2EC6B

Placopecten striated muscle myosin ii
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
133
structure length
126
Chain Sequence
MQEMKEAFTMIDDGFIDINDLKEEFSSLGRTPLTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFGMFDEDATKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVRFVAMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain
publication title Rigor-like structures from muscle myosins reveal key mechanical elements in the transduction pathways of this allosteric motor.
pubmed doi rcsb
source organism Placopecten magellanicus
molecule tags Contractile protein
total genus 16
structure length 126
sequence length 133
ec nomenclature
pdb deposition date 2007-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2ec6B01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2ec6B02
4IL1A 1EJ3A 2LANA 1ZOTB 2KFHA 2PALA 5AXIA 1K94A 3VRNA 2KAYA 2LVKA 1UHJA 3EK7A 1M31A 5DKQA 4DUQA 3SG5A 1SPYA 1K9PA 4OR9B 1PRWA 3M0WA 3BUOB 1EL4A 1TNQA 2KBMA 3DD4A 4ORBB 5AFPA 1MR8A 1NX1A 4YRUA 2K0JA 3TZ1A 2LP2A 5JJGA 3RLZA 3NSLA 2E6WA 1DJXA 1W7JB 4HREE 2M9GA 5TNCA 5AERA 3BOWA 3OX6A 5CSNA 4DIRA 3PALA 2P6BB 1HQVA 1UHKA 1IRJA 1EG3A 3LL8B 5FYXA 1XK4C 3TUYB 2FJUB 1V1FA 1LINA 1IH0A 4WQ3A 2JQ6A 1SL7A 1IWQA 2M97A 5I8NA 2I7AA 2KAXA 1CFDA 4GUKA 1QIVA 5CSFA 2M49B 2K7BA 4XJKA 5CPVA 4MVFA 1CLBA 1CM4A 2KYCA 1DJYA 3O2PA 3BUMB 3I5FB 1KSMA 3IQQA 1UP5A 1TIZA 1S36A 3EVUA 2LLTA 2K2AA 3PATA 3FWCA 1V1GA 1XFWO 2KAVA 1K9KA 2CCMA 2JNXA 1RFJA 4QJ5B 1DJHA 2BKHB 4I5NB 1K90D 1KQVA 1BLQA 1KFUS 1Y6WA 1CFCA 4HRGA 1XK4A 1BG1A 4DS7A 2AUCA 3E3RA 4CFRA 2JT3A 1PALA 3KHEA 5AEQA 1F4OA 3OHMB 1RROA 2Y5IA 3QRXA 4GGNA 5J3XA 2LVVA 3A4UB 2WCFA 2WNDA 4N1GA 4YGEB 1K96A 3C1VA 3WNXB 1S5GZ 4N1FA 5JOLA 1AK8A 1FF1A 1QS7A 1XVJA 1AHRA 1K9UA 3OB2B 1KK8B 5F6TA 1LKJA 3I5HC 3NXAA 2GGZA 3LK1A 1S6IA 2JXLA 2BCAA 1NIWA 2V53A 2WORA 3H4SE 4OKHA 2KYFA 2Y1MA 3O6BA 1NX2A 2SASA 5KU1A 2O60A 4FTGA 1BR4B 5G08A 1CDLA 2ZRSA 4HRHA 4YI8A 3OB1B 4GBAA 1K2HA 3AKBA 2BBNA 1XFYO 1TOPA 4OCIA 3NSIA 1JWDA 3TDIA 1IKUA 1CB1A 1UHNA 1KQMB 2H61A 4WRIA 4ETOA 5I2OA 2JRFA 1QVIZ 1DVIA 4NDBA 1C7VA 2HQWA 2LV7A 1J7OA 2F2PA 2M0RA 1NYAA 2GV5A 1MXEA 2KFFA 1MF8B 3PFVA 4YBHB 1SCMC 1B47A 2L98A 3D0YB 1IJ5A 1OOJA 1A2XA 1J7PA 2FOTA 1MUXA 4NDDA 2EC6C 4YGDB 3ZNIA 4YGAA 2HF5A 2L4HA 1DT7B 1JUOA 3NSKA 4R1EA 1SK6D 2LUXA 1XFVO 1ZACA 1ODBA 1KK7Y 1NP8A 1UHIA 4MZLA 2CTNA 1FPWA 3AKAA 1SCMB 1SW8A 1TTXA 3OP0A 1QX5B 2BKIB 2EC6B 2BL0B 1F8HA 2LMUA 1QV0A 2LE9B 1TNPA 2LUCA 4DCKA 4BY4A 3RM1A 1DJZA 2JXCA 1SKTA 3BOWB 3FIAA 2KNEA 4PCWA 1KFUL 3JVTC 1XA5A 2KGBC 1IQ5A 3JTDC 4PHNA 4MRXA 1JF0A 1RK9A 1DJIA 1XFXO 3AAJA 1SL9A 2ZNDA 4AQIA 1J7QA 1FI6A 2B1UA 1MQ1A 1CMGA 2HQ8A 3AAKA 2KDHA 4M2QA 3SG4A 4CFQA 1WLZA 2CNPA 4XJKB 3HX4A 3I5GC 5GQQC 1BF5A 1H8BA 2JWWA 3GK4X 1QLSA 3SIAA 1DF0B 3JVTB 2WC8A 2L0PA 1TNXA 2KI4C 1SR6C 3SIBA 4I5KA 1A4PA 1QX2A 3KF9A 2L50A 2WCBA 5D69A 3CS1A 1FBVA 1B1GA 1CDNA 2DOQA 4MBEA 2JULA 1QXPA 1PVAA 2NXQA 4I5LB 1K93D 3WHTB 2F3ZA 1J55A 2AAOA 1B7TY 3I5GB 3WHUB 1DF0A 1KWOC 1CTRA 1X02A 2KI4B 4C0LA 2L2EA 4F0ZB 4D1EA 1A29A 2NCOA 3I5IC 2HETA 2Y1NA 5HLOA 5K89A 2MA2A 3WXAA 1RTP1 1ZMZA 4OVNF 1CFPA 3CWGA 2H61C 2M7LA 1S1EA 1K8UA 2PVBA 1Y1AA 2JZIA 5ER4X 1BR1B 1YUTA 4A4CA 4P2YB 4ICBA 1WDCC 3KPXA 4XYNA 1CNPA 2KHNA 5D7FA 1SNLA 3CLNA 4PHMA 2L4IA 1DMOA 1K95A 4UPGA 3ZWHA 1S3PA 5ER5A 3ICBA 3SG6A 1TRFA 1PK0D 3TDUA 1XFZO 1PSRA 2MHHA 3VRRA 1ALVA 4C0JA 5I2QA 1QTXA 2IS9A 4USLA 3PLFB 4MSPA 1FW4A 4Q04A 1CDMA 1YUSA 1XO5A 1IG5A 1OZSA 3I5HB 4GFTA 2K8MB 1UURA 2Q91A 1WRKA 1WY9A 3CGAA 4PDZA 3PN7C 1KK7Z 1NCXA 1XFUO 4N5XA 2ZN8A 1CLMA 4GGFA 3DVEA 3VROA 1G4YR 4CLNA 2JPTA 2F8PA 2I18A 4PE1A 2WCEA 1AUIB 3LK0A 1Y1XA 5BPJA 4U8DA 2MJWB 1HT9A 1IJ6A 4YI9A 2LAPA 3CTNA 3EK8A 3PN7B 3SG2A 3LLEA 2PRUA 3KO0A 4FQOA 2WOSA 5CSIA 1QJTA 1Y1UA 1N65A 1RECA 1NWDA 4ORAB 1S6JA 1D1OA 1F54A 1RWYA 3FS7A 1GGWA 2JTZA 1BJFA 1TNWA 1M46A 1LA3A 2Y4QA 2ZNEA 1NCYA 1G8IA 1JF2A 2M29A 2LM5A 1G33A 4PHJA 3BUNB 1TN4A 3O78A 2LP3A 2ISDA 2JT8A 1JFKA 1H4BA 2LLSA 1JSAA 3KEVA 2VRGA 1J7RA 1MHOA 2LLUA 4MN0A 1WRLA 1QX7A 2SCPA 2OS8C 2NCPA 4OV2A 3K21A 3SG7A 1CMFA 5AANA 2OPOA 1TCOB 1YTZC 1OE9B 5HKYA 3BQ3A 4A4BA 1CKKA 1IQ3A 1UHHA 1BU3A 1B7TZ 1QIWA 3EKHA 3EK4A 3BXKA 1DGVA 1SBJA 2MLEC 3BUXB 4AOMA 1NSHA 1AP4A 1OQPA 3IF7A 1F71A 2OS8B 2I94A 1ZFSA 1ALWA 4ZCUA 2KI6C 2JTTA 2JT0A 2Q4UA 1S26D 3JTDB 2MLFC 1JBAA 1XYDA 3D10A 2MAZA 3TUYC 3EKJA 2LHLA 3CR5X 2F33A 1KFXS 2PASA 2KGRA 1SY9A 1MXLC 2CT9A 2LNKA 2LVIA 2ZFDA 1OMDA 4PE4A 1JC2A 1DTLA 1OSAA 1QLKA 2AMIA 1RJVA 2M1UA 4ZCVA 2COLB 1SRAA 1KSOA 1Y0VH 1B8LA 4GAOA 1YUUA 2M3WA 2FCEA 2RGIA 1UUSA 1NX0A 3TDZA 3FWBA 3I5FC 4DRWA 4NQGA 4QJ4B 1SR6B 3GK2A 1B8RA 2JC2A 1UWOA 2KI6D 2LMVA 1CFFA 1LXFC 3CR2A 3PM8A 1OZOA 1NCZA 5I2LA 1M45A 1ZUZA 3GK1A 1A03A 2NZ0A 3DVMA 2M7NA 2QACA 3BYAA 1CM1A 5KSZA 1CDPA 2K7DA 1N0YA 4PALA 1TCFA 2EHBA 4GNKB 2F2OA 5HLVA 1EXRA 1KWOB 3BUWB 4I5JA 2K7OA 1PULA 4P5OE 4PE7A 5PALA 1LVCD 2L5XB 1KCYA 1QASA 1L7ZA 1E8AA 2KFGA 4GGFC 1OMVA 2MRDA 1YRUB 5CSJA 3MSEB 1Q80A 1PVBA 2LC5A 3I5IB 1C7WA 4JPZB 2GGMA 1QV1A 3PSRA 4M2OA 1KK8C 2M1KB 4NDCA 2QPTA 2KQYA 1YX8A 3OX5A 2BE4A 1NPQA 2ZRTA 2BCXA 4MRYA 3VGOA 2I2RE 1BOCA 3TS5C 1CLLA 2JNFA 1U5IB 4E68A 3F45A 1WDCB 1B4CA 3NSOA 2LVJA 1F4QA 1N2DA 2E30A 3O4YA 4JQ0D 4BY5A 2K2FA 2LMTA 4C0KA 2BCBA 2NLNA 2EGDA 2BE6A 1AJ4A 4GPLB 5DKRA 2MBXA 1C07A 1BT6A 1YVHA 1B8CA 1KQMC 2G9BA 2KOTA 1BMOA 1BODA 1U5IA 5KTYA 1OMRA 2ZKMX 2CXJA 4L9MA 3TS5B 3SJSA 2OTGC 3EVRA 1SL8A 1AJ5A 2A4JA 4TNCA 1YVLA 3IQOA 5IBWA 2ZN9A 4PE0A 2LCPA 1IGVA 5HKZA 2O5GA 4MZJA 4YGCB 1S6CA 2K7CA 3A8RA 4MEWA 4CPVA 1S5GY 4YGBB 1L2OC 1SYMA 5HKWA 1JFJA 1GJYA 5B8IB 2M8UA 3EVVA 1SMGA 4CIDA 1KFXL 1DGUA 2D8NA 1AVSA 1B9AA 2JOJA 2TN4A 1J1DA 2KSPA 2OTGB 3LCPC 1F55A 1YRTB 2CBLA 4ORCB 1R6PA 1FI5A 1DJGA 1WRZA 1LA0A 5DKNA 1GQMA 1WLMA 4QJ3B 2BL0C 4JWQA 2KQ6A 1YX7A 1A75B 3DF0B 3SG3A 2H2KA 1VRKA 2FCDA 1L2OB 1EG4A 4MZKA 3DVJA 4PHKA 1YR5A 1M63B 1M39A 1MWNA 2L51A 2PMYA 1DJWA 2F3YA 2R2IA 3CZTX 3HCMA 3DVKA 2BBMA 2BECA 1NUBA 4MLWA 1R2UA 3D0YA 1SCVA 1W7IB 2G2BA 2K61A 1QVIY 3GOFA 3VRQA 2LHIA 4HSZA 2PSRA 1GGZA 4WQ2A 1A75A 2JU0A 3DF0A 1YURA 1NX3A 4M2PA 5HYDA 1EH2A 1PSBA 2KBIA 1J1EA 3VRPA 3CR4X 1F70A 4AQJA 1QATA 2HPSA
chains in the Genus database with same CATH superfamily
4IL1A 1EJ3A 2LANA 1ZOTB 2KFHA 2PALA 5AXIA 1K94A 2QEBA 3VRNA 4JD9A 2KAYA 2LVKA 1UHJA 3EK7A 1M31A 5DKQA 4DUQA 3B6XA 3SG5A 1SPYA 1K9PA 4OR9B 1PRWA 3M0WA 3BUOB 1P28A 2JPOA 1EL4A 1TNQA 2KBMA 3DD4A 4ORBB 5AFPA 1MR8A 1NX1A 2ERBA 4YRUA 2K0JA 3TZ1A 5FI2A 2LP2A 5JJGA 3RLZA 3NSLA 2E6WA 3B88A 1DJXA 1W7JB 1OOFA 2M9GA 4HREE 5TNCA 3BOWA 3OX6A 5AERA 2P70A 5CSNA 4DIRA 3PALA 2P6BB 1HQVA 1UHKA 1IRJA 1EG3A 3LL8B 5FYXA 3UO9A 1XK4C 3TUYB 5D3OA 2FJUB 3V2LA 1V1FA 1LINA 1IH0A 4WQ3A 2JQ6A 2WCJA 1SL7A 1IWQA 2M97A 5I8NA 2I7AA 2KAXA 1CFDA 4GUKA 1QIVA 5CSFA 2M49B 2K7BA 4XJKA 5CPVA 4MVFA 1CLBA 1CM4A 2KYCA 1DJYA 3O2PA 3BUMB 3I5FB 1KSMA 2L2CA 3IQQA 4INWA 1UP5A 1TIZA 1S36A 3EVUA 2LLTA 3VB1A 2K2AA 3PATA 3FWCA 1V1GA 1XFWO 2KAVA 1K9KA 2CCMA 2JNXA 1RFJA 2L5YA 1DJHA 2BKHB 4I5NB 4QJ5B 2FJYA 5I94A 1K90D 1KQVA 1BLQA 3CDNA 1KFUS 1Y6WA 1CFCA 4HRGA 1XK4A 1BG1A 4DS7A 2AUCA 3E3RA 4CFRA 2JT3A 1PALA 3KHEA 5AEQA 1F4OA 3OHMB 3S0EA 1RROA 2Y5IA 3QRXA 4GGNA 5J3XA 2LVVA 3A4UB 2WCFA 2WNDA 4N1GA 4YGEB 1K96A 3C1VA 3WNXB 1S5GZ 4N1FA 5JOLA 1AK8A 1FF1A 1QS7A 1XVJA 1AHRA 1K9UA 3D77A 1KK8B 3OB2B 5F6TA 1LKJA 3I5HC 3NXAA 2GGZA 3LK1A 1S6IA 2JXLA 2BCAA 3NHTA 3UNWA 1NIWA 2V53A 2WORA 3H4SE 4OKHA 2KYFA 2Y1MA 3O6BA 1NX2A 2SASA 1T14A 5KU1A 2O60A 4FTGA 1BR4B 5G08A 1CDLA 2ZRSA 4HRHA 4YI8A 3OB1B 4GBAA 1K2HA 3AKBA 2BBNA 1DC1A 1XFYO 1TOPA 2WCHA 4OCIA 3NSIA 1JWDA 3TDIA 1IKUA 1CB1A 1UHNA 1KQMB 2H61A 4WRIA 4ETOA 5I2OA 2JRFA 1QVIZ 1DVIA 4NDBA 1C7VA 2HQWA 2LV7A 1J7OA 2F2PA 2M0RA 1NYAA 2GV5A 1XFRA 1MXEA 3SS5A 2KFFA 1MF8B 3PFVA 4YBHB 1SCMC 1B47A 2L98A 3D0YB 1IJ5A 1OOJA 1A2XA 1J7PA 2FOTA 1MUXA 4NDDA 4F7FA 2EC6C 3D74A 3IVTA 4YGDB 3ZNIA 4YGAA 2HF5A 2L4HA 1DT7B 1JUOA 3NSKA 3DY9A 4R1EA 1SK6D 2LUXA 3CZ0A 1XFVO 1ZACA 1ODBA 1KK7Y 1NP8A 1UHIA 4MZLA 2CTNA 3FE6A 1FPWA 3AKAA 1SCMB 1SW8A 1TTXA 4OZDA 3B7AA 3OP0A 1QX5B 2BKIB 2EC6B 2BL0B 4JKTA 1F8HA 2LMUA 3D76A 1GM0A 1QV0A 2LE9B 1TNPA 2LUCA 4DCKA 3FE8A 4BY4A 3Q8IA 3R72A 3RM1A 1DJZA 2JXCA 1SKTA 4FQTA 3BOWB 3FIAA 2KNEA 4PCWA 1KFUL 3JVTC 1XA5A 2KGBC 1IQ5A 3JTDC 4PHNA 3FE9A 4MRXA 1JF0A 1RK9A 1DJIA 1XFXO 3AAJA 3D78A 1SL9A 2ZNDA 4AQIA 1J7QA 1FI6A 2B1UA 1MQ1A 1CMGA 2HQ8A 3S0AA 3AAKA 2KDHA 4M2QA 3SG4A 4CFQA 1WLZA 2CNPA 4XJKB 3HX4A 2WCKA 3BFBA 3I5GC 5GQQC 2KLEA 1BF5A 1H8BA 2JWWA 3CYZA 3GK4X 1QLSA 3NHIA 3SIAA 1DF0B 3JVTB 2WC8A 2L0PA 1TNXA 2KI4C 1SR6C 3L4AA 3SIBA 4I5KA 1A4PA 1QX2A 3KF9A 2WCMA 2L50A 5FI7A 2WCBA 5D69A 3CS1A 1FBVA 1B1GA 1CDNA 2DOQA 4MBEA 2QEHA 2JULA 1QXPA 1PVAA 2NXQA 4I5LB 1K93D 3WHTB 2F3ZA 1J55A 2AAOA 1B7TY 3I5GB 3WHUB 2WCLA 2KPHA 1DF0A 1Z4HA 2BAPA 1KWOC 1CTRA 1X02A 2KI4B 3R1OA 3PJIA 4C0LA 2L2EA 4F0ZB 4D1EA 1A29A 2NCOA 3BFAA 3I5IC 2HETA 2Y1NA 5HLOA 5K89A 1OOGA 3OBVA 2MA2A 3WXAA 2WC6A 1RTP1 1ZMZA 4OVNF 1CFPA 3CWGA 2H61C 2M7LA 1S1EA 1K8UA 1IIOA 1W9ZA 2PVBA 1Y1AA 1LS8A 2JZIA 5ER4X 1BR1B 1YUTA 4A4CA 4P2YB 4ICBA 1WDCC 1OW4A 3KPXA 4XYNA 1CNPA 2KHNA 5D7FA 1SNLA 3CLNA 1ORGA 3R1VA 2L4IA 4PHMA 1K95A 4UPGA 3RZSA 3B87A 1DMOA 3ZWHA 1S3PA 5ER5A 3ICBA 3SG6A 1TRFA 1PK0D 3TDUA 1XFZO 1PSRA 2MHHA 3VRRA 1ALVA 2PQLA 3CZ1A 4C0JA 5I2QA 1QTXA 2IS9A 4USLA 3PLFB 5FI6A 3DZTA 2YGUA 1FW4A 4MSPA 4Q04A 1CDMA 3R1PA 1TUZA 1YUSA 1XO5A 1IG5A 1OZSA 3I5HB 4GFTA 2K8MB 3L47A 1UURA 2Q91A 1WRKA 1WY9A 3CGAA 4PDZA 3CZ2A 3PN7C 1KK7Z 1NCXA 1XFUO 4N5XA 3QMEA 2ZN8A 1CLMA 4GGFA 3DVEA 3VROA 1G4YR 4CLNA 2JPTA 2F8PA 2I18A 4PE1A 3S0BA 2WCEA 1AUIB 3CABA 3LK0A 3SS3A 1Y1XA 5BPJA 4U8DA 2MJWB 1HT9A 3S0FA 1IJ6A 3N7HA 4YI9A 2LAPA 3B86A 3CTNA 3EK8A 3PN7B 3SG2A 3LLEA 2PRUA 3KO0A 4FQOA 2WOSA 2P71A 1QJTA 4KYNA 5CSIA 1Y1UA 1N65A 1RECA 1NWDA 4ORAB 1S6JA 1D1OA 1F54A 1RWYA 2H8VA 3FS7A 1GGWA 2JTZA 1BJFA 1TNWA 1M46A 1LA3A 2Y4QA 2ZNEA 1NCYA 1G8IA 1JF2A 2M29A 2LM5A 1G33A 4PHJA 3BUNB 1TN4A 3O78A 2LP3A 2ISDA 2JT8A 1JFKA 1H4BA 2LLSA 1JSAA 3KEVA 1DELA 2VRGA 3BJHA 1J7RA 1MHOA 2LLUA 4MN0A 1OOHA 1WRLA 1QX7A 2SCPA 4PT1A 2OS8C 2NCPA 4OV2A 3K21A 3SG7A 1CMFA 5AANA 2OPOA 1TCOB 1YTZC 1OE9B 5HKYA 3BQ3A 4A4BA 1CKKA 1IQ3A 1UHHA 1BU3A 1B7TZ 1QIWA 3EKHA 3EK4A 3BXKA 3D73A 1DGVA 1SBJA 2MLEC 3BUXB 4AOMA 1TUJA 1NSHA 4INXA 1OQPA 3IF7A 1AP4A 1F71A 2OS8B 4IJ7A 2I94A 1ZFSA 1ALWA 4ZCUA 2KI6C 2JTTA 2JT0A 2Q4UA 1S26D 3JTDB 2MLFC 1JBAA 1XYDA 3D10A 2MAZA 3K1EA 3EKJA 3TUYC 2LHLA 3CR5X 2F33A 1TWOA 1KFXS 2PASA 2KGRA 1SY9A 1MXLC 2CT9A 2LNKA 2LVIA 2ZFDA 1OMDA 4PE4A 1JC2A 1DTLA 1OSAA 1QLKA 2AMIA 1RJVA 2M1UA 4ZCVA 2COLB 1SRAA 1KSOA 1Y0VH 1B8LA 4GAOA 1YUUA 2M3WA 2FCEA 2RGIA 1UUSA 1NX0A 3TDZA 3FWBA 3I5FC 4DRWA 4NQGA 4QJ4B 1SR6B 3GK2A 1B8RA 2JC2A 1UWOA 2KI6D 2LMVA 1CFFA 1C3YA 1LXFC 3CR2A 3PM8A 1OZOA 1NCZA 5I2LA 1M45A 1ZUZA 3GK1A 1A03A 2NZ0A 3DVMA 2M7NA 2QACA 3BYAA 1CM1A 1Z2CB 5KSZA 1CDPA 2K7DA 2WC5A 1N0YA 4PALA 1TCFA 2EHBA 4GNKB 2F2OA 5HLVA 1EXRA 1KWOB 3BUWB 4I5JA 2K7OA 1PULA 4P5OE 4PE7A 5PALA 1LVCD 2L5XB 1KCYA 3O4XA 1QASA 1L7ZA 1E8AA 2KFGA 4GGFC 1OMVA 2MRDA 1YRUB 5CSJA 3MSEB 5HL1A 1Q80A 1PVBA 2LC5A 1DQEA 3I5IB 3L4LA 1C7WA 4JPZB 2GGMA 1QV1A 3PSRA 1DEKA 4M2OA 1KK8C 2M1KB 4NDCA 2QPTA 2KQYA 1YX8A 3OX5A 2BE4A 1NPQA 2ZRTA 2BCXA 4MRYA 3VGOA 2I2RE 1BOCA 3TS5C 1CLLA 2JNFA 1U5IB 4E68A 3PM2A 3F45A 1WDCB 1QWVA 2K60A 3NSOA 1B4CA 2LVJA 1F4QA 1N2DA 2E30A 3O4YA 4JQ0D 4BY5A 2K2FA 2LMTA 3BFHA 2BCBA 4C0KA 2NLNA 2EGDA 2BE6A 1AJ4A 4GPLB 5DKRA 2MBXA 3S0DA 3S0GA 1C07A 1BT6A 2QDIA 1YVHA 2BNXA 1B8CA 1KQMC 2G9BA 2KOTA 1BMOA 1BODA 1C3ZA 1U5IA 5KTYA 1OMRA 2ZKMX 2CXJA 4L9MA 3TS5B 3SJSA 2OTGC 3EVRA 1SL8A 3EG5B 1AJ5A 2A4JA 4TNCA 1YVLA 3IQOA 5IBWA 2ZN9A 2KLDA 4PE0A 2LCPA 1IGVA 5HKZA 2O5GA 4MZJA 2QEVA 1S6CA 2K7CA 3A8RA 4MEWA 4YGCB 4CPVA 1S5GY 3D75A 3NGVA 4YGBB 1OOIX 1L2OC 1SYMA 5HKWA 1JFJA 1GJYA 5B8IB 2M8UA 3EVVA 1SMGA 4CIDA 1KFXL 1DGUA 2D8NA 1AVSA 1B9AA 2JOJA 2TN4A 1J1DA 2KSPA 2OTGB 3LCPC 1F55A 1YRTB 2CBLA 4ORCB 1R6PA 1FI5A 2GTEA 1DJGA 1WRZA 1LA0A 5DKNA 1GQMA 1WLMA 2PYQA 4QJ3B 3SS4A 2BL0C 4JWQA 2KQ6A 1YX7A 1A75B 3DF0B 3SG3A 2H2KA 1VRKA 2FCDA 1L2OB 1EG4A 3DXLA 4MZKA 3DVJA 4PHKA 1YR5A 1M63B 1M39A 1MWNA 2L51A 2PMYA 1DJWA 2F3YA 2R2IA 3CZTX 3HCMA 3DVKA 1SSEB 2BBMA 1NUBA 2BECA 2QEOA 4MLWA 5EL2A 1R2UA 3D0YA 1SCVA 3DYEA 1W7IB 2G2BA 2K61A 1QVIY 3GOFA 3VRQA 2LHIA 4HSZA 2PSRA 3OGNA 1GGZA 4WQ2A 1A75A 2JU0A 3DF0A 1YURA 1NX3A 4M2PA 5HYDA 1EH2A 1PSBA 2KBIA 1J1EA 3VRPA 3CR4X 1F70A 5DICA 4AQJA 1QATA 2HPSA
chains in the Genus database with same CATH topology
4IL1A 1EJ3A 2LANA 1ZOTB 2KFHA 2PALA 5AXIA 1K94A 3VRNA 2KAYA 2LVKA 1UHJA 3EK7A 1M31A 5DKQA 4DUQA 3SG5A 1SPYA 1K9PA 4OR9B 1PRWA 3M0WA 3BUOB 1EL4A 1TNQA 2KBMA 3DD4A 4ORBB 5AFPA 1MR8A 1NX1A 4YRUA 2K0JA 3TZ1A 2LP2A 5JJGA 3RLZA 3NSLA 2E6WA 1DJXA 1W7JB 4HREE 2M9GA 5TNCA 5AERA 3BOWA 3OX6A 5CSNA 4DIRA 3PALA 2P6BB 1HQVA 1UHKA 1IRJA 1EG3A 3LL8B 5FYXA 1XK4C 3TUYB 2FJUB 1V1FA 1LINA 1IH0A 4WQ3A 2JQ6A 1SL7A 1IWQA 2M97A 5I8NA 2I7AA 2KAXA 1CFDA 4GUKA 1QIVA 5CSFA 2M49B 2K7BA 4XJKA 5CPVA 4MVFA 1CLBA 1CM4A 2KYCA 1DJYA 3O2PA 3BUMB 3I5FB 1KSMA 3IQQA 1UP5A 1TIZA 1S36A 3EVUA 2LLTA 2K2AA 3PATA 3FWCA 1V1GA 1XFWO 2KAVA 1K9KA 2CCMA 2JNXA 1RFJA 4QJ5B 1DJHA 2BKHB 4I5NB 1K90D 1KQVA 1BLQA 1KFUS 1Y6WA 1CFCA 4HRGA 1XK4A 1BG1A 4DS7A 2AUCA 3E3RA 4CFRA 2JT3A 1PALA 3KHEA 5AEQA 1F4OA 3OHMB 1RROA 2Y5IA 3QRXA 4GGNA 5J3XA 2LVVA 3A4UB 2WCFA 2WNDA 4N1GA 4YGEB 1K96A 3C1VA 3WNXB 1S5GZ 4N1FA 5JOLA 1AK8A 1FF1A 1QS7A 1XVJA 1AHRA 1K9UA 3OB2B 1KK8B 5F6TA 1LKJA 3I5HC 3NXAA 2GGZA 3LK1A 1S6IA 2JXLA 2BCAA 1NIWA 2V53A 2WORA 3H4SE 4OKHA 2KYFA 2Y1MA 3O6BA 1NX2A 2SASA 5KU1A 2O60A 4FTGA 1BR4B 5G08A 1CDLA 2ZRSA 4HRHA 4YI8A 3OB1B 4GBAA 1K2HA 3AKBA 2BBNA 1XFYO 1TOPA 4OCIA 3NSIA 1JWDA 3TDIA 1IKUA 1CB1A 1UHNA 1KQMB 2H61A 4WRIA 4ETOA 5I2OA 2JRFA 1QVIZ 1DVIA 4NDBA 1C7VA 2HQWA 2LV7A 1J7OA 2F2PA 2M0RA 1NYAA 2GV5A 1MXEA 2KFFA 1MF8B 3PFVA 4YBHB 1SCMC 1B47A 2L98A 3D0YB 1IJ5A 1OOJA 1A2XA 1J7PA 2FOTA 1MUXA 4NDDA 2EC6C 4YGDB 3ZNIA 4YGAA 2HF5A 2L4HA 1DT7B 1JUOA 3NSKA 4R1EA 1SK6D 2LUXA 1XFVO 1ZACA 1ODBA 1KK7Y 1NP8A 1UHIA 4MZLA 2CTNA 1FPWA 3AKAA 1SCMB 1SW8A 1TTXA 3OP0A 1QX5B 2BKIB 2EC6B 2BL0B 1F8HA 2LMUA 1QV0A 2LE9B 1TNPA 2LUCA 4DCKA 4BY4A 3RM1A 1DJZA 2JXCA 1SKTA 3BOWB 3FIAA 2KNEA 4PCWA 1KFUL 3JVTC 1XA5A 2KGBC 1IQ5A 3JTDC 4PHNA 4MRXA 1JF0A 1RK9A 1DJIA 1XFXO 3AAJA 1SL9A 2ZNDA 4AQIA 1J7QA 1FI6A 2B1UA 1MQ1A 1CMGA 2HQ8A 3AAKA 2KDHA 4M2QA 3SG4A 4CFQA 1WLZA 2CNPA 4XJKB 3HX4A 3I5GC 5GQQC 1BF5A 1H8BA 2JWWA 3GK4X 1QLSA 3SIAA 1DF0B 3JVTB 2WC8A 2L0PA 1TNXA 2KI4C 1SR6C 3SIBA 4I5KA 1A4PA 1QX2A 3KF9A 2L50A 2WCBA 5D69A 3CS1A 1FBVA 1B1GA 1CDNA 2DOQA 4MBEA 2JULA 1QXPA 1PVAA 2NXQA 4I5LB 1K93D 3WHTB 2F3ZA 1J55A 2AAOA 1B7TY 3I5GB 3WHUB 1DF0A 1KWOC 1CTRA 1X02A 2KI4B 4C0LA 2L2EA 4F0ZB 4D1EA 1A29A 2NCOA 3I5IC 2HETA 2Y1NA 5HLOA 5K89A 2MA2A 3WXAA 1RTP1 1ZMZA 4OVNF 1CFPA 3CWGA 2H61C 2M7LA 1S1EA 1K8UA 2PVBA 1Y1AA 2JZIA 5ER4X 1BR1B 1YUTA 4A4CA 4P2YB 4ICBA 1WDCC 3KPXA 4XYNA 1CNPA 2KHNA 5D7FA 1SNLA 3CLNA 4PHMA 2L4IA 1DMOA 1K95A 4UPGA 3ZWHA 1S3PA 5ER5A 3ICBA 3SG6A 1TRFA 1PK0D 3TDUA 1XFZO 1PSRA 2MHHA 3VRRA 1ALVA 4C0JA 5I2QA 1QTXA 2IS9A 4USLA 3PLFB 4MSPA 1FW4A 4Q04A 1CDMA 1YUSA 1XO5A 1IG5A 1OZSA 3I5HB 4GFTA 2K8MB 1UURA 2Q91A 1WRKA 1WY9A 3CGAA 4PDZA 3PN7C 1KK7Z 1NCXA 1XFUO 4N5XA 2ZN8A 1CLMA 4GGFA 3DVEA 3VROA 1G4YR 4CLNA 2JPTA 2F8PA 2I18A 4PE1A 2WCEA 1AUIB 3LK0A 1Y1XA 5BPJA 4U8DA 2MJWB 1HT9A 1IJ6A 4YI9A 2LAPA 3CTNA 3EK8A 3PN7B 3SG2A 3LLEA 2PRUA 3KO0A 4FQOA 2WOSA 5CSIA 1QJTA 1Y1UA 1N65A 1RECA 1NWDA 4ORAB 1S6JA 1D1OA 1F54A 1RWYA 3FS7A 1GGWA 2JTZA 1BJFA 1TNWA 1M46A 1LA3A 2Y4QA 2ZNEA 1NCYA 1G8IA 1JF2A 2M29A 2LM5A 1G33A 4PHJA 3BUNB 1TN4A 3O78A 2LP3A 2ISDA 2JT8A 1JFKA 1H4BA 2LLSA 1JSAA 3KEVA 2VRGA 1J7RA 1MHOA 2LLUA 4MN0A 1WRLA 1QX7A 2SCPA 2OS8C 2NCPA 4OV2A 3K21A 3SG7A 1CMFA 5AANA 2OPOA 1TCOB 1YTZC 1OE9B 5HKYA 3BQ3A 4A4BA 1CKKA 1IQ3A 1UHHA 1BU3A 1B7TZ 1QIWA 3EKHA 3EK4A 3BXKA 1DGVA 1SBJA 2MLEC 3BUXB 4AOMA 1NSHA 1AP4A 1OQPA 3IF7A 1F71A 2OS8B 2I94A 1ZFSA 1ALWA 4ZCUA 2KI6C 2JTTA 2JT0A 2Q4UA 1S26D 3JTDB 2MLFC 1JBAA 1XYDA 3D10A 2MAZA 3TUYC 3EKJA 2LHLA 3CR5X 2F33A 1KFXS 2PASA 2KGRA 1SY9A 1MXLC 2CT9A 2LNKA 2LVIA 2ZFDA 1OMDA 4PE4A 1JC2A 1DTLA 1OSAA 1QLKA 2AMIA 1RJVA 2M1UA 4ZCVA 2COLB 1SRAA 1KSOA 1Y0VH 1B8LA 4GAOA 1YUUA 2M3WA 2FCEA 2RGIA 1UUSA 1NX0A 3TDZA 3FWBA 3I5FC 4DRWA 4NQGA 4QJ4B 1SR6B 3GK2A 1B8RA 2JC2A 1UWOA 2KI6D 2LMVA 1CFFA 1LXFC 3CR2A 3PM8A 1OZOA 1NCZA 5I2LA 1M45A 1ZUZA 3GK1A 1A03A 2NZ0A 3DVMA 2M7NA 2QACA 3BYAA 1CM1A 5KSZA 1CDPA 2K7DA 1N0YA 4PALA 1TCFA 2EHBA 4GNKB 2F2OA 5HLVA 1EXRA 1KWOB 3BUWB 4I5JA 2K7OA 1PULA 4P5OE 4PE7A 5PALA 1LVCD 2L5XB 1KCYA 1QASA 1L7ZA 1E8AA 2KFGA 4GGFC 1OMVA 2MRDA 1YRUB 5CSJA 3MSEB 1Q80A 1PVBA 2LC5A 3I5IB 1C7WA 4JPZB 2GGMA 1QV1A 3PSRA 4M2OA 1KK8C 2M1KB 4NDCA 2QPTA 2KQYA 1YX8A 3OX5A 2BE4A 1NPQA 2ZRTA 2BCXA 4MRYA 3VGOA 2I2RE 1BOCA 3TS5C 1CLLA 2JNFA 1U5IB 4E68A 3F45A 1WDCB 1B4CA 3NSOA 2LVJA 1F4QA 1N2DA 2E30A 3O4YA 4JQ0D 4BY5A 2K2FA 2LMTA 4C0KA 2BCBA 2NLNA 2EGDA 2BE6A 1AJ4A 4GPLB 5DKRA 2MBXA 1C07A 1BT6A 1YVHA 1B8CA 1KQMC 2G9BA 2KOTA 1BMOA 1BODA 1U5IA 5KTYA 1OMRA 2ZKMX 2CXJA 4L9MA 3TS5B 3SJSA 2OTGC 3EVRA 1SL8A 1AJ5A 2A4JA 4TNCA 1YVLA 3IQOA 5IBWA 2ZN9A 4PE0A 2LCPA 1IGVA 5HKZA 2O5GA 4MZJA 4YGCB 1S6CA 2K7CA 3A8RA 4MEWA 4CPVA 1S5GY 4YGBB 1L2OC 1SYMA 5HKWA 1JFJA 1GJYA 5B8IB 2M8UA 3EVVA 1SMGA 4CIDA 1KFXL 1DGUA 2D8NA 1AVSA 1B9AA 2JOJA 2TN4A 1J1DA 2KSPA 2OTGB 3LCPC 1F55A 1YRTB 2CBLA 4ORCB 1R6PA 1FI5A 1DJGA 1WRZA 1LA0A 5DKNA 1GQMA 1WLMA 4QJ3B 2BL0C 4JWQA 2KQ6A 1YX7A 1A75B 3DF0B 3SG3A 2H2KA 1VRKA 2FCDA 1L2OB 1EG4A 4MZKA 3DVJA 4PHKA 1YR5A 1M63B 1M39A 1MWNA 2L51A 2PMYA 1DJWA 2F3YA 2R2IA 3CZTX 3HCMA 3DVKA 2BBMA 2BECA 1NUBA 4MLWA 1R2UA 3D0YA 1SCVA 1W7IB 2G2BA 2K61A 1QVIY 3GOFA 3VRQA 2LHIA 4HSZA 2PSRA 1GGZA 4WQ2A 1A75A 2JU0A 3DF0A 1YURA 1NX3A 4M2PA 5HYDA 1EH2A 1PSBA 2KBIA 1J1EA 3VRPA 3CR4X 1F70A 4AQJA 1QATA 2HPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IL1 A;  1EJ3 A;  2LAN A;  1ZOT B;  2KFH A;  2PAL A;  5AXI A;  1K94 A;  3VRN A;  2KAY A;  2LVK A;  1UHJ A;  3EK7 A;  1M31 A;  5DKQ A;  4DUQ A;  3SG5 A;  1SPY A;  1K9P A;  4OR9 B;  1PRW A;  3M0W A;  3BUO B;  1EL4 A;  1TNQ A;  2KBM A;  3DD4 A;  4ORB B;  5AFP A;  1MR8 A;  1NX1 A;  4YRU A;  2K0J A;  3TZ1 A;  2LP2 A;  5JJG A;  3RLZ A;  3NSL A;  2E6W A;  1DJX A;  1W7J B;  4HRE E;  2M9G A;  5TNC A;  5AER A;  3BOW A;  3OX6 A;  5CSN A;  4DIR A;  3PAL A;  2P6B B;  1HQV A;  1UHK A;  1IRJ A;  1EG3 A;  3LL8 B;  5FYX A;  1XK4 C;  3TUY B;  2FJU B;  1V1F A;  1LIN A;  1IH0 A;  4WQ3 A;  2JQ6 A;  1SL7 A;  1IWQ A;  2M97 A;  5I8N A;  2I7A A;  2KAX A;  1CFD A;  4GUK A;  1QIV A;  5CSF A;  2M49 B;  2K7B A;  4XJK A;  5CPV A;  4MVF A;  1CLB A;  1CM4 A;  2KYC A;  1DJY A;  3O2P A;  3BUM B;  3I5F B;  1KSM A;  3IQQ A;  1UP5 A;  1TIZ A;  1S36 A;  3EVU A;  2LLT A;  2K2A A;  3PAT A;  3FWC A;  1V1G A;  1XFW O;  2KAV A;  1K9K A;  2CCM A;  2JNX A;  1RFJ A;  4QJ5 B;  1DJH A;  2BKH B;  4I5N B;  1K90 D;  1KQV A;  1BLQ A;  1KFU S;  1Y6W A;  1CFC A;  4HRG A;  1XK4 A;  1BG1 A;  4DS7 A;  2AUC A;  3E3R A;  4CFR A;  2JT3 A;  1PAL A;  3KHE A;  5AEQ A;  1F4O A;  3OHM B;  1RRO A;  2Y5I A;  3QRX A;  4GGN A;  5J3X A;  2LVV A;  3A4U B;  2WCF A;  2WND A;  4N1G A;  4YGE B;  1K96 A;  3C1V A;  3WNX B;  1S5G Z;  4N1F A;  5JOL A;  1AK8 A;  1FF1 A;  1QS7 A;  1XVJ A;  1AHR A;  1K9U A;  3OB2 B;  1KK8 B;  5F6T A;  1LKJ A;  3I5H C;  3NXA A;  2GGZ A;  3LK1 A;  1S6I A;  2JXL A;  2BCA A;  1NIW A;  2V53 A;  2WOR A;  3H4S E;  4OKH A;  2KYF A;  2Y1M A;  3O6B A;  1NX2 A;  2SAS A;  5KU1 A;  2O60 A;  4FTG A;  1BR4 B;  5G08 A;  1CDL A;  2ZRS A;  4HRH A;  4YI8 A;  3OB1 B;  4GBA A;  1K2H A;  3AKB A;  2BBN A;  1XFY O;  1TOP A;  4OCI A;  3NSI A;  1JWD A;  3TDI A;  1IKU A;  1CB1 A;  1UHN A;  1KQM B;  2H61 A;  4WRI A;  4ETO A;  5I2O A;  2JRF A;  1QVI Z;  1DVI A;  4NDB A;  1C7V A;  2HQW A;  2LV7 A;  1J7O A;  2F2P A;  2M0R A;  1NYA A;  2GV5 A;  1MXE A;  2KFF A;  1MF8 B;  3PFV A;  4YBH B;  1SCM C;  1B47 A;  2L98 A;  3D0Y B;  1IJ5 A;  1OOJ A;  1A2X A;  1J7P A;  2FOT A;  1MUX A;  4NDD A;  2EC6 C;  4YGD B;  3ZNI A;  4YGA A;  2HF5 A;  2L4H A;  1DT7 B;  1JUO A;  3NSK A;  4R1E A;  1SK6 D;  2LUX A;  1XFV O;  1ZAC A;  1ODB A;  1KK7 Y;  1NP8 A;  1UHI A;  4MZL A;  2CTN A;  1FPW A;  3AKA A;  1SCM B;  1SW8 A;  1TTX A;  3OP0 A;  1QX5 B;  2BKI B;  2EC6 B;  2BL0 B;  1F8H A;  2LMU A;  1QV0 A;  2LE9 B;  1TNP A;  2LUC A;  4DCK A;  4BY4 A;  3RM1 A;  1DJZ A;  2JXC A;  1SKT A;  3BOW B;  3FIA A;  2KNE A;  4PCW A;  1KFU L;  3JVT C;  1XA5 A;  2KGB C;  1IQ5 A;  3JTD C;  4PHN A;  4MRX A;  1JF0 A;  1RK9 A;  1DJI A;  1XFX O;  3AAJ A;  1SL9 A;  2ZND A;  4AQI A;  1J7Q A;  1FI6 A;  2B1U A;  1MQ1 A;  1CMG A;  2HQ8 A;  3AAK A;  2KDH A;  4M2Q A;  3SG4 A;  4CFQ A;  1WLZ A;  2CNP A;  4XJK B;  3HX4 A;  3I5G C;  5GQQ C;  1BF5 A;  1H8B A;  2JWW A;  3GK4 X;  1QLS A;  3SIA A;  1DF0 B;  3JVT B;  2WC8 A;  2L0P A;  1TNX A;  2KI4 C;  1SR6 C;  3SIB A;  4I5K A;  1A4P A;  1QX2 A;  3KF9 A;  2L50 A;  2WCB A;  5D69 A;  3CS1 A;  1FBV A;  1B1G A;  1CDN A;  2DOQ A;  4MBE A;  2JUL A;  1QXP A;  1PVA A;  2NXQ A;  4I5L B;  1K93 D;  3WHT B;  2F3Z A;  1J55 A;  2AAO A;  1B7T Y;  3I5G B;  3WHU B;  1DF0 A;  1KWO C;  1CTR A;  1X02 A;  2KI4 B;  4C0L A;  2L2E A;  4F0Z B;  4D1E A;  1A29 A;  2NCO A;  3I5I C;  2HET A;  2Y1N A;  5HLO A;  5K89 A;  2MA2 A;  3WXA A;  1RTP 1;  1ZMZ A;  4OVN F;  1CFP A;  3CWG A;  2H61 C;  2M7L A;  1S1E A;  1K8U A;  2PVB A;  1Y1A A;  2JZI A;  5ER4 X;  1BR1 B;  1YUT A;  4A4C A;  4P2Y B;  4ICB A;  1WDC C;  3KPX A;  4XYN A;  1CNP A;  2KHN A;  5D7F A;  1SNL A;  3CLN A;  4PHM A;  2L4I A;  1DMO A;  1K95 A;  4UPG A;  3ZWH A;  1S3P A;  5ER5 A;  3ICB A;  3SG6 A;  1TRF A;  1PK0 D;  3TDU A;  1XFZ O;  1PSR A;  2MHH A;  3VRR A;  1ALV A;  4C0J A;  5I2Q A;  1QTX A;  2IS9 A;  4USL A;  3PLF B;  4MSP A;  1FW4 A;  4Q04 A;  1CDM A;  1YUS A;  1XO5 A;  1IG5 A;  1OZS A;  3I5H B;  4GFT A;  2K8M B;  1UUR A;  2Q91 A;  1WRK A;  1WY9 A;  3CGA A;  4PDZ A;  3PN7 C;  1KK7 Z;  1NCX A;  1XFU O;  4N5X A;  2ZN8 A;  1CLM A;  4GGF A;  3DVE A;  3VRO A;  1G4Y R;  4CLN A;  2JPT A;  2F8P A;  2I18 A;  4PE1 A;  2WCE A;  1AUI B;  3LK0 A;  1Y1X A;  5BPJ A;  4U8D A;  2MJW B;  1HT9 A;  1IJ6 A;  4YI9 A;  2LAP A;  3CTN A;  3EK8 A;  3PN7 B;  3SG2 A;  3LLE A;  2PRU A;  3KO0 A;  4FQO A;  2WOS A;  5CSI A;  1QJT A;  1Y1U A;  1N65 A;  1REC A;  1NWD A;  4ORA B;  1S6J A;  1D1O A;  1F54 A;  1RWY A;  3FS7 A;  1GGW A;  2JTZ A;  1BJF A;  1TNW A;  1M46 A;  1LA3 A;  2Y4Q A;  2ZNE A;  1NCY A;  1G8I A;  1JF2 A;  2M29 A;  2LM5 A;  1G33 A;  4PHJ A;  3BUN B;  1TN4 A;  3O78 A;  2LP3 A;  2ISD A;  2JT8 A;  1JFK A;  1H4B A;  2LLS A;  1JSA A;  3KEV A;  2VRG A;  1J7R A;  1MHO A;  2LLU A;  4MN0 A;  1WRL A;  1QX7 A;  2SCP A;  2OS8 C;  2NCP A;  4OV2 A;  3K21 A;  3SG7 A;  1CMF A;  5AAN A;  2OPO A;  1TCO B;  1YTZ C;  1OE9 B;  5HKY A;  3BQ3 A;  4A4B A;  1CKK A;  1IQ3 A;  1UHH A;  1BU3 A;  1B7T Z;  1QIW A;  3EKH A;  3EK4 A;  3BXK A;  1DGV A;  1SBJ A;  2MLE C;  3BUX B;  4AOM A;  1NSH A;  1AP4 A;  1OQP A;  3IF7 A;  1F71 A;  2OS8 B;  2I94 A;  1ZFS A;  1ALW A;  4ZCU A;  2KI6 C;  2JTT A;  2JT0 A;  2Q4U A;  1S26 D;  3JTD B;  2MLF C;  1JBA A;  1XYD A;  3D10 A;  2MAZ A;  3TUY C;  3EKJ A;  2LHL A;  3CR5 X;  2F33 A;  1KFX S;  2PAS A;  2KGR A;  1SY9 A;  1MXL C;  2CT9 A;  2LNK A;  2LVI A;  2ZFD A;  1OMD A;  4PE4 A;  1JC2 A;  1DTL A;  1OSA A;  1QLK A;  2AMI A;  1RJV A;  2M1U A;  4ZCV A;  2COL B;  1SRA A;  1KSO A;  1Y0V H;  1B8L A;  4GAO A;  1YUU A;  2M3W A;  2FCE A;  2RGI A;  1UUS A;  1NX0 A;  3TDZ A;  3FWB A;  3I5F C;  4DRW A;  4NQG A;  4QJ4 B;  1SR6 B;  3GK2 A;  1B8R A;  2JC2 A;  1UWO A;  2KI6 D;  2LMV A;  1CFF A;  1LXF C;  3CR2 A;  3PM8 A;  1OZO A;  1NCZ A;  5I2L A;  1M45 A;  1ZUZ A;  3GK1 A;  1A03 A;  2NZ0 A;  3DVM A;  2M7N A;  2QAC A;  3BYA A;  1CM1 A;  5KSZ A;  1CDP A;  2K7D A;  1N0Y A;  4PAL A;  1TCF A;  2EHB A;  4GNK B;  2F2O A;  5HLV A;  1EXR A;  1KWO B;  3BUW B;  4I5J A;  2K7O A;  1PUL A;  4P5O E;  4PE7 A;  5PAL A;  1LVC D;  2L5X B;  1KCY A;  1QAS A;  1L7Z A;  1E8A A;  2KFG A;  4GGF C;  1OMV A;  2MRD A;  1YRU B;  5CSJ A;  3MSE B;  1Q80 A;  1PVB A;  2LC5 A;  3I5I B;  1C7W A;  4JPZ B;  2GGM A;  1QV1 A;  3PSR A;  4M2O A;  1KK8 C;  2M1K B;  4NDC A;  2QPT A;  2KQY A;  1YX8 A;  3OX5 A;  2BE4 A;  1NPQ A;  2ZRT A;  2BCX A;  4MRY A;  3VGO A;  2I2R E;  1BOC A;  3TS5 C;  1CLL A;  2JNF A;  1U5I B;  4E68 A;  3F45 A;  1WDC B;  1B4C A;  3NSO A;  2LVJ A;  1F4Q A;  1N2D A;  2E30 A;  3O4Y A;  4JQ0 D;  4BY5 A;  2K2F A;  2LMT A;  4C0K A;  2BCB A;  2NLN A;  2EGD A;  2BE6 A;  1AJ4 A;  4GPL B;  5DKR A;  2MBX A;  1C07 A;  1BT6 A;  1YVH A;  1B8C A;  1KQM C;  2G9B A;  2KOT A;  1BMO A;  1BOD A;  1U5I A;  5KTY A;  1OMR A;  2ZKM X;  2CXJ A;  4L9M A;  3TS5 B;  3SJS A;  2OTG C;  3EVR A;  1SL8 A;  1AJ5 A;  2A4J A;  4TNC A;  1YVL A;  3IQO A;  5IBW A;  2ZN9 A;  4PE0 A;  2LCP A;  1IGV A;  5HKZ A;  2O5G A;  4MZJ A;  4YGC B;  1S6C A;  2K7C A;  3A8R A;  4MEW A;  4CPV A;  1S5G Y;  4YGB B;  1L2O C;  1SYM A;  5HKW A;  1JFJ A;  1GJY A;  5B8I B;  2M8U A;  3EVV A;  1SMG A;  4CID A;  1KFX L;  1DGU A;  2D8N A;  1AVS A;  1B9A A;  2JOJ A;  2TN4 A;  1J1D A;  2KSP A;  2OTG B;  3LCP C;  1F55 A;  1YRT B;  2CBL A;  4ORC B;  1R6P A;  1FI5 A;  1DJG A;  1WRZ A;  1LA0 A;  5DKN A;  1GQM A;  1WLM A;  4QJ3 B;  2BL0 C;  4JWQ A;  2KQ6 A;  1YX7 A;  1A75 B;  3DF0 B;  3SG3 A;  2H2K A;  1VRK A;  2FCD A;  1L2O B;  1EG4 A;  4MZK A;  3DVJ A;  4PHK A;  1YR5 A;  1M63 B;  1M39 A;  1MWN A;  2L51 A;  2PMY A;  1DJW A;  2F3Y A;  2R2I A;  3CZT X;  3HCM A;  3DVK A;  2BBM A;  2BEC A;  1NUB A;  4MLW A;  1R2U A;  3D0Y A;  1SCV A;  1W7I B;  2G2B A;  2K61 A;  1QVI Y;  3GOF A;  3VRQ A;  2LHI A;  4HSZ A;  2PSR A;  1GGZ A;  4WQ2 A;  1A75 A;  2JU0 A;  3DF0 A;  1YUR A;  1NX3 A;  4M2P A;  5HYD A;  1EH2 A;  1PSB A;  2KBI A;  1J1E A;  3VRP A;  3CR4 X;  1F70 A;  4AQJ A;  1QAT A;  2HPS A; 
#chains in the Genus database with same CATH topology
 4IL1 A;  1EJ3 A;  2LAN A;  1ZOT B;  2KFH A;  2PAL A;  5AXI A;  1K94 A;  2QEB A;  3VRN A;  4JD9 A;  2KAY A;  2LVK A;  1UHJ A;  3EK7 A;  1M31 A;  5DKQ A;  4DUQ A;  3B6X A;  3SG5 A;  1SPY A;  1K9P A;  4OR9 B;  1PRW A;  3M0W A;  3BUO B;  1P28 A;  2JPO A;  1EL4 A;  1TNQ A;  2KBM A;  3DD4 A;  4ORB B;  5AFP A;  1MR8 A;  1NX1 A;  2ERB A;  4YRU A;  2K0J A;  3TZ1 A;  5FI2 A;  2LP2 A;  5JJG A;  3RLZ A;  3NSL A;  2E6W A;  3B88 A;  1DJX A;  1W7J B;  1OOF A;  2M9G A;  4HRE E;  5TNC A;  3BOW A;  3OX6 A;  5AER A;  2P70 A;  5CSN A;  4DIR A;  3PAL A;  2P6B B;  1HQV A;  1UHK A;  1IRJ A;  1EG3 A;  3LL8 B;  5FYX A;  3UO9 A;  1XK4 C;  3TUY B;  5D3O A;  2FJU B;  3V2L A;  1V1F A;  1LIN A;  1IH0 A;  4WQ3 A;  2JQ6 A;  2WCJ A;  1SL7 A;  1IWQ A;  2M97 A;  5I8N A;  2I7A A;  2KAX A;  1CFD A;  4GUK A;  1QIV A;  5CSF A;  2M49 B;  2K7B A;  4XJK A;  5CPV A;  4MVF A;  1CLB A;  1CM4 A;  2KYC A;  1DJY A;  3O2P A;  3BUM B;  3I5F B;  1KSM A;  2L2C A;  3IQQ A;  4INW A;  1UP5 A;  1TIZ A;  1S36 A;  3EVU A;  2LLT A;  3VB1 A;  2K2A A;  3PAT A;  3FWC A;  1V1G A;  1XFW O;  2KAV A;  1K9K A;  2CCM A;  2JNX A;  1RFJ A;  2L5Y A;  1DJH A;  2BKH B;  4I5N B;  4QJ5 B;  2FJY A;  5I94 A;  1K90 D;  1KQV A;  1BLQ A;  3CDN A;  1KFU S;  1Y6W A;  1CFC A;  4HRG A;  1XK4 A;  1BG1 A;  4DS7 A;  2AUC A;  3E3R A;  4CFR A;  2JT3 A;  1PAL A;  3KHE A;  5AEQ A;  1F4O A;  3OHM B;  3S0E A;  1RRO A;  2Y5I A;  3QRX A;  4GGN A;  5J3X A;  2LVV A;  3A4U B;  2WCF A;  2WND A;  4N1G A;  4YGE B;  1K96 A;  3C1V A;  3WNX B;  1S5G Z;  4N1F A;  5JOL A;  1AK8 A;  1FF1 A;  1QS7 A;  1XVJ A;  1AHR A;  1K9U A;  3D77 A;  1KK8 B;  3OB2 B;  5F6T A;  1LKJ A;  3I5H C;  3NXA A;  2GGZ A;  3LK1 A;  1S6I A;  2JXL A;  2BCA A;  3NHT A;  3UNW A;  1NIW A;  2V53 A;  2WOR A;  3H4S E;  4OKH A;  2KYF A;  2Y1M A;  3O6B A;  1NX2 A;  2SAS A;  1T14 A;  5KU1 A;  2O60 A;  4FTG A;  1BR4 B;  5G08 A;  1CDL A;  2ZRS A;  4HRH A;  4YI8 A;  3OB1 B;  4GBA A;  1K2H A;  3AKB A;  2BBN A;  1DC1 A;  1XFY O;  1TOP A;  2WCH A;  4OCI A;  3NSI A;  1JWD A;  3TDI A;  1IKU A;  1CB1 A;  1UHN A;  1KQM B;  2H61 A;  4WRI A;  4ETO A;  5I2O A;  2JRF A;  1QVI Z;  1DVI A;  4NDB A;  1C7V A;  2HQW A;  2LV7 A;  1J7O A;  2F2P A;  2M0R A;  1NYA A;  2GV5 A;  1XFR A;  1MXE A;  3SS5 A;  2KFF A;  1MF8 B;  3PFV A;  4YBH B;  1SCM C;  1B47 A;  2L98 A;  3D0Y B;  1IJ5 A;  1OOJ A;  1A2X A;  1J7P A;  2FOT A;  1MUX A;  4NDD A;  4F7F A;  2EC6 C;  3D74 A;  3IVT A;  4YGD B;  3ZNI A;  4YGA A;  2HF5 A;  2L4H A;  1DT7 B;  1JUO A;  3NSK A;  3DY9 A;  4R1E A;  1SK6 D;  2LUX A;  3CZ0 A;  1XFV O;  1ZAC A;  1ODB A;  1KK7 Y;  1NP8 A;  1UHI A;  4MZL A;  2CTN A;  3FE6 A;  1FPW A;  3AKA A;  1SCM B;  1SW8 A;  1TTX A;  4OZD A;  3B7A A;  3OP0 A;  1QX5 B;  2BKI B;  2EC6 B;  2BL0 B;  4JKT A;  1F8H A;  2LMU A;  3D76 A;  1GM0 A;  1QV0 A;  2LE9 B;  1TNP A;  2LUC A;  4DCK A;  3FE8 A;  4BY4 A;  3Q8I A;  3R72 A;  3RM1 A;  1DJZ A;  2JXC A;  1SKT A;  4FQT A;  3BOW B;  3FIA A;  2KNE A;  4PCW A;  1KFU L;  3JVT C;  1XA5 A;  2KGB C;  1IQ5 A;  3JTD C;  4PHN A;  3FE9 A;  4MRX A;  1JF0 A;  1RK9 A;  1DJI A;  1XFX O;  3AAJ A;  3D78 A;  1SL9 A;  2ZND A;  4AQI A;  1J7Q A;  1FI6 A;  2B1U A;  1MQ1 A;  1CMG A;  2HQ8 A;  3S0A A;  3AAK A;  2KDH A;  4M2Q A;  3SG4 A;  4CFQ A;  1WLZ A;  2CNP A;  4XJK B;  3HX4 A;  2WCK A;  3BFB A;  3I5G C;  5GQQ C;  2KLE A;  1BF5 A;  1H8B A;  2JWW A;  3CYZ A;  3GK4 X;  1QLS A;  3NHI A;  3SIA A;  1DF0 B;  3JVT B;  2WC8 A;  2L0P A;  1TNX A;  2KI4 C;  1SR6 C;  3L4A A;  3SIB A;  4I5K A;  1A4P A;  1QX2 A;  3KF9 A;  2WCM A;  2L50 A;  5FI7 A;  2WCB A;  5D69 A;  3CS1 A;  1FBV A;  1B1G A;  1CDN A;  2DOQ A;  4MBE A;  2QEH A;  2JUL A;  1QXP A;  1PVA A;  2NXQ A;  4I5L B;  1K93 D;  3WHT B;  2F3Z A;  1J55 A;  2AAO A;  1B7T Y;  3I5G B;  3WHU B;  2WCL A;  2KPH A;  1DF0 A;  1Z4H A;  2BAP A;  1KWO C;  1CTR A;  1X02 A;  2KI4 B;  3R1O A;  3PJI A;  4C0L A;  2L2E A;  4F0Z B;  4D1E A;  1A29 A;  2NCO A;  3BFA A;  3I5I C;  2HET A;  2Y1N A;  5HLO A;  5K89 A;  1OOG A;  3OBV A;  2MA2 A;  3WXA A;  2WC6 A;  1RTP 1;  1ZMZ A;  4OVN F;  1CFP A;  3CWG A;  2H61 C;  2M7L A;  1S1E A;  1K8U A;  1IIO A;  1W9Z A;  2PVB A;  1Y1A A;  1LS8 A;  2JZI A;  5ER4 X;  1BR1 B;  1YUT A;  4A4C A;  4P2Y B;  4ICB A;  1WDC C;  1OW4 A;  3KPX A;  4XYN A;  1CNP A;  2KHN A;  5D7F A;  1SNL A;  3CLN A;  1ORG A;  3R1V A;  2L4I A;  4PHM A;  1K95 A;  4UPG A;  3RZS A;  3B87 A;  1DMO A;  3ZWH A;  1S3P A;  5ER5 A;  3ICB A;  3SG6 A;  1TRF A;  1PK0 D;  3TDU A;  1XFZ O;  1PSR A;  2MHH A;  3VRR A;  1ALV A;  2PQL A;  3CZ1 A;  4C0J A;  5I2Q A;  1QTX A;  2IS9 A;  4USL A;  3PLF B;  5FI6 A;  3DZT A;  2YGU A;  1FW4 A;  4MSP A;  4Q04 A;  1CDM A;  3R1P A;  1TUZ A;  1YUS A;  1XO5 A;  1IG5 A;  1OZS A;  3I5H B;  4GFT A;  2K8M B;  3L47 A;  1UUR A;  2Q91 A;  1WRK A;  1WY9 A;  3CGA A;  4PDZ A;  3CZ2 A;  3PN7 C;  1KK7 Z;  1NCX A;  1XFU O;  4N5X A;  3QME A;  2ZN8 A;  1CLM A;  4GGF A;  3DVE A;  3VRO A;  1G4Y R;  4CLN A;  2JPT A;  2F8P A;  2I18 A;  4PE1 A;  3S0B A;  2WCE A;  1AUI B;  3CAB A;  3LK0 A;  3SS3 A;  1Y1X A;  5BPJ A;  4U8D A;  2MJW B;  1HT9 A;  3S0F A;  1IJ6 A;  3N7H A;  4YI9 A;  2LAP A;  3B86 A;  3CTN A;  3EK8 A;  3PN7 B;  3SG2 A;  3LLE A;  2PRU A;  3KO0 A;  4FQO A;  2WOS A;  2P71 A;  1QJT A;  4KYN A;  5CSI A;  1Y1U A;  1N65 A;  1REC A;  1NWD A;  4ORA B;  1S6J A;  1D1O A;  1F54 A;  1RWY A;  2H8V A;  3FS7 A;  1GGW A;  2JTZ A;  1BJF A;  1TNW A;  1M46 A;  1LA3 A;  2Y4Q A;  2ZNE A;  1NCY A;  1G8I A;  1JF2 A;  2M29 A;  2LM5 A;  1G33 A;  4PHJ A;  3BUN B;  1TN4 A;  3O78 A;  2LP3 A;  2ISD A;  2JT8 A;  1JFK A;  1H4B A;  2LLS A;  1JSA A;  3KEV A;  1DEL A;  2VRG A;  3BJH A;  1J7R A;  1MHO A;  2LLU A;  4MN0 A;  1OOH A;  1WRL A;  1QX7 A;  2SCP A;  4PT1 A;  2OS8 C;  2NCP A;  4OV2 A;  3K21 A;  3SG7 A;  1CMF A;  5AAN A;  2OPO A;  1TCO B;  1YTZ C;  1OE9 B;  5HKY A;  3BQ3 A;  4A4B A;  1CKK A;  1IQ3 A;  1UHH A;  1BU3 A;  1B7T Z;  1QIW A;  3EKH A;  3EK4 A;  3BXK A;  3D73 A;  1DGV A;  1SBJ A;  2MLE C;  3BUX B;  4AOM A;  1TUJ A;  1NSH A;  4INX A;  1OQP A;  3IF7 A;  1AP4 A;  1F71 A;  2OS8 B;  4IJ7 A;  2I94 A;  1ZFS A;  1ALW A;  4ZCU A;  2KI6 C;  2JTT A;  2JT0 A;  2Q4U A;  1S26 D;  3JTD B;  2MLF C;  1JBA A;  1XYD A;  3D10 A;  2MAZ A;  3K1E A;  3EKJ A;  3TUY C;  2LHL A;  3CR5 X;  2F33 A;  1TWO A;  1KFX S;  2PAS A;  2KGR A;  1SY9 A;  1MXL C;  2CT9 A;  2LNK A;  2LVI A;  2ZFD A;  1OMD A;  4PE4 A;  1JC2 A;  1DTL A;  1OSA A;  1QLK A;  2AMI A;  1RJV A;  2M1U A;  4ZCV A;  2COL B;  1SRA A;  1KSO A;  1Y0V H;  1B8L A;  4GAO A;  1YUU A;  2M3W A;  2FCE A;  2RGI A;  1UUS A;  1NX0 A;  3TDZ A;  3FWB A;  3I5F C;  4DRW A;  4NQG A;  4QJ4 B;  1SR6 B;  3GK2 A;  1B8R A;  2JC2 A;  1UWO A;  2KI6 D;  2LMV A;  1CFF A;  1C3Y A;  1LXF C;  3CR2 A;  3PM8 A;  1OZO A;  1NCZ A;  5I2L A;  1M45 A;  1ZUZ A;  3GK1 A;  1A03 A;  2NZ0 A;  3DVM A;  2M7N A;  2QAC A;  3BYA A;  1CM1 A;  1Z2C B;  5KSZ A;  1CDP A;  2K7D A;  2WC5 A;  1N0Y A;  4PAL A;  1TCF A;  2EHB A;  4GNK B;  2F2O A;  5HLV A;  1EXR A;  1KWO B;  3BUW B;  4I5J A;  2K7O A;  1PUL A;  4P5O E;  4PE7 A;  5PAL A;  1LVC D;  2L5X B;  1KCY A;  3O4X A;  1QAS A;  1L7Z A;  1E8A A;  2KFG A;  4GGF C;  1OMV A;  2MRD A;  1YRU B;  5CSJ A;  3MSE B;  5HL1 A;  1Q80 A;  1PVB A;  2LC5 A;  1DQE A;  3I5I B;  3L4L A;  1C7W A;  4JPZ B;  2GGM A;  1QV1 A;  3PSR A;  1DEK A;  4M2O A;  1KK8 C;  2M1K B;  4NDC A;  2QPT A;  2KQY A;  1YX8 A;  3OX5 A;  2BE4 A;  1NPQ A;  2ZRT A;  2BCX A;  4MRY A;  3VGO A;  2I2R E;  1BOC A;  3TS5 C;  1CLL A;  2JNF A;  1U5I B;  4E68 A;  3PM2 A;  3F45 A;  1WDC B;  1QWV A;  2K60 A;  3NSO A;  1B4C A;  2LVJ A;  1F4Q A;  1N2D A;  2E30 A;  3O4Y A;  4JQ0 D;  4BY5 A;  2K2F A;  2LMT A;  3BFH A;  2BCB A;  4C0K A;  2NLN A;  2EGD A;  2BE6 A;  1AJ4 A;  4GPL B;  5DKR A;  2MBX A;  3S0D A;  3S0G A;  1C07 A;  1BT6 A;  2QDI A;  1YVH A;  2BNX A;  1B8C A;  1KQM C;  2G9B A;  2KOT A;  1BMO A;  1BOD A;  1C3Z A;  1U5I A;  5KTY A;  1OMR A;  2ZKM X;  2CXJ A;  4L9M A;  3TS5 B;  3SJS A;  2OTG C;  3EVR A;  1SL8 A;  3EG5 B;  1AJ5 A;  2A4J A;  4TNC A;  1YVL A;  3IQO A;  5IBW A;  2ZN9 A;  2KLD A;  4PE0 A;  2LCP A;  1IGV A;  5HKZ A;  2O5G A;  4MZJ A;  2QEV A;  1S6C A;  2K7C A;  3A8R A;  4MEW A;  4YGC B;  4CPV A;  1S5G Y;  3D75 A;  3NGV A;  4YGB B;  1OOI X;  1L2O C;  1SYM A;  5HKW A;  1JFJ A;  1GJY A;  5B8I B;  2M8U A;  3EVV A;  1SMG A;  4CID A;  1KFX L;  1DGU A;  2D8N A;  1AVS A;  1B9A A;  2JOJ A;  2TN4 A;  1J1D A;  2KSP A;  2OTG B;  3LCP C;  1F55 A;  1YRT B;  2CBL A;  4ORC B;  1R6P A;  1FI5 A;  2GTE A;  1DJG A;  1WRZ A;  1LA0 A;  5DKN A;  1GQM A;  1WLM A;  2PYQ A;  4QJ3 B;  3SS4 A;  2BL0 C;  4JWQ A;  2KQ6 A;  1YX7 A;  1A75 B;  3DF0 B;  3SG3 A;  2H2K A;  1VRK A;  2FCD A;  1L2O B;  1EG4 A;  3DXL A;  4MZK A;  3DVJ A;  4PHK A;  1YR5 A;  1M63 B;  1M39 A;  1MWN A;  2L51 A;  2PMY A;  1DJW A;  2F3Y A;  2R2I A;  3CZT X;  3HCM A;  3DVK A;  1SSE B;  2BBM A;  1NUB A;  2BEC A;  2QEO A;  4MLW A;  5EL2 A;  1R2U A;  3D0Y A;  1SCV A;  3DYE A;  1W7I B;  2G2B A;  2K61 A;  1QVI Y;  3GOF A;  3VRQ A;  2LHI A;  4HSZ A;  2PSR A;  3OGN A;  1GGZ A;  4WQ2 A;  1A75 A;  2JU0 A;  3DF0 A;  1YUR A;  1NX3 A;  4M2P A;  5HYD A;  1EH2 A;  1PSB A;  2KBI A;  1J1E A;  3VRP A;  3CR4 X;  1F70 A;  5DIC A;  4AQJ A;  1QAT A;  2HPS A; 
#chains in the Genus database with same CATH homology
 4IL1 A;  1EJ3 A;  2LAN A;  1ZOT B;  2KFH A;  2PAL A;  5AXI A;  1K94 A;  3VRN A;  2KAY A;  2LVK A;  1UHJ A;  3EK7 A;  1M31 A;  5DKQ A;  4DUQ A;  3SG5 A;  1SPY A;  1K9P A;  4OR9 B;  1PRW A;  3M0W A;  3BUO B;  1EL4 A;  1TNQ A;  2KBM A;  3DD4 A;  4ORB B;  5AFP A;  1MR8 A;  1NX1 A;  4YRU A;  2K0J A;  3TZ1 A;  2LP2 A;  5JJG A;  3RLZ A;  3NSL A;  2E6W A;  1DJX A;  1W7J B;  4HRE E;  2M9G A;  5TNC A;  5AER A;  3BOW A;  3OX6 A;  5CSN A;  4DIR A;  3PAL A;  2P6B B;  1HQV A;  1UHK A;  1IRJ A;  1EG3 A;  3LL8 B;  5FYX A;  1XK4 C;  3TUY B;  2FJU B;  1V1F A;  1LIN A;  1IH0 A;  4WQ3 A;  2JQ6 A;  1SL7 A;  1IWQ A;  2M97 A;  5I8N A;  2I7A A;  2KAX A;  1CFD A;  4GUK A;  1QIV A;  5CSF A;  2M49 B;  2K7B A;  4XJK A;  5CPV A;  4MVF A;  1CLB A;  1CM4 A;  2KYC A;  1DJY A;  3O2P A;  3BUM B;  3I5F B;  1KSM A;  3IQQ A;  1UP5 A;  1TIZ A;  1S36 A;  3EVU A;  2LLT A;  2K2A A;  3PAT A;  3FWC A;  1V1G A;  1XFW O;  2KAV A;  1K9K A;  2CCM A;  2JNX A;  1RFJ A;  4QJ5 B;  1DJH A;  2BKH B;  4I5N B;  1K90 D;  1KQV A;  1BLQ A;  1KFU S;  1Y6W A;  1CFC A;  4HRG A;  1XK4 A;  1BG1 A;  4DS7 A;  2AUC A;  3E3R A;  4CFR A;  2JT3 A;  1PAL A;  3KHE A;  5AEQ A;  1F4O A;  3OHM B;  1RRO A;  2Y5I A;  3QRX A;  4GGN A;  5J3X A;  2LVV A;  3A4U B;  2WCF A;  2WND A;  4N1G A;  4YGE B;  1K96 A;  3C1V A;  3WNX B;  1S5G Z;  4N1F A;  5JOL A;  1AK8 A;  1FF1 A;  1QS7 A;  1XVJ A;  1AHR A;  1K9U A;  3OB2 B;  1KK8 B;  5F6T A;  1LKJ A;  3I5H C;  3NXA A;  2GGZ A;  3LK1 A;  1S6I A;  2JXL A;  2BCA A;  1NIW A;  2V53 A;  2WOR A;  3H4S E;  4OKH A;  2KYF A;  2Y1M A;  3O6B A;  1NX2 A;  2SAS A;  5KU1 A;  2O60 A;  4FTG A;  1BR4 B;  5G08 A;  1CDL A;  2ZRS A;  4HRH A;  4YI8 A;  3OB1 B;  4GBA A;  1K2H A;  3AKB A;  2BBN A;  1XFY O;  1TOP A;  4OCI A;  3NSI A;  1JWD A;  3TDI A;  1IKU A;  1CB1 A;  1UHN A;  1KQM B;  2H61 A;  4WRI A;  4ETO A;  5I2O A;  2JRF A;  1QVI Z;  1DVI A;  4NDB A;  1C7V A;  2HQW A;  2LV7 A;  1J7O A;  2F2P A;  2M0R A;  1NYA A;  2GV5 A;  1MXE A;  2KFF A;  1MF8 B;  3PFV A;  4YBH B;  1SCM C;  1B47 A;  2L98 A;  3D0Y B;  1IJ5 A;  1OOJ A;  1A2X A;  1J7P A;  2FOT A;  1MUX A;  4NDD A;  2EC6 C;  4YGD B;  3ZNI A;  4YGA A;  2HF5 A;  2L4H A;  1DT7 B;  1JUO A;  3NSK A;  4R1E A;  1SK6 D;  2LUX A;  1XFV O;  1ZAC A;  1ODB A;  1KK7 Y;  1NP8 A;  1UHI A;  4MZL A;  2CTN A;  1FPW A;  3AKA A;  1SCM B;  1SW8 A;  1TTX A;  3OP0 A;  1QX5 B;  2BKI B;  2EC6 B;  2BL0 B;  1F8H A;  2LMU A;  1QV0 A;  2LE9 B;  1TNP A;  2LUC A;  4DCK A;  4BY4 A;  3RM1 A;  1DJZ A;  2JXC A;  1SKT A;  3BOW B;  3FIA A;  2KNE A;  4PCW A;  1KFU L;  3JVT C;  1XA5 A;  2KGB C;  1IQ5 A;  3JTD C;  4PHN A;  4MRX A;  1JF0 A;  1RK9 A;  1DJI A;  1XFX O;  3AAJ A;  1SL9 A;  2ZND A;  4AQI A;  1J7Q A;  1FI6 A;  2B1U A;  1MQ1 A;  1CMG A;  2HQ8 A;  3AAK A;  2KDH A;  4M2Q A;  3SG4 A;  4CFQ A;  1WLZ A;  2CNP A;  4XJK B;  3HX4 A;  3I5G C;  5GQQ C;  1BF5 A;  1H8B A;  2JWW A;  3GK4 X;  1QLS A;  3SIA A;  1DF0 B;  3JVT B;  2WC8 A;  2L0P A;  1TNX A;  2KI4 C;  1SR6 C;  3SIB A;  4I5K A;  1A4P A;  1QX2 A;  3KF9 A;  2L50 A;  2WCB A;  5D69 A;  3CS1 A;  1FBV A;  1B1G A;  1CDN A;  2DOQ A;  4MBE A;  2JUL A;  1QXP A;  1PVA A;  2NXQ A;  4I5L B;  1K93 D;  3WHT B;  2F3Z A;  1J55 A;  2AAO A;  1B7T Y;  3I5G B;  3WHU B;  1DF0 A;  1KWO C;  1CTR A;  1X02 A;  2KI4 B;  4C0L A;  2L2E A;  4F0Z B;  4D1E A;  1A29 A;  2NCO A;  3I5I C;  2HET A;  2Y1N A;  5HLO A;  5K89 A;  2MA2 A;  3WXA A;  1RTP 1;  1ZMZ A;  4OVN F;  1CFP A;  3CWG A;  2H61 C;  2M7L A;  1S1E A;  1K8U A;  2PVB A;  1Y1A A;  2JZI A;  5ER4 X;  1BR1 B;  1YUT A;  4A4C A;  4P2Y B;  4ICB A;  1WDC C;  3KPX A;  4XYN A;  1CNP A;  2KHN A;  5D7F A;  1SNL A;  3CLN A;  4PHM A;  2L4I A;  1DMO A;  1K95 A;  4UPG A;  3ZWH A;  1S3P A;  5ER5 A;  3ICB A;  3SG6 A;  1TRF A;  1PK0 D;  3TDU A;  1XFZ O;  1PSR A;  2MHH A;  3VRR A;  1ALV A;  4C0J A;  5I2Q A;  1QTX A;  2IS9 A;  4USL A;  3PLF B;  4MSP A;  1FW4 A;  4Q04 A;  1CDM A;  1YUS A;  1XO5 A;  1IG5 A;  1OZS A;  3I5H B;  4GFT A;  2K8M B;  1UUR A;  2Q91 A;  1WRK A;  1WY9 A;  3CGA A;  4PDZ A;  3PN7 C;  1KK7 Z;  1NCX A;  1XFU O;  4N5X A;  2ZN8 A;  1CLM A;  4GGF A;  3DVE A;  3VRO A;  1G4Y R;  4CLN A;  2JPT A;  2F8P A;  2I18 A;  4PE1 A;  2WCE A;  1AUI B;  3LK0 A;  1Y1X A;  5BPJ A;  4U8D A;  2MJW B;  1HT9 A;  1IJ6 A;  4YI9 A;  2LAP A;  3CTN A;  3EK8 A;  3PN7 B;  3SG2 A;  3LLE A;  2PRU A;  3KO0 A;  4FQO A;  2WOS A;  5CSI A;  1QJT A;  1Y1U A;  1N65 A;  1REC A;  1NWD A;  4ORA B;  1S6J A;  1D1O A;  1F54 A;  1RWY A;  3FS7 A;  1GGW A;  2JTZ A;  1BJF A;  1TNW A;  1M46 A;  1LA3 A;  2Y4Q A;  2ZNE A;  1NCY A;  1G8I A;  1JF2 A;  2M29 A;  2LM5 A;  1G33 A;  4PHJ A;  3BUN B;  1TN4 A;  3O78 A;  2LP3 A;  2ISD A;  2JT8 A;  1JFK A;  1H4B A;  2LLS A;  1JSA A;  3KEV A;  2VRG A;  1J7R A;  1MHO A;  2LLU A;  4MN0 A;  1WRL A;  1QX7 A;  2SCP A;  2OS8 C;  2NCP A;  4OV2 A;  3K21 A;  3SG7 A;  1CMF A;  5AAN A;  2OPO A;  1TCO B;  1YTZ C;  1OE9 B;  5HKY A;  3BQ3 A;  4A4B A;  1CKK A;  1IQ3 A;  1UHH A;  1BU3 A;  1B7T Z;  1QIW A;  3EKH A;  3EK4 A;  3BXK A;  1DGV A;  1SBJ A;  2MLE C;  3BUX B;  4AOM A;  1NSH A;  1AP4 A;  1OQP A;  3IF7 A;  1F71 A;  2OS8 B;  2I94 A;  1ZFS A;  1ALW A;  4ZCU A;  2KI6 C;  2JTT A;  2JT0 A;  2Q4U A;  1S26 D;  3JTD B;  2MLF C;  1JBA A;  1XYD A;  3D10 A;  2MAZ A;  3TUY C;  3EKJ A;  2LHL A;  3CR5 X;  2F33 A;  1KFX S;  2PAS A;  2KGR A;  1SY9 A;  1MXL C;  2CT9 A;  2LNK A;  2LVI A;  2ZFD A;  1OMD A;  4PE4 A;  1JC2 A;  1DTL A;  1OSA A;  1QLK A;  2AMI A;  1RJV A;  2M1U A;  4ZCV A;  2COL B;  1SRA A;  1KSO A;  1Y0V H;  1B8L A;  4GAO A;  1YUU A;  2M3W A;  2FCE A;  2RGI A;  1UUS A;  1NX0 A;  3TDZ A;  3FWB A;  3I5F C;  4DRW A;  4NQG A;  4QJ4 B;  1SR6 B;  3GK2 A;  1B8R A;  2JC2 A;  1UWO A;  2KI6 D;  2LMV A;  1CFF A;  1LXF C;  3CR2 A;  3PM8 A;  1OZO A;  1NCZ A;  5I2L A;  1M45 A;  1ZUZ A;  3GK1 A;  1A03 A;  2NZ0 A;  3DVM A;  2M7N A;  2QAC A;  3BYA A;  1CM1 A;  5KSZ A;  1CDP A;  2K7D A;  1N0Y A;  4PAL A;  1TCF A;  2EHB A;  4GNK B;  2F2O A;  5HLV A;  1EXR A;  1KWO B;  3BUW B;  4I5J A;  2K7O A;  1PUL A;  4P5O E;  4PE7 A;  5PAL A;  1LVC D;  2L5X B;  1KCY A;  1QAS A;  1L7Z A;  1E8A A;  2KFG A;  4GGF C;  1OMV A;  2MRD A;  1YRU B;  5CSJ A;  3MSE B;  1Q80 A;  1PVB A;  2LC5 A;  3I5I B;  1C7W A;  4JPZ B;  2GGM A;  1QV1 A;  3PSR A;  4M2O A;  1KK8 C;  2M1K B;  4NDC A;  2QPT A;  2KQY A;  1YX8 A;  3OX5 A;  2BE4 A;  1NPQ A;  2ZRT A;  2BCX A;  4MRY A;  3VGO A;  2I2R E;  1BOC A;  3TS5 C;  1CLL A;  2JNF A;  1U5I B;  4E68 A;  3F45 A;  1WDC B;  1B4C A;  3NSO A;  2LVJ A;  1F4Q A;  1N2D A;  2E30 A;  3O4Y A;  4JQ0 D;  4BY5 A;  2K2F A;  2LMT A;  4C0K A;  2BCB A;  2NLN A;  2EGD A;  2BE6 A;  1AJ4 A;  4GPL B;  5DKR A;  2MBX A;  1C07 A;  1BT6 A;  1YVH A;  1B8C A;  1KQM C;  2G9B A;  2KOT A;  1BMO A;  1BOD A;  1U5I A;  5KTY A;  1OMR A;  2ZKM X;  2CXJ A;  4L9M A;  3TS5 B;  3SJS A;  2OTG C;  3EVR A;  1SL8 A;  1AJ5 A;  2A4J A;  4TNC A;  1YVL A;  3IQO A;  5IBW A;  2ZN9 A;  4PE0 A;  2LCP A;  1IGV A;  5HKZ A;  2O5G A;  4MZJ A;  4YGC B;  1S6C A;  2K7C A;  3A8R A;  4MEW A;  4CPV A;  1S5G Y;  4YGB B;  1L2O C;  1SYM A;  5HKW A;  1JFJ A;  1GJY A;  5B8I B;  2M8U A;  3EVV A;  1SMG A;  4CID A;  1KFX L;  1DGU A;  2D8N A;  1AVS A;  1B9A A;  2JOJ A;  2TN4 A;  1J1D A;  2KSP A;  2OTG B;  3LCP C;  1F55 A;  1YRT B;  2CBL A;  4ORC B;  1R6P A;  1FI5 A;  1DJG A;  1WRZ A;  1LA0 A;  5DKN A;  1GQM A;  1WLM A;  4QJ3 B;  2BL0 C;  4JWQ A;  2KQ6 A;  1YX7 A;  1A75 B;  3DF0 B;  3SG3 A;  2H2K A;  1VRK A;  2FCD A;  1L2O B;  1EG4 A;  4MZK A;  3DVJ A;  4PHK A;  1YR5 A;  1M63 B;  1M39 A;  1MWN A;  2L51 A;  2PMY A;  1DJW A;  2F3Y A;  2R2I A;  3CZT X;  3HCM A;  3DVK A;  2BBM A;  2BEC A;  1NUB A;  4MLW A;  1R2U A;  3D0Y A;  1SCV A;  1W7I B;  2G2B A;  2K61 A;  1QVI Y;  3GOF A;  3VRQ A;  2LHI A;  4HSZ A;  2PSR A;  1GGZ A;  4WQ2 A;  1A75 A;  2JU0 A;  3DF0 A;  1YUR A;  1NX3 A;  4M2P A;  5HYD A;  1EH2 A;  1PSB A;  2KBI A;  1J1E A;  3VRP A;  3CR4 X;  1F70 A;  4AQJ A;  1QAT A;  2HPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...