A;  3BOW A;  1M31 A;  1YR5 A;  2LLU A;  3GK4 X;  3NSL A;  2MAZ A;  2BL0 B;  1CFP A;  1EJ3 A;  2JT8 A;  3KPX A;  4A4C A;  1CTR A;  2Q4U A;  1QX7 A;  2KI6 C;  4HRH A;  2LAN A;  2LMT A;  3OX6 A;  2G9B A;  4GGN A;  3LLE A;  2LUC A;  4CLN A;  1ZFS A;  1DGU A;  4DIR A;  2L50 A;  2PRU A;  2L0P A;  2WOS A;  1UWO A;  1NX2 A;  2F3Z A;  2JUL A;  1Y1A A;  2KBM A;  1YRU B;  2E30 A;  2ZNE A;  1F55 A;  2E6W A;  3VRQ A;  1CDN A;  2JNF A;  3CLN A;  4QJ5 B;  2D8N A;  1IG5 A;  3I5I C;  3SG5 A;  3GOF A;  1RRO A;  3JVT B;  4GUK A;  2OS8 C;  2LE9 B;  4MRX A;  3EKJ A;  1A03 A;  1GJY A;  1HQV A;  4PHN A;  3LCP C;  4TNC A;  1NP8 A;  1NSH A;  3PFV A;  4YRU A;  5AXI A;  4DUQ A;  3I5F B;  3D10 A;  3RM1 A;  1BOD A;  1OMD A;  1B7T Y;  1WDC C;  2LLS A;  1IJ5 A;  3FWC A;  1QS7 A;  2ZRS A;  3TUY C;  3WXA A;  1G8I A;  2H61 A;  2KAV A;  1TNQ A;  4M2P A;  4OCI A;  4GNK B;  2MHH A;  4GFT A;  2KFF A;  4YI9 A;  1QIW A;  2GV5 A;  2BBN A;  1KSO A;  1BF5 A;  5PAL A;  1LIN A;  1LVC D;  1M46 A;  4PAL A;  3PN7 B;  2JT0 A;  1DT7 B;  1RTP 1;  2FCE A;  1PSR A;  1OOJ A;  4QJ4 B;  1J7Q A;  3EK4 A;  5CSN A;  1C07 A;  2COL B;  1ALV A;  1AJ4 A;  2OPO A;  3K21 A;  2KNE A;  5IBW A;  2JTT A;  2KAX A;  1YRT B;  1TRF A;  2KSP A;  3JTD C;  1PVA A;  2NLN A;  2KI4 C;  1SR6 C;  5DKQ A;  1L2O C;  1IGV A;  1WLM A;  4NDB A;  3ICB A;  1YUT A;  1YUU A;  3BYA A;  1E8A A;  1DJH A;  1MQ1 A;  2JZI A;  2M9G A;  2JRF A;  1FI5 A;  2Y5I A;  1SL9 A;  1B4C A;  4I5L B;  5TNC A;  2EC6 B;  4OKH A;  1NX1 A;  1DMO A;  3PM8 A;  1B8R A;  1C7V A;  4Q04 A;  2LAP A;  1UHH A;  2M0R A;  2F2P A;  4F0Z B;  1UUS A;  4R1E A;  3WHT B;  3CTN A;  3LK0 A;  1ZAC A;  1MUX A;  2QPT A;  2F3Y A;  2Y4Q A;  3CS1 A;  2BBM A;  3NXA A;  2KI6 D;  5JOL A;  4CFR A;  1MXE A;  2OTG C;  1M45 A;  2L98 A;  4BY5 A;  2QAC A;  1YUS A;  3SG7 A;  2LMU A;  2JNX A;  2PMY A;  2BCX A;  1K9P A;  1AHR A;  2I7A A;  1CMF A;  4GBA A;  4OV2 A;  4P5O E;  2K8M B;  2SAS A;  2WND A;  1C7W A;  1QAT A;  5CPV A;  5HLV A;  3LK1 A;  1YVL A;  2L5X B;  1IWQ A;  2M8U A;  1Q80 A;  1BR1 B;  4YBH B;  1XO5 A;  1XFU O;  4P2Y B;  2JOJ A;  5GQQ C;  3PAT A;  1K9U A;  3PLF B;  1UP5 A;  1JBA A;  1B1G A;  5HKW A;  2B1U A;  1UHN A;  1CMG A;  1TNP A;  2A4J A;  2CBL A;  4GGF C;  2JXL A;  4AQI A;  1BLQ A;  3D0Y A;  1MF8 B;  2NXQ A;  2LVJ A;  2RGI A;  2GGZ A;  3I5G C;  1SK6 D;  2LNK A;  4NQG A;  3H4S E;  4HSZ A;  1QX5 B;  1QVI Z;  1W7J B;  1OSA A;  5DKN A;  1XYD A;  2KDH A;  2LP3 A;  3SIB A;  1NX0 A;  1CB1 A;  2M49 B;  3CWG A;  5JJG A;  2SCP A;  2HF5 A;  1CFD A;  2F8P A;  3GK2 A;  2CT9 A;  1J7R A;  2KYF A;  1JUO A;  1QLS A;  2AAO A;  2LCP A;  1JWD A;  1WLZ A;  1S5G Z;  2L4I A;  2O5G A;  1S26 D;  1S6C A;  2L51 A;  4NDC A;  5I2Q A;  1LA3 A;  1SKT A;  4CPV A;  1KQM C;  3EVV A;  1QX2 A;  1DJZ A;  2FJU B;  3D0Y B;  1BT6 A;  1REC A;  1IQ5 A;  1XFX O;  1S1E A;  1XK4 C;  1DJG A;  1TNW A;  5HKZ A;  1KSM A;  3VRP A;  3O6B A;  3TS5 C;  1KK8 C;  1QV0 A;  1UUR A;  3ZNI A;  5I8N A;  3AKA A;  1F4O A;  1NX3 A;  2LV7 A;  2L2E A;  3AKB A;  1XK4 A;  2MRD A;  3PSR A;  2M97 A;  3A4U B;  4MEW A;  4ORC B;  1OMV A;  1PK0 D;  1SCM C;  1NCY A;  4IL1 A;  1IKU A;  3VRN A;  1TIZ A;  4YGB B;  5D7F A;  1KFU S;  3BOW B;  1B9A A;  4CID A;  3EK7 A;  1K93 D;  1AK8 A;  1F70 A;  2CXJ A;  4FTG A;  1KWO B;  1AJ5 A;  1A4P A;  2TN4 A;  2ZKM X;  3NSI A;  4OVN F;  3I5H C;  5CSJ A;  3FWB A;  1NWD A;  4C0K A;  3IQO A;  1KFX L;  1Y6W A;  3EVR A;  1YVH A;  2HQ8 A;  1PAL A;  3MSE B;  2WCB A;  1F4Q A;  1TTX A;  2KHN A;  1QIV A;  3O2P A;  2PAS A;  4GAO A;  3WHU B;  2BKI B;  2M3W A;  1F71 A;  4ZCU A;  1NCX A;  1XFY O;  1QTX A;  2WC8 A;  2KAY A;  2PSR A;  4WQ3 A;  3BUX B;  4PHK A;  4A4B A;  2KBI A;  1NUB A;  1TOP A;  2F2O A;  3DVK A;  2LHL A;  3CR5 X;  2GGM A;  1XFW O;  1LKJ A;  3I5I B;  1IJ6 A;  1R2U A;  1PSB A;  2OS8 B;  2Q91 A;  3TDZ A;  4PE1 A;  1K96 A;  3SG6 A;  2L4H A;  2KOT A;  1WRL A;  4MRY A;  1S5G Y;  4PE0 A;  2H2K A;  1K8U A;  1WDC B;  1R6P A;  1UHJ A;  1ZMZ A;  3SJS A;  2P6B B;  5KU1 A;  3CR4 X;  2ZRT A;  5I2O A;  4MN0 A;  4YGD B;  1V1F A;  1W7I B;  1CLL A;  3DVE A;  3VRO A;  1CFC A;  4I5J A;  1X02 A;  2MBX A;  2Y1M A;  1NYA A;  1XFZ O;  3RLZ A;  2LVK A;  1DJW A;  3CGA A;  1EG3 A;  1DGV A; 
#chains in the Genus database with same CATH topology
 2NZ0 A;  3D75 A;  3PAL A;  2EGD A;  1QWV A;  1WRK A;  2CCM A;  5I2L A;  4M2O A;  3CZ1 A;  3HCM A;  2V53 A;  1RWY A;  1CLB A;  1C3Z A;  1J7O A;  1YUR A;  3KEV A;  3QME A;  2K7D A;  3JTD B;  4N1F A;  3D73 A;  3K1E A;  2KI4 B;  5D69 A;  1SR6 B;  2O60 A;  1L2O B;  3F45 A;  1AVS A;  1L7Z A;  1M39 A;  3DVJ A;  2F33 A;  3EVU A;  4I5K A;  2ZND A;  1F54 A;  2KLD A;  2PAL A;  2ZN8 A;  4WRI A;  4L9M A;  3DZT A;  1EH2 A;  2MLE C;  1DEK A;  1K9K A;  1OZS A;  2LMV A;  1K2H A;  3BJH A;  1XFV O;  3NSO A;  4U8D A;  2MJW B;  1DTL A;  3D77 A;  1EL4 A;  2JPT A;  2KQY A;  1IIO A;  2KYC A;  3SS5 A;  2KQ6 A;  1NIW A;  4N1G A;  4GGF A;  3SG3 A;  1H4B A;  1OQP A;  5AFP A;  5ER5 A;  2OTG B;  1LXF C;  2HET A;  4MSP A;  2BL0 C;  1MWN A;  1Z4H A;  1OOH A;  2IS9 A;  5AEQ A;  3D74 A;  1N65 A;  4XYN A;  3HX4 A;  3AAK A;  3NGV A;  1G33 A;  3NSK A;  4DS7 A;  3C1V A;  3CAB A;  4USL A;  1SL7 A;  1MHO A;  4OZD A;  2BE6 A;  2KFG A;  4JPZ B;  1GGZ A;  1PVB A;  1SRA A;  1SCV A;  4JQ0 D;  2CTN A;  1T14 A;  2K2A A;  1S6J A;  4UPG A;  1JC2 A;  4FQO A;  4HRG A;  1F8H A;  1B8L A;  4JWQ A;  4PCW A;  5J3X A;  1JFK A;  2KGR A;  1CM4 A;  3JVT C;  1SNL A;  1SY9 A;  1TNX A;  3EKH A;  1XFR A;  2LVV A;  3I5G B;  1C3Y A;  1FI6 A;  1CM1 A;  1S6I A;  4YI8 A;  1B47 A;  4KYN A;  1QXP A;  3I5F C;  1TUZ A;  3BUO B;  3CZT X;  2ZFD A;  5CSI A;  1PRW A;  2LLT A;  2I94 A;  2WCF A;  3BUN B;  2ISD A;  1NCZ A;  1IRJ A;  1A29 A;  2K7B A;  1CDL A;  3LL8 B;  1SYM A;  1AUI B;  1OZO A;  2QEB A;  1A2X A;  5CSJ A;  4I5N B;  1YX8 A;  4ORB B;  1EG4 A;  5DKR A;  3DF0 A;  1J1E A;  2K61 A;  3DVM A;  4PHJ A;  2JXC A;  5ER4 X;  5AAN A;  4MZJ A;  5K89 A;  3OHM B;  2PVB A;  3TZ1 A;  3UNW A;  1BJF A;  1KQM B;  3OB2 B;  3PN7 C;  2JTZ A;  3Q8I A;  4MZL A;  5KSZ A;  1IQ3 A;  2NCO A;  3KO0 A;  3BXK A;  4YGC B;  4NDD A;  2BCA A;  4IJ7 A;  1MR8 A;  4WQ2 A;  2M29 A;  1GQM A;  2DOQ A;  3SG4 A;  1PUL A;  3AAJ A;  3EG5 B;  1BOC A;  1SBJ A;  1KK8 B;  4HRE E;  4MVF A;  1BMO A;  1ZUZ A;  2BCB A;  4ZCV A;  3TS5 B;  1K95 A;  4C0L A;  1CDM A;  1DJX A;  1J55 A;  2PQL A;  2Y1N A;  2LM5 A;  3E3R A;  1QVI Y;  2H61 C;  4AOM A;  1DF0 A;  1SCM B;  1ALW A;  5D3O A;  1LA0 A;  1WRZ A;  2BEC A;  4CFQ A;  2NCP A;  4ETO A;  3DF0 B;  4MLW A;  1JSA A;  4OR9 B;  1V1G A;  4FQT A;  4D1E A;  4YGE B;  4N5X A;  1LS8 A;  2KFH A;  2EC6 C;  2FCD A;  3SIA A;  3I5H B;  2WCE A;  1TCF A;  2I18 A;  3TDI A;  4JD9 A;  4AQJ A;  1CNP A;  1FBV A;  2JQ6 A;  2LVI A;  2P70 A;  4MBE A;  3TUY B;  1D1O A;  4PE7 A;  5F6T A;  2LC5 A;  1TUJ A;  1S3P A;  3O78 A;  1UHI A;  2EHB A;  2JU0 A;  1CKK A;  2H8V A;  1FF1 A;  1TWO A;  5G08 A;  4XJK A;  4C0J A;  3OB1 B;  1CLM A;  1J1D A;  1SW8 A;  1H8B A;  1K90 D;  1DF0 B;  3UO9 A;  3O4Y A;  3VRR A;  1RK9 A;  1HT9 A;  3R1P A;  4GPL B;  1KK7 Z;  1Y0V H;  1DVI A;  3EK8 A;  3FE9 A;  5FYX A;  1TCO B;  1B8C A;  2FOT A;  1U5I A;  4M2Q A;  1GM0 A;  1XVJ A;  4DRW A;  2M7N A;  1DJI A;  1XA5 A;  1M63 B;  4PE4 A;  5HYD A;  1GGW A;  4PT1 A;  1QV1 A;  1YX7 A;  1G4Y R;  3VGO A;  5B8I B;  1KFX S;  2BE4 A;  5KTY A;  3BQ3 A;  4MZK A;  1WY9 A;  1Y1U A;  4C0K A;  3B7A A;  1YTZ C;  5HKY A;  2KGB C;  1A75 A;  2AMI A;  1FPW A;  1QJT A;  4XJK B;  1CDP A;  1SL8 A;  1Y1X A;  3D76 A;  1OE9 B;  2K2F A;  1QAS A;  4BY4 A;  1JF0 A;  1FW4 A;  5AER A;  4DCK A;  3SS4 A;  3WNX B;  2R2I A;  1ZOT B;  2HQW A;  1EXR A;  1BG1 A;  2JWW A;  2CNP A;  3CR2 A;  1U5I B;  4ORA B;  2LP2 A;  2K7C A;  2K0J A;  1JFJ A;  3BUM B;  1N2D A;  2M7L A;  5DIC A;  3TDU A;  4YGA A;  1RFJ A;  1SPY A;  1BU3 A;  2G2B A;  1KFU L;  2FJY A;  3KHE A;  4PHM A;  1DJY A;  1K94 A;  2LHI A;  2K7O A;  1VRK A;  5CSF A;  3S0G A;  3IF7 A;  4ICB A;  2M1U A;  3IQQ A;  1B7T Z;  3GK1 A;  3FS7 A;  1J7P A;  1A75 B;  1QLK A;  2HPS A;  3M0W A;  1UHK A;  2WCK A;  1KCY A;  1IH0 A;  1AP4 A;  2L2C A;  5BPJ A;  1NPQ A;  3S0E A;  3SG2 A;  2LUX A;  2M1K B;  2JT3 A;  1BR4 B;  1KQV A;  1RJV A;  1W9Z A;  3B86 A;  3DYE A;  4PDZ A;  3QRX A;  5HLO A;  1S36 A;  1TN4 A;  1ODB A;  1CFF A;  3FIA A;  1JF2 A;  3OX5 A;  5FI2 A;  2JC2 A;  3BUW B;  3ZWH A;  2BKH B;  3BFB A;  3DD4 A;  2ZN9 A;  2MA2 A;  4QJ3 B;  1N0Y A;  2MLF C;  2WOR A;  1OMR A;  3KF9 A;  1KK7 Y;  3OP0 A;  4E68 A;  3SS3 A;  1SMG A;  2QEO A;  1KWO C;  3FE8 A;  3PJI A;  2VRG A;  3A8R A;  1MXL C;  2I2R E;  2AUC A;  3BOW A;  1M31 A;  1YR5 A;  2LLU A;  3GK4 X;  3NSL A;  2MAZ A;  3R72 A;  2BL0 B;  3DY9 A;  1CFP A;  2L5Y A;  1EJ3 A;  2JT8 A;  3KPX A;  2QEV A;  4A4C A;  1CTR A;  2Q4U A;  2KPH A;  1QX7 A;  2KI6 C;  2YGU A;  4HRH A;  2LAN A;  2LMT A;  3OX6 A;  2G9B A;  4GGN A;  3LLE A;  2LUC A;  4CLN A;  1ZFS A;  1DGU A;  2KLE A;  2L50 A;  4DIR A;  2PRU A;  2L0P A;  2WOS A;  1UWO A;  1NX2 A;  2F3Z A;  2JUL A;  1Y1A A;  2KBM A;  1YRU B;  2E30 A;  2ZNE A;  1F55 A;  2E6W A;  3VRQ A;  2PYQ A;  2JNF A;  1CDN A;  3B87 A;  3CLN A;  4QJ5 B;  5FI7 A;  2D8N A;  1IG5 A;  3I5I C;  3BFH A;  3SG5 A;  3GOF A;  1RRO A;  3JVT B;  4GUK A;  2OS8 C;  2LE9 B;  4MRX A;  3EKJ A;  1A03 A;  1GJY A;  1HQV A;  4PHN A;  3LCP C;  2QEH A;  1NP8 A;  1NSH A;  3PFV A;  4TNC A;  5AXI A;  4DUQ A;  3I5F B;  3D10 A;  3RM1 A;  4YRU A;  1BOD A;  3B88 A;  1OMD A;  1B7T Y;  1WDC C;  2LLS A;  1IJ5 A;  2WC6 A;  1QS7 A;  3FWC A;  2ZRS A;  3L4L A;  3TUY C;  3WXA A;  1G8I A;  2H61 A;  2KAV A;  1TNQ A;  3NHT A;  4M2P A;  4OCI A;  4GNK B;  2MHH A;  2BNX A;  4GFT A;  2KFF A;  4YI9 A;  3IVT A;  1QIW A;  2GV5 A;  2BBN A;  1KSO A;  1BF5 A;  5PAL A;  1LIN A;  1LVC D;  1M46 A;  4PAL A;  3PN7 B;  2JT0 A;  1DT7 B;  1RTP 1;  2FCE A;  1PSR A;  1OOJ A;  4QJ4 B;  1J7Q A;  3EK4 A;  3B6X A;  5CSN A;  1C07 A;  2COL B;  1ALV A;  1AJ4 A;  2OPO A;  3K21 A;  2KNE A;  5IBW A;  2BAP A;  2JTT A;  2WCH A;  2KAX A;  1YRT B;  1TRF A;  2KSP A;  3JTD C;  1PVA A;  2NLN A;  2KI4 C;  1SR6 C;  5DKQ A;  1L2O C;  1IGV A;  1WLM A;  4NDB A;  3ICB A;  1YUT A;  1YUU A;  3BYA A;  1E8A A;  1DJH A;  1MQ1 A;  2JZI A;  2M9G A;  2JRF A;  1FI5 A;  2Y5I A;  2ERB A;  1SL9 A;  1B4C A;  4I5L B;  5TNC A;  3S0B A;  2EC6 B;  4OKH A;  1NX1 A;  3CZ2 A;  1DMO A;  3PM8 A;  1B8R A;  1C7V A;  4Q04 A;  5FI6 A;  3VB1 A;  2LAP A;  1UHH A;  1DQE A;  2F2P A;  2M0R A;  4F0Z B;  1UUS A;  4R1E A;  3WHT B;  3CTN A;  3LK0 A;  1ZAC A;  1MUX A;  2QPT A;  2F3Y A;  2Y4Q A;  3CS1 A;  2BBM A;  3NXA A;  2KI6 D;  5JOL A;  4CFR A;  1MXE A;  2OTG C;  1M45 A;  2L98 A;  3OBV A;  4BY5 A;  2QAC A;  1YUS A;  3SG7 A;  2LMU A;  2JNX A;  2PMY A;  2BCX A;  1K9P A;  3S0D A;  1AHR A;  2I7A A;  1CMF A;  4GBA A;  4OV2 A;  4P5O E;  4F7F A;  2K8M B;  2SAS A;  2WC5 A;  2WND A;  3CDN A;  1C7W A;  1QAT A;  5CPV A;  5HLV A;  3LK1 A;  1YVL A;  2L5X B;  1IWQ A;  2M8U A;  1Q80 A;  1BR1 B;  4YBH B;  1XO5 A;  1XFU O;  1OW4 A;  4P2Y B;  2JOJ A;  5GQQ C;  3PAT A;  1DC1 A;  1K9U A;  3PLF B;  1UP5 A;  1JBA A;  1B1G A;  5HKW A;  2B1U A;  1UHN A;  1CMG A;  1TNP A;  2A4J A;  2CBL A;  4GGF C;  2JXL A;  4AQI A;  1BLQ A;  3D0Y A;  1MF8 B;  2NXQ A;  2LVJ A;  2RGI A;  2GGZ A;  3CZ0 A;  1SK6 D;  2LNK A;  3I5G C;  4NQG A;  3H4S E;  4HSZ A;  1OOI X;  1QX5 B;  1QVI Z;  1W7J B;  5EL2 A;  1OSA A;  5DKN A;  1XYD A;  2KDH A;  2LP3 A;  3SIB A;  3DXL A;  1NX0 A;  1CB1 A;  2M49 B;  3CWG A;  2JPO A;  5JJG A;  2SCP A;  2HF5 A;  1Z2C B;  1CFD A;  2F8P A;  3GK2 A;  2CT9 A;  1J7R A;  2KYF A;  1JUO A;  1QLS A;  2AAO A;  2LCP A;  1JWD A;  1WLZ A;  1ORG A;  1S5G Z;  3O4X A;  2L4I A;  2O5G A;  3PM2 A;  1S26 D;  1S6C A;  2L51 A;  4NDC A;  5I2Q A;  1LA3 A;  1SKT A;  4CPV A;  1KQM C;  3EVV A;  1QX2 A;  1DJZ A;  2FJU B;  3D0Y B;  1BT6 A;  1REC A;  1IQ5 A;  1XFX O;  1S1E A;  1XK4 C;  1DJG A;  1TNW A;  3R1V A;  5HKZ A;  1KSM A;  3VRP A;  3O6B A;  5I94 A;  3TS5 C;  1KK8 C;  1QV0 A;  1UUR A;  2WCJ A;  3ZNI A;  5I8N A;  3AKA A;  1F4O A;  1NX3 A;  2LV7 A;  2L2E A;  1SSE B;  3AKB A;  3BFA A;  1XK4 A;  2MRD A;  3PSR A;  2M97 A;  2WCL A;  3A4U B;  4MEW A;  4ORC B;  1OMV A;  1PK0 D;  1SCM C;  1NCY A;  4IL1 A;  1IKU A;  3VRN A;  1TIZ A;  4YGB B;  5D7F A;  1KFU S;  3BOW B;  1B9A A;  4CID A;  3EK7 A;  1K93 D;  1AK8 A;  1F70 A;  2CXJ A;  4FTG A;  1KWO B;  1AJ5 A;  2K60 A;  1A4P A;  2TN4 A;  2ZKM X;  3NSI A;  4OVN F;  3I5H C;  3N7H A;  2P71 A;  1NWD A;  3FWB A;  3IQO A;  1KFX L;  1OOF A;  1Y6W A;  3EVR A;  3CYZ A;  1P28 A;  1YVH A;  2HQ8 A;  3L47 A;  1PAL A;  3MSE B;  2WCB A;  1F4Q A;  1TTX A;  2KHN A;  1QIV A;  3O2P A;  2PAS A;  4GAO A;  3WHU B;  2BKI B;  2GTE A;  3R1O A;  2M3W A;  1F71 A;  4ZCU A;  1NCX A;  1XFY O;  1QTX A;  2WC8 A;  2QDI A;  4INX A;  3RZS A;  2KAY A;  2PSR A;  4WQ3 A;  3BUX B;  3L4A A;  4PHK A;  4A4B A;  2KBI A;  1NUB A;  3D78 A;  1TOP A;  2F2O A;  3DVK A;  2LHL A;  3CR5 X;  1OOG A;  1DEL A;  2GGM A;  1XFW O;  1LKJ A;  3I5I B;  3FE6 A;  1IJ6 A;  1R2U A;  1PSB A;  2OS8 B;  2Q91 A;  3TDZ A;  3V2L A;  4PE1 A;  1K96 A;  3SG6 A;  2L4H A;  2KOT A;  2WCM A;  3S0F A;  1WRL A;  4MRY A;  1S5G Y;  4PE0 A;  2H2K A;  3OGN A;  1K8U A;  1WDC B;  1R6P A;  3NHI A;  1UHJ A;  1ZMZ A;  3SJS A;  2P6B B;  5HL1 A;  5KU1 A;  3S0A A;  3CR4 X;  2ZRT A;  5I2O A;  4MN0 A;  4YGD B;  1V1F A;  1W7I B;  1CLL A;  4INW A;  3DVE A;  3VRO A;  1CFC A;  4I5J A;  1X02 A;  2MBX A;  2Y1M A;  1NYA A;  1XFZ O;  3RLZ A;  2LVK A;  1DJW A;  3CGA A;  1EG3 A;  4JKT A;  1DGV A; 
#chains in the Genus database with same CATH homology
 2NZ0 A;  3PAL A;  2EGD A;  1WRK A;  2CCM A;  5I2L A;  4M2O A;  3HCM A;  2V53 A;  1RWY A;  1CLB A;  1J7O A;  1YUR A;  3KEV A;  5D69 A;  2K7D A;  3JTD B;  4N1F A;  2KI4 B;  1SR6 B;  2O60 A;  1L2O B;  3F45 A;  1AVS A;  1L7Z A;  1M39 A;  3DVJ A;  2F33 A;  3EVU A;  4I5K A;  2ZND A;  1F54 A;  2PAL A;  2ZN8 A;  4WRI A;  4L9M A;  1EH2 A;  2MLE C;  1K9K A;  1OZS A;  2LMV A;  1K2H A;  1XFV O;  3NSO A;  4U8D A;  2MJW B;  1DTL A;  1EL4 A;  2JPT A;  2KQY A;  2KYC A;  2KQ6 A;  1NIW A;  4N1G A;  4GGF A;  3SG3 A;  1H4B A;  1OQP A;  5AFP A;  5ER5 A;  2OTG B;  1LXF C;  2HET A;  4MSP A;  2BL0 C;  1MWN A;  2IS9 A;  5AEQ A;  1N65 A;  4XYN A;  3HX4 A;  3AAK A;  1G33 A;  3NSK A;  4DS7 A;  3C1V A;  4USL A;  1SL7 A;  1MHO A;  2BE6 A;  2KFG A;  4JPZ B;  1GGZ A;  1PVB A;  1SRA A;  1SCV A;  4JQ0 D;  2CTN A;  2K2A A;  1S6J A;  4UPG A;  1JC2 A;  4FQO A;  4HRG A;  1F8H A;  1B8L A;  4JWQ A;  4PCW A;  5J3X A;  1JFK A;  2KGR A;  1CM4 A;  3JVT C;  1SNL A;  1SY9 A;  1TNX A;  3EKH A;  2LVV A;  3I5G B;  1FI6 A;  1CM1 A;  1S6I A;  4YI8 A;  1B47 A;  1QXP A;  3I5F C;  3BUO B;  3CZT X;  2ZFD A;  5CSI A;  1PRW A;  2LLT A;  2I94 A;  2WCF A;  3BUN B;  2ISD A;  1NCZ A;  1IRJ A;  1A29 A;  2K7B A;  1CDL A;  3LL8 B;  1SYM A;  1AUI B;  1OZO A;  1A2X A;  4I5N B;  1YX8 A;  4ORB B;  1EG4 A;  5DKR A;  3DF0 A;  1J1E A;  2K61 A;  3DVM A;  4PHJ A;  2JXC A;  5ER4 X;  5AAN A;  4MZJ A;  5K89 A;  3OHM B;  2PVB A;  3TZ1 A;  1BJF A;  1KQM B;  3OB2 B;  3PN7 C;  2JTZ A;  5KSZ A;  4MZL A;  1IQ3 A;  2NCO A;  3KO0 A;  3BXK A;  4YGC B;  4NDD A;  2BCA A;  1MR8 A;  4WQ2 A;  2M29 A;  1GQM A;  2DOQ A;  3SG4 A;  1PUL A;  3AAJ A;  1BOC A;  1SBJ A;  1KK8 B;  4HRE E;  4MVF A;  1BMO A;  1ZUZ A;  2BCB A;  4ZCV A;  3TS5 B;  1K95 A;  4C0L A;  1CDM A;  1DJX A;  1J55 A;  2Y1N A;  3E3R A;  2LM5 A;  1QVI Y;  2H61 C;  4AOM A;  1DF0 A;  1SCM B;  1ALW A;  1LA0 A;  1WRZ A;  2BEC A;  4CFQ A;  2NCP A;  4ETO A;  3DF0 B;  4MLW A;  1JSA A;  4OR9 B;  1V1G A;  4D1E A;  4YGE B;  4N5X A;  2KFH A;  2EC6 C;  2FCD A;  3SIA A;  3I5H B;  2WCE A;  1TCF A;  2I18 A;  3TDI A;  4AQJ A;  1CNP A;  1FBV A;  2JQ6 A;  2LVI A;  4MBE A;  3TUY B;  1D1O A;  4PE7 A;  5F6T A;  2LC5 A;  1S3P A;  3O78 A;  1UHI A;  2EHB A;  2JU0 A;  1CKK A;  1FF1 A;  5G08 A;  4XJK A;  4C0J A;  3OB1 B;  1CLM A;  1J1D A;  1SW8 A;  1H8B A;  1K90 D;  1DF0 B;  3O4Y A;  3VRR A;  1RK9 A;  1HT9 A;  4GPL B;  1KK7 Z;  1Y0V H;  1DVI A;  3EK8 A;  5FYX A;  1TCO B;  1B8C A;  2FOT A;  1U5I A;  4M2Q A;  1XVJ A;  4DRW A;  2M7N A;  1DJI A;  1XA5 A;  1M63 B;  4PE4 A;  5HYD A;  1GGW A;  1QV1 A;  1YX7 A;  1G4Y R;  3VGO A;  5B8I B;  1KFX S;  2BE4 A;  5KTY A;  3BQ3 A;  4MZK A;  1WY9 A;  1Y1U A;  1YTZ C;  5HKY A;  2KGB C;  1A75 A;  2AMI A;  1FPW A;  1QJT A;  4XJK B;  1CDP A;  1SL8 A;  1Y1X A;  1OE9 B;  2K2F A;  1QAS A;  4BY4 A;  1JF0 A;  1FW4 A;  5AER A;  4DCK A;  3WNX B;  2R2I A;  1ZOT B;  2HQW A;  1EXR A;  1BG1 A;  2JWW A;  2CNP A;  3CR2 A;  1U5I B;  4ORA B;  2LP2 A;  2K7C A;  2K0J A;  1JFJ A;  3BUM B;  1N2D A;  2M7L A;  3TDU A;  4YGA A;  1RFJ A;  1SPY A;  1BU3 A;  2G2B A;  1KFU L;  3KHE A;  4PHM A;  1DJY A;  1K94 A;  2LHI A;  2K7O A;  1VRK A;  5CSF A;  3IF7 A;  4ICB A;  2M1U A;  3IQQ A;  1B7T Z;  3GK1 A;  3FS7 A;  1J7P A;  1A75 B;  1QLK A;  2HPS A;  3M0W A;  1UHK A;  1KCY A;  1IH0 A;  1AP4 A;  5BPJ A;  1NPQ A;  3SG2 A;  2LUX A;  2M1K B;  2JT3 A;  1BR4 B;  1KQV A;  1RJV A;  4PDZ A;  3QRX A;  5HLO A;  1S36 A;  1TN4 A;  1ODB A;  1CFF A;  3FIA A;  1JF2 A;  3OX5 A;  2JC2 A;  3BUW B;  3ZWH A;  2BKH B;  3DD4 A;  2ZN9 A;  2MA2 A;  4QJ3 B;  1N0Y A;  2MLF C;  2WOR A;  1OMR A;  3KF9 A;  1KK7 Y;  3OP0 A;  4E68 A;  1SMG A;  1KWO C;  2VRG A;  3A8R A;  1MXL C;  2I2R E;  2AUC A;  3BOW A;  1M31 A;  1YR5 A;  2LLU A;  3GK4 X;  3NSL A;  2MAZ A;  2BL0 B;  1CFP A;  1EJ3 A;  2JT8 A;  3KPX A;  4A4C A;  1CTR A;  2Q4U A;  1QX7 A;  2KI6 C;  4HRH A;  2LAN A;  2LMT A;  3OX6 A;  2G9B A;  4GGN A;  3LLE A;  2LUC A;  4CLN A;  1ZFS A;  1DGU A;  4DIR A;  2L50 A;  2PRU A;  2L0P A;  2WOS A;  1UWO A;  1NX2 A;  2F3Z A;  2JUL A;  1Y1A A;  2KBM A;  1YRU B;  2E30 A;  2ZNE A;  1F55 A;  2E6W A;  3VRQ A;  1CDN A;  2JNF A;  3CLN A;  4QJ5 B;  2D8N A;  1IG5 A;  3I5I C;  3SG5 A;  3GOF A;  1RRO A;  3JVT B;  4GUK A;  2OS8 C;  2LE9 B;  4MRX A;  3EKJ A;  1A03 A;  1GJY A;  1HQV A;  4PHN A;  3LCP C;  4TNC A;  1NP8 A;  1NSH A;  3PFV A;  4YRU A;  5AXI A;  4DUQ A;  3I5F B;  3D10 A;  3RM1 A;  1BOD A;  1OMD A;  1B7T Y;  1WDC C;  2LLS A;  1IJ5 A;  3FWC A;  1QS7 A;  2ZRS A;  3TUY C;  3WXA A;  1G8I A;  2H61 A;  2KAV A;  1TNQ A;  4M2P A;  4OCI A;  4GNK B;  2MHH A;  4GFT A;  2KFF A;  4YI9 A;  1QIW A;  2GV5 A;  2BBN A;  1KSO A;  1BF5 A;  5PAL A;  1LIN A;  1LVC D;  1M46 A;  4PAL A;  3PN7 B;  2JT0 A;  1DT7 B;  1RTP 1;  2FCE A;  1PSR A;  1OOJ A;  4QJ4 B;  1J7Q A;  3EK4 A;  5CSN A;  1C07 A;  2COL B;  1ALV A;  1AJ4 A;  2OPO A;  3K21 A;  2KNE A;  5IBW A;  2JTT A;  2KAX A;  1YRT B;  1TRF A;  2KSP A;  3JTD C;  1PVA A;  2NLN A;  2KI4 C;  1SR6 C;  5DKQ A;  1L2O C;  1IGV A;  1WLM A;  4NDB A;  3ICB A;  1YUT A;  1YUU A;  3BYA A;  1E8A A;  1DJH A;  1MQ1 A;  2JZI A;  2M9G A;  2JRF A;  1FI5 A;  2Y5I A;  1SL9 A;  1B4C A;  4I5L B;  5TNC A;  2EC6 B;  4OKH A;  1NX1 A;  1DMO A;  3PM8 A;  1B8R A;  1C7V A;  4Q04 A;  2LAP A;  1UHH A;  2M0R A;  2F2P A;  4F0Z B;  1UUS A;  4R1E A;  3WHT B;  3CTN A;  3LK0 A;  1ZAC A;  1MUX A;  2QPT A;  2F3Y A;  2Y4Q A;  3CS1 A;  2BBM A;  3NXA A;  2KI6 D;  5JOL A;  4CFR A;  1MXE A;  2OTG C;  1M45 A;  2L98 A;  4BY5 A;  2QAC A;  1YUS A;  3SG7 A;  2LMU A;  2JNX A;  2PMY A;  2BCX A;  1K9P A;  1AHR A;  2I7A A;  1CMF A;  4GBA A;  4OV2 A;  4P5O E;  2K8M B;  2SAS A;  2WND A;  1C7W A;  1QAT A;  5CPV A;  5HLV A;  3LK1 A;  1YVL A;  2L5X B;  1IWQ A;  2M8U A;  1Q80 A;  1BR1 B;  4YBH B;  1XO5 A;  1XFU O;  4P2Y B;  2JOJ A;  5GQQ C;  3PAT A;  1K9U A;  3PLF B;  1UP5 A;  1JBA A;  1B1G A;  5HKW A;  2B1U A;  1UHN A;  1CMG A;  1TNP A;  2A4J A;  2CBL A;  4GGF C;  2JXL A;  4AQI A;  1BLQ A;  3D0Y A;  1MF8 B;  2NXQ A;  2LVJ A;  2RGI A;  2GGZ A;  3I5G C;  1SK6 D;  2LNK A;  4NQG A;  3H4S E;  4HSZ A;  1QX5 B;  1QVI Z;  1W7J B;  1OSA A;  5DKN A;  1XYD A;  2KDH A;  2LP3 A;  3SIB A;  1NX0 A;  1CB1 A;  2M49 B;  3CWG A;  5JJG A;  2SCP A;  2HF5 A;  1CFD A;  2F8P A;  3GK2 A;  2CT9 A;  1J7R A;  2KYF A;  1JUO A;  1QLS A;  2AAO A;  2LCP A;  1JWD A;  1WLZ A;  1S5G Z;  2L4I A;  2O5G A;  1S26 D;  1S6C A;  2L51 A;  4NDC A;  5I2Q A;  1LA3 A;  1SKT A;  4CPV A;  1KQM C;  3EVV A;  1QX2 A;  1DJZ A;  2FJU B;  3D0Y B;  1BT6 A;  1REC A;  1IQ5 A;  1XFX O;  1S1E A;  1XK4 C;  1DJG A;  1TNW A;  5HKZ A;  1KSM A;  3VRP A;  3O6B A;  3TS5 C;  1KK8 C;  1QV0 A;  1UUR A;  3ZNI A;  5I8N A;  3AKA A;  1F4O A;  1NX3 A;  2LV7 A;  2L2E A;  3AKB A;  1XK4 A;  2MRD A;  3PSR A;  2M97 A;  3A4U B;  4MEW A;  4ORC B;  1OMV A;  1PK0 D;  1SCM C;  1NCY A;  4IL1 A;  1IKU A;  3VRN A;  1TIZ A;  4YGB B;  5D7F A;  1KFU S;  3BOW B;  1B9A A;  4CID A;  3EK7 A;  1K93 D;  1AK8 A;  1F70 A;  2CXJ A;  4FTG A;  1KWO B;  1AJ5 A;  1A4P A;  2TN4 A;  2ZKM X;  3NSI A;  4OVN F;  3I5H C;  5CSJ A;  3FWB A;  1NWD A;  4C0K A;  3IQO A;  1KFX L;  1Y6W A;  3EVR A;  1YVH A;  2HQ8 A;  1PAL A;  3MSE B;  2WCB A;  1F4Q A;  1TTX A;  2KHN A;  1QIV A;  3O2P A;  2PAS A;  4GAO A;  3WHU B;  2BKI B;  2M3W A;  1F71 A;  4ZCU A;  1NCX A;  1XFY O;  1QTX A;  2WC8 A;  2KAY A;  2PSR A;  4WQ3 A;  3BUX B;  4PHK A;  4A4B A;  2KBI A;  1NUB A;  1TOP A;  2F2O A;  3DVK A;  2LHL A;  3CR5 X;  2GGM A;  1XFW O;  1LKJ A;  3I5I B;  1IJ6 A;  1R2U A;  1PSB A;  2OS8 B;  2Q91 A;  3TDZ A;  4PE1 A;  1K96 A;  3SG6 A;  2L4H A;  2KOT A;  1WRL A;  4MRY A;  1S5G Y;  4PE0 A;  2H2K A;  1K8U A;  1WDC B;  1R6P A;  1UHJ A;  1ZMZ A;  3SJS A;  2P6B B;  5KU1 A;  3CR4 X;  2ZRT A;  5I2O A;  4MN0 A;  4YGD B;  1V1F A;  1W7I B;  1CLL A;  3DVE A;  3VRO A;  1CFC A;  4I5J A;  1X02 A;  2MBX A;  2Y1M A;  1NYA A;  1XFZ O;  3RLZ A;  2LVK A;  1DJW A;  3CGA A;  1EG3 A;  1DGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...