2COLB

Crystal structure analysis of cyaa/c-cam with pyrophosphate
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
67
structure length
67
Chain Sequence
TDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional hemolysin-adenylate cyclase
publication title Structural basis for the interaction of Bordetella pertussis adenylyl cyclase toxin with calmodulin
pubmed doi rcsb
source organism Bordetella pertussis
molecule tags Lyase/metal binding protein
total genus 19
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2005-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2colB00
3NSKA 4OCIA 5I2QA 2E30A 1SRAA 1J1EA 1SCMC 3KEVA 3TS5B 2F33A 3IF7A 1J7OA 3KO0A 4TNCA 4GBAA 1NX0A 4YGDB 2PMYA 1RROA 1XFXO 3D10A 3DVEA 2LUCA 2IS9A 3LK1A 1LA0A 1XFWO 2PASA 2LE9B 1JUOA 2JPTA 4M2PA 5JOLA 1TCFA 1UHNA 3VRPA 1KQVA 1ZMZA 2K2AA 1QLKA 1LA3A 4ORCB 2M7LA 1CFCA 3I5HC 1MWNA 4WQ2A 3EKHA 1NPQA 4MLWA 1GQMA 1U5IA 2LVIA 1DJIA 4OKHA 1IH0A 1F70A 1KSMA 3DVJA 2H61C 3DVMA 1M46A 3OP0A 2F3ZA 1KCYA 2AUCA 1XK4C 1AVSA 1S5GY 4ICBA 3I5FC 4PE7A 1S3PA 2EC6B 4NDCA 1AK8A 3FWCA 5ER5A 1PSRA 1LKJA 2KBMA 1WDCC 2CXJA 2KYCA 1K95A 1AUIB 4MRYA 1CFFA 2JT0A 1CKKA 1F8HA 4YBHB 4GAOA 3WXAA 1N0YA 4I5KA 2NCOA 4A4BA 5JJGA 1NYAA 3TUYB 5KU1A 1K9PA 1TCOB 1ZUZA 1CLMA 2JWWA 2RGIA 2LANA 2KSPA 2LVVA 1N65A 1DF0B 1Q80A 2JOJA 4UPGA 2JZIA 2LHIA 1CDLA 4CPVA 1PSBA 2LNKA 2ZN9A 5I2OA 1OMDA 4A4CA 3ZNIA 1NCZA 4AQJA 5HYDA 4MBEA 1A2XA 2KQ6A 2WORA 4MEWA 1SL7A 4GFTA 5B8IB 1E8AA 4N5XA 1F4OA 3AKAA 4PHKA 1SW8A 2JNFA 4YGCB 1DTLA 1AJ4A 1M39A 2PALA 4GGFA 1DJWA 2SCPA 2ZKMX 1OSAA 1XFZO 4ORBB 1FPWA 4ETOA 1NCXA 2JXCA 3CR4X 2M29A 2HPSA 2G9BA 2NZ0A 3VROA 4M2OA 1IJ6A 1NP8A 1UP5A 2BECA 3IQOA 1UHJA 4DIRA 4MRXA 1PULA 2KAVA 4ZCVA 2MHHA 2KFGA 4NDDA 1BJFA 2KI4B 2Q4UA 1ODBA 1B47A 2BBMA 3GOFA 3I5GB 3QRXA 3TZ1A 1Y0VH 2K8MB 5AFPA 1XVJA 1K96A 3I5GC 2LLTA 1JSAA 2WC8A 3EVVA 3SG3A 3SG6A 3SG7A 1QV0A 1EG3A 2KGBC 1HT9A 2DOQA 4XYNA 3I5IB 3O6BA 1WLMA 3LK0A 1YVLA 2KYFA 1B8LA 1CM4A 3A4UB 1JC2A 4NDBA 2FCEA 1PALA 1S36A 2KOTA 1BT6A 3DF0A 2LAPA 2LLSA 3BOWB 4ORAB 3VRNA 3VRQA 1TNQA 4MZKA 3NXAA 2KAXA 2BBNA 4PHMA 5AEQA 1UWOA 1SL9A 1PVAA 2VRGA 2KFHA 2K2FA 1S6IA 3NSLA 1XO5A 2O5GA 3AKBA 3JVTB 3IQQA 3SIBA 3CLNA 4BY5A 3JVTC 3WNXB 3NSOA 2I2RE 1B9AA 1A75A 3PM8A 3RLZA 1YURA 2K61A 5PALA 1K8UA 1RJVA 3LL8B 1SCMB 4GGFC 3EK8A 2V53A 4HRGA 4DRWA 1IWQA 1RECA 1EXRA 1QJTA 4GUKA 1K9KA 5D7FA 3BYAA 2SASA 1MQ1A 1QV1A 1UUSA 3GK2A 4GNKB 1CB1A 2KAYA 3SJSA 1J7RA 1CMGA 2GGMA 1NCYA 1Y6WA 4AOMA 3I5HB 1AHRA 1DGVA 2JRFA 1BU3A 1JFKA 1S6JA 2LMTA 4C0LA 3MSEB 2CT9A 5DKNA 1G33A 1QXPA 2MLEC 4HRHA 4AQIA 1RTP1 1TTXA 2JNXA 2ZRTA 2NXQA 1XYDA 2G2BA 4PE1A 1AP4A 1H4BA 2D8NA 1W7JB 3LLEA 1QX5B 3CS1A 2AAOA 2WCFA 3EK7A 4HSZA 3I5FB 3DF0B 1KWOC 2WCEA 3NSIA 1AJ5A 4PCWA 4XJKB 2L2EA 1XFVO 1F55A 4MVFA 2JULA 2P6BB 1C07A 3SG4A 1WDCB 1S5GZ 1A29A 1KQMC 1J1DA 2KI6D 4OR9B 2F2OA 1NIWA 2GV5A 1BLQA 1KK8C 2F2PA 1SR6C 1KFXS 1W7IB 1A75B 2JTZA 1NWDA 3BUXB 4MZLA 2M8UA 1CDNA 1OE9B 1QS7A 4P5OE 2MLFC 1UHIA 2MA2A 1SNLA 1Y1UA 2Y5IA 1IG5A 5FYXA 1QIWA 3E3RA 3OB1B 3OHMB 3F45A 1BR1B 1M31A 2OPOA 4R1EA 5G08A 1OZSA 1WRKA 2OS8C 3PLFB 1NX1A 2LV7A 2PRUA 5HLVA 3ZWHA 1JF0A 3PN7C 3TDZA 4I5NB 2LM5A 1UHKA 4OVNF 1L2OC 1NX3A 1R6PA 1N2DA 3PATA 4YGAA 1TRFA 1CLLA 1NX2A 1YTZC 3EK4A 2OTGC 1BF5A 1U5IB 1DJXA 2LP2A 2L50A 1PRWA 1FF1A 2M9GA 1QIVA 1SCVA 2L4HA 1CDPA 2Y1MA 1GGWA 3BUMB 4I5JA 4FQOA 4GPLB 2K7OA 3O78A 1C7VA 4MZJA 2JT3A 3O4YA 2L51A 2LHLA 1EL4A 3OB2B 2MRDA 3RM1A 3JTDC 3KF9A 3FIAA 2CNPA 1DT7B 1MHOA 1YRTB 2LLUA 2CCMA 4PHNA 1FI6A 2ZFDA 2BCXA 2FCDA 1PK0D 2BE6A 1LVCD 1CDMA 4YGBB 2KGRA 2NCPA 2LP3A 5HKYA 3D0YA 1FBVA 1DJZA 1KSOA 2KFFA 2WNDA 4YRUA 4PALA 4CFRA 1R2UA 1XFYO 5AXIA 2LVJA 1IJ5A 2KQYA 2ZRSA 1CM1A 4QJ4B 1ZFSA 1ALWA 1RWYA 3DVKA 4CLNA 4P2YB 1IRJA 4USLA 1CNPA 5CSFA 2BKHB 2E6WA 1XA5A 1WLZA 2L5XB 2L4IA 3C1VA 2M7NA 2M3WA 4PE4A 1K90D 2COLB 2JT8A 1WRZA 2KI6C 1BG1A 1B4CA 1FI5A 2EHBA 1TNPA 4WQ3A 4DS7A 3VGOA 3EVUA 4ZCUA 3SIAA 1MR8A 1EJ3A 1EG4A 1C7WA 2BL0C 3A8RA 2KNEA 2I94A 2Y4QA 3LCPC 2I18A 3CTNA 4GGNA 5CPVA 5BPJA 1OMRA 2M97A 1IKUA 4PDZA 3BUOB 2PVBA 3TDUA 1NSHA 1Y1AA 1J7QA 2LUXA 2O60A 3CZTX 1VRKA 2I7AA 4D1EA 1BOCA 2LC5A 2HETA 1KK7Y 5HKZA 4F0ZB 1DJGA 4MSPA 3D0YB 5J3XA 4DUQA 2QACA 3WHTB 3GK4X 1DGUA 1F4QA 1KK7Z 2K0JA 1BMOA 1NUBA 1MUXA 2LVKA 2K7CA 5TNCA 1QX7A 2K7DA 1SK6D 1DJYA 1QX2A 3CR5X 1LINA 1DF0A 1KWOB 2BKIB 3TS5C 1F54A 3FS7A 1OMVA 3OX5A 2EGDA 1K93D 1ZACA 2ZN8A 1JWDA 1TN4A 5KSZA 1D1OA 2HQ8A 1KQMB 4JQ0D 1LXFC 1YX8A 3OX6A 2LCPA 1YUUA 1IQ3A 1EH2A 1J7PA 1BODA 1CFDA 1KK8B 1SR6B 2LMVA 3HX4A 4Q04A 3WHUB 4PE0A 4YI9A 1SMGA 1IGVA 2NLNA 2BCBA 2CTNA 4MN0A 3GK1A 3CGAA 2HF5A 4N1FA 1CMFA 3PFVA 4NQGA 2AMIA 3EVRA 2ZNDA 1SYMA 1OZOA 2JTTA 5AERA 2MAZA 2FOTA 1CFPA 2Y1NA 3BUWB 1K2HA 2BE4A 1CTRA 2MJWB 3M0WA 2OS8B 1TIZA 5CSJA 1PVBA 2EC6C 1ZOTB 3PN7B 3CR2A 1L2OB 2LMUA 4JWQA 1QTXA 1UURA 1Y1XA 2OTGB 1QATA 2L98A 1K94A 3KPXA 4M2QA 2WOSA 1GGZA 4OV2A 5K89A 3AAKA 4CIDA 1V1FA 3TUYC 2CBLA 4N1GA 1QVIY 4C0JA 1B1GA 5DKQA 2GGZA 3HCMA 1G4YR 2BCAA 2FJUB 2TN4A 3BOWA 1S1EA 3JTDB 4IL1A 5CSIA 1QVIZ 1TNXA 1RFJA 1KFUS 5HLOA 1SBJA 1MXLC 1SPYA 2QPTA 3K21A 2JQ6A 5AANA 4CFQA 1QLSA 2KBIA 3BQ3A 1YRUB 1JBAA 1F71A 1DMOA 1M45A 3SG5A 1B7TY 2ISDA 2KDHA 3BUNB 3CWGA 5I8NA 3PALA 1KFXL 1ALVA 4HREE 2M49B 2B1UA 4FTGA 1B7TZ 1JF2A 1YUSA 2F8PA 5I2LA 1BR4B 2KHNA 2JC2A 1YVHA 1SKTA 1SY9A 3PSRA 2ZNEA 1B8RA 1M63B 1XFUO 4WRIA 2L0PA 4QJ3B 1MXEA 2H2KA 3H4SE 3EKJA 5GQQC 1L7ZA 1OQPA 3VRRA 2A4JA 1JFJA 5HKWA 1A4PA 2KI4C 3TDIA 4I5LB 1DJHA 3ICBA 2HQWA 5F6TA 5IBWA 4PHJA 2PSRA 1TOPA 1SL8A 4YGEB 1S6CA 1QASA 1RK9A 2H61A 1V1GA 1OOJA 1K9UA 1XK4A 1UHHA 2JXLA 2R2IA 2WCBA 3I5IC 1YX7A 1WY9A 3O2PA 4JPZB 4DCKA 5DKRA 2BL0B 4QJ5B 2MBXA 1YUTA 1FW4A 4XJKA 2K7BA 1KFUL 5D69A 3DD4A 2M0RA 4BY4A 1MF8B 1S26D 1IQ5A 1J55A 1WRLA 3FWBA 1GJYA 1HQVA 1H8BA 5ER4X 1TNWA 3BXKA 1A03A 2M1UA 2M1KB 5CSNA 2Q91A 4U8DA 1YR5A 4C0KA 5KTYA 1G8IA 3SG2A 1CLBA 1DVIA 1B8CA 3AAJA 2JU0A 3KHEA 2F3YA 1X02A 4YI8A 4E68A 4L9MA
chains in the Genus database with same CATH superfamily
4FQTA 1P28A 3NSKA 4INWA 4OCIA 5I2QA 2E30A 1SRAA 1J1EA 1SCMC 3KEVA 3TS5B 2F33A 3IF7A 1J7OA 3KO0A 4TNCA 4GBAA 1NX0A 4YGDB 2PMYA 1RROA 1XFXO 3D10A 3DVEA 2LUCA 3S0AA 2IS9A 3LK1A 1LA0A 1XFWO 2PASA 2LE9B 1JUOA 2JPTA 4M2PA 3SS3A 5JOLA 3CYZA 1TCFA 1UHNA 3VRPA 1KQVA 1ZMZA 2K2AA 1QLKA 2QEVA 1LA3A 2WC6A 4ORCB 2M7LA 1CFCA 3I5HC 1MWNA 1TUZA 4WQ2A 3EKHA 1NPQA 4MLWA 1GQMA 1U5IA 2LVIA 1DJIA 4OKHA 3FE6A 1IH0A 2FJYA 1F70A 1KSMA 3B6XA 3DVJA 2H61C 1C3ZA 2JPOA 3DVMA 3L47A 1M46A 3OP0A 2F3ZA 1KCYA 2AUCA 1XK4C 4KYNA 1AVSA 1S5GY 4ICBA 3I5FC 4PE7A 1S3PA 2EC6B 4NDCA 1AK8A 3FWCA 5ER5A 1PSRA 1LKJA 2KBMA 1WDCC 2CXJA 2KYCA 5EL2A 1K95A 1AUIB 4MRYA 1CFFA 2JT0A 1CKKA 1F8HA 4YBHB 2WCJA 4GAOA 3WXAA 1N0YA 4I5KA 2NCOA 4A4BA 1OOHA 5I94A 5JJGA 1NYAA 1DEKA 3TUYB 5KU1A 1K9PA 1TCOB 3S0EA 1ZUZA 1CLMA 2JWWA 2RGIA 2LANA 2KSPA 3CABA 2LVVA 3L4AA 1N65A 1DF0B 1Q80A 3NGVA 2JOJA 2WCHA 4UPGA 2JZIA 2LHIA 1CDLA 4CPVA 1PSBA 2LNKA 2ZN9A 5I2OA 1OMDA 4A4CA 3ZNIA 1NCZA 4AQJA 5HYDA 4MBEA 1A2XA 2KQ6A 2WORA 3IVTA 4MEWA 1SL7A 4GFTA 5B8IB 1E8AA 4N5XA 1F4OA 3AKAA 4PHKA 1SW8A 2JNFA 4YGCB 1DTLA 1AJ4A 1M39A 2PALA 4GGFA 1DJWA 2SCPA 2ZKMX 1OSAA 1XFZO 4JD9A 4ORBB 1FPWA 4ETOA 1NCXA 2JXCA 3CR4X 5FI6A 3SS4A 2M29A 2HPSA 2QEBA 3D78A 2G9BA 2NZ0A 3VROA 4M2OA 1IJ6A 1NP8A 1UP5A 2BECA 2PQLA 1UHJA 3IQOA 3NHIA 4DIRA 4MRXA 1PULA 2KAVA 2L5YA 4ZCVA 2MHHA 2KFGA 4NDDA 1BJFA 2KLDA 2KI4B 1ODBA 2BNXA 1B47A 2BBMA 2Q4UA 3GOFA 3I5GB 3QRXA 3TZ1A 1Y0VH 5DICA 2K8MB 5AFPA 1XVJA 1K96A 3I5GC 2LLTA 1JSAA 3S0FA 2WC8A 3EVVA 3SG3A 3SG6A 3SG7A 2KLEA 1QV0A 1EG3A 2KGBC 1C3YA 2WC5A 1HT9A 2DOQA 4XYNA 3I5IB 3O6BA 1WLMA 2P71A 3LK0A 3DY9A 1YVLA 2KYFA 1TUJA 4JKTA 5FI2A 1B8LA 1CM4A 3A4UB 2PYQA 1JC2A 4NDBA 2FCEA 1PALA 1S36A 2KOTA 2L2CA 1BT6A 3DF0A 2LAPA 2LLSA 3BOWB 4ORAB 3VRNA 3VRQA 1TNQA 4MZKA 3NXAA 2KAXA 2BBNA 4PHMA 5AEQA 1UWOA 1SL9A 1PVAA 2VRGA 1OW4A 2K2FA 2KFHA 1S6IA 3NSLA 1XO5A 2O5GA 3AKBA 3JVTB 3IQQA 3SIBA 3CLNA 1T14A 4BY5A 3DXLA 3JVTC 3Q8IA 3WNXB 4PT1A 3NSOA 3RZSA 2I2RE 1B9AA 1A75A 3PM8A 3RLZA 3OBVA 1YURA 2K61A 5PALA 1K8UA 1RJVA 3LL8B 1SCMB 4GGFC 3EK8A 2V53A 4HRGA 4DRWA 4INXA 5HL1A 3L4LA 1IWQA 1RECA 1EXRA 1QJTA 4GUKA 1K9KA 5D7FA 3BYAA 2SASA 1MQ1A 1QV1A 3PJIA 1UUSA 3GK2A 4GNKB 1CB1A 2KAYA 3SJSA 1OOIX 1J7RA 1Z4HA 1CMGA 2GGMA 1NCYA 1Y6WA 4AOMA 3I5HB 1AHRA 1DGVA 2JRFA 1BU3A 1JFKA 1S6JA 2LMTA 4C0LA 1GM0A 3OGNA 3MSEB 2CT9A 5DKNA 1G33A 1QXPA 2GTEA 2MLEC 4HRHA 4AQIA 1RTP1 1TTXA 2JNXA 2ZRTA 2NXQA 1XYDA 2G2BA 4PE1A 1AP4A 3V2LA 1H4BA 2D8NA 1W7JB 3LLEA 1QX5B 3CS1A 2AAOA 2WCFA 3EK7A 4HSZA 3I5FB 3DF0B 1KWOC 2WCEA 3NSIA 1AJ5A 4PCWA 4XJKB 2L2EA 1XFVO 1F55A 1DELA 4MVFA 2JULA 2P6BB 1XFRA 1C07A 3SG4A 1WDCB 1S5GZ 1A29A 1KQMC 1J1DA 4OZDA 2KI6D 4OR9B 2F2OA 1NIWA 2GV5A 1BLQA 1KK8C 2F2PA 1SR6C 1KFXS 1W7IB 1A75B 2JTZA 3DYEA 1NWDA 3BUXB 4MZLA 2M8UA 1CDNA 1OE9B 1QS7A 4P5OE 2MLFC 1UHIA 2MA2A 1SNLA 1Y1UA 2Y5IA 1IG5A 5FYXA 1QIWA 3E3RA 3OB1B 1DQEA 3OHMB 3F45A 2H8VA 1BR1B 1M31A 2OPOA 1W9ZA 1OOGA 1OZSA 1WRKA 4R1EA 5G08A 2OS8C 3PLFB 3UNWA 2WCKA 1NX1A 2LV7A 2PRUA 1QWVA 5HLVA 3ZWHA 1JF0A 3PN7C 3TDZA 4I5NB 2LM5A 1UHKA 4OVNF 1L2OC 1NX3A 1R6PA 1N2DA 3PATA 4YGAA 1TRFA 1CLLA 1NX2A 1YTZC 3EK4A 2OTGC 1BF5A 1U5IB 1DJXA 3CZ1A 1OOFA 1TWOA 2L50A 1PRWA 2LP2A 1FF1A 2M9GA 1QIVA 2QEOA 1SCVA 2L4HA 1CDPA 2Y1MA 3R72A 3BUMB 4I5JA 1GGWA 4FQOA 3R1PA 1DC1A 4GPLB 2K7OA 3O78A 3DZTA 1C7VA 4MZJA 2JT3A 3O4YA 3B86A 2L51A 2LHLA 3BFBA 1EL4A 3OB2B 2MRDA 3RM1A 3JTDC 3KF9A 3FIAA 2CNPA 1DT7B 1MHOA 1YRTB 2LLUA 2CCMA 4PHNA 1FI6A 2ZFDA 2BCXA 2FCDA 5FI7A 1PK0D 2BE6A 1LVCD 1CDMA 4YGBB 2KGRA 2NCPA 2LP3A 5HKYA 3D0YA 3R1OA 4IJ7A 1FBVA 1DJZA 1KSOA 2KFFA 2WNDA 1SSEB 4F7FA 4YRUA 4PALA 4CFRA 1R2UA 3BFHA 1XFYO 5AXIA 2LVJA 1IJ5A 3PM2A 2K60A 2KQYA 2ZRSA 1CM1A 4QJ4B 1ZFSA 1ALWA 3QMEA 1RWYA 3DVKA 4CLNA 4P2YB 1ORGA 1IRJA 4USLA 1CNPA 5CSFA 2BKHB 2E6WA 1XA5A 2YGUA 1WLZA 2L5XB 2L4IA 3C1VA 2M7NA 2M3WA 4PE4A 1K90D 2COLB 2JT8A 1WRZA 2KI6C 1BG1A 1B4CA 1FI5A 2EHBA 1TNPA 4WQ3A 4DS7A 3VGOA 3EVUA 4ZCUA 3SIAA 1MR8A 1EJ3A 1EG4A 1C7WA 2BL0C 3A8RA 2KNEA 2I94A 2Y4QA 3D76A 3LCPC 2I18A 3CTNA 4GGNA 5CPVA 5BPJA 1OMRA 2M97A 1IKUA 4PDZA 3BUOB 2PVBA 3TDUA 1NSHA 1Y1AA 1J7QA 2LUXA 2O60A 2ERBA 3CZTX 5D3OA 1VRKA 2I7AA 4D1EA 2P70A 1BOCA 2LC5A 2HETA 1KK7Y 5HKZA 4F0ZB 1DJGA 4MSPA 3D0YB 5J3XA 4DUQA 2QACA 3FE9A 3GK4X 1DGUA 3WHTB 1F4QA 1KK7Z 2K0JA 1BMOA 1NUBA 1MUXA 2LVKA 2K7CA 5TNCA 1QX7A 2K7DA 3BJHA 1SK6D 1DJYA 1QX2A 3CR5X 1LINA 1DF0A 1KWOB 2BKIB 3TS5C 1F54A 3FS7A 1OMVA 3OX5A 3S0GA 3UO9A 2EGDA 1K93D 1ZACA 2ZN8A 1JWDA 1TN4A 5KSZA 1D1OA 2HQ8A 1KQMB 3BFAA 4JQ0D 1LXFC 1YX8A 3OX6A 2LCPA 1YUUA 3CZ0A 1IQ3A 1EH2A 1J7PA 1BODA 1CFDA 1KK8B 1SR6B 2LMVA 3HX4A 4Q04A 3WHUB 4PE0A 4YI9A 1SMGA 1IGVA 2NLNA 3SS5A 2BCBA 2CTNA 3D77A 3GK1A 3CGAA 2HF5A 4MN0A 4N1FA 1CMFA 3PFVA 4NQGA 2AMIA 3EVRA 2ZNDA 1SYMA 1OZOA 2JTTA 3O4XA 5AERA 2MAZA 3K1EA 2FOTA 1CFPA 2Y1NA 3BUWB 1K2HA 2BE4A 1CTRA 2MJWB 3M0WA 2OS8B 1TIZA 3CDNA 2WCMA 5CSJA 3S0DA 1PVBA 2EC6C 3NHTA 1ZOTB 3PN7B 3CR2A 1L2OB 2LMUA 4JWQA 1QTXA 2WCLA 1UURA 1Y1XA 2OTGB 1QATA 2L98A 1K94A 3KPXA 4M2QA 2WOSA 1LS8A 3N7HA 1GGZA 4OV2A 5K89A 3AAKA 4CIDA 1V1FA 3TUYC 3B7AA 2CBLA 4N1GA 1QVIY 4C0JA 1B1GA 5DKQA 2GGZA 3HCMA 1G4YR 2BCAA 2FJUB 2TN4A 3BOWA 1S1EA 3JTDB 4IL1A 5CSIA 1QVIZ 1TNXA 1RFJA 1KFUS 5HLOA 1SBJA 1MXLC 1SPYA 2QPTA 3K21A 2JQ6A 5AANA 4CFQA 1QLSA 2KBIA 3BQ3A 1YRUB 1JBAA 1F71A 1DMOA 1M45A 3SG5A 1B7TY 3EG5B 2KDHA 3BUNB 3CWGA 2ISDA 3VB1A 3PALA 5I8NA 1KFXL 1ALVA 4HREE 2M49B 2B1UA 4FTGA 1B7TZ 1JF2A 1YUSA 2F8PA 5I2LA 1BR4B 2KHNA 3B87A 3B88A 2JC2A 3D73A 1YVHA 1SKTA 1SY9A 3PSRA 2ZNEA 1IIOA 1B8RA 1M63B 1XFUO 4WRIA 2L0PA 4QJ3B 1MXEA 2H2KA 3H4SE 3EKJA 5GQQC 1L7ZA 1OQPA 3VRRA 2A4JA 1JFJA 5HKWA 1A4PA 2KI4C 3TDIA 4I5LB 1DJHA 3ICBA 3D75A 2HQWA 5F6TA 5IBWA 4PHJA 2PSRA 1TOPA 2QDIA 3FE8A 1SL8A 4YGEB 1S6CA 1QASA 1RK9A 2H61A 1V1GA 1OOJA 1K9UA 1XK4A 1UHHA 2JXLA 2R2IA 2WCBA 2QEHA 1YX7A 1WY9A 3I5IC 3O2PA 4JPZB 4DCKA 5DKRA 2BL0B 4QJ5B 2MBXA 1YUTA 1FW4A 3CZ2A 3D74A 4XJKA 2K7BA 1KFUL 3R1VA 5D69A 3DD4A 2M0RA 4BY4A 1MF8B 1S26D 1IQ5A 1WRLA 1J55A 3FWBA 1GJYA 2KPHA 1HQVA 1H8BA 5ER4X 1TNWA 3BXKA 1A03A 2M1UA 2M1KB 3S0BA 1Z2CB 5CSNA 2Q91A 4U8DA 1YR5A 4C0KA 2BAPA 5KTYA 1G8IA 3SG2A 1CLBA 1DVIA 1B8CA 3AAJA 2JU0A 3KHEA 2F3YA 1X02A 4YI8A 4E68A 4L9MA
chains in the Genus database with same CATH topology
3NSKA 4OCIA 5I2QA 2E30A 1SRAA 1J1EA 1SCMC 3KEVA 3TS5B 2F33A 3IF7A 1J7OA 3KO0A 4TNCA 4GBAA 1NX0A 4YGDB 2PMYA 1RROA 1XFXO 3D10A 3DVEA 2LUCA 2IS9A 3LK1A 1LA0A 1XFWO 2PASA 2LE9B 1JUOA 2JPTA 4M2PA 5JOLA 1TCFA 1UHNA 3VRPA 1KQVA 1ZMZA 2K2AA 1QLKA 1LA3A 4ORCB 2M7LA 1CFCA 3I5HC 1MWNA 4WQ2A 3EKHA 1NPQA 4MLWA 1GQMA 1U5IA 2LVIA 1DJIA 4OKHA 1IH0A 1F70A 1KSMA 3DVJA 2H61C 3DVMA 1M46A 3OP0A 2F3ZA 1KCYA 2AUCA 1XK4C 1AVSA 1S5GY 4ICBA 3I5FC 4PE7A 1S3PA 2EC6B 4NDCA 1AK8A 3FWCA 5ER5A 1PSRA 1LKJA 2KBMA 1WDCC 2CXJA 2KYCA 1K95A 1AUIB 4MRYA 1CFFA 2JT0A 1CKKA 1F8HA 4YBHB 4GAOA 3WXAA 1N0YA 4I5KA 2NCOA 4A4BA 5JJGA 1NYAA 3TUYB 5KU1A 1K9PA 1TCOB 1ZUZA 1CLMA 2JWWA 2RGIA 2LANA 2KSPA 2LVVA 1N65A 1DF0B 1Q80A 2JOJA 4UPGA 2JZIA 2LHIA 1CDLA 4CPVA 1PSBA 2LNKA 2ZN9A 5I2OA 1OMDA 4A4CA 3ZNIA 1NCZA 4AQJA 5HYDA 4MBEA 1A2XA 2KQ6A 2WORA 4MEWA 1SL7A 4GFTA 5B8IB 1E8AA 4N5XA 1F4OA 3AKAA 4PHKA 1SW8A 2JNFA 4YGCB 1DTLA 1AJ4A 1M39A 2PALA 4GGFA 1DJWA 2SCPA 2ZKMX 1OSAA 1XFZO 4ORBB 1FPWA 4ETOA 1NCXA 2JXCA 3CR4X 2M29A 2HPSA 2G9BA 2NZ0A 3VROA 4M2OA 1IJ6A 1NP8A 1UP5A 2BECA 3IQOA 1UHJA 4DIRA 4MRXA 1PULA 2KAVA 4ZCVA 2MHHA 2KFGA 4NDDA 1BJFA 2KI4B 2Q4UA 1ODBA 1B47A 2BBMA 3GOFA 3I5GB 3QRXA 3TZ1A 1Y0VH 2K8MB 5AFPA 1XVJA 1K96A 3I5GC 2LLTA 1JSAA 2WC8A 3EVVA 3SG3A 3SG6A 3SG7A 1QV0A 1EG3A 2KGBC 1HT9A 2DOQA 4XYNA 3I5IB 3O6BA 1WLMA 3LK0A 1YVLA 2KYFA 1B8LA 1CM4A 3A4UB 1JC2A 4NDBA 2FCEA 1PALA 1S36A 2KOTA 1BT6A 3DF0A 2LAPA 2LLSA 3BOWB 4ORAB 3VRNA 3VRQA 1TNQA 4MZKA 3NXAA 2KAXA 2BBNA 4PHMA 5AEQA 1UWOA 1SL9A 1PVAA 2VRGA 2KFHA 2K2FA 1S6IA 3NSLA 1XO5A 2O5GA 3AKBA 3JVTB 3IQQA 3SIBA 3CLNA 4BY5A 3JVTC 3WNXB 3NSOA 2I2RE 1B9AA 1A75A 3PM8A 3RLZA 1YURA 2K61A 5PALA 1K8UA 1RJVA 3LL8B 1SCMB 4GGFC 3EK8A 2V53A 4HRGA 4DRWA 1IWQA 1RECA 1EXRA 1QJTA 4GUKA 1K9KA 5D7FA 3BYAA 2SASA 1MQ1A 1QV1A 1UUSA 3GK2A 4GNKB 1CB1A 2KAYA 3SJSA 1J7RA 1CMGA 2GGMA 1NCYA 1Y6WA 4AOMA 3I5HB 1AHRA 1DGVA 2JRFA 1BU3A 1JFKA 1S6JA 2LMTA 4C0LA 3MSEB 2CT9A 5DKNA 1G33A 1QXPA 2MLEC 4HRHA 4AQIA 1RTP1 1TTXA 2JNXA 2ZRTA 2NXQA 1XYDA 2G2BA 4PE1A 1AP4A 1H4BA 2D8NA 1W7JB 3LLEA 1QX5B 3CS1A 2AAOA 2WCFA 3EK7A 4HSZA 3I5FB 3DF0B 1KWOC 2WCEA 3NSIA 1AJ5A 4PCWA 4XJKB 2L2EA 1XFVO 1F55A 4MVFA 2JULA 2P6BB 1C07A 3SG4A 1WDCB 1S5GZ 1A29A 1KQMC 1J1DA 2KI6D 4OR9B 2F2OA 1NIWA 2GV5A 1BLQA 1KK8C 2F2PA 1SR6C 1KFXS 1W7IB 1A75B 2JTZA 1NWDA 3BUXB 4MZLA 2M8UA 1CDNA 1OE9B 1QS7A 4P5OE 2MLFC 1UHIA 2MA2A 1SNLA 1Y1UA 2Y5IA 1IG5A 5FYXA 1QIWA 3E3RA 3OB1B 3OHMB 3F45A 1BR1B 1M31A 2OPOA 4R1EA 5G08A 1OZSA 1WRKA 2OS8C 3PLFB 1NX1A 2LV7A 2PRUA 5HLVA 3ZWHA 1JF0A 3PN7C 3TDZA 4I5NB 2LM5A 1UHKA 4OVNF 1L2OC 1NX3A 1R6PA 1N2DA 3PATA 4YGAA 1TRFA 1CLLA 1NX2A 1YTZC 3EK4A 2OTGC 1BF5A 1U5IB 1DJXA 2LP2A 2L50A 1PRWA 1FF1A 2M9GA 1QIVA 1SCVA 2L4HA 1CDPA 2Y1MA 1GGWA 3BUMB 4I5JA 4FQOA 4GPLB 2K7OA 3O78A 1C7VA 4MZJA 2JT3A 3O4YA 2L51A 2LHLA 1EL4A 3OB2B 2MRDA 3RM1A 3JTDC 3KF9A 3FIAA 2CNPA 1DT7B 1MHOA 1YRTB 2LLUA 2CCMA 4PHNA 1FI6A 2ZFDA 2BCXA 2FCDA 1PK0D 2BE6A 1LVCD 1CDMA 4YGBB 2KGRA 2NCPA 2LP3A 5HKYA 3D0YA 1FBVA 1DJZA 1KSOA 2KFFA 2WNDA 4YRUA 4PALA 4CFRA 1R2UA 1XFYO 5AXIA 2LVJA 1IJ5A 2KQYA 2ZRSA 1CM1A 4QJ4B 1ZFSA 1ALWA 1RWYA 3DVKA 4CLNA 4P2YB 1IRJA 4USLA 1CNPA 5CSFA 2BKHB 2E6WA 1XA5A 1WLZA 2L5XB 2L4IA 3C1VA 2M7NA 2M3WA 4PE4A 1K90D 2COLB 2JT8A 1WRZA 2KI6C 1BG1A 1B4CA 1FI5A 2EHBA 1TNPA 4WQ3A 4DS7A 3VGOA 3EVUA 4ZCUA 3SIAA 1MR8A 1EJ3A 1EG4A 1C7WA 2BL0C 3A8RA 2KNEA 2I94A 2Y4QA 3LCPC 2I18A 3CTNA 4GGNA 5CPVA 5BPJA 1OMRA 2M97A 1IKUA 4PDZA 3BUOB 2PVBA 3TDUA 1NSHA 1Y1AA 1J7QA 2LUXA 2O60A 3CZTX 1VRKA 2I7AA 4D1EA 1BOCA 2LC5A 2HETA 1KK7Y 5HKZA 4F0ZB 1DJGA 4MSPA 3D0YB 5J3XA 4DUQA 2QACA 3WHTB 3GK4X 1DGUA 1F4QA 1KK7Z 2K0JA 1BMOA 1NUBA 1MUXA 2LVKA 2K7CA 5TNCA 1QX7A 2K7DA 1SK6D 1DJYA 1QX2A 3CR5X 1LINA 1DF0A 1KWOB 2BKIB 3TS5C 1F54A 3FS7A 1OMVA 3OX5A 2EGDA 1K93D 1ZACA 2ZN8A 1JWDA 1TN4A 5KSZA 1D1OA 2HQ8A 1KQMB 4JQ0D 1LXFC 1YX8A 3OX6A 2LCPA 1YUUA 1IQ3A 1EH2A 1J7PA 1BODA 1CFDA 1KK8B 1SR6B 2LMVA 3HX4A 4Q04A 3WHUB 4PE0A 4YI9A 1SMGA 1IGVA 2NLNA 2BCBA 2CTNA 4MN0A 3GK1A 3CGAA 2HF5A 4N1FA 1CMFA 3PFVA 4NQGA 2AMIA 3EVRA 2ZNDA 1SYMA 1OZOA 2JTTA 5AERA 2MAZA 2FOTA 1CFPA 2Y1NA 3BUWB 1K2HA 2BE4A 1CTRA 2MJWB 3M0WA 2OS8B 1TIZA 5CSJA 1PVBA 2EC6C 1ZOTB 3PN7B 3CR2A 1L2OB 2LMUA 4JWQA 1QTXA 1UURA 1Y1XA 2OTGB 1QATA 2L98A 1K94A 3KPXA 4M2QA 2WOSA 1GGZA 4OV2A 5K89A 3AAKA 4CIDA 1V1FA 3TUYC 2CBLA 4N1GA 1QVIY 4C0JA 1B1GA 5DKQA 2GGZA 3HCMA 1G4YR 2BCAA 2FJUB 2TN4A 3BOWA 1S1EA 3JTDB 4IL1A 5CSIA 1QVIZ 1TNXA 1RFJA 1KFUS 5HLOA 1SBJA 1MXLC 1SPYA 2QPTA 3K21A 2JQ6A 5AANA 4CFQA 1QLSA 2KBIA 3BQ3A 1YRUB 1JBAA 1F71A 1DMOA 1M45A 3SG5A 1B7TY 2ISDA 2KDHA 3BUNB 3CWGA 5I8NA 3PALA 1KFXL 1ALVA 4HREE 2M49B 2B1UA 4FTGA 1B7TZ 1JF2A 1YUSA 2F8PA 5I2LA 1BR4B 2KHNA 2JC2A 1YVHA 1SKTA 1SY9A 3PSRA 2ZNEA 1B8RA 1M63B 1XFUO 4WRIA 2L0PA 4QJ3B 1MXEA 2H2KA 3H4SE 3EKJA 5GQQC 1L7ZA 1OQPA 3VRRA 2A4JA 1JFJA 5HKWA 1A4PA 2KI4C 3TDIA 4I5LB 1DJHA 3ICBA 2HQWA 5F6TA 5IBWA 4PHJA 2PSRA 1TOPA 1SL8A 4YGEB 1S6CA 1QASA 1RK9A 2H61A 1V1GA 1OOJA 1K9UA 1XK4A 1UHHA 2JXLA 2R2IA 2WCBA 3I5IC 1YX7A 1WY9A 3O2PA 4JPZB 4DCKA 5DKRA 2BL0B 4QJ5B 2MBXA 1YUTA 1FW4A 4XJKA 2K7BA 1KFUL 5D69A 3DD4A 2M0RA 4BY4A 1MF8B 1S26D 1IQ5A 1J55A 1WRLA 3FWBA 1GJYA 1HQVA 1H8BA 5ER4X 1TNWA 3BXKA 1A03A 2M1UA 2M1KB 5CSNA 2Q91A 4U8DA 1YR5A 4C0KA 5KTYA 1G8IA 3SG2A 1CLBA 1DVIA 1B8CA 3AAJA 2JU0A 3KHEA 2F3YA 1X02A 4YI8A 4E68A 4L9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NSK A;  4OCI A;  5I2Q A;  2E30 A;  1SRA A;  1J1E A;  1SCM C;  3KEV A;  3TS5 B;  2F33 A;  3IF7 A;  1J7O A;  3KO0 A;  4TNC A;  4GBA A;  1NX0 A;  4YGD B;  2PMY A;  1RRO A;  1XFX O;  3D10 A;  3DVE A;  2LUC A;  2IS9 A;  3LK1 A;  1LA0 A;  1XFW O;  2PAS A;  2LE9 B;  1JUO A;  2JPT A;  4M2P A;  5JOL A;  1TCF A;  1UHN A;  3VRP A;  1KQV A;  1ZMZ A;  2K2A A;  1QLK A;  1LA3 A;  4ORC B;  2M7L A;  1CFC A;  3I5H C;  1MWN A;  4WQ2 A;  3EKH A;  1NPQ A;  4MLW A;  1GQM A;  1U5I A;  2LVI A;  1DJI A;  4OKH A;  1IH0 A;  1F70 A;  1KSM A;  3DVJ A;  2H61 C;  3DVM A;  1M46 A;  3OP0 A;  2F3Z A;  1KCY A;  2AUC A;  1XK4 C;  1AVS A;  1S5G Y;  4ICB A;  3I5F C;  4PE7 A;  1S3P A;  2EC6 B;  4NDC A;  1AK8 A;  3FWC A;  5ER5 A;  1PSR A;  1LKJ A;  2KBM A;  1WDC C;  2CXJ A;  2KYC A;  1K95 A;  1AUI B;  4MRY A;  1CFF A;  2JT0 A;  1CKK A;  1F8H A;  4YBH B;  4GAO A;  3WXA A;  1N0Y A;  4I5K A;  2NCO A;  4A4B A;  5JJG A;  1NYA A;  3TUY B;  5KU1 A;  1K9P A;  1TCO B;  1ZUZ A;  1CLM A;  2JWW A;  2RGI A;  2LAN A;  2KSP A;  2LVV A;  1N65 A;  1DF0 B;  1Q80 A;  2JOJ A;  4UPG A;  2JZI A;  2LHI A;  1CDL A;  4CPV A;  1PSB A;  2LNK A;  2ZN9 A;  5I2O A;  1OMD A;  4A4C A;  3ZNI A;  1NCZ A;  4AQJ A;  5HYD A;  4MBE A;  1A2X A;  2KQ6 A;  2WOR A;  4MEW A;  1SL7 A;  4GFT A;  5B8I B;  1E8A A;  4N5X A;  1F4O A;  3AKA A;  4PHK A;  1SW8 A;  2JNF A;  4YGC B;  1DTL A;  1AJ4 A;  1M39 A;  2PAL A;  4GGF A;  1DJW A;  2SCP A;  2ZKM X;  1OSA A;  1XFZ O;  4ORB B;  1FPW A;  4ETO A;  1NCX A;  2JXC A;  3CR4 X;  2M29 A;  2HPS A;  2G9B A;  2NZ0 A;  3VRO A;  4M2O A;  1IJ6 A;  1NP8 A;  1UP5 A;  2BEC A;  3IQO A;  1UHJ A;  4DIR A;  4MRX A;  1PUL A;  2KAV A;  4ZCV A;  2MHH A;  2KFG A;  4NDD A;  1BJF A;  2KI4 B;  2Q4U A;  1ODB A;  1B47 A;  2BBM A;  3GOF A;  3I5G B;  3QRX A;  3TZ1 A;  1Y0V H;  2K8M B;  5AFP A;  1XVJ A;  1K96 A;  3I5G C;  2LLT A;  1JSA A;  2WC8 A;  3EVV A;  3SG3 A;  3SG6 A;  3SG7 A;  1QV0 A;  1EG3 A;  2KGB C;  1HT9 A;  2DOQ A;  4XYN A;  3I5I B;  3O6B A;  1WLM A;  3LK0 A;  1YVL A;  2KYF A;  1B8L A;  1CM4 A;  3A4U B;  1JC2 A;  4NDB A;  2FCE A;  1PAL A;  1S36 A;  2KOT A;  1BT6 A;  3DF0 A;  2LAP A;  2LLS A;  3BOW B;  4ORA B;  3VRN A;  3VRQ A;  1TNQ A;  4MZK A;  3NXA A;  2KAX A;  2BBN A;  4PHM A;  5AEQ A;  1UWO A;  1SL9 A;  1PVA A;  2VRG A;  2KFH A;  2K2F A;  1S6I A;  3NSL A;  1XO5 A;  2O5G A;  3AKB A;  3JVT B;  3IQQ A;  3SIB A;  3CLN A;  4BY5 A;  3JVT C;  3WNX B;  3NSO A;  2I2R E;  1B9A A;  1A75 A;  3PM8 A;  3RLZ A;  1YUR A;  2K61 A;  5PAL A;  1K8U A;  1RJV A;  3LL8 B;  1SCM B;  4GGF C;  3EK8 A;  2V53 A;  4HRG A;  4DRW A;  1IWQ A;  1REC A;  1EXR A;  1QJT A;  4GUK A;  1K9K A;  5D7F A;  3BYA A;  2SAS A;  1MQ1 A;  1QV1 A;  1UUS A;  3GK2 A;  4GNK B;  1CB1 A;  2KAY A;  3SJS A;  1J7R A;  1CMG A;  2GGM A;  1NCY A;  1Y6W A;  4AOM A;  3I5H B;  1AHR A;  1DGV A;  2JRF A;  1BU3 A;  1JFK A;  1S6J A;  2LMT A;  4C0L A;  3MSE B;  2CT9 A;  5DKN A;  1G33 A;  1QXP A;  2MLE C;  4HRH A;  4AQI A;  1RTP 1;  1TTX A;  2JNX A;  2ZRT A;  2NXQ A;  1XYD A;  2G2B A;  4PE1 A;  1AP4 A;  1H4B A;  2D8N A;  1W7J B;  3LLE A;  1QX5 B;  3CS1 A;  2AAO A;  2WCF A;  3EK7 A;  4HSZ A;  3I5F B;  3DF0 B;  1KWO C;  2WCE A;  3NSI A;  1AJ5 A;  4PCW A;  4XJK B;  2L2E A;  1XFV O;  1F55 A;  4MVF A;  2JUL A;  2P6B B;  1C07 A;  3SG4 A;  1WDC B;  1S5G Z;  1A29 A;  1KQM C;  1J1D A;  2KI6 D;  4OR9 B;  2F2O A;  1NIW A;  2GV5 A;  1BLQ A;  1KK8 C;  2F2P A;  1SR6 C;  1KFX S;  1W7I B;  1A75 B;  2JTZ A;  1NWD A;  3BUX B;  4MZL A;  2M8U A;  1CDN A;  1OE9 B;  1QS7 A;  4P5O E;  2MLF C;  1UHI A;  2MA2 A;  1SNL A;  1Y1U A;  2Y5I A;  1IG5 A;  5FYX A;  1QIW A;  3E3R A;  3OB1 B;  3OHM B;  3F45 A;  1BR1 B;  1M31 A;  2OPO A;  4R1E A;  5G08 A;  1OZS A;  1WRK A;  2OS8 C;  3PLF B;  1NX1 A;  2LV7 A;  2PRU A;  5HLV A;  3ZWH A;  1JF0 A;  3PN7 C;  3TDZ A;  4I5N B;  2LM5 A;  1UHK A;  4OVN F;  1L2O C;  1NX3 A;  1R6P A;  1N2D A;  3PAT A;  4YGA A;  1TRF A;  1CLL A;  1NX2 A;  1YTZ C;  3EK4 A;  2OTG C;  1BF5 A;  1U5I B;  1DJX A;  2LP2 A;  2L50 A;  1PRW A;  1FF1 A;  2M9G A;  1QIV A;  1SCV A;  2L4H A;  1CDP A;  2Y1M A;  1GGW A;  3BUM B;  4I5J A;  4FQO A;  4GPL B;  2K7O A;  3O78 A;  1C7V A;  4MZJ A;  2JT3 A;  3O4Y A;  2L51 A;  2LHL A;  1EL4 A;  3OB2 B;  2MRD A;  3RM1 A;  3JTD C;  3KF9 A;  3FIA A;  2CNP A;  1DT7 B;  1MHO A;  1YRT B;  2LLU A;  2CCM A;  4PHN A;  1FI6 A;  2ZFD A;  2BCX A;  2FCD A;  1PK0 D;  2BE6 A;  1LVC D;  1CDM A;  4YGB B;  2KGR A;  2NCP A;  2LP3 A;  5HKY A;  3D0Y A;  1FBV A;  1DJZ A;  1KSO A;  2KFF A;  2WND A;  4YRU A;  4PAL A;  4CFR A;  1R2U A;  1XFY O;  5AXI A;  2LVJ A;  1IJ5 A;  2KQY A;  2ZRS A;  1CM1 A;  4QJ4 B;  1ZFS A;  1ALW A;  1RWY A;  3DVK A;  4CLN A;  4P2Y B;  1IRJ A;  4USL A;  1CNP A;  5CSF A;  2BKH B;  2E6W A;  1XA5 A;  1WLZ A;  2L5X B;  2L4I A;  3C1V A;  2M7N A;  2M3W A;  4PE4 A;  1K90 D;  2COL B;  2JT8 A;  1WRZ A;  2KI6 C;  1BG1 A;  1B4C A;  1FI5 A;  2EHB A;  1TNP A;  4WQ3 A;  4DS7 A;  3VGO A;  3EVU A;  4ZCU A;  3SIA A;  1MR8 A;  1EJ3 A;  1EG4 A;  1C7W A;  2BL0 C;  3A8R A;  2KNE A;  2I94 A;  2Y4Q A;  3LCP C;  2I18 A;  3CTN A;  4GGN A;  5CPV A;  5BPJ A;  1OMR A;  2M97 A;  1IKU A;  4PDZ A;  3BUO B;  2PVB A;  3TDU A;  1NSH A;  1Y1A A;  1J7Q A;  2LUX A;  2O60 A;  3CZT X;  1VRK A;  2I7A A;  4D1E A;  1BOC A;  2LC5 A;  2HET A;  1KK7 Y;  5HKZ A;  4F0Z B;  1DJG A;  4MSP A;  3D0Y B;  5J3X A;  4DUQ A;  2QAC A;  3WHT B;  3GK4 X;  1DGU A;  1F4Q A;  1KK7 Z;  2K0J A;  1BMO A;  1NUB A;  1MUX A;  2LVK A;  2K7C A;  5TNC A;  1QX7 A;  2K7D A;  1SK6 D;  1DJY A;  1QX2 A;  3CR5 X;  1LIN A;  1DF0 A;  1KWO B;  2BKI B;  3TS5 C;  1F54 A;  3FS7 A;  1OMV A;  3OX5 A;  2EGD A;  1K93 D;  1ZAC A;  2ZN8 A;  1JWD A;  1TN4 A;  5KSZ A;  1D1O A;  2HQ8 A;  1KQM B;  4JQ0 D;  1LXF C;  1YX8 A;  3OX6 A;  2LCP A;  1YUU A;  1IQ3 A;  1EH2 A;  1J7P A;  1BOD A;  1CFD A;  1KK8 B;  1SR6 B;  2LMV A;  3HX4 A;  4Q04 A;  3WHU B;  4PE0 A;  4YI9 A;  1SMG A;  1IGV A;  2NLN A;  2BCB A;  2CTN A;  4MN0 A;  3GK1 A;  3CGA A;  2HF5 A;  4N1F A;  1CMF A;  3PFV A;  4NQG A;  2AMI A;  3EVR A;  2ZND A;  1SYM A;  1OZO A;  2JTT A;  5AER A;  2MAZ A;  2FOT A;  1CFP A;  2Y1N A;  3BUW B;  1K2H A;  2BE4 A;  1CTR A;  2MJW B;  3M0W A;  2OS8 B;  1TIZ A;  5CSJ A;  1PVB A;  2EC6 C;  1ZOT B;  3PN7 B;  3CR2 A;  1L2O B;  2LMU A;  4JWQ A;  1QTX A;  1UUR A;  1Y1X A;  2OTG B;  1QAT A;  2L98 A;  1K94 A;  3KPX A;  4M2Q A;  2WOS A;  1GGZ A;  4OV2 A;  5K89 A;  3AAK A;  4CID A;  1V1F A;  3TUY C;  2CBL A;  4N1G A;  1QVI Y;  4C0J A;  1B1G A;  5DKQ A;  2GGZ A;  3HCM A;  1G4Y R;  2BCA A;  2FJU B;  2TN4 A;  3BOW A;  1S1E A;  3JTD B;  4IL1 A;  5CSI A;  1QVI Z;  1TNX A;  1RFJ A;  1KFU S;  5HLO A;  1SBJ A;  1MXL C;  1SPY A;  2QPT A;  3K21 A;  2JQ6 A;  5AAN A;  4CFQ A;  1QLS A;  2KBI A;  3BQ3 A;  1YRU B;  1JBA A;  1F71 A;  1DMO A;  1M45 A;  3SG5 A;  1B7T Y;  2ISD A;  2KDH A;  3BUN B;  3CWG A;  5I8N A;  3PAL A;  1KFX L;  1ALV A;  4HRE E;  2M49 B;  2B1U A;  4FTG A;  1B7T Z;  1JF2 A;  1YUS A;  2F8P A;  5I2L A;  1BR4 B;  2KHN A;  2JC2 A;  1YVH A;  1SKT A;  1SY9 A;  3PSR A;  2ZNE A;  1B8R A;  1M63 B;  1XFU O;  4WRI A;  2L0P A;  4QJ3 B;  1MXE A;  2H2K A;  3H4S E;  3EKJ A;  5GQQ C;  1L7Z A;  1OQP A;  3VRR A;  2A4J A;  1JFJ A;  5HKW A;  1A4P A;  2KI4 C;  3TDI A;  4I5L B;  1DJH A;  3ICB A;  2HQW A;  5F6T A;  5IBW A;  4PHJ A;  2PSR A;  1TOP A;  1SL8 A;  4YGE B;  1S6C A;  1QAS A;  1RK9 A;  2H61 A;  1V1G A;  1OOJ A;  1K9U A;  1XK4 A;  1UHH A;  2JXL A;  2R2I A;  2WCB A;  3I5I C;  1YX7 A;  1WY9 A;  3O2P A;  4JPZ B;  4DCK A;  5DKR A;  2BL0 B;  4QJ5 B;  2MBX A;  1YUT A;  1FW4 A;  4XJK A;  2K7B A;  1KFU L;  5D69 A;  3DD4 A;  2M0R A;  4BY4 A;  1MF8 B;  1S26 D;  1IQ5 A;  1J55 A;  1WRL A;  3FWB A;  1GJY A;  1HQV A;  1H8B A;  5ER4 X;  1TNW A;  3BXK A;  1A03 A;  2M1U A;  2M1K B;  5CSN A;  2Q91 A;  4U8D A;  1YR5 A;  4C0K A;  5KTY A;  1G8I A;  3SG2 A;  1CLB A;  1DVI A;  1B8C A;  3AAJ A;  2JU0 A;  3KHE A;  2F3Y A;  1X02 A;  4YI8 A;  4E68 A;  4L9M A; 
#chains in the Genus database with same CATH topology
 4FQT A;  1P28 A;  3NSK A;  4INW A;  4OCI A;  5I2Q A;  2E30 A;  1SRA A;  1J1E A;  1SCM C;  3KEV A;  3TS5 B;  2F33 A;  3IF7 A;  1J7O A;  3KO0 A;  4TNC A;  4GBA A;  1NX0 A;  4YGD B;  2PMY A;  1RRO A;  1XFX O;  3D10 A;  3DVE A;  2LUC A;  3S0A A;  2IS9 A;  3LK1 A;  1LA0 A;  1XFW O;  2PAS A;  2LE9 B;  1JUO A;  2JPT A;  4M2P A;  3SS3 A;  5JOL A;  3CYZ A;  1TCF A;  1UHN A;  3VRP A;  1KQV A;  1ZMZ A;  2K2A A;  1QLK A;  2QEV A;  1LA3 A;  2WC6 A;  4ORC B;  2M7L A;  1CFC A;  3I5H C;  1MWN A;  1TUZ A;  4WQ2 A;  3EKH A;  1NPQ A;  4MLW A;  1GQM A;  1U5I A;  2LVI A;  1DJI A;  4OKH A;  3FE6 A;  1IH0 A;  2FJY A;  1F70 A;  1KSM A;  3B6X A;  3DVJ A;  2H61 C;  1C3Z A;  2JPO A;  3DVM A;  3L47 A;  1M46 A;  3OP0 A;  2F3Z A;  1KCY A;  2AUC A;  1XK4 C;  4KYN A;  1AVS A;  1S5G Y;  4ICB A;  3I5F C;  4PE7 A;  1S3P A;  2EC6 B;  4NDC A;  1AK8 A;  3FWC A;  5ER5 A;  1PSR A;  1LKJ A;  2KBM A;  1WDC C;  2CXJ A;  2KYC A;  5EL2 A;  1K95 A;  1AUI B;  4MRY A;  1CFF A;  2JT0 A;  1CKK A;  1F8H A;  4YBH B;  2WCJ A;  4GAO A;  3WXA A;  1N0Y A;  4I5K A;  2NCO A;  4A4B A;  1OOH A;  5I94 A;  5JJG A;  1NYA A;  1DEK A;  3TUY B;  5KU1 A;  1K9P A;  1TCO B;  3S0E A;  1ZUZ A;  1CLM A;  2JWW A;  2RGI A;  2LAN A;  2KSP A;  3CAB A;  2LVV A;  3L4A A;  1N65 A;  1DF0 B;  1Q80 A;  3NGV A;  2JOJ A;  2WCH A;  4UPG A;  2JZI A;  2LHI A;  1CDL A;  4CPV A;  1PSB A;  2LNK A;  2ZN9 A;  5I2O A;  1OMD A;  4A4C A;  3ZNI A;  1NCZ A;  4AQJ A;  5HYD A;  4MBE A;  1A2X A;  2KQ6 A;  2WOR A;  3IVT A;  4MEW A;  1SL7 A;  4GFT A;  5B8I B;  1E8A A;  4N5X A;  1F4O A;  3AKA A;  4PHK A;  1SW8 A;  2JNF A;  4YGC B;  1DTL A;  1AJ4 A;  1M39 A;  2PAL A;  4GGF A;  1DJW A;  2SCP A;  2ZKM X;  1OSA A;  1XFZ O;  4JD9 A;  4ORB B;  1FPW A;  4ETO A;  1NCX A;  2JXC A;  3CR4 X;  5FI6 A;  3SS4 A;  2M29 A;  2HPS A;  2QEB A;  3D78 A;  2G9B A;  2NZ0 A;  3VRO A;  4M2O A;  1IJ6 A;  1NP8 A;  1UP5 A;  2BEC A;  2PQL A;  1UHJ A;  3IQO A;  3NHI A;  4DIR A;  4MRX A;  1PUL A;  2KAV A;  2L5Y A;  4ZCV A;  2MHH A;  2KFG A;  4NDD A;  1BJF A;  2KLD A;  2KI4 B;  1ODB A;  2BNX A;  1B47 A;  2BBM A;  2Q4U A;  3GOF A;  3I5G B;  3QRX A;  3TZ1 A;  1Y0V H;  5DIC A;  2K8M B;  5AFP A;  1XVJ A;  1K96 A;  3I5G C;  2LLT A;  1JSA A;  3S0F A;  2WC8 A;  3EVV A;  3SG3 A;  3SG6 A;  3SG7 A;  2KLE A;  1QV0 A;  1EG3 A;  2KGB C;  1C3Y A;  2WC5 A;  1HT9 A;  2DOQ A;  4XYN A;  3I5I B;  3O6B A;  1WLM A;  2P71 A;  3LK0 A;  3DY9 A;  1YVL A;  2KYF A;  1TUJ A;  4JKT A;  5FI2 A;  1B8L A;  1CM4 A;  3A4U B;  2PYQ A;  1JC2 A;  4NDB A;  2FCE A;  1PAL A;  1S36 A;  2KOT A;  2L2C A;  1BT6 A;  3DF0 A;  2LAP A;  2LLS A;  3BOW B;  4ORA B;  3VRN A;  3VRQ A;  1TNQ A;  4MZK A;  3NXA A;  2KAX A;  2BBN A;  4PHM A;  5AEQ A;  1UWO A;  1SL9 A;  1PVA A;  2VRG A;  1OW4 A;  2K2F A;  2KFH A;  1S6I A;  3NSL A;  1XO5 A;  2O5G A;  3AKB A;  3JVT B;  3IQQ A;  3SIB A;  3CLN A;  1T14 A;  4BY5 A;  3DXL A;  3JVT C;  3Q8I A;  3WNX B;  4PT1 A;  3NSO A;  3RZS A;  2I2R E;  1B9A A;  1A75 A;  3PM8 A;  3RLZ A;  3OBV A;  1YUR A;  2K61 A;  5PAL A;  1K8U A;  1RJV A;  3LL8 B;  1SCM B;  4GGF C;  3EK8 A;  2V53 A;  4HRG A;  4DRW A;  4INX A;  5HL1 A;  3L4L A;  1IWQ A;  1REC A;  1EXR A;  1QJT A;  4GUK A;  1K9K A;  5D7F A;  3BYA A;  2SAS A;  1MQ1 A;  1QV1 A;  3PJI A;  1UUS A;  3GK2 A;  4GNK B;  1CB1 A;  2KAY A;  3SJS A;  1OOI X;  1J7R A;  1Z4H A;  1CMG A;  2GGM A;  1NCY A;  1Y6W A;  4AOM A;  3I5H B;  1AHR A;  1DGV A;  2JRF A;  1BU3 A;  1JFK A;  1S6J A;  2LMT A;  4C0L A;  1GM0 A;  3OGN A;  3MSE B;  2CT9 A;  5DKN A;  1G33 A;  1QXP A;  2GTE A;  2MLE C;  4HRH A;  4AQI A;  1RTP 1;  1TTX A;  2JNX A;  2ZRT A;  2NXQ A;  1XYD A;  2G2B A;  4PE1 A;  1AP4 A;  3V2L A;  1H4B A;  2D8N A;  1W7J B;  3LLE A;  1QX5 B;  3CS1 A;  2AAO A;  2WCF A;  3EK7 A;  4HSZ A;  3I5F B;  3DF0 B;  1KWO C;  2WCE A;  3NSI A;  1AJ5 A;  4PCW A;  4XJK B;  2L2E A;  1XFV O;  1F55 A;  1DEL A;  4MVF A;  2JUL A;  2P6B B;  1XFR A;  1C07 A;  3SG4 A;  1WDC B;  1S5G Z;  1A29 A;  1KQM C;  1J1D A;  4OZD A;  2KI6 D;  4OR9 B;  2F2O A;  1NIW A;  2GV5 A;  1BLQ A;  1KK8 C;  2F2P A;  1SR6 C;  1KFX S;  1W7I B;  1A75 B;  2JTZ A;  3DYE A;  1NWD A;  3BUX B;  4MZL A;  2M8U A;  1CDN A;  1OE9 B;  1QS7 A;  4P5O E;  2MLF C;  1UHI A;  2MA2 A;  1SNL A;  1Y1U A;  2Y5I A;  1IG5 A;  5FYX A;  1QIW A;  3E3R A;  3OB1 B;  1DQE A;  3OHM B;  3F45 A;  2H8V A;  1BR1 B;  1M31 A;  2OPO A;  1W9Z A;  1OOG A;  1OZS A;  1WRK A;  4R1E A;  5G08 A;  2OS8 C;  3PLF B;  3UNW A;  2WCK A;  1NX1 A;  2LV7 A;  2PRU A;  1QWV A;  5HLV A;  3ZWH A;  1JF0 A;  3PN7 C;  3TDZ A;  4I5N B;  2LM5 A;  1UHK A;  4OVN F;  1L2O C;  1NX3 A;  1R6P A;  1N2D A;  3PAT A;  4YGA A;  1TRF A;  1CLL A;  1NX2 A;  1YTZ C;  3EK4 A;  2OTG C;  1BF5 A;  1U5I B;  1DJX A;  3CZ1 A;  1OOF A;  1TWO A;  2L50 A;  1PRW A;  2LP2 A;  1FF1 A;  2M9G A;  1QIV A;  2QEO A;  1SCV A;  2L4H A;  1CDP A;  2Y1M A;  3R72 A;  3BUM B;  4I5J A;  1GGW A;  4FQO A;  3R1P A;  1DC1 A;  4GPL B;  2K7O A;  3O78 A;  3DZT A;  1C7V A;  4MZJ A;  2JT3 A;  3O4Y A;  3B86 A;  2L51 A;  2LHL A;  3BFB A;  1EL4 A;  3OB2 B;  2MRD A;  3RM1 A;  3JTD C;  3KF9 A;  3FIA A;  2CNP A;  1DT7 B;  1MHO A;  1YRT B;  2LLU A;  2CCM A;  4PHN A;  1FI6 A;  2ZFD A;  2BCX A;  2FCD A;  5FI7 A;  1PK0 D;  2BE6 A;  1LVC D;  1CDM A;  4YGB B;  2KGR A;  2NCP A;  2LP3 A;  5HKY A;  3D0Y A;  3R1O A;  4IJ7 A;  1FBV A;  1DJZ A;  1KSO A;  2KFF A;  2WND A;  1SSE B;  4F7F A;  4YRU A;  4PAL A;  4CFR A;  1R2U A;  3BFH A;  1XFY O;  5AXI A;  2LVJ A;  1IJ5 A;  3PM2 A;  2K60 A;  2KQY A;  2ZRS A;  1CM1 A;  4QJ4 B;  1ZFS A;  1ALW A;  3QME A;  1RWY A;  3DVK A;  4CLN A;  4P2Y B;  1ORG A;  1IRJ A;  4USL A;  1CNP A;  5CSF A;  2BKH B;  2E6W A;  1XA5 A;  2YGU A;  1WLZ A;  2L5X B;  2L4I A;  3C1V A;  2M7N A;  2M3W A;  4PE4 A;  1K90 D;  2COL B;  2JT8 A;  1WRZ A;  2KI6 C;  1BG1 A;  1B4C A;  1FI5 A;  2EHB A;  1TNP A;  4WQ3 A;  4DS7 A;  3VGO A;  3EVU A;  4ZCU A;  3SIA A;  1MR8 A;  1EJ3 A;  1EG4 A;  1C7W A;  2BL0 C;  3A8R A;  2KNE A;  2I94 A;  2Y4Q A;  3D76 A;  3LCP C;  2I18 A;  3CTN A;  4GGN A;  5CPV A;  5BPJ A;  1OMR A;  2M97 A;  1IKU A;  4PDZ A;  3BUO B;  2PVB A;  3TDU A;  1NSH A;  1Y1A A;  1J7Q A;  2LUX A;  2O60 A;  2ERB A;  3CZT X;  5D3O A;  1VRK A;  2I7A A;  4D1E A;  2P70 A;  1BOC A;  2LC5 A;  2HET A;  1KK7 Y;  5HKZ A;  4F0Z B;  1DJG A;  4MSP A;  3D0Y B;  5J3X A;  4DUQ A;  2QAC A;  3FE9 A;  3GK4 X;  1DGU A;  3WHT B;  1F4Q A;  1KK7 Z;  2K0J A;  1BMO A;  1NUB A;  1MUX A;  2LVK A;  2K7C A;  5TNC A;  1QX7 A;  2K7D A;  3BJH A;  1SK6 D;  1DJY A;  1QX2 A;  3CR5 X;  1LIN A;  1DF0 A;  1KWO B;  2BKI B;  3TS5 C;  1F54 A;  3FS7 A;  1OMV A;  3OX5 A;  3S0G A;  3UO9 A;  2EGD A;  1K93 D;  1ZAC A;  2ZN8 A;  1JWD A;  1TN4 A;  5KSZ A;  1D1O A;  2HQ8 A;  1KQM B;  3BFA A;  4JQ0 D;  1LXF C;  1YX8 A;  3OX6 A;  2LCP A;  1YUU A;  3CZ0 A;  1IQ3 A;  1EH2 A;  1J7P A;  1BOD A;  1CFD A;  1KK8 B;  1SR6 B;  2LMV A;  3HX4 A;  4Q04 A;  3WHU B;  4PE0 A;  4YI9 A;  1SMG A;  1IGV A;  2NLN A;  3SS5 A;  2BCB A;  2CTN A;  3D77 A;  3GK1 A;  3CGA A;  2HF5 A;  4MN0 A;  4N1F A;  1CMF A;  3PFV A;  4NQG A;  2AMI A;  3EVR A;  2ZND A;  1SYM A;  1OZO A;  2JTT A;  3O4X A;  5AER A;  2MAZ A;  3K1E A;  2FOT A;  1CFP A;  2Y1N A;  3BUW B;  1K2H A;  2BE4 A;  1CTR A;  2MJW B;  3M0W A;  2OS8 B;  1TIZ A;  3CDN A;  2WCM A;  5CSJ A;  3S0D A;  1PVB A;  2EC6 C;  3NHT A;  1ZOT B;  3PN7 B;  3CR2 A;  1L2O B;  2LMU A;  4JWQ A;  1QTX A;  2WCL A;  1UUR A;  1Y1X A;  2OTG B;  1QAT A;  2L98 A;  1K94 A;  3KPX A;  4M2Q A;  2WOS A;  1LS8 A;  3N7H A;  1GGZ A;  4OV2 A;  5K89 A;  3AAK A;  4CID A;  1V1F A;  3TUY C;  3B7A A;  2CBL A;  4N1G A;  1QVI Y;  4C0J A;  1B1G A;  5DKQ A;  2GGZ A;  3HCM A;  1G4Y R;  2BCA A;  2FJU B;  2TN4 A;  3BOW A;  1S1E A;  3JTD B;  4IL1 A;  5CSI A;  1QVI Z;  1TNX A;  1RFJ A;  1KFU S;  5HLO A;  1SBJ A;  1MXL C;  1SPY A;  2QPT A;  3K21 A;  2JQ6 A;  5AAN A;  4CFQ A;  1QLS A;  2KBI A;  3BQ3 A;  1YRU B;  1JBA A;  1F71 A;  1DMO A;  1M45 A;  3SG5 A;  1B7T Y;  3EG5 B;  2KDH A;  3BUN B;  3CWG A;  2ISD A;  3VB1 A;  3PAL A;  5I8N A;  1KFX L;  1ALV A;  4HRE E;  2M49 B;  2B1U A;  4FTG A;  1B7T Z;  1JF2 A;  1YUS A;  2F8P A;  5I2L A;  1BR4 B;  2KHN A;  3B87 A;  3B88 A;  2JC2 A;  3D73 A;  1YVH A;  1SKT A;  1SY9 A;  3PSR A;  2ZNE A;  1IIO A;  1B8R A;  1M63 B;  1XFU O;  4WRI A;  2L0P A;  4QJ3 B;  1MXE A;  2H2K A;  3H4S E;  3EKJ A;  5GQQ C;  1L7Z A;  1OQP A;  3VRR A;  2A4J A;  1JFJ A;  5HKW A;  1A4P A;  2KI4 C;  3TDI A;  4I5L B;  1DJH A;  3ICB A;  3D75 A;  2HQW A;  5F6T A;  5IBW A;  4PHJ A;  2PSR A;  1TOP A;  2QDI A;  3FE8 A;  1SL8 A;  4YGE B;  1S6C A;  1QAS A;  1RK9 A;  2H61 A;  1V1G A;  1OOJ A;  1K9U A;  1XK4 A;  1UHH A;  2JXL A;  2R2I A;  2WCB A;  2QEH A;  1YX7 A;  1WY9 A;  3I5I C;  3O2P A;  4JPZ B;  4DCK A;  5DKR A;  2BL0 B;  4QJ5 B;  2MBX A;  1YUT A;  1FW4 A;  3CZ2 A;  3D74 A;  4XJK A;  2K7B A;  1KFU L;  3R1V A;  5D69 A;  3DD4 A;  2M0R A;  4BY4 A;  1MF8 B;  1S26 D;  1IQ5 A;  1WRL A;  1J55 A;  3FWB A;  1GJY A;  2KPH A;  1HQV A;  1H8B A;  5ER4 X;  1TNW A;  3BXK A;  1A03 A;  2M1U A;  2M1K B;  3S0B A;  1Z2C B;  5CSN A;  2Q91 A;  4U8D A;  1YR5 A;  4C0K A;  2BAP A;  5KTY A;  1G8I A;  3SG2 A;  1CLB A;  1DVI A;  1B8C A;  3AAJ A;  2JU0 A;  3KHE A;  2F3Y A;  1X02 A;  4YI8 A;  4E68 A;  4L9M A; 
#chains in the Genus database with same CATH homology
 3NSK A;  4OCI A;  5I2Q A;  2E30 A;  1SRA A;  1J1E A;  1SCM C;  3KEV A;  3TS5 B;  2F33 A;  3IF7 A;  1J7O A;  3KO0 A;  4TNC A;  4GBA A;  1NX0 A;  4YGD B;  2PMY A;  1RRO A;  1XFX O;  3D10 A;  3DVE A;  2LUC A;  2IS9 A;  3LK1 A;  1LA0 A;  1XFW O;  2PAS A;  2LE9 B;  1JUO A;  2JPT A;  4M2P A;  5JOL A;  1TCF A;  1UHN A;  3VRP A;  1KQV A;  1ZMZ A;  2K2A A;  1QLK A;  1LA3 A;  4ORC B;  2M7L A;  1CFC A;  3I5H C;  1MWN A;  4WQ2 A;  3EKH A;  1NPQ A;  4MLW A;  1GQM A;  1U5I A;  2LVI A;  1DJI A;  4OKH A;  1IH0 A;  1F70 A;  1KSM A;  3DVJ A;  2H61 C;  3DVM A;  1M46 A;  3OP0 A;  2F3Z A;  1KCY A;  2AUC A;  1XK4 C;  1AVS A;  1S5G Y;  4ICB A;  3I5F C;  4PE7 A;  1S3P A;  2EC6 B;  4NDC A;  1AK8 A;  3FWC A;  5ER5 A;  1PSR A;  1LKJ A;  2KBM A;  1WDC C;  2CXJ A;  2KYC A;  1K95 A;  1AUI B;  4MRY A;  1CFF A;  2JT0 A;  1CKK A;  1F8H A;  4YBH B;  4GAO A;  3WXA A;  1N0Y A;  4I5K A;  2NCO A;  4A4B A;  5JJG A;  1NYA A;  3TUY B;  5KU1 A;  1K9P A;  1TCO B;  1ZUZ A;  1CLM A;  2JWW A;  2RGI A;  2LAN A;  2KSP A;  2LVV A;  1N65 A;  1DF0 B;  1Q80 A;  2JOJ A;  4UPG A;  2JZI A;  2LHI A;  1CDL A;  4CPV A;  1PSB A;  2LNK A;  2ZN9 A;  5I2O A;  1OMD A;  4A4C A;  3ZNI A;  1NCZ A;  4AQJ A;  5HYD A;  4MBE A;  1A2X A;  2KQ6 A;  2WOR A;  4MEW A;  1SL7 A;  4GFT A;  5B8I B;  1E8A A;  4N5X A;  1F4O A;  3AKA A;  4PHK A;  1SW8 A;  2JNF A;  4YGC B;  1DTL A;  1AJ4 A;  1M39 A;  2PAL A;  4GGF A;  1DJW A;  2SCP A;  2ZKM X;  1OSA A;  1XFZ O;  4ORB B;  1FPW A;  4ETO A;  1NCX A;  2JXC A;  3CR4 X;  2M29 A;  2HPS A;  2G9B A;  2NZ0 A;  3VRO A;  4M2O A;  1IJ6 A;  1NP8 A;  1UP5 A;  2BEC A;  3IQO A;  1UHJ A;  4DIR A;  4MRX A;  1PUL A;  2KAV A;  4ZCV A;  2MHH A;  2KFG A;  4NDD A;  1BJF A;  2KI4 B;  2Q4U A;  1ODB A;  1B47 A;  2BBM A;  3GOF A;  3I5G B;  3QRX A;  3TZ1 A;  1Y0V H;  2K8M B;  5AFP A;  1XVJ A;  1K96 A;  3I5G C;  2LLT A;  1JSA A;  2WC8 A;  3EVV A;  3SG3 A;  3SG6 A;  3SG7 A;  1QV0 A;  1EG3 A;  2KGB C;  1HT9 A;  2DOQ A;  4XYN A;  3I5I B;  3O6B A;  1WLM A;  3LK0 A;  1YVL A;  2KYF A;  1B8L A;  1CM4 A;  3A4U B;  1JC2 A;  4NDB A;  2FCE A;  1PAL A;  1S36 A;  2KOT A;  1BT6 A;  3DF0 A;  2LAP A;  2LLS A;  3BOW B;  4ORA B;  3VRN A;  3VRQ A;  1TNQ A;  4MZK A;  3NXA A;  2KAX A;  2BBN A;  4PHM A;  5AEQ A;  1UWO A;  1SL9 A;  1PVA A;  2VRG A;  2KFH A;  2K2F A;  1S6I A;  3NSL A;  1XO5 A;  2O5G A;  3AKB A;  3JVT B;  3IQQ A;  3SIB A;  3CLN A;  4BY5 A;  3JVT C;  3WNX B;  3NSO A;  2I2R E;  1B9A A;  1A75 A;  3PM8 A;  3RLZ A;  1YUR A;  2K61 A;  5PAL A;  1K8U A;  1RJV A;  3LL8 B;  1SCM B;  4GGF C;  3EK8 A;  2V53 A;  4HRG A;  4DRW A;  1IWQ A;  1REC A;  1EXR A;  1QJT A;  4GUK A;  1K9K A;  5D7F A;  3BYA A;  2SAS A;  1MQ1 A;  1QV1 A;  1UUS A;  3GK2 A;  4GNK B;  1CB1 A;  2KAY A;  3SJS A;  1J7R A;  1CMG A;  2GGM A;  1NCY A;  1Y6W A;  4AOM A;  3I5H B;  1AHR A;  1DGV A;  2JRF A;  1BU3 A;  1JFK A;  1S6J A;  2LMT A;  4C0L A;  3MSE B;  2CT9 A;  5DKN A;  1G33 A;  1QXP A;  2MLE C;  4HRH A;  4AQI A;  1RTP 1;  1TTX A;  2JNX A;  2ZRT A;  2NXQ A;  1XYD A;  2G2B A;  4PE1 A;  1AP4 A;  1H4B A;  2D8N A;  1W7J B;  3LLE A;  1QX5 B;  3CS1 A;  2AAO A;  2WCF A;  3EK7 A;  4HSZ A;  3I5F B;  3DF0 B;  1KWO C;  2WCE A;  3NSI A;  1AJ5 A;  4PCW A;  4XJK B;  2L2E A;  1XFV O;  1F55 A;  4MVF A;  2JUL A;  2P6B B;  1C07 A;  3SG4 A;  1WDC B;  1S5G Z;  1A29 A;  1KQM C;  1J1D A;  2KI6 D;  4OR9 B;  2F2O A;  1NIW A;  2GV5 A;  1BLQ A;  1KK8 C;  2F2P A;  1SR6 C;  1KFX S;  1W7I B;  1A75 B;  2JTZ A;  1NWD A;  3BUX B;  4MZL A;  2M8U A;  1CDN A;  1OE9 B;  1QS7 A;  4P5O E;  2MLF C;  1UHI A;  2MA2 A;  1SNL A;  1Y1U A;  2Y5I A;  1IG5 A;  5FYX A;  1QIW A;  3E3R A;  3OB1 B;  3OHM B;  3F45 A;  1BR1 B;  1M31 A;  2OPO A;  4R1E A;  5G08 A;  1OZS A;  1WRK A;  2OS8 C;  3PLF B;  1NX1 A;  2LV7 A;  2PRU A;  5HLV A;  3ZWH A;  1JF0 A;  3PN7 C;  3TDZ A;  4I5N B;  2LM5 A;  1UHK A;  4OVN F;  1L2O C;  1NX3 A;  1R6P A;  1N2D A;  3PAT A;  4YGA A;  1TRF A;  1CLL A;  1NX2 A;  1YTZ C;  3EK4 A;  2OTG C;  1BF5 A;  1U5I B;  1DJX A;  2LP2 A;  2L50 A;  1PRW A;  1FF1 A;  2M9G A;  1QIV A;  1SCV A;  2L4H A;  1CDP A;  2Y1M A;  1GGW A;  3BUM B;  4I5J A;  4FQO A;  4GPL B;  2K7O A;  3O78 A;  1C7V A;  4MZJ A;  2JT3 A;  3O4Y A;  2L51 A;  2LHL A;  1EL4 A;  3OB2 B;  2MRD A;  3RM1 A;  3JTD C;  3KF9 A;  3FIA A;  2CNP A;  1DT7 B;  1MHO A;  1YRT B;  2LLU A;  2CCM A;  4PHN A;  1FI6 A;  2ZFD A;  2BCX A;  2FCD A;  1PK0 D;  2BE6 A;  1LVC D;  1CDM A;  4YGB B;  2KGR A;  2NCP A;  2LP3 A;  5HKY A;  3D0Y A;  1FBV A;  1DJZ A;  1KSO A;  2KFF A;  2WND A;  4YRU A;  4PAL A;  4CFR A;  1R2U A;  1XFY O;  5AXI A;  2LVJ A;  1IJ5 A;  2KQY A;  2ZRS A;  1CM1 A;  4QJ4 B;  1ZFS A;  1ALW A;  1RWY A;  3DVK A;  4CLN A;  4P2Y B;  1IRJ A;  4USL A;  1CNP A;  5CSF A;  2BKH B;  2E6W A;  1XA5 A;  1WLZ A;  2L5X B;  2L4I A;  3C1V A;  2M7N A;  2M3W A;  4PE4 A;  1K90 D;  2COL B;  2JT8 A;  1WRZ A;  2KI6 C;  1BG1 A;  1B4C A;  1FI5 A;  2EHB A;  1TNP A;  4WQ3 A;  4DS7 A;  3VGO A;  3EVU A;  4ZCU A;  3SIA A;  1MR8 A;  1EJ3 A;  1EG4 A;  1C7W A;  2BL0 C;  3A8R A;  2KNE A;  2I94 A;  2Y4Q A;  3LCP C;  2I18 A;  3CTN A;  4GGN A;  5CPV A;  5BPJ A;  1OMR A;  2M97 A;  1IKU A;  4PDZ A;  3BUO B;  2PVB A;  3TDU A;  1NSH A;  1Y1A A;  1J7Q A;  2LUX A;  2O60 A;  3CZT X;  1VRK A;  2I7A A;  4D1E A;  1BOC A;  2LC5 A;  2HET A;  1KK7 Y;  5HKZ A;  4F0Z B;  1DJG A;  4MSP A;  3D0Y B;  5J3X A;  4DUQ A;  2QAC A;  3WHT B;  3GK4 X;  1DGU A;  1F4Q A;  1KK7 Z;  2K0J A;  1BMO A;  1NUB A;  1MUX A;  2LVK A;  2K7C A;  5TNC A;  1QX7 A;  2K7D A;  1SK6 D;  1DJY A;  1QX2 A;  3CR5 X;  1LIN A;  1DF0 A;  1KWO B;  2BKI B;  3TS5 C;  1F54 A;  3FS7 A;  1OMV A;  3OX5 A;  2EGD A;  1K93 D;  1ZAC A;  2ZN8 A;  1JWD A;  1TN4 A;  5KSZ A;  1D1O A;  2HQ8 A;  1KQM B;  4JQ0 D;  1LXF C;  1YX8 A;  3OX6 A;  2LCP A;  1YUU A;  1IQ3 A;  1EH2 A;  1J7P A;  1BOD A;  1CFD A;  1KK8 B;  1SR6 B;  2LMV A;  3HX4 A;  4Q04 A;  3WHU B;  4PE0 A;  4YI9 A;  1SMG A;  1IGV A;  2NLN A;  2BCB A;  2CTN A;  4MN0 A;  3GK1 A;  3CGA A;  2HF5 A;  4N1F A;  1CMF A;  3PFV A;  4NQG A;  2AMI A;  3EVR A;  2ZND A;  1SYM A;  1OZO A;  2JTT A;  5AER A;  2MAZ A;  2FOT A;  1CFP A;  2Y1N A;  3BUW B;  1K2H A;  2BE4 A;  1CTR A;  2MJW B;  3M0W A;  2OS8 B;  1TIZ A;  5CSJ A;  1PVB A;  2EC6 C;  1ZOT B;  3PN7 B;  3CR2 A;  1L2O B;  2LMU A;  4JWQ A;  1QTX A;  1UUR A;  1Y1X A;  2OTG B;  1QAT A;  2L98 A;  1K94 A;  3KPX A;  4M2Q A;  2WOS A;  1GGZ A;  4OV2 A;  5K89 A;  3AAK A;  4CID A;  1V1F A;  3TUY C;  2CBL A;  4N1G A;  1QVI Y;  4C0J A;  1B1G A;  5DKQ A;  2GGZ A;  3HCM A;  1G4Y R;  2BCA A;  2FJU B;  2TN4 A;  3BOW A;  1S1E A;  3JTD B;  4IL1 A;  5CSI A;  1QVI Z;  1TNX A;  1RFJ A;  1KFU S;  5HLO A;  1SBJ A;  1MXL C;  1SPY A;  2QPT A;  3K21 A;  2JQ6 A;  5AAN A;  4CFQ A;  1QLS A;  2KBI A;  3BQ3 A;  1YRU B;  1JBA A;  1F71 A;  1DMO A;  1M45 A;  3SG5 A;  1B7T Y;  2ISD A;  2KDH A;  3BUN B;  3CWG A;  5I8N A;  3PAL A;  1KFX L;  1ALV A;  4HRE E;  2M49 B;  2B1U A;  4FTG A;  1B7T Z;  1JF2 A;  1YUS A;  2F8P A;  5I2L A;  1BR4 B;  2KHN A;  2JC2 A;  1YVH A;  1SKT A;  1SY9 A;  3PSR A;  2ZNE A;  1B8R A;  1M63 B;  1XFU O;  4WRI A;  2L0P A;  4QJ3 B;  1MXE A;  2H2K A;  3H4S E;  3EKJ A;  5GQQ C;  1L7Z A;  1OQP A;  3VRR A;  2A4J A;  1JFJ A;  5HKW A;  1A4P A;  2KI4 C;  3TDI A;  4I5L B;  1DJH A;  3ICB A;  2HQW A;  5F6T A;  5IBW A;  4PHJ A;  2PSR A;  1TOP A;  1SL8 A;  4YGE B;  1S6C A;  1QAS A;  1RK9 A;  2H61 A;  1V1G A;  1OOJ A;  1K9U A;  1XK4 A;  1UHH A;  2JXL A;  2R2I A;  2WCB A;  3I5I C;  1YX7 A;  1WY9 A;  3O2P A;  4JPZ B;  4DCK A;  5DKR A;  2BL0 B;  4QJ5 B;  2MBX A;  1YUT A;  1FW4 A;  4XJK A;  2K7B A;  1KFU L;  5D69 A;  3DD4 A;  2M0R A;  4BY4 A;  1MF8 B;  1S26 D;  1IQ5 A;  1J55 A;  1WRL A;  3FWB A;  1GJY A;  1HQV A;  1H8B A;  5ER4 X;  1TNW A;  3BXK A;  1A03 A;  2M1U A;  2M1K B;  5CSN A;  2Q91 A;  4U8D A;  1YR5 A;  4C0K A;  5KTY A;  1G8I A;  3SG2 A;  1CLB A;  1DVI A;  1B8C A;  3AAJ A;  2JU0 A;  3KHE A;  2F3Y A;  1X02 A;  4YI8 A;  4E68 A;  4L9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...