2COLB

Crystal structure analysis of cyaa/c-cam with pyrophosphate
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
67
structure length
67
Chain Sequence
TDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase/metal binding protein
molecule keywords Bifunctional hemolysin-adenylate cyclase
publication title Structural basis for the interaction of Bordetella pertussis adenylyl cyclase toxin with calmodulin
pubmed doi rcsb
source organism Bordetella pertussis
total genus 19
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2005-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2colB00
2LLSA 2F8PA 4OCIA 1SMGA 2ZRTA 1SRAA 3BUNB 1NPQA 1PRWA 3IQQA 2M7LA 2Y4QA 1YTZC 3PATA 2M0RA 4AQIA 3PLFB 1OZOA 1QIVA 2BE4A 2L0PA 2OTGB 3GK2A 1Y1XA 4M2OA 2H61C 4OV2A 1UHHA 3DVKA 4XJKB 3SJSA 1Y6WA 3I5IB 4GGFC 4N5XA 3NSIA 1QV1A 3JTDB 1SNLA 4MRYA 5AANA 2MA2A 1C7VA 4M2PA 1DJIA 5IBWA 2GV5A 1F4QA 1SR6B 2WOSA 1CFFA 1SCVA 2KI4C 2TN4A 2KAVA 2JRFA 3PFVA 1K93D 2ZN9A 4CLNA 2JNFA 4MLWA 2FJUB 1M63B 1JFJA 1AJ5A 1C7WA 1QVIY 1BU3A 1QVIZ 2KAXA 1IJ5A 5I8NA 1AUIB 1NX3A 3SG7A 3K21A 4I5JA 1YRUB 4PE4A 2Q4UA 3KPXA 1NUBA 3SG6A 1UHJA 1KFXS 1DJGA 1JF2A 2CNPA 4DUQA 1CMGA 2ZKMX 1S6CA 1TNXA 4I5LB 1N2DA 2JC2A 1IWQA 3OB2B 1BR4B 4U8DA 1ALWA 2PRUA 1JC2A 2AUCA 2MRDA 4MZJA 3GK1A 2K7OA 1J55A 3SG5A 2Y1MA 3BUXB 4WRIA 1KSOA 2JQ6A 2KFFA 1KK8C 3SG4A 3CS1A 1JSAA 4CPVA 2JTZA 1SK6D 2JT3A 2F3YA 1YRTB 1AJ4A 1W7IB 2F3ZA 3LK0A 1EG4A 1WRKA 3OHMB 3EKJA 5ER4X 1OOJA 1CNPA 4MZKA 3PM8A 3I5FC 4MN0A 1GJYA 1CMFA 4ETOA 1YVHA 1F8HA 2LLUA 2O60A 1F70A 1UHKA 2M1KB 1L7ZA 2F2OA 3ICBA 4ORCB 1RFJA 1J7PA 2KI4B 3IQOA 2BCBA 1K96A 1UP5A 1XFWO 2ZRSA 3VRPA 4CFQA 3BOWB 1CLLA 3KF9A 5AXIA 4GGNA 1CDLA 2CBLA 3O6BA 2KYCA 1B7TY 2EHBA 2M9GA 4GAOA 1B7TZ 4PHNA 3WXAA 1XFUO 4AQJA 4IL1A 4BY4A 2Y1NA 3EK4A 3OP0A 3LLEA 1G4YR 1JUOA 1H4BA 1PSRA 1KQVA 2HF5A 1DJHA 2K7BA 2ZFDA 5J3XA 2CXJA 1K9PA 3SIAA 1FI6A 1J7RA 1MXLC 3KO0A 1XO5A 1NCZA 3FWBA 2JU0A 1YX7A 2JULA 2KYFA 3JVTC 4CIDA 1DVIA 1KK8B 1S5GY 4P5OE 1ZFSA 1S5GZ 2BCAA 3E3RA 3GK4X 3SG3A 3I5GC 1JWDA 2HQWA 1XFXO 2BBNA 2SCPA 3TDUA 1FI5A 3CZTX 5HLVA 2I2RE 3WNXB 1KFUS 1M45A 2IS9A 2R2IA 3CWGA 1DF0B 1YUUA 3EK7A 5JOLA 1YUTA 2LMUA 2I18A 5DKQA 1IG5A 2L4IA 3VROA 4FQOA 1TCOB 2LCPA 3I5FB 1KSMA 5DKRA 3NSOA 1NSHA 1TRFA 1KQMC 1GQMA 1A4PA 1UHNA 1V1FA 3KHEA 1F55A 1SYMA 5I2LA 4AOMA 2KOTA 2M29A 1JBAA 4JPZB 4CFRA 1B4CA 1CFPA 1NP8A 1RK9A 3WHUB 4YRUA 1FF1A 2B1UA 1SL8A 2BE6A 3C1VA 4YI8A 1V1GA 3MSEB 2M97A 4YGAA 1B47A 3I5HC 3ZWHA 1DT7B 1KK7Y 1OSAA 4PE1A 1WLMA 1DJWA 1WY9A 1A29A 3HCMA 2AAOA 4MZLA 1BJFA 1MUXA 1ZOTB 1S26D 2KFHA 5KSZA 3OX6A 2K7CA 4MRXA 1GGZA 5FYXA 3VRRA 2NCPA 4XJKA 3NSKA 2WNDA 1M31A 1J7QA 2PVBA 5HLOA 1QXPA 1YUSA 3JVTB 1AVSA 1CTRA 1NYAA 1FW4A 2JPTA 2M8UA 3O78A 2K8MB 4QJ4B 1KWOC 1QX2A 4DCKA 3DVEA 1XFVO 1WRLA 3I5GB 4YGCB 3FS7A 5F6TA 2LLTA 4C0KA 1LA3A 4OR9B 2KI6D 1DMOA 2NZ0A 1Y1AA 1Y1UA 2OS8C 2KBMA 1KFXL 2RGIA 4DRWA 1F54A 2F2PA 1YVLA 2CTNA 3KEVA 1PVBA 1K90D 1S36A 2HETA 1XK4C 3CGAA 1OMRA 1NX1A 1HQVA 1QATA 1OQPA 2PALA 2M7NA 2KGRA 1NCXA 3CR2A 1RROA 4F0ZB 1KQMB 3DF0B 5AFPA 3TZ1A 5CSJA 1YURA 2E30A 3H4SE 1B9AA 2KQYA 4YGDB 1WDCC 1IH0A 1BMOA 4DIRA 1XFYO 3F45A 2LE9B 1GGWA 1K94A 5AEQA 2HPSA 2CCMA 4PHJA 1K9UA 1DGUA 2NXQA 3D0YB 1CLMA 1K9KA 3FWCA 3OX5A 1S6IA 5CPVA 5HYDA 1C07A 2LVIA 3BYAA 4HRGA 2FCDA 2KSPA 4N1GA 3IF7A 3TDZA 3BQ3A 3SG2A 1AHRA 5I2OA 3I5HB 5I2QA 1FBVA 3OB1B 3EKHA 4ICBA 2MHHA 1J7OA 1K8UA 2KI6C 3RLZA 3VGOA 4Q04A 2LANA 5CSNA 1IQ3A 4ORBB 3RM1A 2L4HA 3AKAA 4WQ3A 4ZCUA 1M39A 4A4BA 1S6JA 2H61A 1QIWA 3O4YA 4GGFA 1TNQA 1BOCA 2ZNDA 4NDCA 1SL9A 2M3WA 2MAZA 3WHTB 1XA5A 2M49B 1KWOB 1DJZA 2V53A 1U5IB 3BXKA 4PHMA 2LVKA 1N0YA 4MEWA 1A75B 1NCYA 2OS8B 1B8CA 2G9BA 2K61A 1IJ6A 3BOWA 2G2BA 4YI9A 1CB1A 1SKTA 3EK8A 3EVUA 4PDZA 1IKUA 1X02A 3SIBA 4MSPA 2JXLA 4M2QA 4HRHA 2KHNA 1A03A 3LCPC 5HKZA 1LA0A 2LUCA 2LMTA 3CR5X 4DS7A 2KGBC 2L2EA 3VRNA 1OE9B 1BF5A 4MBEA 5G08A 1MHOA 1VRKA 1EG3A 2LHIA 4D1EA 2L98A 1OZSA 1WDCB 1BODA 4I5KA 1SW8A 2Q91A 5PALA 5JJGA 2ZN8A 5HKYA 4NDDA 4HSZA 2PASA 3FIAA 3CLNA 2PMYA 3CR4X 2SASA 1R6PA 1DJYA 2JWWA 2ISDA 3QRXA 4GNKB 1KFUL 2F33A 1RTP1 2A4JA 2BKIB 4NQGA 4XYNA 4YGEB 2L51A 3ZNIA 5KTYA 2LP2A 2WCEA 1QLSA 1NX2A 1ODBA 2K7DA 2JZIA 2K0JA 1XYDA 2AMIA 3NXAA 4GPLB 2LUXA 2BECA 1CM1A 1L2OC 2MBXA 2NLNA 1HT9A 1LINA 2WC8A 1MQ1A 1N65A 1Q80A 1DTLA 1DF0A 3BUWB 1SCMC 1SPYA 1KK7Z 4PCWA 5AERA 4I5NB 4PHKA 4NDBA 2BL0C 3AAKA 1BG1A 2EC6C 1QX5B 1K2HA 4TNCA 2FOTA 1RECA 1DGVA 1EH2A 3LL8B 4HREE 2BCXA 4ORAB 4JQ0D 1QTXA 1SBJA 2MLFC 4L9MA 1TOPA 1IRJA 4OVNF 3TUYC 1S3PA 1PULA 5CSFA 4ZCVA 1PK0D 2PSRA 2KDHA 1NX0A 2E6WA 3EVVA 1BR1B 3AAJA 1QASA 1AP4A 3PALA 1XFZO 1PVAA 3GOFA 1UWOA 1EXRA 1TN4A 1CDMA 2K2AA 1QS7A 1PALA 3TS5C 2OPOA 5DKNA 1LXFC 1S1EA 1MR8A 2KFGA 2MJWB 1AK8A 2L5XB 3M0WA 1F4OA 5BPJA 1NWDA 5B8IB 1SL7A 3PN7C 4GBAA 5CSIA 1W7JB 1TNWA 2JXCA 3NSLA 1JFKA 2VRGA 1B1GA 2LVVA 4A4CA 2JNXA 2LP3A 2I94A 1B8RA 3BUOB 4P2YB 2DOQA 5HKWA 5GQQC 1IQ5A 3BUMB 1F71A 5D7FA 2WCBA 1Y0VH 1E8AA 1ZUZA 2FCEA 1LVCD 2Y5IA 1L2OB 1OMDA 1LKJA 4PE7A 1DJXA 3LK1A 1G33A 1QX7A 2EGDA 5KU1A 1ZACA 1RWYA 1SCMB 2WCFA 2GGZA 2COLB 2LV7A 1CM4A 2GGMA 2P6BB 1OMVA 4UPGA 2LNKA 2BL0B 2BBMA 2H2KA 4PE0A 1MF8B 1EJ3A 1UURA 2MLEC 2EC6B 2LM5A 3DF0A 2I7AA 1YX8A 2LMVA 1D1OA 1XVJA 3DVJA 3VRQA 2JT8A 1KCYA 1TCFA 1B8LA 2K2FA 3AKBA 1FPWA 3EVRA 4GUKA 2OTGC 3A8RA 3TUYB 5TNCA 2KAYA 3D0YA 2QACA 2LAPA 2JTTA 3I5IC 4PALA 1TNPA 4BY5A 1CDPA 1CLBA 3JTDC 1UUSA 5K89A 1G8IA 2KQ6A 1QLKA 2WORA 3HX4A 4E68A 1NIWA 2JOJA 2CT9A 3D10A 1RJVA 1J1DA 4MVFA 3TDIA 4QJ5B 1ALVA 1BLQA 1SR6C 3TS5B 1TTXA 1WRZA 1A2XA 2O5GA 1YR5A 1MXEA 1JF0A 3DVMA 3PN7B 4C0LA 4OKHA 1CDNA 3CTNA 2NCOA 3PSRA 4USLA 5D69A 2LVJA 4C0JA 1QJTA 1CFDA 2KNEA 2D8NA 4QJ3B 2L50A 2ZNEA 1J1EA 1IGVA 1WLZA 1U5IA 1H8BA 1K95A 1TIZA 1MWNA 1ZMZA 2HQ8A 1A75A 3O2PA 4FTGA 4JWQA 2JT0A 1M46A 1EL4A 2QPTA 4WQ2A 1CKKA 1SY9A 4GFTA 1CFCA 4YGBB 1R2UA 4YBHB 2LC5A 5ER5A 3A4UB 1UHIA 2LHLA 1QV0A 1XK4A 2KBIA 4R1EA 1PSBA 4N1FA 2M1UA 1BT6A 3DD4A 2BKHB
chains in the Genus database with same CATH superfamily
2LLSA 2F8PA 4OCIA 1SMGA 4F7FA 2ZRTA 1SRAA 3BUNB 1NPQA 1PRWA 3IQQA 2M7LA 2Y4QA 1YTZC 3PATA 2M0RA 4AQIA 3PLFB 1OZOA 1QIVA 2BE4A 2KPHA 3R1PA 2L0PA 2OTGB 2JPOA 3GK2A 1Y1XA 4M2OA 3L4LA 2H61C 4OV2A 1UHHA 3DVKA 4XJKB 2FJYA 3SJSA 1Y6WA 3I5IB 4GGFC 4N5XA 3NSIA 1QV1A 3JTDB 1SNLA 4MRYA 5AANA 2MA2A 1C7VA 4M2PA 1DJIA 5IBWA 2GV5A 1F4QA 1SR6B 2WOSA 1CFFA 1SCVA 2KI4C 2TN4A 3S0AA 2KAVA 2JRFA 3PFVA 1K93D 2ZN9A 4CLNA 2JNFA 4MLWA 2FJUB 1M63B 1JFJA 1AJ5A 1C7WA 1QVIY 1BU3A 1QVIZ 2KAXA 1IJ5A 5I8NA 1AUIB 1NX3A 3SG7A 3K21A 5FI6A 4I5JA 1YRUB 4PE4A 2Q4UA 3KPXA 1NUBA 3SG6A 4JD9A 1UHJA 5I94A 1KFXS 2L5YA 1DJGA 1JF2A 2CNPA 1XFRA 2KLDA 3DYEA 4DUQA 2ZKMX 1S6CA 1CMGA 1TNXA 4I5LB 1N2DA 2JC2A 1IWQA 3OB2B 1BR4B 4U8DA 1ALWA 2PRUA 2H8VA 2AUCA 2MRDA 2WCKA 4MZJA 1JC2A 3GK1A 2K7OA 1J55A 3SG5A 2Y1MA 3BUXB 4WRIA 1KSOA 2JQ6A 2KFFA 1KK8C 3SG4A 3CS1A 1JSAA 4CPVA 2JTZA 1SK6D 2JT3A 2F3YA 3S0FA 1YRTB 1AJ4A 1W7IB 2F3ZA 3LK0A 1EG4A 1WRKA 3OHMB 3B86A 3EKJA 5ER4X 3BFHA 1OOJA 1CNPA 4MZKA 3PM8A 3I5FC 2QEVA 2QEOA 4MN0A 1GJYA 1CMFA 4ETOA 1YVHA 1F8HA 2LLUA 2O60A 1F70A 1UHKA 2M1KB 1L7ZA 2F2OA 3ICBA 4ORCB 1RFJA 1J7PA 2KI4B 3IQOA 2BCBA 1K96A 1UP5A 1XFWO 2ZRSA 3VRPA 4CFQA 3BOWB 1CLLA 2P71A 3KF9A 5AXIA 4GGNA 1CDLA 2CBLA 3O6BA 2KYCA 1B7TY 2EHBA 2M9GA 4GAOA 1B7TZ 3B87A 4PHNA 1XFUO 3WXAA 4IL1A 4AQJA 4BY4A 2Y1NA 3EK4A 3OP0A 3LLEA 1G4YR 1JUOA 1H4BA 1PSRA 1KQVA 2HF5A 1DJHA 2K7BA 2WCLA 2ZFDA 5J3XA 2CXJA 1K9PA 3SIAA 1FI6A 1J7RA 1MXLC 2BAPA 1XO5A 3KO0A 1NCZA 3FWBA 3R1VA 2JU0A 1YX7A 2JULA 2KYFA 2PQLA 3D74A 3FE8A 1DQEA 3JVTC 4CIDA 1DVIA 2K60A 1KK8B 1S5GY 4P5OE 1ZFSA 1S5GZ 2BCAA 3E3RA 3GK4X 3SG3A 3I5GC 1JWDA 2HQWA 1XFXO 2BBNA 2SCPA 3TDUA 3B7AA 3CZTX 5HLVA 2I2RE 3WNXB 1FI5A 1KFUS 3D73A 1M45A 2IS9A 2R2IA 3CWGA 1DF0B 1YUUA 3EK7A 5JOLA 1YUTA 3S0DA 2LMUA 2I18A 5DKQA 1IG5A 2L4IA 3S0BA 3VROA 4FQOA 1TCOB 2LCPA 3I5FB 1DEKA 1KSMA 4KYNA 5DKRA 3NSOA 1NSHA 1TRFA 1KQMC 1GQMA 1A4PA 1UHNA 1V1FA 3KHEA 1F55A 1SYMA 5I2LA 4AOMA 4OZDA 2KOTA 2M29A 1JBAA 4JPZB 3D77A 4CFRA 1DC1A 1B4CA 1CFPA 1NP8A 1RK9A 3WHUB 4YRUA 1FF1A 2B1UA 1SL8A 2BE6A 3C1VA 3CZ2A 4YI8A 1V1GA 3MSEB 2M97A 4YGAA 1B47A 3I5HC 3ZWHA 1DT7B 1KK7Y 1C3ZA 1OSAA 3B6XA 4PE1A 1WLMA 1DJWA 1WY9A 1A29A 3HCMA 2AAOA 4MZLA 1BJFA 1MUXA 1ZOTB 1S26D 2KFHA 5KSZA 3OX6A 2K7CA 4MRXA 1GGZA 5FYXA 3VRRA 5FI7A 2NCPA 4XJKA 3NSKA 2WNDA 3Q8IA 1M31A 4FQTA 4JKTA 1OOGA 2PVBA 1J7QA 5HLOA 3CYZA 1QXPA 5DICA 1YUSA 3JVTB 1AVSA 1CTRA 1NYAA 1FW4A 2JPTA 2M8UA 2QDIA 2QEBA 3UNWA 3O78A 2K8MB 4QJ4B 1KWOC 1QX2A 5D3OA 4DCKA 3DVEA 1XFVO 1WRLA 3I5GB 4YGCB 3FS7A 5F6TA 2LLTA 4C0KA 1LA3A 4INWA 4OR9B 2KI6D 3S0GA 1DMOA 2NZ0A 1Y1AA 1Y1UA 1Z2CB 2KBMA 1KFXL 2OS8C 2RGIA 4DRWA 1F54A 2F2PA 1YVLA 2CTNA 2ERBA 3KEVA 1PVBA 1K90D 1S36A 2HETA 1XK4C 1GM0A 3CGAA 1OMRA 1NX1A 1HQVA 1QATA 1OQPA 2PALA 2M7NA 3UO9A 2KGRA 1NCXA 3CR2A 1RROA 4F0ZB 1KQMB 3DF0B 5AFPA 3TZ1A 5CSJA 1YURA 2E30A 3H4SE 1B9AA 2KQYA 4YGDB 1WDCC 1IH0A 1BMOA 4DIRA 1XFYO 3F45A 2LE9B 1GGWA 1K94A 5AEQA 2HPSA 3DY9A 1C3YA 2CCMA 3BFBA 4PHJA 1K9UA 5HL1A 1DGUA 2NXQA 3D0YB 1CLMA 1K9KA 3FWCA 3OX5A 1S6IA 5CPVA 5HYDA 1C07A 2LVIA 3BYAA 4HRGA 1TUJA 2FCDA 2KSPA 3D76A 4N1GA 3IF7A 3SS3A 3BQ3A 3TDZA 3SG2A 1AHRA 5I2OA 3I5HB 3NGVA 5I2QA 2WC5A 1FBVA 3OB1B 1LS8A 3EKHA 4ICBA 5EL2A 3PM2A 2YGUA 2MHHA 1J7OA 1K8UA 3FE6A 3EG5B 2KI6C 3RLZA 3VGOA 4Q04A 2KLEA 2LANA 5CSNA 1IQ3A 4ORBB 3RM1A 3FE9A 2L4HA 3AKAA 4WQ3A 4ZCUA 1M39A 3PJIA 4A4BA 1S6JA 2H61A 1QIWA 3O4YA 4GGFA 1TNQA 1BOCA 2ZNDA 4NDCA 1SL9A 2M3WA 2MAZA 1T14A 3WHTB 1XA5A 2M49B 1KWOB 1DJZA 2V53A 1U5IB 3BXKA 3R1OA 4PHMA 2LVKA 1N0YA 4MEWA 1A75B 3K1EA 1NCYA 2L2CA 2OS8B 1B8CA 2G9BA 3CZ1A 1QWVA 3CZ0A 2K61A 1IJ6A 3BOWA 2G2BA 4YI9A 1OOIX 1SKTA 3EK8A 3EVUA 4PDZA 1CB1A 1IKUA 1X02A 3SIBA 4MSPA 2JXLA 4M2QA 4HRHA 2KHNA 1A03A 3LCPC 5HKZA 1LA0A 2LUCA 2LMTA 1OOFA 3CR5X 4DS7A 2KGBC 2L2EA 3VRNA 1OE9B 1BF5A 1TWOA 4MBEA 5G08A 1MHOA 1VRKA 1EG3A 2LHIA 4D1EA 2L98A 1OZSA 1WDCB 1BODA 4I5KA 1SW8A 2Q91A 3NHTA 5PALA 5JJGA 2ZN8A 5HKYA 4NDDA 4HSZA 2PASA 3FIAA 1ORGA 3CLNA 2PMYA 3CR4X 2SASA 1R6PA 1DJYA 2JWWA 2ISDA 3QRXA 4GNKB 1KFUL 2F33A 1RTP1 2A4JA 2BKIB 4NQGA 4XYNA 4YGEB 2L51A 3ZNIA 5KTYA 2LP2A 2WCEA 1QLSA 1NX2A 1ODBA 2K7DA 2JZIA 1W9ZA 1XYDA 2AMIA 2K0JA 2WCJA 2GTEA 3L47A 3NXAA 2LUXA 2BECA 4GPLB 1CM1A 1DELA 1L2OC 2MBXA 5FI2A 2NLNA 1HT9A 1LINA 2WC8A 1MQ1A 1N65A 3S0EA 1Q80A 1DTLA 1DF0A 3BUWB 1SCMC 3D78A 3NHIA 1SPYA 1KK7Z 4PCWA 5AERA 4I5NB 4PHKA 4NDBA 3N7HA 1OW4A 2BL0C 3AAKA 1BG1A 2EC6C 1QX5B 1OOHA 1K2HA 4TNCA 2FOTA 1RECA 1DGVA 1EH2A 3BFAA 3LL8B 2BCXA 3CDNA 4HREE 1QTXA 1SBJA 2MLFC 4JQ0D 4ORAB 4L9MA 1IIOA 1TOPA 1IRJA 2P70A 4OVNF 3TUYC 3OBVA 1S3PA 1PULA 5CSFA 4ZCVA 3DZTA 1PK0D 2PSRA 2KDHA 1NX0A 2E6WA 3EVVA 1BR1B 3AAJA 1QASA 1AP4A 3PALA 1XFZO 1PVAA 3GOFA 1UWOA 1EXRA 1TN4A 1CDMA 3RZSA 2K2AA 3B88A 1QS7A 1PALA 1TUZA 3TS5C 2OPOA 5DKNA 1LXFC 1S1EA 1MR8A 2KFGA 2MJWB 1AK8A 3BJHA 2L5XB 3M0WA 1F4OA 4PT1A 5BPJA 1NWDA 3CABA 5B8IB 1SL7A 3PN7C 4GBAA 5CSIA 1W7JB 1TNWA 2JXCA 3NSLA 1JFKA 2VRGA 1B1GA 2LVVA 4A4CA 2JNXA 2LP3A 2I94A 1B8RA 3BUOB 4P2YB 2DOQA 5HKWA 5GQQC 1IQ5A 3BUMB 1SSEB 3QMEA 1F71A 5D7FA 2WCBA 1Y0VH 1E8AA 2BNXA 1ZUZA 2FCEA 1LVCD 2Y5IA 1L2OB 1OMDA 1LKJA 4PE7A 1DJXA 3LK1A 1QX7A 1G33A 2EGDA 5KU1A 1ZACA 3V2LA 1RWYA 1SCMB 2WCFA 2GGZA 2COLB 2LV7A 1CM4A 2GGMA 2P6BB 1OMVA 4UPGA 2LNKA 2BL0B 2BBMA 2H2KA 4PE0A 1MF8B 1EJ3A 1UURA 2MLEC 2EC6B 2LM5A 3DF0A 2I7AA 1YX8A 2LMVA 1D1OA 1XVJA 3DVJA 4IJ7A 3VRQA 2JT8A 1KCYA 1TCFA 1B8LA 3O4XA 2K2FA 3AKBA 1FPWA 3EVRA 4GUKA 2OTGC 3A8RA 3TUYB 5TNCA 2KAYA 3D0YA 3DXLA 1Z4HA 2QACA 2LAPA 2JTTA 3I5IC 4PALA 1TNPA 4BY5A 1CDPA 1CLBA 3JTDC 1UUSA 5K89A 1G8IA 2KQ6A 1QLKA 2WORA 3HX4A 3OGNA 4E68A 1NIWA 2JOJA 2CT9A 3D10A 1RJVA 1J1DA 4MVFA 3TDIA 3VB1A 4QJ5B 1ALVA 1BLQA 1SR6C 3R72A 3TS5B 1TTXA 1WRZA 1A2XA 2O5GA 1YR5A 1MXEA 1JF0A 2WCHA 3L4AA 3DVMA 3PN7B 2WCMA 4OKHA 3SS4A 4C0LA 1CDNA 3CTNA 2NCOA 3PSRA 3D75A 4USLA 3IVTA 5D69A 2LVJA 4C0JA 1QJTA 1CFDA 2KNEA 2D8NA 4QJ3B 2L50A 2ZNEA 1J1EA 3SS5A 2WC6A 1IGVA 1WLZA 1U5IA 1H8BA 1K95A 1TIZA 1MWNA 4INXA 1ZMZA 2HQ8A 1A75A 3O2PA 4FTGA 4JWQA 2JT0A 1M46A 1EL4A 2QPTA 4WQ2A 1CKKA 1SY9A 4GFTA 1CFCA 4YGBB 1R2UA 4YBHB 2LC5A 2QEHA 5ER5A 3A4UB 1UHIA 2LHLA 1QV0A 1XK4A 1P28A 2KBIA 1PSBA 4R1EA 2PYQA 4N1FA 2M1UA 1BT6A 3DD4A 2BKHB
chains in the Genus database with same CATH topology
2LLSA 2F8PA 4OCIA 1SMGA 2ZRTA 1SRAA 3BUNB 1NPQA 1PRWA 3IQQA 2M7LA 2Y4QA 1YTZC 3PATA 2M0RA 4AQIA 3PLFB 1OZOA 1QIVA 2BE4A 2L0PA 2OTGB 3GK2A 1Y1XA 4M2OA 2H61C 4OV2A 1UHHA 3DVKA 4XJKB 3SJSA 1Y6WA 3I5IB 4GGFC 4N5XA 3NSIA 1QV1A 3JTDB 1SNLA 4MRYA 5AANA 2MA2A 1C7VA 4M2PA 1DJIA 5IBWA 2GV5A 1F4QA 1SR6B 2WOSA 1CFFA 1SCVA 2KI4C 2TN4A 2KAVA 2JRFA 3PFVA 1K93D 2ZN9A 4CLNA 2JNFA 4MLWA 2FJUB 1M63B 1JFJA 1AJ5A 1C7WA 1QVIY 1BU3A 1QVIZ 2KAXA 1IJ5A 5I8NA 1AUIB 1NX3A 3SG7A 3K21A 4I5JA 1YRUB 4PE4A 2Q4UA 3KPXA 1NUBA 3SG6A 1UHJA 1KFXS 1DJGA 1JF2A 2CNPA 4DUQA 1CMGA 2ZKMX 1S6CA 1TNXA 4I5LB 1N2DA 2JC2A 1IWQA 3OB2B 1BR4B 4U8DA 1ALWA 2PRUA 1JC2A 2AUCA 2MRDA 4MZJA 3GK1A 2K7OA 1J55A 3SG5A 2Y1MA 3BUXB 4WRIA 1KSOA 2JQ6A 2KFFA 1KK8C 3SG4A 3CS1A 1JSAA 4CPVA 2JTZA 1SK6D 2JT3A 2F3YA 1YRTB 1AJ4A 1W7IB 2F3ZA 3LK0A 1EG4A 1WRKA 3OHMB 3EKJA 5ER4X 1OOJA 1CNPA 4MZKA 3PM8A 3I5FC 4MN0A 1GJYA 1CMFA 4ETOA 1YVHA 1F8HA 2LLUA 2O60A 1F70A 1UHKA 2M1KB 1L7ZA 2F2OA 3ICBA 4ORCB 1RFJA 1J7PA 2KI4B 3IQOA 2BCBA 1K96A 1UP5A 1XFWO 2ZRSA 3VRPA 4CFQA 3BOWB 1CLLA 3KF9A 5AXIA 4GGNA 1CDLA 2CBLA 3O6BA 2KYCA 1B7TY 2EHBA 2M9GA 4GAOA 1B7TZ 4PHNA 3WXAA 1XFUO 4AQJA 4IL1A 4BY4A 2Y1NA 3EK4A 3OP0A 3LLEA 1G4YR 1JUOA 1H4BA 1PSRA 1KQVA 2HF5A 1DJHA 2K7BA 2ZFDA 5J3XA 2CXJA 1K9PA 3SIAA 1FI6A 1J7RA 1MXLC 3KO0A 1XO5A 1NCZA 3FWBA 2JU0A 1YX7A 2JULA 2KYFA 3JVTC 4CIDA 1DVIA 1KK8B 1S5GY 4P5OE 1ZFSA 1S5GZ 2BCAA 3E3RA 3GK4X 3SG3A 3I5GC 1JWDA 2HQWA 1XFXO 2BBNA 2SCPA 3TDUA 1FI5A 3CZTX 5HLVA 2I2RE 3WNXB 1KFUS 1M45A 2IS9A 2R2IA 3CWGA 1DF0B 1YUUA 3EK7A 5JOLA 1YUTA 2LMUA 2I18A 5DKQA 1IG5A 2L4IA 3VROA 4FQOA 1TCOB 2LCPA 3I5FB 1KSMA 5DKRA 3NSOA 1NSHA 1TRFA 1KQMC 1GQMA 1A4PA 1UHNA 1V1FA 3KHEA 1F55A 1SYMA 5I2LA 4AOMA 2KOTA 2M29A 1JBAA 4JPZB 4CFRA 1B4CA 1CFPA 1NP8A 1RK9A 3WHUB 4YRUA 1FF1A 2B1UA 1SL8A 2BE6A 3C1VA 4YI8A 1V1GA 3MSEB 2M97A 4YGAA 1B47A 3I5HC 3ZWHA 1DT7B 1KK7Y 1OSAA 4PE1A 1WLMA 1DJWA 1WY9A 1A29A 3HCMA 2AAOA 4MZLA 1BJFA 1MUXA 1ZOTB 1S26D 2KFHA 5KSZA 3OX6A 2K7CA 4MRXA 1GGZA 5FYXA 3VRRA 2NCPA 4XJKA 3NSKA 2WNDA 1M31A 1J7QA 2PVBA 5HLOA 1QXPA 1YUSA 3JVTB 1AVSA 1CTRA 1NYAA 1FW4A 2JPTA 2M8UA 3O78A 2K8MB 4QJ4B 1KWOC 1QX2A 4DCKA 3DVEA 1XFVO 1WRLA 3I5GB 4YGCB 3FS7A 5F6TA 2LLTA 4C0KA 1LA3A 4OR9B 2KI6D 1DMOA 2NZ0A 1Y1AA 1Y1UA 2OS8C 2KBMA 1KFXL 2RGIA 4DRWA 1F54A 2F2PA 1YVLA 2CTNA 3KEVA 1PVBA 1K90D 1S36A 2HETA 1XK4C 3CGAA 1OMRA 1NX1A 1HQVA 1QATA 1OQPA 2PALA 2M7NA 2KGRA 1NCXA 3CR2A 1RROA 4F0ZB 1KQMB 3DF0B 5AFPA 3TZ1A 5CSJA 1YURA 2E30A 3H4SE 1B9AA 2KQYA 4YGDB 1WDCC 1IH0A 1BMOA 4DIRA 1XFYO 3F45A 2LE9B 1GGWA 1K94A 5AEQA 2HPSA 2CCMA 4PHJA 1K9UA 1DGUA 2NXQA 3D0YB 1CLMA 1K9KA 3FWCA 3OX5A 1S6IA 5CPVA 5HYDA 1C07A 2LVIA 3BYAA 4HRGA 2FCDA 2KSPA 4N1GA 3IF7A 3TDZA 3BQ3A 3SG2A 1AHRA 5I2OA 3I5HB 5I2QA 1FBVA 3OB1B 3EKHA 4ICBA 2MHHA 1J7OA 1K8UA 2KI6C 3RLZA 3VGOA 4Q04A 2LANA 5CSNA 1IQ3A 4ORBB 3RM1A 2L4HA 3AKAA 4WQ3A 4ZCUA 1M39A 4A4BA 1S6JA 2H61A 1QIWA 3O4YA 4GGFA 1TNQA 1BOCA 2ZNDA 4NDCA 1SL9A 2M3WA 2MAZA 3WHTB 1XA5A 2M49B 1KWOB 1DJZA 2V53A 1U5IB 3BXKA 4PHMA 2LVKA 1N0YA 4MEWA 1A75B 1NCYA 2OS8B 1B8CA 2G9BA 2K61A 1IJ6A 3BOWA 2G2BA 4YI9A 1CB1A 1SKTA 3EK8A 3EVUA 4PDZA 1IKUA 1X02A 3SIBA 4MSPA 2JXLA 4M2QA 4HRHA 2KHNA 1A03A 3LCPC 5HKZA 1LA0A 2LUCA 2LMTA 3CR5X 4DS7A 2KGBC 2L2EA 3VRNA 1OE9B 1BF5A 4MBEA 5G08A 1MHOA 1VRKA 1EG3A 2LHIA 4D1EA 2L98A 1OZSA 1WDCB 1BODA 4I5KA 1SW8A 2Q91A 5PALA 5JJGA 2ZN8A 5HKYA 4NDDA 4HSZA 2PASA 3FIAA 3CLNA 2PMYA 3CR4X 2SASA 1R6PA 1DJYA 2JWWA 2ISDA 3QRXA 4GNKB 1KFUL 2F33A 1RTP1 2A4JA 2BKIB 4NQGA 4XYNA 4YGEB 2L51A 3ZNIA 5KTYA 2LP2A 2WCEA 1QLSA 1NX2A 1ODBA 2K7DA 2JZIA 2K0JA 1XYDA 2AMIA 3NXAA 4GPLB 2LUXA 2BECA 1CM1A 1L2OC 2MBXA 2NLNA 1HT9A 1LINA 2WC8A 1MQ1A 1N65A 1Q80A 1DTLA 1DF0A 3BUWB 1SCMC 1SPYA 1KK7Z 4PCWA 5AERA 4I5NB 4PHKA 4NDBA 2BL0C 3AAKA 1BG1A 2EC6C 1QX5B 1K2HA 4TNCA 2FOTA 1RECA 1DGVA 1EH2A 3LL8B 4HREE 2BCXA 4ORAB 4JQ0D 1QTXA 1SBJA 2MLFC 4L9MA 1TOPA 1IRJA 4OVNF 3TUYC 1S3PA 1PULA 5CSFA 4ZCVA 1PK0D 2PSRA 2KDHA 1NX0A 2E6WA 3EVVA 1BR1B 3AAJA 1QASA 1AP4A 3PALA 1XFZO 1PVAA 3GOFA 1UWOA 1EXRA 1TN4A 1CDMA 2K2AA 1QS7A 1PALA 3TS5C 2OPOA 5DKNA 1LXFC 1S1EA 1MR8A 2KFGA 2MJWB 1AK8A 2L5XB 3M0WA 1F4OA 5BPJA 1NWDA 5B8IB 1SL7A 3PN7C 4GBAA 5CSIA 1W7JB 1TNWA 2JXCA 3NSLA 1JFKA 2VRGA 1B1GA 2LVVA 4A4CA 2JNXA 2LP3A 2I94A 1B8RA 3BUOB 4P2YB 2DOQA 5HKWA 5GQQC 1IQ5A 3BUMB 1F71A 5D7FA 2WCBA 1Y0VH 1E8AA 1ZUZA 2FCEA 1LVCD 2Y5IA 1L2OB 1OMDA 1LKJA 4PE7A 1DJXA 3LK1A 1G33A 1QX7A 2EGDA 5KU1A 1ZACA 1RWYA 1SCMB 2WCFA 2GGZA 2COLB 2LV7A 1CM4A 2GGMA 2P6BB 1OMVA 4UPGA 2LNKA 2BL0B 2BBMA 2H2KA 4PE0A 1MF8B 1EJ3A 1UURA 2MLEC 2EC6B 2LM5A 3DF0A 2I7AA 1YX8A 2LMVA 1D1OA 1XVJA 3DVJA 3VRQA 2JT8A 1KCYA 1TCFA 1B8LA 2K2FA 3AKBA 1FPWA 3EVRA 4GUKA 2OTGC 3A8RA 3TUYB 5TNCA 2KAYA 3D0YA 2QACA 2LAPA 2JTTA 3I5IC 4PALA 1TNPA 4BY5A 1CDPA 1CLBA 3JTDC 1UUSA 5K89A 1G8IA 2KQ6A 1QLKA 2WORA 3HX4A 4E68A 1NIWA 2JOJA 2CT9A 3D10A 1RJVA 1J1DA 4MVFA 3TDIA 4QJ5B 1ALVA 1BLQA 1SR6C 3TS5B 1TTXA 1WRZA 1A2XA 2O5GA 1YR5A 1MXEA 1JF0A 3DVMA 3PN7B 4C0LA 4OKHA 1CDNA 3CTNA 2NCOA 3PSRA 4USLA 5D69A 2LVJA 4C0JA 1QJTA 1CFDA 2KNEA 2D8NA 4QJ3B 2L50A 2ZNEA 1J1EA 1IGVA 1WLZA 1U5IA 1H8BA 1K95A 1TIZA 1MWNA 1ZMZA 2HQ8A 1A75A 3O2PA 4FTGA 4JWQA 2JT0A 1M46A 1EL4A 2QPTA 4WQ2A 1CKKA 1SY9A 4GFTA 1CFCA 4YGBB 1R2UA 4YBHB 2LC5A 5ER5A 3A4UB 1UHIA 2LHLA 1QV0A 1XK4A 2KBIA 4R1EA 1PSBA 4N1FA 2M1UA 1BT6A 3DD4A 2BKHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LLS A;  2F8P A;  4OCI A;  1SMG A;  2ZRT A;  1SRA A;  3BUN B;  1NPQ A;  1PRW A;  3IQQ A;  2M7L A;  2Y4Q A;  1YTZ C;  3PAT A;  2M0R A;  4AQI A;  3PLF B;  1OZO A;  1QIV A;  2BE4 A;  2L0P A;  2OTG B;  3GK2 A;  1Y1X A;  4M2O A;  2H61 C;  4OV2 A;  1UHH A;  3DVK A;  4XJK B;  3SJS A;  1Y6W A;  3I5I B;  4GGF C;  4N5X A;  3NSI A;  1QV1 A;  3JTD B;  1SNL A;  4MRY A;  5AAN A;  2MA2 A;  1C7V A;  4M2P A;  1DJI A;  5IBW A;  2GV5 A;  1F4Q A;  1SR6 B;  2WOS A;  1CFF A;  1SCV A;  2KI4 C;  2TN4 A;  2KAV A;  2JRF A;  3PFV A;  1K93 D;  2ZN9 A;  4CLN A;  2JNF A;  4MLW A;  2FJU B;  1M63 B;  1JFJ A;  1AJ5 A;  1C7W A;  1QVI Y;  1BU3 A;  1QVI Z;  2KAX A;  1IJ5 A;  5I8N A;  1AUI B;  1NX3 A;  3SG7 A;  3K21 A;  4I5J A;  1YRU B;  4PE4 A;  2Q4U A;  3KPX A;  1NUB A;  3SG6 A;  1UHJ A;  1KFX S;  1DJG A;  1JF2 A;  2CNP A;  4DUQ A;  1CMG A;  2ZKM X;  1S6C A;  1TNX A;  4I5L B;  1N2D A;  2JC2 A;  1IWQ A;  3OB2 B;  1BR4 B;  4U8D A;  1ALW A;  2PRU A;  1JC2 A;  2AUC A;  2MRD A;  4MZJ A;  3GK1 A;  2K7O A;  1J55 A;  3SG5 A;  2Y1M A;  3BUX B;  4WRI A;  1KSO A;  2JQ6 A;  2KFF A;  1KK8 C;  3SG4 A;  3CS1 A;  1JSA A;  4CPV A;  2JTZ A;  1SK6 D;  2JT3 A;  2F3Y A;  1YRT B;  1AJ4 A;  1W7I B;  2F3Z A;  3LK0 A;  1EG4 A;  1WRK A;  3OHM B;  3EKJ A;  5ER4 X;  1OOJ A;  1CNP A;  4MZK A;  3PM8 A;  3I5F C;  4MN0 A;  1GJY A;  1CMF A;  4ETO A;  1YVH A;  1F8H A;  2LLU A;  2O60 A;  1F70 A;  1UHK A;  2M1K B;  1L7Z A;  2F2O A;  3ICB A;  4ORC B;  1RFJ A;  1J7P A;  2KI4 B;  3IQO A;  2BCB A;  1K96 A;  1UP5 A;  1XFW O;  2ZRS A;  3VRP A;  4CFQ A;  3BOW B;  1CLL A;  3KF9 A;  5AXI A;  4GGN A;  1CDL A;  2CBL A;  3O6B A;  2KYC A;  1B7T Y;  2EHB A;  2M9G A;  4GAO A;  1B7T Z;  4PHN A;  3WXA A;  1XFU O;  4AQJ A;  4IL1 A;  4BY4 A;  2Y1N A;  3EK4 A;  3OP0 A;  3LLE A;  1G4Y R;  1JUO A;  1H4B A;  1PSR A;  1KQV A;  2HF5 A;  1DJH A;  2K7B A;  2ZFD A;  5J3X A;  2CXJ A;  1K9P A;  3SIA A;  1FI6 A;  1J7R A;  1MXL C;  3KO0 A;  1XO5 A;  1NCZ A;  3FWB A;  2JU0 A;  1YX7 A;  2JUL A;  2KYF A;  3JVT C;  4CID A;  1DVI A;  1KK8 B;  1S5G Y;  4P5O E;  1ZFS A;  1S5G Z;  2BCA A;  3E3R A;  3GK4 X;  3SG3 A;  3I5G C;  1JWD A;  2HQW A;  1XFX O;  2BBN A;  2SCP A;  3TDU A;  1FI5 A;  3CZT X;  5HLV A;  2I2R E;  3WNX B;  1KFU S;  1M45 A;  2IS9 A;  2R2I A;  3CWG A;  1DF0 B;  1YUU A;  3EK7 A;  5JOL A;  1YUT A;  2LMU A;  2I18 A;  5DKQ A;  1IG5 A;  2L4I A;  3VRO A;  4FQO A;  1TCO B;  2LCP A;  3I5F B;  1KSM A;  5DKR A;  3NSO A;  1NSH A;  1TRF A;  1KQM C;  1GQM A;  1A4P A;  1UHN A;  1V1F A;  3KHE A;  1F55 A;  1SYM A;  5I2L A;  4AOM A;  2KOT A;  2M29 A;  1JBA A;  4JPZ B;  4CFR A;  1B4C A;  1CFP A;  1NP8 A;  1RK9 A;  3WHU B;  4YRU A;  1FF1 A;  2B1U A;  1SL8 A;  2BE6 A;  3C1V A;  4YI8 A;  1V1G A;  3MSE B;  2M97 A;  4YGA A;  1B47 A;  3I5H C;  3ZWH A;  1DT7 B;  1KK7 Y;  1OSA A;  4PE1 A;  1WLM A;  1DJW A;  1WY9 A;  1A29 A;  3HCM A;  2AAO A;  4MZL A;  1BJF A;  1MUX A;  1ZOT B;  1S26 D;  2KFH A;  5KSZ A;  3OX6 A;  2K7C A;  4MRX A;  1GGZ A;  5FYX A;  3VRR A;  2NCP A;  4XJK A;  3NSK A;  2WND A;  1M31 A;  1J7Q A;  2PVB A;  5HLO A;  1QXP A;  1YUS A;  3JVT B;  1AVS A;  1CTR A;  1NYA A;  1FW4 A;  2JPT A;  2M8U A;  3O78 A;  2K8M B;  4QJ4 B;  1KWO C;  1QX2 A;  4DCK A;  3DVE A;  1XFV O;  1WRL A;  3I5G B;  4YGC B;  3FS7 A;  5F6T A;  2LLT A;  4C0K A;  1LA3 A;  4OR9 B;  2KI6 D;  1DMO A;  2NZ0 A;  1Y1A A;  1Y1U A;  2OS8 C;  2KBM A;  1KFX L;  2RGI A;  4DRW A;  1F54 A;  2F2P A;  1YVL A;  2CTN A;  3KEV A;  1PVB A;  1K90 D;  1S36 A;  2HET A;  1XK4 C;  3CGA A;  1OMR A;  1NX1 A;  1HQV A;  1QAT A;  1OQP A;  2PAL A;  2M7N A;  2KGR A;  1NCX A;  3CR2 A;  1RRO A;  4F0Z B;  1KQM B;  3DF0 B;  5AFP A;  3TZ1 A;  5CSJ A;  1YUR A;  2E30 A;  3H4S E;  1B9A A;  2KQY A;  4YGD B;  1WDC C;  1IH0 A;  1BMO A;  4DIR A;  1XFY O;  3F45 A;  2LE9 B;  1GGW A;  1K94 A;  5AEQ A;  2HPS A;  2CCM A;  4PHJ A;  1K9U A;  1DGU A;  2NXQ A;  3D0Y B;  1CLM A;  1K9K A;  3FWC A;  3OX5 A;  1S6I A;  5CPV A;  5HYD A;  1C07 A;  2LVI A;  3BYA A;  4HRG A;  2FCD A;  2KSP A;  4N1G A;  3IF7 A;  3TDZ A;  3BQ3 A;  3SG2 A;  1AHR A;  5I2O A;  3I5H B;  5I2Q A;  1FBV A;  3OB1 B;  3EKH A;  4ICB A;  2MHH A;  1J7O A;  1K8U A;  2KI6 C;  3RLZ A;  3VGO A;  4Q04 A;  2LAN A;  5CSN A;  1IQ3 A;  4ORB B;  3RM1 A;  2L4H A;  3AKA A;  4WQ3 A;  4ZCU A;  1M39 A;  4A4B A;  1S6J A;  2H61 A;  1QIW A;  3O4Y A;  4GGF A;  1TNQ A;  1BOC A;  2ZND A;  4NDC A;  1SL9 A;  2M3W A;  2MAZ A;  3WHT B;  1XA5 A;  2M49 B;  1KWO B;  1DJZ A;  2V53 A;  1U5I B;  3BXK A;  4PHM A;  2LVK A;  1N0Y A;  4MEW A;  1A75 B;  1NCY A;  2OS8 B;  1B8C A;  2G9B A;  2K61 A;  1IJ6 A;  3BOW A;  2G2B A;  4YI9 A;  1CB1 A;  1SKT A;  3EK8 A;  3EVU A;  4PDZ A;  1IKU A;  1X02 A;  3SIB A;  4MSP A;  2JXL A;  4M2Q A;  4HRH A;  2KHN A;  1A03 A;  3LCP C;  5HKZ A;  1LA0 A;  2LUC A;  2LMT A;  3CR5 X;  4DS7 A;  2KGB C;  2L2E A;  3VRN A;  1OE9 B;  1BF5 A;  4MBE A;  5G08 A;  1MHO A;  1VRK A;  1EG3 A;  2LHI A;  4D1E A;  2L98 A;  1OZS A;  1WDC B;  1BOD A;  4I5K A;  1SW8 A;  2Q91 A;  5PAL A;  5JJG A;  2ZN8 A;  5HKY A;  4NDD A;  4HSZ A;  2PAS A;  3FIA A;  3CLN A;  2PMY A;  3CR4 X;  2SAS A;  1R6P A;  1DJY A;  2JWW A;  2ISD A;  3QRX A;  4GNK B;  1KFU L;  2F33 A;  1RTP 1;  2A4J A;  2BKI B;  4NQG A;  4XYN A;  4YGE B;  2L51 A;  3ZNI A;  5KTY A;  2LP2 A;  2WCE A;  1QLS A;  1NX2 A;  1ODB A;  2K7D A;  2JZI A;  2K0J A;  1XYD A;  2AMI A;  3NXA A;  4GPL B;  2LUX A;  2BEC A;  1CM1 A;  1L2O C;  2MBX A;  2NLN A;  1HT9 A;  1LIN A;  2WC8 A;  1MQ1 A;  1N65 A;  1Q80 A;  1DTL A;  1DF0 A;  3BUW B;  1SCM C;  1SPY A;  1KK7 Z;  4PCW A;  5AER A;  4I5N B;  4PHK A;  4NDB A;  2BL0 C;  3AAK A;  1BG1 A;  2EC6 C;  1QX5 B;  1K2H A;  4TNC A;  2FOT A;  1REC A;  1DGV A;  1EH2 A;  3LL8 B;  4HRE E;  2BCX A;  4ORA B;  4JQ0 D;  1QTX A;  1SBJ A;  2MLF C;  4L9M A;  1TOP A;  1IRJ A;  4OVN F;  3TUY C;  1S3P A;  1PUL A;  5CSF A;  4ZCV A;  1PK0 D;  2PSR A;  2KDH A;  1NX0 A;  2E6W A;  3EVV A;  1BR1 B;  3AAJ A;  1QAS A;  1AP4 A;  3PAL A;  1XFZ O;  1PVA A;  3GOF A;  1UWO A;  1EXR A;  1TN4 A;  1CDM A;  2K2A A;  1QS7 A;  1PAL A;  3TS5 C;  2OPO A;  5DKN A;  1LXF C;  1S1E A;  1MR8 A;  2KFG A;  2MJW B;  1AK8 A;  2L5X B;  3M0W A;  1F4O A;  5BPJ A;  1NWD A;  5B8I B;  1SL7 A;  3PN7 C;  4GBA A;  5CSI A;  1W7J B;  1TNW A;  2JXC A;  3NSL A;  1JFK A;  2VRG A;  1B1G A;  2LVV A;  4A4C A;  2JNX A;  2LP3 A;  2I94 A;  1B8R A;  3BUO B;  4P2Y B;  2DOQ A;  5HKW A;  5GQQ C;  1IQ5 A;  3BUM B;  1F71 A;  5D7F A;  2WCB A;  1Y0V H;  1E8A A;  1ZUZ A;  2FCE A;  1LVC D;  2Y5I A;  1L2O B;  1OMD A;  1LKJ A;  4PE7 A;  1DJX A;  3LK1 A;  1G33 A;  1QX7 A;  2EGD A;  5KU1 A;  1ZAC A;  1RWY A;  1SCM B;  2WCF A;  2GGZ A;  2COL B;  2LV7 A;  1CM4 A;  2GGM A;  2P6B B;  1OMV A;  4UPG A;  2LNK A;  2BL0 B;  2BBM A;  2H2K A;  4PE0 A;  1MF8 B;  1EJ3 A;  1UUR A;  2MLE C;  2EC6 B;  2LM5 A;  3DF0 A;  2I7A A;  1YX8 A;  2LMV A;  1D1O A;  1XVJ A;  3DVJ A;  3VRQ A;  2JT8 A;  1KCY A;  1TCF A;  1B8L A;  2K2F A;  3AKB A;  1FPW A;  3EVR A;  4GUK A;  2OTG C;  3A8R A;  3TUY B;  5TNC A;  2KAY A;  3D0Y A;  2QAC A;  2LAP A;  2JTT A;  3I5I C;  4PAL A;  1TNP A;  4BY5 A;  1CDP A;  1CLB A;  3JTD C;  1UUS A;  5K89 A;  1G8I A;  2KQ6 A;  1QLK A;  2WOR A;  3HX4 A;  4E68 A;  1NIW A;  2JOJ A;  2CT9 A;  3D10 A;  1RJV A;  1J1D A;  4MVF A;  3TDI A;  4QJ5 B;  1ALV A;  1BLQ A;  1SR6 C;  3TS5 B;  1TTX A;  1WRZ A;  1A2X A;  2O5G A;  1YR5 A;  1MXE A;  1JF0 A;  3DVM A;  3PN7 B;  4C0L A;  4OKH A;  1CDN A;  3CTN A;  2NCO A;  3PSR A;  4USL A;  5D69 A;  2LVJ A;  4C0J A;  1QJT A;  1CFD A;  2KNE A;  2D8N A;  4QJ3 B;  2L50 A;  2ZNE A;  1J1E A;  1IGV A;  1WLZ A;  1U5I A;  1H8B A;  1K95 A;  1TIZ A;  1MWN A;  1ZMZ A;  2HQ8 A;  1A75 A;  3O2P A;  4FTG A;  4JWQ A;  2JT0 A;  1M46 A;  1EL4 A;  2QPT A;  4WQ2 A;  1CKK A;  1SY9 A;  4GFT A;  1CFC A;  4YGB B;  1R2U A;  4YBH B;  2LC5 A;  5ER5 A;  3A4U B;  1UHI A;  2LHL A;  1QV0 A;  1XK4 A;  2KBI A;  4R1E A;  1PSB A;  4N1F A;  2M1U A;  1BT6 A;  3DD4 A;  2BKH B; 
#chains in the Genus database with same CATH topology
 2LLS A;  2F8P A;  4OCI A;  1SMG A;  4F7F A;  2ZRT A;  1SRA A;  3BUN B;  1NPQ A;  1PRW A;  3IQQ A;  2M7L A;  2Y4Q A;  1YTZ C;  3PAT A;  2M0R A;  4AQI A;  3PLF B;  1OZO A;  1QIV A;  2BE4 A;  2KPH A;  3R1P A;  2L0P A;  2OTG B;  2JPO A;  3GK2 A;  1Y1X A;  4M2O A;  3L4L A;  2H61 C;  4OV2 A;  1UHH A;  3DVK A;  4XJK B;  2FJY A;  3SJS A;  1Y6W A;  3I5I B;  4GGF C;  4N5X A;  3NSI A;  1QV1 A;  3JTD B;  1SNL A;  4MRY A;  5AAN A;  2MA2 A;  1C7V A;  4M2P A;  1DJI A;  5IBW A;  2GV5 A;  1F4Q A;  1SR6 B;  2WOS A;  1CFF A;  1SCV A;  2KI4 C;  2TN4 A;  3S0A A;  2KAV A;  2JRF A;  3PFV A;  1K93 D;  2ZN9 A;  4CLN A;  2JNF A;  4MLW A;  2FJU B;  1M63 B;  1JFJ A;  1AJ5 A;  1C7W A;  1QVI Y;  1BU3 A;  1QVI Z;  2KAX A;  1IJ5 A;  5I8N A;  1AUI B;  1NX3 A;  3SG7 A;  3K21 A;  5FI6 A;  4I5J A;  1YRU B;  4PE4 A;  2Q4U A;  3KPX A;  1NUB A;  3SG6 A;  4JD9 A;  1UHJ A;  5I94 A;  1KFX S;  2L5Y A;  1DJG A;  1JF2 A;  2CNP A;  1XFR A;  2KLD A;  3DYE A;  4DUQ A;  2ZKM X;  1S6C A;  1CMG A;  1TNX A;  4I5L B;  1N2D A;  2JC2 A;  1IWQ A;  3OB2 B;  1BR4 B;  4U8D A;  1ALW A;  2PRU A;  2H8V A;  2AUC A;  2MRD A;  2WCK A;  4MZJ A;  1JC2 A;  3GK1 A;  2K7O A;  1J55 A;  3SG5 A;  2Y1M A;  3BUX B;  4WRI A;  1KSO A;  2JQ6 A;  2KFF A;  1KK8 C;  3SG4 A;  3CS1 A;  1JSA A;  4CPV A;  2JTZ A;  1SK6 D;  2JT3 A;  2F3Y A;  3S0F A;  1YRT B;  1AJ4 A;  1W7I B;  2F3Z A;  3LK0 A;  1EG4 A;  1WRK A;  3OHM B;  3B86 A;  3EKJ A;  5ER4 X;  3BFH A;  1OOJ A;  1CNP A;  4MZK A;  3PM8 A;  3I5F C;  2QEV A;  2QEO A;  4MN0 A;  1GJY A;  1CMF A;  4ETO A;  1YVH A;  1F8H A;  2LLU A;  2O60 A;  1F70 A;  1UHK A;  2M1K B;  1L7Z A;  2F2O A;  3ICB A;  4ORC B;  1RFJ A;  1J7P A;  2KI4 B;  3IQO A;  2BCB A;  1K96 A;  1UP5 A;  1XFW O;  2ZRS A;  3VRP A;  4CFQ A;  3BOW B;  1CLL A;  2P71 A;  3KF9 A;  5AXI A;  4GGN A;  1CDL A;  2CBL A;  3O6B A;  2KYC A;  1B7T Y;  2EHB A;  2M9G A;  4GAO A;  1B7T Z;  3B87 A;  4PHN A;  1XFU O;  3WXA A;  4IL1 A;  4AQJ A;  4BY4 A;  2Y1N A;  3EK4 A;  3OP0 A;  3LLE A;  1G4Y R;  1JUO A;  1H4B A;  1PSR A;  1KQV A;  2HF5 A;  1DJH A;  2K7B A;  2WCL A;  2ZFD A;  5J3X A;  2CXJ A;  1K9P A;  3SIA A;  1FI6 A;  1J7R A;  1MXL C;  2BAP A;  1XO5 A;  3KO0 A;  1NCZ A;  3FWB A;  3R1V A;  2JU0 A;  1YX7 A;  2JUL A;  2KYF A;  2PQL A;  3D74 A;  3FE8 A;  1DQE A;  3JVT C;  4CID A;  1DVI A;  2K60 A;  1KK8 B;  1S5G Y;  4P5O E;  1ZFS A;  1S5G Z;  2BCA A;  3E3R A;  3GK4 X;  3SG3 A;  3I5G C;  1JWD A;  2HQW A;  1XFX O;  2BBN A;  2SCP A;  3TDU A;  3B7A A;  3CZT X;  5HLV A;  2I2R E;  3WNX B;  1FI5 A;  1KFU S;  3D73 A;  1M45 A;  2IS9 A;  2R2I A;  3CWG A;  1DF0 B;  1YUU A;  3EK7 A;  5JOL A;  1YUT A;  3S0D A;  2LMU A;  2I18 A;  5DKQ A;  1IG5 A;  2L4I A;  3S0B A;  3VRO A;  4FQO A;  1TCO B;  2LCP A;  3I5F B;  1DEK A;  1KSM A;  4KYN A;  5DKR A;  3NSO A;  1NSH A;  1TRF A;  1KQM C;  1GQM A;  1A4P A;  1UHN A;  1V1F A;  3KHE A;  1F55 A;  1SYM A;  5I2L A;  4AOM A;  4OZD A;  2KOT A;  2M29 A;  1JBA A;  4JPZ B;  3D77 A;  4CFR A;  1DC1 A;  1B4C A;  1CFP A;  1NP8 A;  1RK9 A;  3WHU B;  4YRU A;  1FF1 A;  2B1U A;  1SL8 A;  2BE6 A;  3C1V A;  3CZ2 A;  4YI8 A;  1V1G A;  3MSE B;  2M97 A;  4YGA A;  1B47 A;  3I5H C;  3ZWH A;  1DT7 B;  1KK7 Y;  1C3Z A;  1OSA A;  3B6X A;  4PE1 A;  1WLM A;  1DJW A;  1WY9 A;  1A29 A;  3HCM A;  2AAO A;  4MZL A;  1BJF A;  1MUX A;  1ZOT B;  1S26 D;  2KFH A;  5KSZ A;  3OX6 A;  2K7C A;  4MRX A;  1GGZ A;  5FYX A;  3VRR A;  5FI7 A;  2NCP A;  4XJK A;  3NSK A;  2WND A;  3Q8I A;  1M31 A;  4FQT A;  4JKT A;  1OOG A;  2PVB A;  1J7Q A;  5HLO A;  3CYZ A;  1QXP A;  5DIC A;  1YUS A;  3JVT B;  1AVS A;  1CTR A;  1NYA A;  1FW4 A;  2JPT A;  2M8U A;  2QDI A;  2QEB A;  3UNW A;  3O78 A;  2K8M B;  4QJ4 B;  1KWO C;  1QX2 A;  5D3O A;  4DCK A;  3DVE A;  1XFV O;  1WRL A;  3I5G B;  4YGC B;  3FS7 A;  5F6T A;  2LLT A;  4C0K A;  1LA3 A;  4INW A;  4OR9 B;  2KI6 D;  3S0G A;  1DMO A;  2NZ0 A;  1Y1A A;  1Y1U A;  1Z2C B;  2KBM A;  1KFX L;  2OS8 C;  2RGI A;  4DRW A;  1F54 A;  2F2P A;  1YVL A;  2CTN A;  2ERB A;  3KEV A;  1PVB A;  1K90 D;  1S36 A;  2HET A;  1XK4 C;  1GM0 A;  3CGA A;  1OMR A;  1NX1 A;  1HQV A;  1QAT A;  1OQP A;  2PAL A;  2M7N A;  3UO9 A;  2KGR A;  1NCX A;  3CR2 A;  1RRO A;  4F0Z B;  1KQM B;  3DF0 B;  5AFP A;  3TZ1 A;  5CSJ A;  1YUR A;  2E30 A;  3H4S E;  1B9A A;  2KQY A;  4YGD B;  1WDC C;  1IH0 A;  1BMO A;  4DIR A;  1XFY O;  3F45 A;  2LE9 B;  1GGW A;  1K94 A;  5AEQ A;  2HPS A;  3DY9 A;  1C3Y A;  2CCM A;  3BFB A;  4PHJ A;  1K9U A;  5HL1 A;  1DGU A;  2NXQ A;  3D0Y B;  1CLM A;  1K9K A;  3FWC A;  3OX5 A;  1S6I A;  5CPV A;  5HYD A;  1C07 A;  2LVI A;  3BYA A;  4HRG A;  1TUJ A;  2FCD A;  2KSP A;  3D76 A;  4N1G A;  3IF7 A;  3SS3 A;  3BQ3 A;  3TDZ A;  3SG2 A;  1AHR A;  5I2O A;  3I5H B;  3NGV A;  5I2Q A;  2WC5 A;  1FBV A;  3OB1 B;  1LS8 A;  3EKH A;  4ICB A;  5EL2 A;  3PM2 A;  2YGU A;  2MHH A;  1J7O A;  1K8U A;  3FE6 A;  3EG5 B;  2KI6 C;  3RLZ A;  3VGO A;  4Q04 A;  2KLE A;  2LAN A;  5CSN A;  1IQ3 A;  4ORB B;  3RM1 A;  3FE9 A;  2L4H A;  3AKA A;  4WQ3 A;  4ZCU A;  1M39 A;  3PJI A;  4A4B A;  1S6J A;  2H61 A;  1QIW A;  3O4Y A;  4GGF A;  1TNQ A;  1BOC A;  2ZND A;  4NDC A;  1SL9 A;  2M3W A;  2MAZ A;  1T14 A;  3WHT B;  1XA5 A;  2M49 B;  1KWO B;  1DJZ A;  2V53 A;  1U5I B;  3BXK A;  3R1O A;  4PHM A;  2LVK A;  1N0Y A;  4MEW A;  1A75 B;  3K1E A;  1NCY A;  2L2C A;  2OS8 B;  1B8C A;  2G9B A;  3CZ1 A;  1QWV A;  3CZ0 A;  2K61 A;  1IJ6 A;  3BOW A;  2G2B A;  4YI9 A;  1OOI X;  1SKT A;  3EK8 A;  3EVU A;  4PDZ A;  1CB1 A;  1IKU A;  1X02 A;  3SIB A;  4MSP A;  2JXL A;  4M2Q A;  4HRH A;  2KHN A;  1A03 A;  3LCP C;  5HKZ A;  1LA0 A;  2LUC A;  2LMT A;  1OOF A;  3CR5 X;  4DS7 A;  2KGB C;  2L2E A;  3VRN A;  1OE9 B;  1BF5 A;  1TWO A;  4MBE A;  5G08 A;  1MHO A;  1VRK A;  1EG3 A;  2LHI A;  4D1E A;  2L98 A;  1OZS A;  1WDC B;  1BOD A;  4I5K A;  1SW8 A;  2Q91 A;  3NHT A;  5PAL A;  5JJG A;  2ZN8 A;  5HKY A;  4NDD A;  4HSZ A;  2PAS A;  3FIA A;  1ORG A;  3CLN A;  2PMY A;  3CR4 X;  2SAS A;  1R6P A;  1DJY A;  2JWW A;  2ISD A;  3QRX A;  4GNK B;  1KFU L;  2F33 A;  1RTP 1;  2A4J A;  2BKI B;  4NQG A;  4XYN A;  4YGE B;  2L51 A;  3ZNI A;  5KTY A;  2LP2 A;  2WCE A;  1QLS A;  1NX2 A;  1ODB A;  2K7D A;  2JZI A;  1W9Z A;  1XYD A;  2AMI A;  2K0J A;  2WCJ A;  2GTE A;  3L47 A;  3NXA A;  2LUX A;  2BEC A;  4GPL B;  1CM1 A;  1DEL A;  1L2O C;  2MBX A;  5FI2 A;  2NLN A;  1HT9 A;  1LIN A;  2WC8 A;  1MQ1 A;  1N65 A;  3S0E A;  1Q80 A;  1DTL A;  1DF0 A;  3BUW B;  1SCM C;  3D78 A;  3NHI A;  1SPY A;  1KK7 Z;  4PCW A;  5AER A;  4I5N B;  4PHK A;  4NDB A;  3N7H A;  1OW4 A;  2BL0 C;  3AAK A;  1BG1 A;  2EC6 C;  1QX5 B;  1OOH A;  1K2H A;  4TNC A;  2FOT A;  1REC A;  1DGV A;  1EH2 A;  3BFA A;  3LL8 B;  2BCX A;  3CDN A;  4HRE E;  1QTX A;  1SBJ A;  2MLF C;  4JQ0 D;  4ORA B;  4L9M A;  1IIO A;  1TOP A;  1IRJ A;  2P70 A;  4OVN F;  3TUY C;  3OBV A;  1S3P A;  1PUL A;  5CSF A;  4ZCV A;  3DZT A;  1PK0 D;  2PSR A;  2KDH A;  1NX0 A;  2E6W A;  3EVV A;  1BR1 B;  3AAJ A;  1QAS A;  1AP4 A;  3PAL A;  1XFZ O;  1PVA A;  3GOF A;  1UWO A;  1EXR A;  1TN4 A;  1CDM A;  3RZS A;  2K2A A;  3B88 A;  1QS7 A;  1PAL A;  1TUZ A;  3TS5 C;  2OPO A;  5DKN A;  1LXF C;  1S1E A;  1MR8 A;  2KFG A;  2MJW B;  1AK8 A;  3BJH A;  2L5X B;  3M0W A;  1F4O A;  4PT1 A;  5BPJ A;  1NWD A;  3CAB A;  5B8I B;  1SL7 A;  3PN7 C;  4GBA A;  5CSI A;  1W7J B;  1TNW A;  2JXC A;  3NSL A;  1JFK A;  2VRG A;  1B1G A;  2LVV A;  4A4C A;  2JNX A;  2LP3 A;  2I94 A;  1B8R A;  3BUO B;  4P2Y B;  2DOQ A;  5HKW A;  5GQQ C;  1IQ5 A;  3BUM B;  1SSE B;  3QME A;  1F71 A;  5D7F A;  2WCB A;  1Y0V H;  1E8A A;  2BNX A;  1ZUZ A;  2FCE A;  1LVC D;  2Y5I A;  1L2O B;  1OMD A;  1LKJ A;  4PE7 A;  1DJX A;  3LK1 A;  1QX7 A;  1G33 A;  2EGD A;  5KU1 A;  1ZAC A;  3V2L A;  1RWY A;  1SCM B;  2WCF A;  2GGZ A;  2COL B;  2LV7 A;  1CM4 A;  2GGM A;  2P6B B;  1OMV A;  4UPG A;  2LNK A;  2BL0 B;  2BBM A;  2H2K A;  4PE0 A;  1MF8 B;  1EJ3 A;  1UUR A;  2MLE C;  2EC6 B;  2LM5 A;  3DF0 A;  2I7A A;  1YX8 A;  2LMV A;  1D1O A;  1XVJ A;  3DVJ A;  4IJ7 A;  3VRQ A;  2JT8 A;  1KCY A;  1TCF A;  1B8L A;  3O4X A;  2K2F A;  3AKB A;  1FPW A;  3EVR A;  4GUK A;  2OTG C;  3A8R A;  3TUY B;  5TNC A;  2KAY A;  3D0Y A;  3DXL A;  1Z4H A;  2QAC A;  2LAP A;  2JTT A;  3I5I C;  4PAL A;  1TNP A;  4BY5 A;  1CDP A;  1CLB A;  3JTD C;  1UUS A;  5K89 A;  1G8I A;  2KQ6 A;  1QLK A;  2WOR A;  3HX4 A;  3OGN A;  4E68 A;  1NIW A;  2JOJ A;  2CT9 A;  3D10 A;  1RJV A;  1J1D A;  4MVF A;  3TDI A;  3VB1 A;  4QJ5 B;  1ALV A;  1BLQ A;  1SR6 C;  3R72 A;  3TS5 B;  1TTX A;  1WRZ A;  1A2X A;  2O5G A;  1YR5 A;  1MXE A;  1JF0 A;  2WCH A;  3L4A A;  3DVM A;  3PN7 B;  2WCM A;  4OKH A;  3SS4 A;  4C0L A;  1CDN A;  3CTN A;  2NCO A;  3PSR A;  3D75 A;  4USL A;  3IVT A;  5D69 A;  2LVJ A;  4C0J A;  1QJT A;  1CFD A;  2KNE A;  2D8N A;  4QJ3 B;  2L50 A;  2ZNE A;  1J1E A;  3SS5 A;  2WC6 A;  1IGV A;  1WLZ A;  1U5I A;  1H8B A;  1K95 A;  1TIZ A;  1MWN A;  4INX A;  1ZMZ A;  2HQ8 A;  1A75 A;  3O2P A;  4FTG A;  4JWQ A;  2JT0 A;  1M46 A;  1EL4 A;  2QPT A;  4WQ2 A;  1CKK A;  1SY9 A;  4GFT A;  1CFC A;  4YGB B;  1R2U A;  4YBH B;  2LC5 A;  2QEH A;  5ER5 A;  3A4U B;  1UHI A;  2LHL A;  1QV0 A;  1XK4 A;  1P28 A;  2KBI A;  1PSB A;  4R1E A;  2PYQ A;  4N1F A;  2M1U A;  1BT6 A;  3DD4 A;  2BKH B; 
#chains in the Genus database with same CATH homology
 2LLS A;  2F8P A;  4OCI A;  1SMG A;  2ZRT A;  1SRA A;  3BUN B;  1NPQ A;  1PRW A;  3IQQ A;  2M7L A;  2Y4Q A;  1YTZ C;  3PAT A;  2M0R A;  4AQI A;  3PLF B;  1OZO A;  1QIV A;  2BE4 A;  2L0P A;  2OTG B;  3GK2 A;  1Y1X A;  4M2O A;  2H61 C;  4OV2 A;  1UHH A;  3DVK A;  4XJK B;  3SJS A;  1Y6W A;  3I5I B;  4GGF C;  4N5X A;  3NSI A;  1QV1 A;  3JTD B;  1SNL A;  4MRY A;  5AAN A;  2MA2 A;  1C7V A;  4M2P A;  1DJI A;  5IBW A;  2GV5 A;  1F4Q A;  1SR6 B;  2WOS A;  1CFF A;  1SCV A;  2KI4 C;  2TN4 A;  2KAV A;  2JRF A;  3PFV A;  1K93 D;  2ZN9 A;  4CLN A;  2JNF A;  4MLW A;  2FJU B;  1M63 B;  1JFJ A;  1AJ5 A;  1C7W A;  1QVI Y;  1BU3 A;  1QVI Z;  2KAX A;  1IJ5 A;  5I8N A;  1AUI B;  1NX3 A;  3SG7 A;  3K21 A;  4I5J A;  1YRU B;  4PE4 A;  2Q4U A;  3KPX A;  1NUB A;  3SG6 A;  1UHJ A;  1KFX S;  1DJG A;  1JF2 A;  2CNP A;  4DUQ A;  1CMG A;  2ZKM X;  1S6C A;  1TNX A;  4I5L B;  1N2D A;  2JC2 A;  1IWQ A;  3OB2 B;  1BR4 B;  4U8D A;  1ALW A;  2PRU A;  1JC2 A;  2AUC A;  2MRD A;  4MZJ A;  3GK1 A;  2K7O A;  1J55 A;  3SG5 A;  2Y1M A;  3BUX B;  4WRI A;  1KSO A;  2JQ6 A;  2KFF A;  1KK8 C;  3SG4 A;  3CS1 A;  1JSA A;  4CPV A;  2JTZ A;  1SK6 D;  2JT3 A;  2F3Y A;  1YRT B;  1AJ4 A;  1W7I B;  2F3Z A;  3LK0 A;  1EG4 A;  1WRK A;  3OHM B;  3EKJ A;  5ER4 X;  1OOJ A;  1CNP A;  4MZK A;  3PM8 A;  3I5F C;  4MN0 A;  1GJY A;  1CMF A;  4ETO A;  1YVH A;  1F8H A;  2LLU A;  2O60 A;  1F70 A;  1UHK A;  2M1K B;  1L7Z A;  2F2O A;  3ICB A;  4ORC B;  1RFJ A;  1J7P A;  2KI4 B;  3IQO A;  2BCB A;  1K96 A;  1UP5 A;  1XFW O;  2ZRS A;  3VRP A;  4CFQ A;  3BOW B;  1CLL A;  3KF9 A;  5AXI A;  4GGN A;  1CDL A;  2CBL A;  3O6B A;  2KYC A;  1B7T Y;  2EHB A;  2M9G A;  4GAO A;  1B7T Z;  4PHN A;  3WXA A;  1XFU O;  4AQJ A;  4IL1 A;  4BY4 A;  2Y1N A;  3EK4 A;  3OP0 A;  3LLE A;  1G4Y R;  1JUO A;  1H4B A;  1PSR A;  1KQV A;  2HF5 A;  1DJH A;  2K7B A;  2ZFD A;  5J3X A;  2CXJ A;  1K9P A;  3SIA A;  1FI6 A;  1J7R A;  1MXL C;  3KO0 A;  1XO5 A;  1NCZ A;  3FWB A;  2JU0 A;  1YX7 A;  2JUL A;  2KYF A;  3JVT C;  4CID A;  1DVI A;  1KK8 B;  1S5G Y;  4P5O E;  1ZFS A;  1S5G Z;  2BCA A;  3E3R A;  3GK4 X;  3SG3 A;  3I5G C;  1JWD A;  2HQW A;  1XFX O;  2BBN A;  2SCP A;  3TDU A;  1FI5 A;  3CZT X;  5HLV A;  2I2R E;  3WNX B;  1KFU S;  1M45 A;  2IS9 A;  2R2I A;  3CWG A;  1DF0 B;  1YUU A;  3EK7 A;  5JOL A;  1YUT A;  2LMU A;  2I18 A;  5DKQ A;  1IG5 A;  2L4I A;  3VRO A;  4FQO A;  1TCO B;  2LCP A;  3I5F B;  1KSM A;  5DKR A;  3NSO A;  1NSH A;  1TRF A;  1KQM C;  1GQM A;  1A4P A;  1UHN A;  1V1F A;  3KHE A;  1F55 A;  1SYM A;  5I2L A;  4AOM A;  2KOT A;  2M29 A;  1JBA A;  4JPZ B;  4CFR A;  1B4C A;  1CFP A;  1NP8 A;  1RK9 A;  3WHU B;  4YRU A;  1FF1 A;  2B1U A;  1SL8 A;  2BE6 A;  3C1V A;  4YI8 A;  1V1G A;  3MSE B;  2M97 A;  4YGA A;  1B47 A;  3I5H C;  3ZWH A;  1DT7 B;  1KK7 Y;  1OSA A;  4PE1 A;  1WLM A;  1DJW A;  1WY9 A;  1A29 A;  3HCM A;  2AAO A;  4MZL A;  1BJF A;  1MUX A;  1ZOT B;  1S26 D;  2KFH A;  5KSZ A;  3OX6 A;  2K7C A;  4MRX A;  1GGZ A;  5FYX A;  3VRR A;  2NCP A;  4XJK A;  3NSK A;  2WND A;  1M31 A;  1J7Q A;  2PVB A;  5HLO A;  1QXP A;  1YUS A;  3JVT B;  1AVS A;  1CTR A;  1NYA A;  1FW4 A;  2JPT A;  2M8U A;  3O78 A;  2K8M B;  4QJ4 B;  1KWO C;  1QX2 A;  4DCK A;  3DVE A;  1XFV O;  1WRL A;  3I5G B;  4YGC B;  3FS7 A;  5F6T A;  2LLT A;  4C0K A;  1LA3 A;  4OR9 B;  2KI6 D;  1DMO A;  2NZ0 A;  1Y1A A;  1Y1U A;  2OS8 C;  2KBM A;  1KFX L;  2RGI A;  4DRW A;  1F54 A;  2F2P A;  1YVL A;  2CTN A;  3KEV A;  1PVB A;  1K90 D;  1S36 A;  2HET A;  1XK4 C;  3CGA A;  1OMR A;  1NX1 A;  1HQV A;  1QAT A;  1OQP A;  2PAL A;  2M7N A;  2KGR A;  1NCX A;  3CR2 A;  1RRO A;  4F0Z B;  1KQM B;  3DF0 B;  5AFP A;  3TZ1 A;  5CSJ A;  1YUR A;  2E30 A;  3H4S E;  1B9A A;  2KQY A;  4YGD B;  1WDC C;  1IH0 A;  1BMO A;  4DIR A;  1XFY O;  3F45 A;  2LE9 B;  1GGW A;  1K94 A;  5AEQ A;  2HPS A;  2CCM A;  4PHJ A;  1K9U A;  1DGU A;  2NXQ A;  3D0Y B;  1CLM A;  1K9K A;  3FWC A;  3OX5 A;  1S6I A;  5CPV A;  5HYD A;  1C07 A;  2LVI A;  3BYA A;  4HRG A;  2FCD A;  2KSP A;  4N1G A;  3IF7 A;  3TDZ A;  3BQ3 A;  3SG2 A;  1AHR A;  5I2O A;  3I5H B;  5I2Q A;  1FBV A;  3OB1 B;  3EKH A;  4ICB A;  2MHH A;  1J7O A;  1K8U A;  2KI6 C;  3RLZ A;  3VGO A;  4Q04 A;  2LAN A;  5CSN A;  1IQ3 A;  4ORB B;  3RM1 A;  2L4H A;  3AKA A;  4WQ3 A;  4ZCU A;  1M39 A;  4A4B A;  1S6J A;  2H61 A;  1QIW A;  3O4Y A;  4GGF A;  1TNQ A;  1BOC A;  2ZND A;  4NDC A;  1SL9 A;  2M3W A;  2MAZ A;  3WHT B;  1XA5 A;  2M49 B;  1KWO B;  1DJZ A;  2V53 A;  1U5I B;  3BXK A;  4PHM A;  2LVK A;  1N0Y A;  4MEW A;  1A75 B;  1NCY A;  2OS8 B;  1B8C A;  2G9B A;  2K61 A;  1IJ6 A;  3BOW A;  2G2B A;  4YI9 A;  1CB1 A;  1SKT A;  3EK8 A;  3EVU A;  4PDZ A;  1IKU A;  1X02 A;  3SIB A;  4MSP A;  2JXL A;  4M2Q A;  4HRH A;  2KHN A;  1A03 A;  3LCP C;  5HKZ A;  1LA0 A;  2LUC A;  2LMT A;  3CR5 X;  4DS7 A;  2KGB C;  2L2E A;  3VRN A;  1OE9 B;  1BF5 A;  4MBE A;  5G08 A;  1MHO A;  1VRK A;  1EG3 A;  2LHI A;  4D1E A;  2L98 A;  1OZS A;  1WDC B;  1BOD A;  4I5K A;  1SW8 A;  2Q91 A;  5PAL A;  5JJG A;  2ZN8 A;  5HKY A;  4NDD A;  4HSZ A;  2PAS A;  3FIA A;  3CLN A;  2PMY A;  3CR4 X;  2SAS A;  1R6P A;  1DJY A;  2JWW A;  2ISD A;  3QRX A;  4GNK B;  1KFU L;  2F33 A;  1RTP 1;  2A4J A;  2BKI B;  4NQG A;  4XYN A;  4YGE B;  2L51 A;  3ZNI A;  5KTY A;  2LP2 A;  2WCE A;  1QLS A;  1NX2 A;  1ODB A;  2K7D A;  2JZI A;  2K0J A;  1XYD A;  2AMI A;  3NXA A;  4GPL B;  2LUX A;  2BEC A;  1CM1 A;  1L2O C;  2MBX A;  2NLN A;  1HT9 A;  1LIN A;  2WC8 A;  1MQ1 A;  1N65 A;  1Q80 A;  1DTL A;  1DF0 A;  3BUW B;  1SCM C;  1SPY A;  1KK7 Z;  4PCW A;  5AER A;  4I5N B;  4PHK A;  4NDB A;  2BL0 C;  3AAK A;  1BG1 A;  2EC6 C;  1QX5 B;  1K2H A;  4TNC A;  2FOT A;  1REC A;  1DGV A;  1EH2 A;  3LL8 B;  4HRE E;  2BCX A;  4ORA B;  4JQ0 D;  1QTX A;  1SBJ A;  2MLF C;  4L9M A;  1TOP A;  1IRJ A;  4OVN F;  3TUY C;  1S3P A;  1PUL A;  5CSF A;  4ZCV A;  1PK0 D;  2PSR A;  2KDH A;  1NX0 A;  2E6W A;  3EVV A;  1BR1 B;  3AAJ A;  1QAS A;  1AP4 A;  3PAL A;  1XFZ O;  1PVA A;  3GOF A;  1UWO A;  1EXR A;  1TN4 A;  1CDM A;  2K2A A;  1QS7 A;  1PAL A;  3TS5 C;  2OPO A;  5DKN A;  1LXF C;  1S1E A;  1MR8 A;  2KFG A;  2MJW B;  1AK8 A;  2L5X B;  3M0W A;  1F4O A;  5BPJ A;  1NWD A;  5B8I B;  1SL7 A;  3PN7 C;  4GBA A;  5CSI A;  1W7J B;  1TNW A;  2JXC A;  3NSL A;  1JFK A;  2VRG A;  1B1G A;  2LVV A;  4A4C A;  2JNX A;  2LP3 A;  2I94 A;  1B8R A;  3BUO B;  4P2Y B;  2DOQ A;  5HKW A;  5GQQ C;  1IQ5 A;  3BUM B;  1F71 A;  5D7F A;  2WCB A;  1Y0V H;  1E8A A;  1ZUZ A;  2FCE A;  1LVC D;  2Y5I A;  1L2O B;  1OMD A;  1LKJ A;  4PE7 A;  1DJX A;  3LK1 A;  1G33 A;  1QX7 A;  2EGD A;  5KU1 A;  1ZAC A;  1RWY A;  1SCM B;  2WCF A;  2GGZ A;  2COL B;  2LV7 A;  1CM4 A;  2GGM A;  2P6B B;  1OMV A;  4UPG A;  2LNK A;  2BL0 B;  2BBM A;  2H2K A;  4PE0 A;  1MF8 B;  1EJ3 A;  1UUR A;  2MLE C;  2EC6 B;  2LM5 A;  3DF0 A;  2I7A A;  1YX8 A;  2LMV A;  1D1O A;  1XVJ A;  3DVJ A;  3VRQ A;  2JT8 A;  1KCY A;  1TCF A;  1B8L A;  2K2F A;  3AKB A;  1FPW A;  3EVR A;  4GUK A;  2OTG C;  3A8R A;  3TUY B;  5TNC A;  2KAY A;  3D0Y A;  2QAC A;  2LAP A;  2JTT A;  3I5I C;  4PAL A;  1TNP A;  4BY5 A;  1CDP A;  1CLB A;  3JTD C;  1UUS A;  5K89 A;  1G8I A;  2KQ6 A;  1QLK A;  2WOR A;  3HX4 A;  4E68 A;  1NIW A;  2JOJ A;  2CT9 A;  3D10 A;  1RJV A;  1J1D A;  4MVF A;  3TDI A;  4QJ5 B;  1ALV A;  1BLQ A;  1SR6 C;  3TS5 B;  1TTX A;  1WRZ A;  1A2X A;  2O5G A;  1YR5 A;  1MXE A;  1JF0 A;  3DVM A;  3PN7 B;  4C0L A;  4OKH A;  1CDN A;  3CTN A;  2NCO A;  3PSR A;  4USL A;  5D69 A;  2LVJ A;  4C0J A;  1QJT A;  1CFD A;  2KNE A;  2D8N A;  4QJ3 B;  2L50 A;  2ZNE A;  1J1E A;  1IGV A;  1WLZ A;  1U5I A;  1H8B A;  1K95 A;  1TIZ A;  1MWN A;  1ZMZ A;  2HQ8 A;  1A75 A;  3O2P A;  4FTG A;  4JWQ A;  2JT0 A;  1M46 A;  1EL4 A;  2QPT A;  4WQ2 A;  1CKK A;  1SY9 A;  4GFT A;  1CFC A;  4YGB B;  1R2U A;  4YBH B;  2LC5 A;  5ER5 A;  3A4U B;  1UHI A;  2LHL A;  1QV0 A;  1XK4 A;  2KBI A;  4R1E A;  1PSB A;  4N1F A;  2M1U A;  1BT6 A;  3DD4 A;  2BKH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...